2OFWA

Crystal structure of the apsk domain of human papss1 complexed with 2 aps molecules
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
201
structure length
200
Chain Sequence
NVTYQAHHVSRNKRGQVVGTRGGFRGCTIWLTGLSGAGKTTVSMALEEYLVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRRIAEVAKLFADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLNERDILP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elucidation of the Active Conformation of the APS-Kinase Domain of Human PAPS Synthetase 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords APS kinase domain of the PAPS synthetase 1
total genus 74
structure length 200
sequence length 201
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2007-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ofwA00
1XMIA 1NI3A 3BJIC 5TV2A 1KSHA 1N6IA 1QZXA 4UNRA 4ABYA 4IJMA 2NO9A 1ZVQA 4JS0A 4NE2A 2V7QA 2AKYA 3EW9A 4IFBA 3CF0A 3DZ8A 3LVQE 1B0UA 3P20A 2BBSA 2FZ4A 3NEJA 3WYAA 4JYBA 1DG3A 2LKCA 4KYUA 1Z22A 2G6BA 3C5HA 3CIOA 4CT4B 5BYKA 4R9UC 3DHWC 3ZS8A 3AUXA 3K09A 2ZJ2A 3AVUA 4MA4A 1BKDR 1SXJD 4RD1A 4G5RA 2QBYA 2GETA 1NN3A 4LBWA 1Q22A 5B2ZA 2RGDA 4FMBB 2RGGA 3ASZA 3R9WA 3RRMA 5JHHB 3OIYA 1G3QA 1R10A 3UMFA 1XTKA 1LV7A 3OESA 4HLUC 4KFTA 2B21A 5DO9A 2R6GA 5KDOA 1S1CA 2OCPA 1UEIA 1AS0A 1MO6A 4OQLA 3RS7A 1G6OA 2AX4A 3PCRB 1IN8A 3K0FB 4LUCA 4R7ZA 5FUYA 4NCNA 3VQTA 2OBLA 4S35A 1NBMD 3K9LA 3Q3JB 4QFMA 2QI9C 4HDOB 1AKYA 4XJXA 3K09C 2NGRA 5FOVA 1OT3A 5IK2D 2GCNA 2XSZA 3X1ZA 5EXXA 2JLYA 2VSFA 3BORA 1E69A 1DAFA 1P5ZB 4BUJA 1H8HD 1VYTA 4IHQA 1KJWA 4N0DA 1MRSA 1NNEA 4OI0A 1II0A 1G8GA 4TYPA 3TW4A 1XCPA 1HEIA 3QXSA 5D3MB 1NL3A 4A0GA 1KSFX 421PA 1ZIOA 4WXPA 3QEJA 2RAPA 4TTRA 5EE9A 1G3IA 1E2QA 5TMPA 5HKKD 4DLYA 1G5PA 3VNUA 1EFRD 1QG2A 2A5DA 1HURA 3IBYA 1SVSA 4RZ2A 4C0KA 1KDRA 2OUKA 3U3MA 2CL6X 1OF1A 3RANA 1E79D 3JVVA 3SJAA 2C78A 1TEVA 1SVMA 3RS0A 4EJSA 4LJ5A 521PA 4FCVA 1ZJ6A 1IJFA 2WTUA 3RRNA 3BH7A 5H1YA 1MO3A 1P9RA 3CM0A 2ZUBA 4ASUD 1YR7A 5F9FA 2XXAA 4RVCA 3X1YA 4NU0A 3GLFA 2RKOA 3W8RA 3VX3A 3KKOA 3QJYA 2WWYA 1WA5A 3T5GA 4Q02A 1HE1C 2QENA 4HB3A 1QG4A 2P5SA 5FI1B 4RD3A 2QN6A 2PCLA 3BWDD 3CF6R 2R65A 3C16C 4O2LA 2WV9A 3NBXX 2OILA 4BQSA 3PITA 3WMGA 4M4SA 1QBKC 5KPJA 3TUZC 1YR6A 3TIFA 1T9HA 4ZCIA 1HUQA 4M9XA 3UPUA 3SOPA 3LXRA 1R4AA 4KBFA 1Q1QA 4MKHA 5GJVC 3KKQA 5E3HA 4LJ4A 3LV8A 2PZEA 4UXIA 4PSKA 3FMPB 4DZZA 1CJTC 3P4YA 3CW2A 4TYQA 2P3SA 1Q1EA 1NKSA 1Z6GA 3ADCA 3VU9A 3LO5A 5AJXA 2BM1A 4HEJA 1X86B 2W0MA 3I4LA 4QJ4A 2H7VA 4QGFA 5FTNA 3V9PA 3R9XA 3ONWA 2OFOA 4CEJB 1KY3A 1S3SA 4MYCA 2QM8A 3CPEA 1JPNA 1N5KA 4Q1AA 4HAUA 2BEJA 1US8B 2ZJAA 4NP6A 1W48A 3TAHA 1Z2AA 3SZRA 1E0AA 2Z0MA 3K70C 3FB4A 2C03A 2IHYA 4WZBE 5KOYA 4MKGA 3SNHA 1N25A 4PO1A 2RGAA 3FYHA 1XEFA 4C0JA 3GMTA 1VMAA 4EPTA 4UNSA 2FV8A 1TADA 3F3YA 4BLRA 2ZUCA 4FD2A 1CR0A 4B71A 5JWHA 5CDFA 1FUKA 3B1WA 1TQ6A 1CTQA 2G83A 3A4MA 4X8HA 1S1MA 1KIMA 3OEED 4WIAA 1RC8A 4AKIA 1VG8A 3RSOA 5G3YA 1CBUA 1VPLA 3KTAA 4TT3A 4YXWA 4OK6A 1CKEA 1E9DA 2ORWA 1ANKA 4KLNA 2ATVA 2WMOB 2HXSA 4JVSB 4LPSA 4LHXA 4D80A 2RGNA 3WP0A 2WAYA 2O5VA 2VTKA 3QKUA 4N3NA 1D2EA 3B7GA 3VFDA 4MDEA 2FZLA 2ZITA 1ZM3A 4A36A 3VHXA 4RY2A 4BZQA 3QG5A 1L2TA 4POAA 4EDHA 1COWA 4DDTA 5L3SA 1T91A 5EZ6B 1X1SA 2PZGA 2ODEA 2HLDA 5HZHA 3CBQA 4LYFA 1E2FA 3B1ZA 1NSTA 3GFTA 4MRVA 1N0VC 3CZPA 1JQLB 4B6FA 2A5GA 2A2ZA 4I1OA 2FOLA 2OCYC 4JSTA 5C4GB 5G41A 5A5GA 2D7CA 4GSYA 4DLWA 3NHBA 3AUYA 2YJTD 3GLIB 4BEJA 1UKYA 4JVMA 2JLUA 5BW8A 1R0YA 3VU9B 4ILEA 1GP2A 2N46A 1Z29A 4AYXA 3WNBA 2I1VB 3HYTA 3LBHA 4M1OA 3VR3A 4ACAA 2W6IA 3AKEA 4MQBA 3ZS9A 1OHHD 4QG7A 4C9BA 3CPHA 4NYIQ 1E2GA 1Z0FA 3ICEA 2Q3MA 2FNAA 3EA5A 3OE7D 3TVDA 1XPRA 2W2TA 1TL7C 2J7PA 1CR2A 4C0LA 1ZNYA 2GEVA 1TQ2A 4LC1A 1W36B 2R6DA 2DYKA 2C9OA 2HT6A 3GLHE 4KFRA 3IBGA 4D0GA 3KB1A 2RB4A 2C04A 3BXZA 3KXKA 2HJGA 1AGPA 4KITB 1Z6TA 2Y8EA 2CE7A 2WJHA 2ZR7A 3NC1C 2RMKA 4QGAA 4Z8XA 3TBKA 1DAIA 3EZ9A 4RCYA 4IDOA 3LDAA 1E9AA 2OFXA 3I8XA 4BFZA 5KSPA 2XXAB 2V6IA 2QRZA 4R71A 3NH6A 3DVLA 1CEEA 1ONBA 4U00A 5G3ZA 1F5NA 5GVSA 4CEHA 3HPQA 2DWQA 1NBME 3AB3A 2HYIC 2N1BA 3DZDA 4U5XA 3BRWD 1JBKA 1CXZA 2BJWA 2NO6A 4U02A 5AR1A 1SVIA 4QC2A 4Y0VA 2J0SA 3BD9A 3AF0A 1KO5A 3CH5A 2WKPA 1C4OA 1U9IC 2DHRA 4LDJA 4UNNA 4D0LB 2R9VA 3ETLA 4Z1MD 4YMSA 3SFVA 2P5TB 3OE7A 4US1R 3U7EB 1FX0B 1UFQA 1UKVY 1J99A 4Q5IA 4KSBA 3HWSA 2IXGA 4MH0R 5D3MA 3SFZA 3A1WA 2QT0A 1UKEA 1XEWY 4ZIRA 2FPLA 2BBOA 2PJZA 2W0SA 3PUWA 3LLUA 4HB4A 3SQWA 2CHQA 1LW7A 1WE2A 1AK2A 2P6UA 4QGHA 4PHTA 3NG1A 1BO6A 4YLGA 1AQUA 1CJMA 1KYIA 1ZRHA 2SHKA 3M0EA 3BS4A 4OQMA 4ZKEA 3FHTA 1P72A 5P21A 1XXHE 3SJCA 4RD2A 1GSIA 1CR4A 1YQTA 4US0R 2G88A 2ZJ5A 1XX6A 3LAWA 4JL8A 4V02A 2V3CC 2EYQA 4GDFA 1E1RD 1JR3D 2YKGA 1OXXK 3THWA 4C2TA 3SI7A 2YYZA 1DAGA 1E1RA 1CU1A 1JR3A 1JJVA 1P2TA 1COWD 1W4RA 3BFKA 4ESVA 4LV5B 4Q4LA 3B1YA 1Q0UA 5EP2A 1G7TA 5FFMA 1ZC3A 5FUXA 2AL7A 1SQ5A 3GLHB 3RS4A 1E0JA 4ZV4A 4RFSB 2IYVA 2B7BA 3FHCB 1TNDA 2J0VA 3UMSA 1E2HA 2EFCB 3AVWA 1P73A 1Z0JA 5IT5A 4DIEA 3ZGXA 4C3ZA 1TU4A 3WP1B 4JL5A 4Q03A 3MSXA 2ZIAA 3NBYC 2Q21A 2ECKA 2G77B 1YU9A 2YVUA 4RD4A 1XB2A 2WJVA 4Q4HB 1TF7A 4WA7A 1PV4A 2C99A 4IEIA 3SJZA 2IS4A 1N3BA 1OKKA 1E0SA 1FQKA 4NCJA 2Q6TA 3BFVA 1AGRA 1E4VA 2ODWA 1N6OA 4A1FA 4IXMA 3EC2A 1GILA 2LCFA 2NO1A 4JKYA 3EWAA 2J0UB 3E5HA 2DFLA 4L16A 3SQXA 1F2TA 1VIYA 2EQBA 3WRXC 4EFMA 2OBNA 1Z08A 4URUR 4RKFA 1QHXA 1W0KA 5EXPA 3ZZ0A 3IHWA 4C0SA 1T0HB 3W6PA 2PJRA 1T4GA 2I4IA 1QHSA 3NHAA 4LJ8A 3RS5A 3RSLA 4TQ9A 2QROA 4E09A 1UM8A 3D3QA 2JIZA 5CJ2A 2PEYA 1JXOA 1JEDA 4TWZA 4A0FA 2ZRKA 4BFVA 2HV8A 1VG9B 2ZVQX 4CRWB 4AKHA 1KDTA 4V0OA 1A7JA 1Z0AA 1VHTA 1YR9A 3AP1A 1VCIA 4RFSA 4BWYA 3QKRA 1XJQA 4V0MA 2IUUA 1IXSB 2JATA 1GTVA 1CRQA 3A1UA 2RHMA 2ZROA 4NL4H 3LA6A 3H0KA 1D5CA 5DHFA 1P2SA 3THXB 1Y63A 2BMDA 5CB8A 1XBTA 4M21A 1A1VA 3N70A 1W36C 3CF2A 5DN6D 3QUSA 1E99A 2OHFA 1ZU4A 4AG6A 1YR8A 3AP2A 4XVQA 5DI3B 2HUPA 1M7HA 2C8VA 5KDDA 4NH0A 3T1QA 4CEHB 1DVRA 4L9SA 4BFSA 5LPNA 2OV2A 1ESMA 4OBEA 4M9QA 3VR4A 3N2IA 2J59A 1QHNA 1VYUA 1W47A 4ASUA 4HUTA 1E6CA 1U94A 4HLCA 2NOAA 3IDQA 1VKJA 3WBKA 3A8TA 4EPRA 4WZAE 4JMPA 3TR5A 2JGNA 1W46A 1BIFA 1E9FA 1JB1A 4DUGA 2GRJA 4LYAA 4FCWA 2CNWA 1F48A 3EZ2A 3FHOA 5DE3A 2J3EA 5HCIA 1II8A 5DYIA 3W3ZB 3GJ4A 4CVNA 4Q1EA 4GOJA 5KDLA 4FMCF 4II7A 2GCOA 4PSVA 4V0NA 2ERYA 2WZQA 4RFVA 2O8FA 2KSQA 4AKEA 4BGDA 3E1SA 2ZU0C 2V4ZA 3A1VA 3BB1A 3DDCA 4A8JA 2ZAOA 1OW3B 3VR1A 3HR8A 4ARZB 4NZYA 3CPJB 5JWRA 2GF9A 4KCGA 2OESA 4P31A 3QI2A 2RH5A 4LY6A 1ZC4A 2JJ8A 1KAGA 4KXFB 3TUJC 2WIBA 1RE0A 5FL7D 1KMHA 1T6NA 1IN6A 5EP4A 1E2NA 2JCSA 4NCHA 3NIBA 2ZI5A 2AWNA 3LFUA 4TYNA 1F2UB 3EIQA 5FOSA 1Z0IA 5JCZA 3ADDA 2F43A 2O8DA 4PAMA 3A6PC 4OI4A 1KDPA 5FTKA 4EPVA 3GJ0A 1Q57A 2EW1A 3PEVA 5EXSA 5FOWA 3WXMA 3MCAA 3CNNA 1RIFA 4C30A 3I5XA 1Z5ZA 3QXXA 2WJIA 4L15A 1QHHA 1KTVA 2OG2A 2V8OA 4B32A 1UDXA 3DKPA 4TMXA 1OJLA 2PEZA 3M6AA 1B23P 1I4LD 2WWGA 1ZNZA 3K0CC 4CIDA 5BN3A 4WVFA 2VP2A 1Z0KA 3OAAA 3GJ3A 4QBGB 3RDPA 1KI2A 1P9NA 4GMDA 2MSCB 3SS8A 3T34A 1XTSA 3LXXA 4I1UA 1F3OA 4OHVA 2JDID 3AM1A 2ZS9A 2HF8A 3EIHA 2F3RA 3D7MA 1NP6A 1KK3A 1G21E 1NY5A 1WCV1 4A15A 3DMDA 2IWRA 3CX8A 3EWSA 5IF9A 4DCNA 3VR5A 3VAAA 1GL9B 2G9NA 4A6XA 3WRYC 3D6TB 4ZDIA 5J5CA 4PPGA 3BB4A 2R6FA 3SYNA 1S0UA 2Z4RA 1BMFA 4HAWA 2QP9X 1NLYA 2AFIE 1OYWA 1RRPA 2MMCA 1VHLA 1DG1G 1JR3E 2JLRA 2H18A 3CO5A 1KGDA 4JLVA 2V1UA 1K5DA 3DM5A 2FFAA 1QHIA 2PLRA 1L4YA 1F6BA 3BH0A 4PC2A 4EIWA 1SXJA 2JA1A 4GBMA 1OE0A 3TNFA 3DKVA 4I4LA 4NHOA 5TY0A 3TMKA 2ZRGA 1GKYA 3AF4A 2J1LA 5JJKA 2AK2A 4CZ2A 4B3GA 2O8BA 1QDEA 1U2RA 2PZFA 3C4JA 1KSGA 4LWZA 4JBYA 4MITA 2ZSDA 2WAXA 2ONJA 4JLKA 5AUOB 2REOA 1U99A 4D4LA 2DPXA 1OXVA 1G4UR 4HZUA 2H92A 3LW8A 1XEXB 3C8UA 3R8FA 1KAOA 2QMEA 5AK0A 4JZKA 5TDHA 2QQEA 5FH9A 1YZLA 3TLXA 2VH5R 3B2EA 5L8VA 1GOTA 1OHHA 1LVGA 1IM2A 4CEJA 2Z6VA 4KI0A 3FFAA 3X2SA 2F55A 1UBEA 1O87A 4YDSA 3VTKA 2QA5A 2FPKA 3BGWA 3FKSD 2CHGA 3KQUA 4DVGA 1OFIA 3RYTC 2QAJA 5CLLA 3C7KA 2ZE5A 4AK9A 3ZVNA 1WBDA 4M1KA 4QGGA 2JASA 3CONA 5H8WA 4O25A 2HDNB 4JBXA 4MUAA 2GZAA 2BWJA 3AF3A 4NDZA 2ATXA 4HAZA 2G3YA 4HI0E 3GEEA 4AI6A 4HUQB 1E1QD 4QHSA 3LH5A 5HPYB 3I92A 4A2QA 5BWMA 4AKGA 3GPLA 1TQDA 1ZNWA 3AF1A 1G41A 3B9PA 4TMZA 1EXMA 1M6NA 2BM0A 2YWEA 2VHUA 2AHOA 4W5HA 4A4DA 1ELOA 3GLFB 4HAXA 4IDPA 2G0NA 2ASEA 2KWIA 2UKDA 4PHGA 2J45A 3TUIC 3AVOA 1XFAA 3T5DA 2H17A 1X8LA 5JJIA 1GNRA 1PLLA 2ZJYA 3HJNA 3LQRA 2Q0HA 1KO1A 1DO2A 1R5NA 2FSIA 3BOSA 3EPKA 3U7FB 2QP3A 3D8BA 1ZD8A 1XPUA 3DOEA 1SULA 2FWRA 2VIIA 2HLDD 4G1UC 1E4YA 4JLNA 1G16A 2QTHA 2P6RA 1IN5A 4ZI3A 2P67A 3RWOA 3K0EA 1OSNA 4Q4JB 3QBTA 4PZLA 5KHOC 1KNQA 1E2DA 2F1HA 2WKQA 4QBHA 1P75A 2FX3A 5LDDC 1NLFA 2ZE6A 1SVWA 3RS2A 1IN4A 5FBRB 2F9MA 2FU5C 2JDIA 2NO7A 5KPDA 2GXQA 2NMVA 2GXSA 1DOAA 1V5WA 3K0AB 2I1QA 2W2XA 2VP6A 2XEXA 1AKEA 3CNOA 3KXLA 1U8YA 4TMVA 1ZCAA 2OT3B 2WBLC 3TH5A 2D7DA 1FP6A 3VHLB 2O0JA 2YOGA 4PZZA 1F2UA 2IYRA 621PA 1KI6B 3HDTA 2HT1A 4FCTA 2XX3A 3HPRA 2PT5A 1KMHB 4RD6A 2WOJA 1U0JA 3P1JA 1XJ0A 3LQQA 1KZGB 1N5IA 3EAQA 4QM7A 1G3UA 4LV8B 4Q9LA 3GLGB 2IXFA 1CS4C 5BYJA 1LF0A 2ANCA 2J0QA 4H1VA 3K9NA 5LD2B 2B92A 4ARZA 4G01B 1NN1A 2GJKA 2WJYA 3ADKA 5C18A 1XMVA 2QQ0A 2QY9A 4P4SA 3RWMB 4PC1A 3KQHA 4L4UA 1ZYUA 3OIUA 1P60A 4IOJA 4XIGS 3A4LA 3UANA 4DCTA 1XJCA 3DM9B 3UG6A 3E2IA 1WBBA 1HTWA 1KO8A 2OO7A 2V1XA 2GCOB 3QPUA 4NMMA 5FI0B 4CDGA 5BN4A 3EPHA 2F1RA 1ZD1A 2Z83A 1A4RA 3UATA 2IC5A 2OM2A 3L0OA 4TLEA 2RGBA 4F4JA 3ND8A 5LB4A 1G17A 1EFHA 4F38A 5G40A 4TL9A 3GJ6A 1M7BA 1KSJA 2A78A 1GKIA 2XTZA 2IWHA 4DDWA 3HR7A 1XCMA 4MYTA 4DBLC 2C9YA 1Z6XA 1SVKA 5CB6A 4DSNA 1G291 3W34A 1X6VA 1TUIA 2CK3A 4MKFA 1XTRA 2QRNA 1MR3F 3MWJA 4RKEA 1DAKA 3QF4A 2OAQ1 4KHZA 4F4CA 1G7CA 3MFYA 2CL0X 5DI3A 4PZYA 3IGFA 2EFHB 4G5SA 3IIMA 2F1IA 3C15C 1RYHA 1SKYB 2FF7A 3EC1A 4RJLA 3QPVA 2UZ3A 3WYFA 4F92B 3C5CA 4FIDA 2ONKA 1CJKC 3B78A 3LX5A 2WJJA 4A9AA 4CYMA 1N6RA 3B6EA 3W90A 3FMIA 1A82A 1G8HA 3FMOB 3UMRA 2XZLA 2ZI3A 3WMFA 1SKYE 1S9HA 3QKRB 1E9RA 4Q1DA 5FBWB 2QPAA 1XTQA 2WMNB 5E7MA 1G7RA 5L3QB 3I5YA 2GHIA 4ZKDA 5HZKA 1NVXQ 2E1RA 4XD7D 1IXRC 5FTMA 1RRFA 2Z4SA 4YQFA 1E79A 1GRNA 1JALA 2QMHA 2QGZA 2AXPA 2YNMA 4PFSA 3RC3A 1WQ1R 2DBYA 2IYTA 4FI3C 4HZUB 1ZM7A 4L9WA 3ZVLA 3GFPA 1G20E 1AJEA 2IYQA 4B48A 8OHMA 4AG5A 4HSEA 3OIVA 3JZAA 5JCPA 3I32A 4EJSC 3GLIE 2BKEA 5D3QA 3DMNA 5KNBA 1NKTA 4MGYR 4MRRA 3AEZA 4M22A 2J0UA 2EFEB 4H9GA 5GVRA 3QKSB 1BOFA 3FDIA 2K5UA 4P33A 2QU8A 1E2MA 1XMSA 3EPLA 5IDVA 2H8KA 4LJ7A 1W5SA 4BRWA 2ZSAA 5KSOA 2JLQA 5CITA 2ZANA 1W4AA 4XVRA 2CHVA 4M0LA 4FN5A 1D2MA 1VIAA 2PCJA 3REGA 3PUYA 5L3VA 4I1VA 4A92A 4LJ9A 2IA5A 3TE6A 2QZ4A 4OHXA 3ZJYA 1C9KA 3B60A 3B85A 2A5FA 1R0ZA 1AZSC 2GZDA 4NCIA 4WOPA 5BXQC 2JJ2A 4DHEA 4DLZA 3VNVA 3IKJA 1AS2A 1W5TA 2GWHA 5SZHB 4D25A 1CR1A 2JJ2D 2NG1A 4PO8A 5GJBA 2O52A 2PL3A 2OFWA 2NO0A 1KO7A 1R0WA 2W83A 4I1SA 3A36A 2EU8A 1GM5A 2JIZD 4Q7JB 5UKDA 1F60A 1WF3A 2HJVA 1IBRA 1R6BX 4M1TA 4PC3A 3T61A 2QE7A 3IPYA 1GG2A 2BBTA 5FBQB 3QSYA 5DGXA 4Q4AA 1MO4A 1UF9A 1VG0B 2FSHA 2GTPA 1M2OB 2Z43A 4LOAA 4TQUS 2IF2A 4TLBA 4C7OA 1OYYA 3TVTA 1JPJA 3L82B 3VKHA 1RZ3A 4JLDA 4Q7MB 1JI0A 3RRZA 4M9ZA 4P3YA 3QG1A 3NC0C 2BJVA 1AIPA 3L43A 4YMTA 1BMFD 3WNDA 1AZTA 3OEEA 5CDFE 4C2UA 3I62A 2EYUA 2WSMA 3PIRA 4PPFA 2O8CB 3KJIA 3O47A 3PENA 1XTIA 4GP7A 5FPYA 4UJ3A 1FW6A 5BN5A 1VCMA 2KBEA 2IXEA 4QNRA 5FPHA 5JLJA 4OHYA 1MABB 4IXNA 3WYGA 1W0JA 5FUWA 4ON9A 2ZYVX 2GDJA 1YZNA 4NPHA 4UNPA 3HP1A 1U81A 4KVAA 4A8JB 3RS3A 3V00A 4A2WA 1SZPA 4MUBA 1D9XA 5LB2A 1M1YE 4EUNA 4US2R 2PX3A 2MMGA 1ODFA 1G6HA 1W1WA 5A4JA 1E94E 3PJRA 3S1AB 3P4XA 1Y3AA 5EQTA 121PA 4IRUB 4JKIA 1P6XA 4PQYA 3FKQA 1NG1A 2FGJA 3P32A 4JSYA 4URWR 1X8KA 2QL6A 4XWKA 3ZH9B 3QIAA 2XSZD 4JLBA 1DELA 4DDVA 1HY3A 4GMXA 1DEKA 4X8LA 2FFQA 2FSFA 1FOEB 3EZFA 1FMLA 4Q00A 4BFXA 4IDNA 4P4TA 1EG7A 3MWYW 2P6NA 1GKUB 3THOA 2QAGC 5FTLA 1W49A 2R8RA 2JLVA 3U3RA 1GRRA 1ZCBA 3V4FA 2IS1A 3TJZA 5EE5B 2OLKA 4LJAA 1JECA 5HTKA 3DO6A 2I3BA 3AVTA 1ZAKA 3QEOA 5DLQC 1Z8FA 2RCNA 1SHZA 3W3AA 3SJBA 5AUPB 1MRNA 4DT1B 5JS7A 1X8JA 1FTNA 1SXJC 1XEWX 3OF5A 4D82A 3ZLJA 3OFNA 1G5RA 2J7KA 2VHQA 3PFIA 3SYLA 4A0RA 3UXMA 3DOFA 3FKSA 3EZ6A 3SC3A 3IQXA 1JXMA 2X8AA 4DLUA 2QAGA 4URYR 1P7CA 2RGNC 2GAAA 4BLSA 3LD9A 5KNCA 3BE4A 4RZUA 4TL6A 3U2QA 1XD2B 2PLFA 2WWHA 1KHTA 5JI3E 1NG9A 1TF2A 2A5JA 4OQNA 2QG6A 2W2VA 4IVRA 1Q1ZA 1U8AA 1D9ZA 3CLVA 2IYXA 5JFGA 1W4CA 3KFXA 3KQLA 1BH2A 2O8EA 2JLXA 1JJ7A 5CYPA 3U5ZB 5KSZA 4JJZA 4PPNA 4WW0A 1QVRA 2NPFA 4DDUA 1OH5A 4Q9HA 2ZSEA 1E9SA 4B74A 5DHAA 1MH1A 1XTJA 4IEEA 4BLOA 2D74A 3WHKA 1EX6A 1HE8B 1UADA 1S2MA 1G1MA 1Q21A 1OIWA 1G5TA 5SZJA 1FZQA 1R5BA 3FTQA 3O8BA 2WVJA 1UPTA 3W5IA 2EFGA 4I99A 1XWIA 3PV0A 5FOUA 4EKDA 4URVR 5KSYA 2IEYA 2BVNA 3NKVA 3AH8A 2NPIA 1SVOA 2FFHA 4DXAA 1DAEA 4QRHA 1NMYA 3QKTA 5CIWA 5HR5A 4DLTA 1J70A 1E3MA 5FUVA 1Z07A 4TZ0A 1I2MA 4O0MA 1JEEA 2QP4A 2MSDB 2WPDD 3GJ5A 3UKDA 1T0JB 3V4RA 2REBA 3M1IA 1H8HA 1G9XA 5L3QA 1E96A 1KI9A 1OLOA 1DS6A 2A7QA 3ZVRA 3VR2A 4LHZA 1J7KA 1XD8A 1PUJA 3QXJA 3OHMA 4PHFA 4CF7A 2D3WA 3P27A 3U7HB 5J4VA 1ZP6A 2ZRHA 3QKSA 2QM7A 1AN0A 1GVNB 2O0HA 721PA 2D2EA 1TQ4A 4ZDWA 1K8RA 3CH4B 3CKLA 1HT2E 2V7QD 2IW3A 1GDDA 2VQSA 5FPTA 4EAQA 5F3WB 4ZCLA 3LBIA 1I4DD 1YVDA 1YHNA 3LRPA 3PUZA 1ETUA 2UVQA 4OL0A 4ZCMA 1WB9A 1OH6A 2AD5A 1W7AA 1YZQA 2AKAB 2BCGY 1TF5A 2GJ8A 3FWYA 2ZE8A 3A1TA 5E95A 2QTFA 1P2VA 1NVVQ 2F1JA 3FMFA 4Q19A 2IX3A 3QY0A 2JJ1D 4UJ5A 4PX9A 3FVQA 4LV6A 1G4AE 3KUCA 1YKSA 1TPZA 3SE0A 2X1VA 4PTLA 3AVXA 4Q21A 3AKYA 5H70A 3I73A 4XTRA 2ZRCA 3VKWA 2A5YB 4KU4A 4YXWD 3U60B 4EJSB 2BIFA 4TN1A 3QBVA 5FR2A 5KNDA 4LPKA 4NTZA 3RHFA 1WP9A 2BHRA 1XNJA 2Q3FA 3IILA 4B44A 3NEYA 1NVVR 4X8OA 2BMJA 3N2EA 3QF4B 4TZ6A 3UWKA 4WZ6A 2DB3A 3CUEF 1U0LA 1LS6A 5JSZB 2ZE7A 2GKSA 5HCNA 5IRCD 1HQCA 4GI7A 3QXCA 4E03A 4CEIB 4DCUA 3H4MA 5JECA 4DSUA 3UG7A 3ZQJA 4K81B 4LSGA 4I81A 1IOZA 2ZRJA 4URXR 2H16A 4BPBA 4P4UA 2YHSA 2AXNA 1KO4A 4E22A 2GXUA 2PMKA 3MRSA 4EFNA 3SR0A 1SGWA 1CJUC 2ORIA 3AVVA 2VP9A 1TMKA 1KK1A 2ZYUX 5B30A 2ZTSA 4G0NA 4XVUA 3AP3A 2RGEA 3Q5DA 4BFWA 3LVRE 4PXAA 1KZ7B 3A4NA 1GFIA 3EX7C 4Q4JA 2XGJA 1S4QA 2ZSFA 3WY9A 3JZMA 1N6KA 3D31A 3GCGA 4GPTA 2ZVPX 1XD9A 3CZQA 4C0QC 1GIAA 1X1RA 1Q3TA 5DSZA 1ZD9A 3GLIA 4PHHA 1SKQA 3RLFA 1KI3A 2JLSA 3NTUA 4W5JA 3ECCA 3AGQA 4DLVA 1EWQA 3U3OA 1G8PA 2XB4A 4FWTA 1J8YF 1OIXA 4YC7A 3BERA 1KI6A 4LHVA 4WXRA 1H8ED 1T3LA 4R98A 4BLPA 1XF9A 3GQBA 2QUZA 1ZUIA 2VSXA 3L0IB 5SZKB 3K0SA 5C4MA 3WMEA 3B8HA 2QT1A 2FPMA 1PLKA 1KKLA 1NIPA 2PX0A 3B1XA 2FDCA 4D6PA 3K0AA 4YMVA 3QENA 2QPTA 3U3KA 2DCUA 5J4KA 2IYLD 3CRQA 1QVAA 4CEIA 4TSFD 3RABA 5DI9A 5LD2C 3BIFA 4HUQA 3SHWA 2OE2A 5AUQA 4Q66C 5JSZA 1NF3A 4DIDA 5AJVB 4ZI2A 4B3DA 1E2IA 2GF0A 2R2AA 2GJSA 3GJ8A 3KJGA 3NXSA 5DN6A 4D81A 3GP8A 1G7SA 1OIVA 3KDSE 5A0FA 1FL9A 2F7SA 1GNQA 1BS1A 2QTVB 3H84A 2XNSA 1UJ2A 3B13B 4D4KA 2BOVA 2NZ8A 1XD2A 2IF0A 1N2CE 2ZRAA 3CX6A 4MYHA 2J46A 4DSTA 3KB2A 5LBIA 4C0AC 4A2PA 3IIKA 1AA9A 3DL0A 4B2LA 3W6OA 3REFA 2IEZA 2EWVA 3L8ZA 5K8IA 2W58A 4IVQA 4PO9A 1US8A 5J4YA 1CRPA 2GA8A 2HEIA 2LKDA 3DEFA 1GAJA 3K0CA 4YDHB 2VHTA 5C1BA 3X1XA 2MSEB 2XZOA 1Z3IX 4AURA 5K8TA 2ZJZA 2OZEA 4ITRC 5TB5A 1Q1BA 1MOZA 3T12A 1NJGA 4RZXA 1E0KA 1LY1A 3IEUA 4IOMA 5EJEA 4KBGA 3W8NA 3KJEA 1KK2A 5EE3A 3ZD7A 5GADl 2V6JA 1T5LA 4QHTA 4LHWA 1CULC 1LF5A 2HCBA 2RGCA 3ND9A 3WNCA 2O8BB 2JAQA 2W00A 1ZM2A 3BFXA 3TAUA 4EPYA 5FPKA 1YJ5A 2FG5A 3SDZA 3G0HA 4P0TA 1HH4A 4F4IA 3T35A 1UAAA 2GZHA 2WOOA 2XOKA 2XNDA 5HE8A 4DCVA 1V43A 1P9WA 1NSFA 1NBMA 1J90A 1KMQA 1N6NA 3KKNA 3OIWA 4D4JA 1UBGA 3Q5EA 5J4LA 1Z63A 3KKPA 4LBVA 4D26A 2EWWA 4Q9JA 4XWAA 4XWOA 3C14C 1EK0A 1II9A 1Q44A 2D4HA 2WWFA 5E7JA 5BQ5A 4QL3A 4DB4A 1PVOA 1TX4B 3M4YA 4TTQA 4Q1BA 1S8FA 3QVUA 3ZZTA 1XMJA 3J81k 4Z8YA 4PC6A 4CW7A 1D2NA 3BBPA 2OEPA 1U98A 4LYHA 2ZR0A 4XSHA 2FA9A 4LZZA 1OXSC 1G19A 3TGPA 2PBRA 2VRWA 4JLMA 4X8MA 2F9LA 3U44B 3Q72A 1K6MA 4FXPA 4JBWA 1T3SA 4LJ6A 4Q01A 1MABA 1UBCA 1H8EA 2ZI9A 4OK3A 3LWNA 4QOSA 2JLZA 3CWQA 2L0XA 4E5UA 5KU1A 2ZRMA 2FH5B 1DPFA 2WJGA 4NKRA 1Z06A 1HV8A 3L0SA 4DLRA 4LX0A 1DADA 2X2EA 2ZQ5A 5EUQB 1QHHB 2WWIA 1DTSA 4M53A 1PUIA 1TU3A 2JJ1A 5E4FA 1S3GA 5CK4A 3U4QA 1H65A 4GRAA 4KO8A 3X1DA 1CJVC 4DEXA 1GZSA 5CJPA 2FEOA 5EZ5A 3TR0A 3NBZC 6Q21A 1E1QA 3BAFA 4FW9A 4JLAA 1TTTA 1VCNA 2ZI6A 3LX8A 4GZMA 5EUMA 5FOXA 1YZTA 4Y0AA 2VP4A 1OPXA 1RVDA 3K9HA 1I4TD 3IO3A 1IQPA 4B2IA 2YWFA 1RKBA 2C96A 2QNRA 4IFEA 4UQOA 1LS1A 4MDFA 2VA8A 2DR3A 1YZKA 2ZREA 2BV3A 3EXAA 4OHZA 2WHXA 4DEYA 4KJZA 3LY5A 3H2YA 5C2JB 2CMKA 4ZO4A 3U44A 2IYUA 4LJYA 4M1YA 1QRAA 2R6CA 5EP1A 1KJYA 1GRQA 5H68A 3O8RA 3AKCA 2CNWD 4TMKA 1X3SA 2C9CA 3I1FA 4JYCA 3F5FA 2HXYA 2VP5A 4NYMR 2GBLC 1IHUA 1II8B 4AY2A 3CR8A 5KO2A 3C41J 1QF9A 2V9PA 4KLZA 3HU3A 1M34E 5GJWC 3ZIAD 1SVLA 4L5BA 1XXHB 3KFVA 5ELXA 1XP8A 4B43A 4BEBA 1EESA 1JQJC 5SZIA 3IO5A 4Q7LA 3CB4A 5FL3A 1NMXA 1NJFA 3S1AA 4EPWA 5KYKA 1E2PA 4Q9IA 4TLCA 1IY0A 221PA 3ASYA 4QBFA 4HLDA 4OKSA 3KL4A 5IHPA 4N1AA 3HU1A 4RSGA 3ZDQA 2G0TA 3OEHA 3PG5A 1FFHA 3ZD6A 1EWRA 1Z83A 4JVLA 5GJCA 4MGKR 1N0UA 1KI7A 4KYIB 2C2HA 4Z1MA 4B73A 4UXHA 3THXA 4WBSA 4RCZA 1C1YA 1TUEA 2VBCA 1NVWQ 2D06A 4MRNA 4TLDA 4KVGA 2CLSA 1OFUX 4TTPA 5AWFC 2O8CA 1VDZA 2ZU6A 2DFKB 4Q48A 1ZM9A 4Q7KA 1P2UA 4OJKA 1GNPA 4D2IA 2PH1A 2OCAA 1WDTA 2ZUDA 3A1SA 2NTYC 2CJWB 2YC4C 3B1VA 1OKKD 2CXXA 4ZDJA 1CLUA 4C7OB 3QF7A 5JMTA 1BYIA 2CEAA 4Z51A 4TT3D 2CBZA 5F9HA 1ESNA 1O3YA 1QHYA 4KV9A 2VHCA 1KK0A 2ZJBA 4TLAA 4EQ6A 1HT1E 3T1VA 1P3JA 4DB2A 1E32A 2O0KA 4O3MA 5F2EA 4G5OA 1FQJA 2NZJA 2XNDD 1NMZA 2XOKD 4IKEA 4C4PA 3SBDA 4QBIA 4OYHA 3EASA 2WSSA 4QJ5A 1L7VC 4BFUA 3GJ7A 1ZBDA 4Q18A 3BB3A 4DJTA 5M04A 1VTKA 3KX2A 4LK2A 3EPJA 3W5JA 2ZI7A 2R44A 2ORVA 3CRRA 2FFBA 1TEXA 1RRGA 3GJXC 3PXGA 3PVSA 3K8YA 4A0HA 3PEUA 5JWOA 1Q12A 4B33A 2ZRLA 3I3SR 2QMUA 3JVUA 2GXAA 4JJKA 3R7WA 1IJEA 4FINA 4OHWA 1IY2A 4LHYA 1Z2CA 2BC9A 5ANRB 3H86A 4NONA 4AD8A 3GLHA 2QGNA 3IQWA 3ZQ6A 2ZYWX 5KUTA 2Z5FA 4P4SB 1T5IA 1N5JA 1UDWA 3QPWA 4JLPA 4DKXA 1NRJB 1ZM4A 4AC9A 2DFNA 4GOXA 5DIFA 4MRPA 1ZUNB 1KOFA 3SN6A 1R8QA 3GLGA 2D2FA 5HE9A 5J47A 1IN7A 4HB2A 4CGZA 1KI8A 1DBSA 2C98A 4H1UA 2B6HA 3EG5A 3LBNA 3K53A 1WXQA 3NBFA 5JHGB 4M2LA 2GJ9A 4P32A 4Q4HA 1KI4A 4NYIR 1IAQA 4XSGA 4V0ME 5JRJA 2FGKA 3WHLA 3PEYA 4KFUA 3MLEA 3SBEA 3NDPA 1NLZA 2GCPA 3SYKA 2RHDA 1OXUA 5AJZA 1A2BA 1G64A 1FMJA 4NBSA 1E2KA 3U6BA 3EA0A 2FN4A 2OXRA 1ZU5A 3NVAA 3KZ1E 4UNQA 2IS2A 4WAUA 4JVNA 2GEDA 4E07A 4AIIA 4JIMA 2BMFA 2ZS7A 4M8NE 2PMDA 1JNYA 1YE8A 1M74A 2ODNA 1S96A 2GJAA 4IOLA 2GEUA 4XOIA 4ZPXA 1FTSA 2XTNA 5G53C 4F7WA 4Z54A 4G3XA 1UEJA 3TSOA 3THWB 1M8PA 1UKZA 1DO0A 4B3CA 2ZAMA 4TMWA 1Q20A 1HQYE 4LRWA 2AK3A 1EFCA 4FMDB 3MUFA 5CK5A 3QNUA 4TSFA 5FPSA 5HKKA 1SXJE 1LFDB 1XZQA 1XZPA 2P2LA 1JAIA 2ZYTX 4BFYA 2OCBA 2WICA 2WWWA 1KI1A 4J0QA 2V54A 1Z6YA 3EARA 2YC2C 1CP2A 3UIEA 3Q7PA 5DISB 4ESHA 3NWJA 5FOTA 2KBFA 1R7RA 4HLUA 1GL7A 2H5EA 5CM8B 1FX0A 2CCGA 1HYQA 4M1SA 2IBMA 1KDOA 4GOKA 3ZYCA 2AD1A 2C5LA 1K5GA 4KAXA 4JL6A 1PZNA 1W44A 1TAGA 4URZR 4F91B 3Q7QA 4AYTA 1SHKA 1Z28A 1ZIPA 4MYUA 1KY2A 2ANBA 4PQRA 2F3TA 2Q9CA 2XJ4A 4HLQB 4FWIB 4LCBA 2VP0A 3A58B 2ZRIA 2YOFA 5JBQA 3QVVA 4TMTA 2XTMA 2QORA 2BBWA 1WMSA 1J2JA 2A9KA 3F0TA 1FP7A 5CIQA 5JEEA 1W0KD 4ACBA 2VLIA 1S9DA 3MWLA 4LBZA 3T1TA 4ZDKA 4Q47A 2GVZC 1OH7A 1YZGA 3I8SA 4B3XA 1GITA 1P61B 1CF4A 4XD7A 2A30A 1OH8A 4MGZR 4FMDF 1D8TA 2FMXA 2QEQA 3O8DA 3Q9LA 5L3SB 3AVPA 1NY6A 1OXTA 3FE2A 1OFHA 2QSYA 5B58C 2ZETA 3RC8A 3GEIA 2OSBA 4QKQA 4K8OA 2HF9A 3MWKA 3TSWA 3ICQB 3F8TA 2ODBA 5EE1A 2VEDA 5CLQA 2N42A 3G5UA 2OLJA 2OXCA 5DH9A 3KTAB 2W6JD 2NQ2C 2UZIR 1EFTA 3B82A 3BK7A 3AGPA 5J40A 4S2EA 3RAPR 1N6HA 1M7GA 3GD7A 4AWXA 2YZ2A 4TL7A 3QXHA 3MGCA 1SXJB 1CIPA 1RJ9A 3AQ4A 4Q1FA 4DCSA 2A3RA 5FTJA 3CR7A 2IHBA 4HZIA 4CT5A 5KTYA 3U61B 1W36D 2P0EA 2P65A 1N5LA 1EFRA 3UK6A 4V0KA 2IUTA 2ZRPA 4NYJQ 1Q3HA 2FSGA 4PANA 1ZINA 5FBLB 1E98A 4B75A 5JEDA 4LYJA 5K8UA 3FOZA 3CRVA 2C77A 1G18A 4LI0A 2QAGB 3RRYA 2IYZA 3RNLA 1AQYA 4B34A 1KKMA 4PSAA 1E2EA 3AF2A 3DPUA 4M1WA 4NCKA 2ZRNA 4QXAA 4HB0A 1Z47A 2J7PD 1PLJA 2XJ9A 1OB5A 3VKGA 3KKMA 4QJ3A 1FNNA 2X2FA 2WPDA 4B3BA 3AVQA 3I61A 1GWNA 1RJ9B 4DT1A 3OZXA 4BE7B 3I72A 3VX4A 4BECA 3UWOA 4U7DA 2AN9A 1L8QA 1MT0A 2IL1A 4IOKA 2YINC 1NVUQ 2CK3D 1R5OA 2FJUA 2O8EB 1U90A 2KI5A 4OI2A 1R8SA 5JRZA 2OAP1 3OFND 4PPQA 4RZ3A 1AS3A 3PEWA 4B47A 1R0XA 1R2QA 3B5JA 1OV4A 2WKRA 1HA3A 4A8JC 3ZVMA 3L8YA 3CNLA 2ZRDA 4L8GA 2IS6A 1Z6AA 4K46A 2GK6A 2QMOA 4PR0A 2VO1A 2BEKA 1L4UA 1FPMA 1G8FA 1LTQA 1YZUA 2AR7A 3MJRA 3P26A 3SU8A 4AYWA 2F43B 3OAAD 2O8DB 1VCOA 2H57A 4A82A 2J87A 2RGXA 3ZIAA 4LGMA 1KJZA 3SHFA 5TARA 1IXZA 3QOFA 4JLJA 4TYYA 1QHGA 2CVFA 4B76A 3R8CA 2VYFA 4QHYA 3KXIA 4LBYA 4BZPA 1N6LA 3IIJA 3KJHA 1MV5A 1XEXA 4UXJA 3H1TA 3HU2A 3PR1A 2CVHA 2ZXUA 4OQFA 3NH9A 4MRSA 3VMFA 1EGAA 3AKDA 5FL7A 3K9GA 3U6KA 2BDTA 4G5QA 3IEVA 2ZPTX 1I2DA 4NYJR 3U3JA 3KQNA 3WBJA 1RRCA 4R2IA 4QM6A 5JZVA 1YRBA 1IONA 3Q8XB 2O8FB 2VPPA 3TQFA 5DNYB 1YRAA 4HAYA 2XZPA 3K70B 2YOHA 5CYOA 1P4SA 4OK5A 2NIPA 4C0BA 4EPXA 3ZZUA 2G1KA 3BH6A 5JS8A 3BC1A 1FNMA 2OBMA 2XITA 1PJRA 2D62A 2DFTA 2KJQA 2IT1A 4XH9B 1XCGB 4GNKA 4GT1A 4YMWA 1U0HC 1XXHA 4W5WA 3T1OA 2E87A 5TXGA 3R20A 2B7CA 3IUYA 4GZLA 2W6ID 4JLOA 1G3MA 4JT2A 2FE4A 4OQXA 2ZRBA 2XB2A 2CCJA 1W2HA 2V55B 2AFHE 5EP3A 2E9SA 4GP6A 1BYUA 1IY1A 2LWIA 3EZ7A 1RW4A 3MMPA 1OFTA 3PQCA 2GBLA 2YWHA 2Q9BA 4LC0A 2GILA 3KUDA 4BASA 4HYYA 3TRFA 1KNXA 2ZRFA 4BLTA 4IDHA 4R2HA 2JLWA 3G82C 4Q1CA 2R62A 3Q85A 1XRJA 2ZJOA 4PC7A 2ZJ8A 4HATA 2VSOA 3T15A 2REXB 1A2KC 1NIJA 4DWJA 3FPAA 1AM4D 3O8CA 1GL6A 5F98A 1P62B 1W0JD 1DAHA 2KE5A 4V0LA 4B2PA 5AJYA 4C0HA 2IK8A 5K8LA 1JAHA 3CX7A 3A37A 4BZXA 4ERNA 2ZSBA 2EFDB 2J41A 2QBYB 4RD0A 1DE0A 4W7SA 4Q9KA 821PA 5JI2E 3EIEA 1W4BA 4IDQA 2YV5A 2DWPA 2ZM5A 4MKIA 1MKYA 2CCKA 3ADBA 3U4QB 5C46F 2W6JA 1A5TA 4PAOA 2ZI4A 2WSSD 2GVDC 1E2JA 1VECA 2CLCX 4HDQB 3X1WA 4Q4AB 4PAQA 4B6EA 4TYWA 2Q3HA 1U9IA 1FUUA 3K0FA 1F2TB 5DYGA 2ZEJA 2WM9B 3TQCA 4DLXA 1U8ZA 2WWXA 2X77A 1NN0A 1DAMA 3TKLA 1T8UA 4IVPA 5AJWA 1T3HA 4IW3B 3GEHA 4W9MC 3K70D 2CDNA 3B9QA 3TK1A 4DLSA 1RYFA 2AWOA 2DWOA 2ERXA 4UKDA 4D4MA 3QE0A 4BLQA 3GFOA 2KB0A 3K1JA 4B3FX 2B8WA 2IYWA 4G5GA 3FFBA 2GAOA 3CWZA 1RFLA 2X19A 3HYRA 3L2OB 2ZR9A 4HAVA 4QNMA 3THYB 5E7IA 2FEMA 4D0NA 2YWGA 5JJLA 3QQ5A 1Z0DA 3R7WB 2J9RA 3TSZA 4DUGD 3AVYA 1OB2A 4TQAA 1ZW6A 1DARA 1EX7A 4DC9A 2QSZA 1UBFA 3T06B 1G3RA 1LNZA 3E70C 4A6PA 1E9BA 1T8TA 5B57C 3L0PA 2BKUA 4KODA 1JR6A 1WRBA 5FR1A 2GESA 2H1LA 2VL7A 3CRMA 5IK2A 5CM9C 5L3RA 2EVWX 3LW7A 2Q9AA 4N0EA 3LNCA 4OI1A 1W2GA 2XAUA 3PUVA 3NDBB 1D6JA 2ZS8A 2BMEA 2VF8A 3VR6A 3MJHA 3GLGE 5EXTA 2TMKA 4DRZA 3SEAA 5AUNB 4YMUA 3LLMA 4M9SA 1VG1A 3TW8B 2G1JA 5EE0A 4KFSA 1XPOA 1G8YA 3N5CA 1NN5A 4GFDA 5B64A 1XDBA 4EQ6B 4F93B 1N0WA 2CL7X 4BRUA 2CE2X 2CLDX 1XU4A 2GK7A 2R6AA 4JT4A 5FBVB 1ZUHA 3IHLA 4B35A 2CJWA 1EFUA 4KSCA 3MAAC 1ZNXA 3IPXA 1GUAA 2F6RA 2DY1A 2B8TA 4ZIRB 3MD0A 4V03A 5J4HA 2HCJB 4DSOA 1N6PA 4PQFA 3KQKA 4MGIR 3OEHD 3U7GA 1MO5A 4YONB 2IYYA 3RVBA 2JEOA 5TVKA 2HYDA 2VHJA 2WIAA 2PT7A 4OJQA 3PUXA 1E9EA 4M1MA 4TL8A 4HDCA 1ZMXA 3THYA 3W6NA 2QE7D 2IUSA 2IYSA 4FMCB 2BCJQ 4O2RA 4BFTA 2QPOA 1E9CA 3AV0B 4EFLA 3R9IA 1VYVA 4XTCS 4GL2A 4NYMQ 3MG9A 1RPZA 1J8MF 2GNOA 3FGNA 2VF7A 3GLFE 1E2LA 2C95A 2J5XA 3W9YA 3CRW1 1LB1B
chains in the Genus database with same CATH superfamily
1KMNA 4F2DA 2XGMA 1C29B 1C4XA 1KSHA 2HNKA 4LXTA 4D8YA 3QOWA 3AI1A 4UNRA 2AN3A 2YMLA 4MR9A 4NE2A 5K1ZA 1Z62A 4IG9A 4P58A 3DZ8A 1TYCA 1JIVA 3LVQE 4FNMA 5FX2A 5IULC 2OB2A 3P20A 5EY5B 3NHZA 2YJ4A 1DG3A 4ZJUA 4KYUA 4JXZA 1KYWA 2VJOA 4CT4B 2BFDA 1NVAA 1NF9A 4FX5A 1ENOA 4RXMA 2DFVA 4TQGA 1NXSA 1L4HA 4EA6A 5MN6A 3AVUA 3H1PA 2F4VB 3EZNA 2D5CA 3D4PA 3EY4A 3MWFA 4J2OA 4X90A 4RD1A 1QTRA 1FEZA 2CFOA 4F9GA 1GGVA 4XQEA 4IIYA 4C5CA 4UOEA 2RGDA 4FMBB 2RGGA 3W1VA 4DC0A 1DU4A 1UJ4A 3WSTA 1MEOA 4BTVA 1G3QA 4B3RB 2ERCA 5K0ZA 3UMFA 2PFSA 1M72A 2EJBA 1YQQA 4HLUC 5TT0A 2FF5A 1NQXA 2FZGA 5AI9A 3LL7A 1MO6A 2JAPA 3QWHA 4MVXA 2RHCA 2N9UA 2QTAA 3RS7A 3K1ZA 3JWJA 3LCUA 3QWAA 3ZV5A 2W2NA 3ICVA 4Z7OB 3O4RA 5K45A 2QYHA 1TM2A 3SC2A 4LF9B 4BNWA 4R7ZA 3VQTA 5F4BA 4OY3A 1IJKA 1X1CA 2WM3A 1Z5PA 2QI9C 2YY5A 3K9LA 3K09C 1DPGA 3FYUB 3LDGA 4QUGA 3A1FA 4AL4A 2XSZA 3FBTA 3LUDA 3ZHVA 4V1CB 3KYCB 3LKZA 4EB0A 1MTZA 2BFFB 3BORA 1E69A 4KWIA 4BUJA 1ODJA 1H8HD 4RY8A 3PI7A 1MRSA 1RCFA 5C34B 1YQWA 3DULA 5C4IA 1WLYA 3CKKA 4L76A 1HEIA 3HLKA 3TNDA 4G1MB 4CMAA 1J8DA 3LCVB 5KNDH 1T6BY 2CMGA 2RAPA 1E2QA 1H2XA 1OI3A 3N6VA 5HKKD 4DLYA 2ID4A 3WG9A 1L5NA 3E35A 4FC7A 3VNUA 2A5DA 4UHDA 4YY3B 1LBIA 1SVSA 1WPGA 1EE1A 2OUKA 3U5ZB 1E5TA 2CL6X 4YBZA 4MVJI 4N18A 1AA6A 1GLNA 2BFAA 4M7WA 4CFSA 2CLFB 3VU0A 1FVHA 2IVFA 2DQYA 1ML4A 3JVVA 3WK7A 4CF3A 2C78A 1BVUA 2AE2A 3JQ6A 1AH2A 1IJFA 2OZLA 3BH7A 3LZDA 1P1IA 3IBFA 4OX9Y 4KQMA 2CVOA 4QTYA 1J23A 3NXKA 2IEAA 4PTYA 1QCCA 4RTRA 1EEXB 2XXAA 1YIOA 3OQIA 1O94A 3X1YA 4XX1A 4UOZA 3GLFA 1GXSA 1WABA 4NK5A 2BFNA 3A05A 1WA5A 2NU7A 3JYQA 4Q02A 1PWHA 3T5GA 5TJHA 3TZEA 2Y05A 2NSJA 4L8VA 1C1HA 2QENA 4HB3A 2CWDA 4P93A 1H1LB 1MEEA 4HPXB 4MWCA 1QYCA 4YAEA 4E5SA 2JC3A 4GM1A 3VHQA 2Z30A 5G0TA 3H42B 4W4TA 2OILA 2O05A 3WMGA 1RNLA 1V9SA 3TUZC 4KGXA 1YR6A 1HUQA 2GMWA 3DUFA 3TLBA 4JNCA 3LXRA 4YJHA 2GX6A 1R4AA 4GBED 3OG9A 4PWYA 1FFGA 4Y6QA 5IDYA 2P1ZA 3UJDA 3WOHA 5KVCA 1VIVA 1D7OA 3STVA 4Q7QA 1MC5A 4JASB 3VZDA 4JJ7A 3GXOA 4BQNA 1AO3A 1LV8A 2HADA 2YWXA 2O3QA 4ITVA 2XVXA 3RASA 1RBZA 2CZQA 4FYJA 5AW3A 2PTGA 5JQGA 3PFBA 4UAGA 1NKSA 4DL9A 2CSXA 3ZHQA 3KDAA 4LRUA 3LO5A 3RSHA 3T38A 4HEJA 3U7JA 2GD1O 5AVVA 3UB4A 4ED9A 3H5IA 4BAZA 2K6GA 9ATCA 2SICE 3F9IA 1HT3A 3T54A 3QE9Y 5FTNA 4UU1A 2FFRA 4MPTA 3V9PA 5EJ7A 1HF3A 1KVRA 3SPXA 2CGEA 1K9VF 3R9XA 1H2FA 4LQDA 1R6UA 1P45A 3AUSA 3RREA 1KY3A 1S3SA 3P7MA 1JYEA 4B3MB 4X9XA 2SECE 4YUWA 2GYYA 3O91A 1XHLA 3JAKA 2GFIA 3ESRA 3P52A 1US8B 2WUEA 3BWMA 1QQTA 3ZK7A 3SZRA 3F3KA 4XCQA 3VDMA 4G0UA 1E58A 1T6XA 4KDRA 3QITA 4P35A 3QEMB 2IHYA 7REQB 3FPEA 4MKGA 4QBTA 1N25A 4PO1A 4QEKA 3SNHA 4S2UA 3ZD8A 4C0JA 2UDPA 1JG1A 6CHYA 3GMTA 3G1TA 2ZIZA 4FZ5A 3DA8A 2CLHB 4MUNA 1QHFA 4NPAA 2WK1A 1JUDA 3S0JA 3WSWA 4UHJA 4EPTA 5IT0A 1ZGHA 3C6YA 5EYPB 3O1HB 5CB4F 3I34X 1JQ3A 4O4IB 4QFBA 4B71A 5CCXA 3LT1A 4FGSA 2MIIA 4JR2A 4X8HA 3A4MA 4KGZA 4EHDA 1S1MA 1Y1LA 5DX1A 1YI0A 3O4FA 2G67A 3DAHA 1ES9A 4AKIA 1DC5A 3AM5A 2TYSB 2J5QA 4YXWA 1QVZA 1WX1A 3QVKA 3MJTA 3O74A 5F2OA 2Q2NA 4MR7B 3SSMA 2WMOB 3ZXIA 5EJ8A 4ZVSA 2AR9A 5LNK6 2C00A 3AC0A 4N3NA 4MDEA 3MJDA 6ADHA 1YUNA 1WDWB 2FZLA 1DV1A 2W11A 4BZQA 2ZXEA 4D0SA 4K1LA 4IDBA 4ONEA 5EZ6B 2VRNA 1PZMA 1RWNA 2HLDA 5HZHA 3D02A 1K5HA 4LYFA 5FWAA 4Z5XA 3EF3A 3E84A 1C2YA 2HSZA 3ETHA 5TT1A 3LLSA 1YMQA 3HDVA 1GNVA 3FTDA 3X1KA 1D2GA 5ITZB 3HDQA 2FOLA 4JSTA 5CB0A 4IWYA 5G41A 4B6JA 1BX1A 4C7MA 2XGOA 3NHBA 3C1AA 3FDZB 3AB7A 3A4VA 1UKYA 3W2TA 3LT0A 2YW2A 3F49S 1R0YA 3LXUX 4B3SB 4BQQA 1VE3A 2WZBA 4HO1X 4ILEA 5H3LA 1G8AA 3WNBA 1T24A 1CPYA 1YAHA 1K7EB 1FF9A 4RKRA 4XRRA 2G1AA 3WGOA 2FPWA 3E03A 4Z0PA 3I42A 4UHHA 2Z5GA 3OD5A 3ZS9A 4OXIA 4QG7A 4NYIQ 1TD9A 2LBPA 5JBIA 1F8XA 1ZOIA 4K28A 4K2HA 1ARZA 3KSMA 4X7BA 1QYIA 3TCNA 3EA5A 3OE7D 3V6LA 4RU1A 1TL7C 1ZJJA 4QTTB 4L78A 1ZNYA 3AIKA 2GEVA 1RKVA 1XYYA 1TQ2A 4LC1A 3L1KA 1RPNA 2Z2ZA 2DYKA 2HT6A 2PVSA 3DLPX 3GLHE 2OGUA 4KFRA 2J0EA 3N87A 3ABSB 5A9TA 4CDNA 3MCWA 3OM0A 4D0GA 1LJLA 2MCFA 1GY8A 1JBEA 2RB4A 3BXZA 3E27A 3LJKA 2HJGA 4BLVA 4KITB 5DV9A 3T5CA 1Z6TA 1Z7BA 1B6RA 2MT9A 2NU7B 3NC1C 1DJPA 2RMKA 4BV9A 1MA3A 3GZNA 3RGWS 1DAIA 3MYYA 4PBSA 4BFZA 1E9AA 2XXAB 1GUBA 3VNRA 2V6IA 1GADO 3IAUA 3BXFA 4QSHA 1CEEA 1ONBA 5G3ZA 3W5CA 3ZVLA 2HLNA 2VYCA 3FA2A 5GVSA 4YECA 2JFUA 3B70A 3WL4A 4CEHA 3W7AA 4DV0B 1W6UA 1HEUA 3BRWD 1MENA 3DHYA 2Z58A 3LPNA 5AR1A 3ZR4B 1SELA 4QC2A 5LQJA 2FSSA 1ML3A 3PIDA 2ZBUA 3ZY6A 1M6VB 3CH5A 4F9FA 5KTPA 4TMYA 1PR4A 1JSRA 4XR4A 1U9IC 4EF4A 3EOBI 1TAQA 3AESA 4JWKA 2R9VA 3ZLUA 3ETLA 1L3BA 4WCFA 2ZBQA 4F8YA 1IBKB 1NQWA 3SFVA 1A69A 4HWTA 4IXWA 1VHWA 2DETA 4KLAA 3EZLA 4ARAA 5CA1A 1DKOA 1JIUA 1UH5A 1FX0B 3FGPA 3H99A 4EJ6A 3KR1A 2V0CA 3ZOKA 3JRXA 4MH0R 2CMFA 1J1IA 1N5MA 1QFZA 2UYGA 2Y1FA 3AERB 3E0QA 4ND6A 5DGIA 3W9SA 2FPLA 2BBOA 2J9GA 2W0SA 1J7JA 1OBFO 2JHPA 4P7KA 4HB4A 4MCIA 2BFFA 1I9GA 3UK2A 2WSYB 4ZVQA 1FVFA 5K6TA 2C8JA 4QQ8A 4YLGA 2E49A 3QKWA 2QUHA 1IHDA 4OQMA 1K7FB 1WKBA 2HW8A 3R24A 5P21A 2VF4X 4XX0A 5TMEA 1GSIA 1U9CA 2OGTA 4GKKB 4US0R 3ONNA 4AXXA 4Y6RA 2G88A 4V02A 1LPOA 2V3CC 1YFLA 5FYDA 1JR3D 1BEZA 5KWIA 3FYDA 2VWPA 5DM60 2Z2IA 4E46A 5L40A 2YYZA 3DR3A 1A77A 1JR3A 4ZO7A 2GR9A 1JJVA 5ALJA 1SXGA 4ESVA 1VBFA 4Q4LA 1Q0UA 2GHRA 2G9QA 3WIBA 2NU6A 1EVQA 3OO0A 1KE2A 1XZJA 1NX9A 1IATA 3RUCA 3STUA 5IS2A 3KQVA 1D07A 3RS4A 1ILWA 1IZZA 1E0JA 1KFBB 1XAGA 2AHRA 3IALA 5IDWA 3L7JA 3FXAA 4U39A 3D5QA 2J0VA 3MNFA 3O0DA 3ZJTA 3E9QA 2CXRA 5A3QA 3A1NA 1IFXA 2YUIA 4AICA 2XF2A 2HL6A 3RR2A 1WMFA 1BJRE 1Z0JA 4W99A 1Z45A 1C2TA 3D5EA 4WECA 4C3ZA 2GK3A 3DAFA 4CIAA 3WP1B 3AHFA 4JL5A 1YULA 3NBYC 3MCUA 3UICA 2ECKA 2YVUA 1YU9A 2R7MA 1VMKA 4M46A 1E9VA 1LI4A 3OY2A 2P8SA 2WJVA 4Q4HB 4Q1VA 5EFOA 1TF7A 4EKEA 3SF8A 2B2NA 4Z1OA 3PC6A 1O97D 1Q2XA 2XLBA 3SJZA 1RYNA 3CKMA 4MVJA 1ZUNA 1TUGA 3RV3A 1E4VA 2H0AA 3DT9A 4XRGA 4IXMA 1GILA 4Q16A 1M2EA 3A0UA 3EZXA 5E1OA 3SE7A 4CWAA 2R0QC 2J33A 5B4UA 3QVGA 3OT5A 3I0NA 4TXHA 5JCOA 1VIYA 2BH9A 3LZ6A 2H1OA 4GOND 3TQOA 4EFMA 5AYVA 2GPWA 4EBBA 3ZNNA 1X92A 1CY7A 4RKFA 1YA6A 5JJBA 3UA3A 2BSAA 1K86A 2XUHA 1T0HB 1BE8A 2A7XA 3FYTA 1MOQA 2I4IA 5FEMA 1GYPA 1KEEA 4LJ8A 1S4MA 2OYSA 3UAOA 3IPCA 3MEQA 3I9JA 4HGPA 2QROA 4Y1RA 1EXVA 3D3QA 2PBFA 3I0MA 4UFOA 1JXOA 4LECA 2WD7B 1B42A 2YBDA 4BFVA 2R7NA 1C8LA 4CRWB 4V1CI 2I80A 1KDTA 1Z0AA 1KEVA 3H18A 3D6JA 4DZTA 1Y1RA 3H65A 4S1PA 4KPEC 1VFPA 4QULA 4BWYA 4EVRA 3L7DA 3EXHA 1XJQA 4V0MA 1YRLA 3R5TA 3RG8A 2B35A 2A92A 3NS7A 3YASA 2BGIA 4NL4H 5H3CA 5ALLA 4ZO8A 1CDEA 1ESEA 1PSWA 2C2YA 1KZHA 4EYGA 5CX4A 3H3XA 2Q7DA 2J6IA 2EKLA 5CB8A 1V5GA 1A1VA 1QUEA 1M6VA 2ILVA 3HBMA 3QPAA 4IIXA 3QUSA 1E6LA 4NE9A 1IN1A 4AG6A 1CUYA 3AP2A 1V7PC 1L5FA 2VUHB 3NAGA 4OB6A 2HUPA 4XVQA 5DI3B 2BDEA 1J8FA 5JFOA 1DVRA 3KKKA 5KSWB 4CEHB 3DW3X 1M6WA 4L9SA 5BQOA 4BFSA 1JSLA 2JH8A 2R8BA 1ESMA 4BO5A 1BJTA 4M9QA 4OBEA 3VR4A 2AMFA 5E38A 3RHZA 5I51A 1IAVA 1NQVA 4UREA 3KB6A 1XN4A 2WW8A 3ACCA 1VHJA 4X97A 4XZ3A 4YPFA 2D6FA 3QFSA 3KYIB 3WICA 3MGGA 2VQDA 1OPRA 1VKJA 3W78A 4AP9A 3TD2A 2EATA 2OYCA 2Y1LA 1DKPA 1P1KA 1UPUA 3JSXA 2JGNA 4JMPA 3OCYA 1JB1A 2GRJA 1IG3A 1RMYA 4BQFA 4AO8A 3EQ8A 3Q88A 3W5HA 1NUHA 1ODLA 4PG7A 4FCWA 4TTTS 4EHBA 2CNWA 1F48A 4K9RA 5KOHA 2J3EA 3CA8A 5IMSA 3TS1A 3GJ4A 2PXXA 3Q9NA 1YQUA 1E3IA 3HZHA 1DMSA 3NHYA 4MXDA 5KDLA 5BUQA 4II7A 2GCOA 3TTUA 5AM4A 1D1QA 4PSVA 4V0NA 4HWOA 4KXYA 2A57A 3BWVA 2PA3A 1DNPA 3FW1A 2WZQA 2HDOA 4RFVA 4ZI7A 1Z7EA 4BGDA 1V47A 1LRKA 2V4ZA 1Y37A 4QO8A 3ESDA 3DVAB 2GPJA 1V4VA 3DT6A 3CEMA 1APBA 4Q6WA 3UGJA 3HTXA 2E2WA 2B98A 4QFCA 2E18A 3I05A 2DTDA 4K5QA 2V7PA 4ZQIA 5DW0A 4RV5A 3DZGA 3OX3A 3NU1A 4H0NA 3QI2A 1L1FA 1VKOA 3FDZA 4PIPA 1Y5MA 4LY6A 1ZC4A 3EYWA 2NAPA 5F77A 2JJ8A 2WIBA 2AOTB 2BFMA 1KMHA 1T6NA 4Y1EA 5ALXA 3WLTA 4ZVVA 4KQ6A 4LK3A 2W8ZA 2JGRA 3NIBA 1V6AA 2JBHA 4WCVA 3PU6A 2AWNA 3EIQA 5FOSA 1K4MA 4JYZA 3QK7A 3ADDA 5JSHA 1S2LA 2O8DA 4E5PA 2PMCA 4OI4A 4NAHA 3L8CA 1Q11A 2FZCA 3GJ0A 4MWGA 5FOWA 3U62A 5EXSA 1UXKA 3FLBA 1TO2E 4W6ZA 4P92A 4XM1A 3QXXA 1XRLA 1BZYA 4M1EA 5KTSA 2OTCA 1QHHA 2R7KA 4OD0A 2A9RA 1G38A 3K0CC 3L8EA 5MDHA 4NSNA 4PR3A 1YK1A 4L8YA 1KBQA 4WLEA 5JV5A 1IMOA 4WVFA 3WWOA 3F74A 5MF6A 4YS6A 1JSCA 2R1TB 3DUWA 4W9NA 2WM2A 1MFPA 3UV7A 4GMDA 4EMUA 5JROA 4RETA 3OLWA 1XIVA 3X1JA 4D6YA 4OHVA 2EF0A 5EJ6A 2JDID 5IEJA 3AZQA 2F3RA 3UW1A 1AZLA 5EAIA 1KK3A 5EYPA 2CUNA 1G21E 1NY5A 1WCV1 3VO1A 1WHTA 2QRJA 3UJ9A 1FMTA 2I78A 3EWSA 1O6FA 1X7ZB 3E8MA 3VR5A 5KQPA 2X6RA 3EH1A 4MWEA 1N78A 2R7AA 1PQ4A 3L7MA 3D6TB 5FFFA 2TRSB 4G67A 1TMGE 2R6FA 2Z9BA 3QPDA 2Z4RA 4NFHA 2PFGA 3AB8A 3MGAA 4O5OA 3AHHA 2QP9X 3MTQA 2NXCA 2W4IA 4IHJB 2AFIE 1NLYA 1SHUX 1P4GA 1UKCA 3CVXA 1DG1G 2YIVX 2GFHA 2IY8A 4C05A 5MN4A 1C1XB 1B7GO 1RI4A 1YR1A 1KGDA 1B73A 3KUKA 3KV3O 1T1RA 5G0SA 1QHIA 3D1VA 3T7EA 1L4YA 1F6BA 1QC5B 4X65B 1SXJA 2JANA 2XQGA 4GBMA 1JQEA 1M8JA 3TNFA 1E6UA 2EP8A 3GAZA 3G2IA 4RM3A 2PIDA 5TY0A 3MTDA 1FS5A 4QJBA 4IUBS 1PR2A 5DSTA 4K40A 4PQEA 3TMKA 3W4KA 4B79A 1ZESA 2P8JA 3LUJA 1FC0A 3QMVA 1PWYE 2AK2A 4CZ2A 2O8BA 1OXKB 4P5PA 4YH1A 1KSGA 4I6JA 1Q17A 3FR8A 5TIIA 4A3SA 2C4KA 2JFPA 1G4HA 4B17A 1R66A 2MTBA 3LFHA 3FCOA 2JAHA 2WAXA 1L5RA 1SD2A 3GEPA 2R25B 2ONJA 5LQKA 2GO1A 3DC7A 2REOA 5LFAA 4D4LA 1A04A 3GK3A 2HPZA 1OXVA 1G4UR 4HZUA 2LRHA 4DVJA 5B36A 3FFTA 3PIIA 5T8KA 1Y7PA 3WXBA 3G6WA 1GUDA 5TDHA 4DYDA 1KDYA 1GGMA 1XRPA 3B2EA 3GPBA 2XUGA 3KLOA 5L8VA 1LVGA 1IM2A 4AZTA 2O7NA 2Z6VA 2PUWA 5DBGA 3ND5A 2DT5A 1E1CB 3V2UA 3TLGA 1O87A 1DWUA 4G0PA 1PL0A 1O0BA 3BA6A 1HOTA 3LF2A 3OF3A 4PGFA 3BGWA 4FSHA 2A0XA 4Q34A 1B93A 2NW6A 2YRWA 3ENQA 2OZLB 4GLBA 1Z4PX 5CLLA 3VPDA 2YWJA 2ZE5A 4ZXPA 3IA7A 4MSUA 1A7KA 3A9WA 4L9AA 4DA9A 1WBDA 4M1KA 1P9OA 2PMFA 3DKIA 3P9QA 4DKJA 1KP3A 4YAWA 5H8WA 1X74A 2HDNB 4LVNA 4MUAA 3ESCA 3FBWA 2GZAA 2RG1A 4E15A 1V8ZA 2FSPA 5SYAA 3PCXA 2BWJA 3TNJA 4E7OA 4EGJA 5K0CA 1HNZB 3HVJA 1AY0A 2G3YA 2G07A 3ETJA 3MLAA 4HI0E 4AI6A 1E1QD 2LDBA 2PMEA 4NCXA 1QAQA 2GKOA 3BXGA 2WUGA 3I92A 4AKGA 2VJMB 4N5LA 1F06A 2X4IA 4X63A 1FSPA 2FWJA 1G41A 1ZI6A 3FWPA 1EXMA 4U63A 5ALSA 5I7VA 5JCJD 4GR9A 4R5MA 1M6NA 3U31A 3GT4A 1QIDA 3C3AA 1D0IA 2VTVA 4H6VA 4JYMA 4W5HA 1ELOA 4IDPA 4WWHA 1EWVA 3RVSA 1Z5UA 2O4UX 3SYTA 3MPUA 4AP5A 3UYLA 3H5AA 5IM5A 3BSYA 1QIEA 1XFAA 4WNYA 4EG5A 1X8LA 4I14A 2MYUA 4KXVA 1DKNA 2JIDA 2FG7C 1V4NA 1PLLA 4P4LA 4MJXA 3QELB 2IOFK 1JHDA 3OPVA 4LKOA 5AO9A 4ARSA 3BOSA 3HYLA 2H2AA 1BMQA 1FW8A 3R6GA 3U7FB 4YCNA 1M83A 1SG0A 1G60A 1ZD8A 4V3CA 1SULA 3OZEA 3SZLA 4BC0A 2VIIA 4GQIA 4ZTUB 1E4YA 3RS9A 1SZDA 3TZQA 4HNUA 1RD4A 5HFNA 1ZXXA 1G16A 1FNDA 4EGAA 1EUZA 1IN5A 4ZI3A 3H2JA 3FSEA 3QBTA 5ER9A 1KNQA 1LJUA 1E2DA 2F1HA 1YGPA 2WKQA 1VKNA 2FX3A 2O48X 2H2HA 2ZE6A 1SVWA 3BQNB 4FZVA 1IN4A 1QQ5A 1FJHA 5DMXA 5FBRB 4I50B 4AZVA 4CKEB 4BWGA 1C3EA 4ZHQA 5KPDA 1Y82A 1BNCA 3GT7A 2GXSA 1DOAA 3EG9B 1Z68A 2I1QA 3IAS1 3CIFA 3KXLA 3U4MA 1S7CA 1RAGA 3SEQA 3ZDZB 2I1LA 2OZKA 4PZZA 3FVVA 4FGWA 3V8RA 1QFMA 3CUYA 2PFKA 1KI6B 3OICA 4MGHA 4FCTA 2O2GA 1JHQA 1HT0A 3JQBA 3OZTA 5DBIA 1QCZA 3P1JA 1XJ0A 4B1FA 3EAQA 4LV8B 4BJ5A 2MU1A 1HE3A 1IEQA 1UXIA 5DEIA 1LF0A 2ANCA 4QOEA 4H1VA 4X6LA 1GDHA 5BSVA 1T0UA 3KLNA 5LD2B 2NYRA 1KBOA 1K8ZB 1MW9X 2ZB4A 4RK7A 3RYIA 4ARZA 1NN1A 4ZYUA 3CVUA 1IEXA 2GUGA 4J0HA 3RVJA 3AEUA 5KREA 2QQ0A 1A97A 4PC1A 3KQHA 1XP5A 4L4YA 3OIUA 1P60A 3A4LA 1N2CB 2NXNA 3DDWA 3DQPA 1KA9H 4ZEXA 3UG6A 1GYRA 1M1NA 1M6EX 5TQ2B 1WBBA 1QKJA 1EP1B 2BZ1A 2DKNA 3RYCB 4N40A 3WV5A 3EPHA 4Z7NB 4O2BA 1ZD1A 4D99A 5DLEA 3I6IA 2IC5A 3KTOA 3R0JA 3V1TC 3ZHOA 4FD3A 5AD1A 3VYSB 2W8BA 4O6VA 3C43A 3DL2A 4XFDA 1Z12A 2UAGA 4GLFA 4BO3A 1G17A 4LNHA 4UHCA 3KO8A 4G37A 4NENA 4TV9F 4TL9A 3GJ6A 1M7BA 2HPVA 2Z98A 4A5SA 2NN3C 2XTZA 1DX6A 2MSKA 3GEMA 3E9NA 4YPOA 2X7HA 3HR7A 4MYTA 2JAXA 1NF2A 1JAXA 2H1IA 1Z6XA 4YCJA 5TEWA 2KMLA 3SICE 1WD7A 5CB6A 5KNCD 2CFCA 3OOHA 4LC9A 1UCFA 1AGNA 1TUIA 2VT3A 2XKAA 2CK3A 4MUMA 4RKEA 4WTOA 2F1KA 1U2EA 3CG4A 2F64A 5TPWB 1M1ZA 4KQWA 3RF6A 4A16A 1EM6A 5JZBA 2OZVA 4UHEA 4D5EA 3AXSA 1TDJA 1DO8A 3C5CA 1B4DA 1XKTA 2ONKA 3PNOA 4FGKA 1HDXA 3RTCA 3ONFA 4BFCA 1CJKC 4JFRA 1N1EA 2F90A 4EYQA 1NA5A 1C0LA 4EMSA 2XCOA 1G8HA 2VDKB 3PXAA 2COKA 2CMDA 1Y6QA 2OD2A 2FFJA 2WHQA 3IQDB 1E6EA 3L7LA 3DJFA 2QPAA 4R8KA 3WJ7A 3ZXYA 1G7RA 1V5FA 1R16A 3NWPA 5HZKA 1NVXQ 2E1RA 4XD7D 2BGGA 3KJZA 3A27A 4I5IA 4YQFA 4RKQA 1XDDA 1JALA 2QMHA 1YJQA 3M1YA 2E1PA 3ITEA 1RYBA 4NDNE 4PFSA 4X91A 4ETMA 1YMUA 1YASA 3VZPA 4ENSA 1AV7A 4KP7A 1PEKE 2JI7A 3U9LA 2OKCA 1CUDA 2Q0QA 4BEWA 5CLJA 4A5OA 2JFGA 4KR3A 4BP8A 4P5EA 3JSAA 3BRCA 3V4VB 2XQIA 5EIEA 4IHKA 2C29D 4K2AA 3RFCA 1IK4A 5DBEX 3QE3A 5JCPA 4PZ0A 3MOGA 1YB4A 5BNFA 4EB8A 3OOEA 4HHEA 3EIOA 2J0UA 3WKBA 4YUYA 1RYZA 4H9GA 5GVRA 3ZU5A 5A1TA 4RLHA 3OUTA 1X14A 2JL1A 5ALMA 4PLZA 4M0FA 2EQ5A 5H16A 3WLMA 4YRCA 2WTAA 3EUFA 4LJ7A 5HF9A 1W5SA 1ZMOA 2XE6A 2ZSAA 4HYTA 4BQIA 5EL0A 3ZBTA 1AMUA 3FJ1A 5FCDA 2ZANA 1W4AA 2W98A 3QX8A 1P77A 4HTAA 2QLTA 4GM4A 2X4LA 4DNOA 2GAFA 2R11A 3N2GB 2HRBA 2VDRB 3BIOA 4QUHA 4QYIA 5EXDA 4MICA 1VBMA 4MR8A 1JKFA 1T43A 2AZMA 3BMNB 4YO7A 4KH0A 3LLVA 3TLCA 4YAUA 2NSYA 2J32A 2IPAB 4H7FA 2YFYA 3LT4A 1AN9A 3PB3A 5JSQA 2PNFA 3QWIA 4BNFA 1BDIA 1REQA 3BXXA 4MO9A 4BKUA 2ZIWB 1FVOA 4QELA 4BKOA 5BXQC 3PX3A 3RYFA 4DHEA 4DLZA 2VDPB 1AS2A 3P9RA 3DGEC 4B7ZA 1CR1A 3E58A 1UBNA 4H15A 4F2WA 5E8RA 5EIHA 1DMRA 4CGYA 1TVKB 5GM1A 3F8SA 4G2NA 2NO0A 2QNBA 5EMHA 4QYWA 2O23A 3CC8A 4OQZA 2X3FA 4N5IX 3WL7A 1ORIA 1F60A 3GARA 1WF3A 1IBRA 3R5KA 2Q9UA 1WMDA 2LW7A 5M3BA 3VNSA 3WIVA 3HCCA 2WG2A 2XCUA 1U8FO 3QVTA 3LUCA 3NCHA 4TQUS 3RQSA 4LOAA 3DTTA 5LKRA 2HO4A 2IF2A 4PE5B 4RXUA 4FOPA 1U28C 3K2IA 2XQJA 4JVOA 1JI0A 4PNPA 4W5QA 3RRZA 2NV0A 3EXEA 1G21B 4XIJA 4MUGA 1SC4A 4YMTA 3S2EA 2Z6QA 1BHO1 2XQFA 5KX5F 1E0DA 3PIRA 3D5TA 4H6WA 4HDNB 4LWQA 4AU1A 4CCSA 1RM3A 1Z63A 3H3FA 1JDZA 2O8CB 3HVUA 4FDUA 3ASVA 1XTIA 4GPAA 5BQXA 3NHWA 4UHBA 1H5NA 3QJGA 5GAJA 2ODTX 1VCMA 4ZT4A 5JY6A 4ZWNA 4N6NA 2PBLA 1OC4A 3VYTB 5AW0A 2JVKA 3QW4B 3TQSA 5GIOE 5JLJA 2RHWA 2QTRA 3IXQA 4DWOA 4KOEC 1Y4AE 3WYGA 3R5SA 1ZK4A 2GDJA 3N86A 2IV3A 4XE5A 4KVAA 4DRYA 4A8JB 3RS3A 3CH6A 4MUBA 5ALTA 3I5AA 3HMKA 3ILXA 5LB2A 3PSAA 1DB3A 3OZFA 1CVLA 5DSXA 1U9JA 1CQIA 2YH2A 4J0GA 3T9AA 1FLNA 5EHXA 5A4JA 1R8JA 1E94E 3KALA 1JA1A 2H63A 4LVCA 1TRKA 1Y3AA 5ECDA 4FZRA 4LZPA 5EQTA 3BREA 3FKQA 3I9MA 3O92A 3LRTA 2FR8A 3P32A 3WDLA 3ISTA 1QGYA 1I3KA 4URWR 4HDNA 4LMPA 4WLNA 4YGXB 3ZH9B 4F5YA 4XWKA 4IIEA 4F3CA 5IZ4A 3STYA 1TCCA 5HX7A 5JZ9A 1RZUA 4OO3A 5I7HA 2EDCA 4L1KA 3TD9A 1OI2A 3O9MA 1XEAA 3GLRA 1RYEA 2FSFA 1ZJ5A 1FOEB 3EZFA 1FMLA 3U81A 1O7JA 4BFXA 4P4TA 3GMIA 2XDWA 3MELA 1FDIA 4K05A 4MVCA 5EQDA 2QAGC 4C4TA 1W49A 3PEEA 2YNMD 1F5SA 3IE2A 5AQEA 1EFAA 3RVOA 1Z35A 2HMTA 2AOWA 4B6GA 1ECJA 3M8KA 4L3VA 4R54A 4CN9A 4WERA 2XWPA 4LJAA 5HW0A 4JOSA 2I3BA 2C2XA 1RHUA 3OA2A 2PD3A 1UP7A 2HK8A 3KEGA 3W3AA 4ZC8A 2Q6OA 3AG6A 1Q0RA 2IODA 2A86A 4X1YB 3IEXA 3I30X 5HMMA 1XEWX 3LVBA 2PS1A 4HQKA 4MOWA 3K20A 2FOIA 3MRVA 1G5RA 2EJUA 2QUIA 3ZGOA 3SC3A 3V8QA 1M1XB 1DEOA 1YNSA 3OCCA 2ROQA 3VBEA 2HRDA 4DLUA 1U2GC 5KYNA 3HGTA 3LYHA 1BMDA 1PDWA 4L5AA 4S1VA 2P9GA 3PGKA 1B3BA 4EF5A 2ZBGA 3BE4A 2XI4A 1PHRA 4LW8A 4MR8B 1DQZA 3IA2A 3K15A 2WWHA 1KHTA 1PE0A 1FJ2A 2IELA 3CGGA 3WYEA 5AW2A 5J58A 4MVYA 2QG6A 5FUBA 3Q4GA 1MIHA 3GNSA 1U8AA 4IS3A 3IOCA 5JSUA 5JFGA 1K97A 2O8EA 2XCLA 4LS3A 4BMPB 5CYPA 2QYSA 2B7LA 5KSZA 1T4BA 4XASA 1YO6A 2NPFA 4BY9E 3F6BX 1LKZA 4DDUA 3R0IA 4GX1A 1OH5A 3L1VA 4B85A 1EYZA 2NO4A 4FYYA 2XT0A 1E9SA 3FH0A 3PX2A 1XTJA 4FQ8A 4WJZA 5DHAA 4B74A 1JG4A 3WHKA 1UADA 1S2MA 3MT7A 4NQZA 1RQNA 3STWA 3FTQA 3O8BA 3P9PA 4M0MA 1V9LA 3JPYA 4EYKA 5JTUA 4ROTA 1BD4A 3V4OA 3KRTA 4URVR 5A9SA 3ZU6A 4FHDA 1JFRA 1SVOA 3AUAA 1DAPA 4QRHA 1SY7A 2C42A 4Z7QB 3RCBA 4OGWA 2PVCA 5FOQA 1GN8A 4XFKA 2FJPA 4CHGA 4P86A 3I12A 4UW9A 1JTEA 1P19A 1F6DA 1I3LA 3HWRA 4J0FA 3TIVA 3VH1A 4E1AA 3E9RA 4H7IA 1E96A 2AXQA 3T7CA 8GPBA 1RHJA 2VJAA 4PRKA 4D1YA 4EMBA 1UAGA 3FSJX 3GZTB 5JTTA 1GPKA 3ZVRA 5JIBA 3VR2A 5BYAA 9MHTA 3DBIA 1M5TA 1YBAA 7MHTA 3W8FA 4V2IA 1J7KA 1XD8A 1PUJA 2XDQA 3EVZA 1ST2A 3QXJA 3LQ2A 4PHFA 1PG5A 1Z7YA 2F8MA 2D3WA 1TCBA 3LPAA 3Q1KA 3TCKA 1Z7GA 2WTBA 1Y8RB 5J4VA 2PE5A 3BPSA 4FWBA 1A9PA 1AN0A 4IIJA 4K9QA 3S44A 2O0HA 4QSMA 1MJ5A 3CH4B 1CQJB 3VYRB 2XE8A 2J9ZB 4TV9A 4POOA 1NW8A 1GDDA 5FPTA 3C0KA 3A28A 2V7BA 2Q4DA 5DGDA 3FLMA 5E6RA 4ZCLA 2GPYA 1I4DD 1YVDA 1YHNA 2H3EA 2ZBPA 3I2HA 3PTLA 4GUAA 3VNAA 4EEKA 2HCTA 5AOBA 4DG9A 1WB9A 1MQAA 1W7AA 1ATZA 1WXGA 3Q0IA 4RHYA 3ELDA 1BRTA 4ZV4A 4QVGA 3ACBA 3T4UA 4D25A 2GJ8A 4EHFA 2HBYA 3A1TA 4J7AA 5IBCA 1PDVA 1TLLA 5E95A 1JXAA 1NVVQ 1ULZA 2YASA 3L0CA 4ZP1A 1I7LA 2JHAA 4I4TA 4XPZA 4PX9A 4AW9A 1E3QA 4LV6A 3ER6A 1E5DA 1YKSA 4RPKA 3R0QA 3LK7A 4BMNA 1X94A 4Q21A 4NS4A 2W8BB 5CVUA 1NFFA 2PUEA 2Y1KA 3VKWA 3UUEA 4HRAA 2GBFA 4N0MA 2VUSA 2DCMA 4H77A 3KWJA 3IT0A 3RYCA 1R4NB 2WF6A 2QTVA 5D2CA 2BIFA 1UJ6A 3GOHA 3FYUC 3QBVA 5FR2A 4EP1A 1O5TA 1N2CA 4KWCA 4RK6A 2PRSA 4YCCA 3RHFA 2W2MA 1WP9A 3M4ZA 5B55A 2QTZA 4BO0A 1UZAA 3IILA 2VK1A 2JBWA 3AEUB 3UK1A 1VRCA 4X8OA 1OWMA 3N2EA 5LNK1 3HJFA 3AR9A 2ENUA 4OLFA 4FHCA 4AJOA 4F5ZA 5K4GA 1U0LA 4M54A 5HM8A 1RAHA 1GAWA 3HABA 3NANA 3PE6A 4K6CA 4BO6A 1V95A 4R2MA 4E03A 4E2XA 2HMSA 2FPRA 1A8HA 5JOQA 3CVVA 5HNKA 4LSGA 2ID7A 1IOZA 4R40A 2ZRJA 4DAOA 2BEWA 4DA0A 4B3TB 1BDMA 1EX9A 1QGDA 2O2SA 4NV3A 4HQ0A 4BPBA 4RHEA 3WLIA 3HA2A 2AXNA 4IUDS 4KXQA 4KXUA 3HVIA 5CAEB 3MRSA 4QYTA 1A9OA 4NVRA 3GWZA 4U1RA 4KQJA 4MQEA 3SR0A 1U11A 4DM4A 2Z6UA 4HH3C 1MAWA 1TMKA 2F00A 2J6HA 3IESA 4XOUA 1USUA 2ZTSA 2YHIA 4G0NA 1CY6A 2I4RA 2VSQA 2Q6IA 3H05A 3BIXA 3FPBA 4D4IA 4XVUA 2C0QA 2RGEA 3Q5DA 3V2HA 3LVRE 4ML3A 1KZ7B 1NQUA 3A4NA 5FFNA 1GFIA 3QE2A 1RLMA 3F7NA 3QLTA 3W05A 2XGJA 1S4QA 2ZSFA 2QM3A 3K0BA 3BSWA 4CQMD 4N39A 4YAGA 2YY6A 3GCGA 1E7WA 4GPTA 2BL4A 2HA6A 3AV3A 2LR0A 4YRLA 5HF5A 5J2TF 2VXBA 3R76A 4A26A 1XD9A 3BL5A 3ZV7A 3FRHA 1T4CB 3OFKA 1KZ9A 1OAOA 5FI5A 3T3HA 4ETNA 1XLWA 2I3AA 4PHHA