2OFYA

Crystal structure of putative xre-family transcriptional regulator from rhodococcus sp.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
82
structure length
82
Chain Sequence
RVPLTAEELERGQRLGELLRSARGDMSMVTVAFDAGISVETLRKIETGRIATPAFFTIAAVARVLDLSLDDVAAVVTFGPVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative XRE-family transcriptional regulator from Rhodococcus sp.
rcsb
source organism Rhodococcus sp.
molecule tags Transcription
molecule keywords Putative XRE-family transcriptional regulator
total genus 24
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13560 HTH_31 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2ofyA01
3RZZA 1PRAA 2JVLA 1ZVVA 3SCFA 2IVQA 1CQTA 4PU7A 2ICPA 1O4XA 3H5TA 2XJ3A 1LLIA 2WUSR 4Z5CA 1YSEA 2XSDC 4JCYA 1R69A 4PU8A 2IVBA 4I6UA 3OQNA 1PNRA 2AWIA 1QP7A 2L8NA 3S8QA 2MQKA 3SCHA 1LCDA 1SQ8A 4GHJA 2KEIA 1QPZA 1ADRA 2PPXA 1JFSA 1OCTC 2PUDA 3L1PA 1B0NA 1PRUA 4X4BA 2LYQA 3F51A 1RPEL 2XI8A 3GN5A 1HF0A 5A7LA 4IA8A 1ZS4A 3CLCA 1PRVA 1ZZ9A 3R1FA 2H8RA 2AW6A 2IVGA 4Y42A 2R1JL 1BDHA 3EUSA 3O9XA 1LMB3 2PUGA 2LYLA 4X4DA 1BDIA 4OB4A 2AXZA 3JXDL 3F6WA 3IVPA 1QP4A 2PUEA 1QQBA 4JQDA 1WIZA 1ZZBA 2PIJA 3FYAA 3QWGA 2BJCA 1Y7YA 4MCXA 2PUAA 4YG7B 2O49A 4YBAA 2JCGA 3KXAA 3HZIB 2EBYA 1GT0C 4GQMA 1QP0A 2AXUA 4FN3A 1JH9A 2LYRA 2MEZA 2D5VA 3OQOA 3OQMA 2EF8A 1WH6A 3JXCL 1LQCA 1JWLA 1UTXA 2O4AA 4YG1A 2AXVA 1ZZ7A 2LYPA 1UXDA 4X4HA 3ZHMA 3D1NI 2PE5A 1QQAA 2IUOA 2XIUA 2LYSA 3ZKCA 3QF3A 4PU4C 1PERL 1DW9A 2BNOA 3CROL 3FMYA 4IWRA 2ICTA 3CECA 1ZPQA 3DNVB 2KEJA 2HINA 3BD1A 2FJRA 1X2LA 3FYMA 4X4IA 3LISA 1L1MA 3OMTA 2LYJA 1ZZ8A 3QQ6A 4O8BA 1ZZCA 3OP9A 5K98B 1OSLA 3VK0A 3JXBC 2LCVA 3BDNA 4MCTA 4I6TA 3SCGA 4I6RA 2PUCA 1POUA 2XCJA 1NERA 1WH8A 4PU3C 2KZ8A 2HSGA 1AU7A 2OR1L 1XWRA 3KJXA 4J1WA 1CJGA 3U3WA 1IC8A 2CSFA 2PUBA 3KZ3A 3BS3A 2AUWA 1RZRD 1DWKA 1RZSA 2BNMA 4FBIA 4J1XA 1RZRA 1Y9QA 1X57A 2WIUB 1ZZ6A 2IU7A 4Z59A 3GBFA 4X4FA 1E3OC 1R63A 1ZAYA 3G5GA 4Z5HA 4IVZA 3TRBA 4I8TA 3F52A 3G7DA 4X4EA 4JCXA 1VPWA 1NEQA 1JFTA 4NDWA 1EFAA 2GRLA 1LCCA 4X4GA 3UFDA 2LYKA 3LFPA 2O38A 1S7EA 4YARA 2KEKA 2A6CA 2B5AA 3ZHIA 4Z58A 4Z5DA 4YG4A 1UXCA 2GRMA 2KPJA 2BNNA 3MLFA 2EWTA 4F8DA 2CROA 2PUFA 4X4CA 2R63A 3PXPA 2IV1A 2L49A 3GN5B 2OFYA 3QYXA 1WETA 1ZUGA 1RIOA 2GZUA 3B7HA
chains in the Genus database with same CATH superfamily
2JVLA 3VWSA 3H5TA 1YSEA 3QOWA 1PNRA 2IVBA 2L8NA 1QPZA 1LCDA 3G0TA 1OCTC 5DTQA 2XI8A 5A7LA 3CLCA 1PRVA 3R1FA 4EKGA 2H8RA 2IVGA 1BDHA 1LMB3 4WVLA 2AXZA 3IVPA 1QQBA 2BJCA 4YBAA 2JCGA 2PXEA 2AXUA 4FN3A 5DRYA 2EF8A 3JXCL 2VEOA 3QF3A 2XXPA 2V3CC 3CROL 3GZDA 2HINA 3FYMA 3SX0A 4X4IA 4O8BA 3OP9A 4ER0A 4MCTA 2XCJA 1WH8A 1CJGA 3U3WA 3BS3A 1RZSA 3ME5A 5DTRA 1R63A 3F52A 2LLWA 4X4EA 3R09A 1EFAA 3UFDA 2PXDA 2B5AA 2PUFA 4X4CA 3DM5A 1U2ZA 2L49A 2M4HA 2JQEA 2OFYA 3QYXA 2PXFA 1RIOA 2GZUA 1PRAA 2IVQA 1R69A 4I6UA 3LQXA 1NW3A 2KEIA 1ADRA 2LYQA 1RPEL 1HF0A 4IA8A 1ZZ9A 2AW6A 3EUSA 2PUGA 4JQDA 1ZZBA 2PIJA 3QWGA 1Y7YA 4MCXA 5JUWA 4YG7B 2O49A 2EBYA 1QP0A 1JH9A 2MEZA 3NROA 3TELA 1JWLA 2HCNA 3SR4A 2O4AA 3UWPA 4X4HA 3ZKCA 3KL4A 4IWRA 3BD1A 3A9YA 2LYJA 1OSLA 2LLVA 3QQ6A 1ZZCA 5K98B 3JXBC 2PUCA 4I6RA 4ER3A 4PU3C 5GAGi 1XWRA 4OBMA 3GZCA 1IC8A 2CSFA 2AUWA 1Y9QA 1X57A 2WIUB 1ZZ6A 5DSXA 3GZDC 4IVZA 3TRBA 4I8TA 1VPWA 1NEQA 1JFTA 4NDWA 2O38A 1S7EA 3ZHIA 2HCSA 5DTMA 4HRAA 2GRMA 2PXTA 3PXPA 3GN5B 2PXVA 1ZUGA 3RZZA 1ZVVA 3SCFA 2ICPA 3NXHA 2ODRD 3OWQA 4Z5CA 2XSDC 3OQNA 1QP7A 2AWIA 3S8QA 2MQKA 1SQ8A 4GHJA 2PXPA 2J7UA 3L1PA 2PUDA 1B0NA 1PRUA 3GN5A 2LNMA 3ZPXA 4ER5A 4ER6A 4Y42A 2R1JL 2LYLA 3JXDL 2XXAA 3GUUA 2PXLA 5DRTA 4GQMA 3OQOA 2FFHA 1WH6A 1UTXA 4YG1A 2AXVA 1ZZ7A 1UXDA 3ZHMA 2YBDA 2IUOA 2LYSA 2PXBA 1PERL 2L1PA 3FMYA 3CECA 2FJRA 3LISA 3OMTA 1ZZ8A 2MXDA 3VK0A 2PXQA 2KZ8A 2HSGA 1AU7A 2OR1L 2PUBA 3KZ3A 1HQ1A 1RZRD 1DWKA 3QFIA 4Z59A 1E3OC 4X4FA 4Z5HA 3TEPA 3A9XA 3G7DA 4JCXA 1LCCA 4X4GA 2LYKA 2KEKA 4Z58A 3PE5A 4YG4A 2KPJA 2BNNA 4F8DA 4EQZA 1QZXA 3TFLA 2IV1A 2PXUA 2PXKA 3M9LA 1WETA 1CQTA 4PU7A 1O4XA 2XJ3A 1LLIA 2WUSR 4JCYA 3OKZA 4PU8A 3MEJA 4EK9A 3SCHA 2PPXA 1JFSA 4X4BA 3F51A 3NDBB 4ER7A 1ZS4A 1MFQC 2J7WA 3O9XA 4X4DA 1BDIA 4OB4A 3F6WA 1QP4A 2PUEA 1WIZA 3FYAA 2PUAA 3QOXA 3KXAA 3HZIB 1GT0C 2LYRA 2D5VA 3OQMA 1LQCA 2LYPA 3D1NI 5DT2A 2PE5A 1QQAA 2XIUA 4PU4C 1DW9A 2BNOA 2ICTA 3DNVB 1ZPQA 2KEJA 1X2LA 1L1MA 1QB2A 2LCVA 3BDNA 3NZLA 4I6TA 3SCGA 1POUA 2XXQA 1NERA 1DULA 4Q2JA 3KJXA 4J1WA 3A9ZA 4DE8A 2BNMA 4FBIA 2HFZA 4J1XA 1RZRA 2IU7A 1ZAYA 3GBFA 4EZIA 3G5GA 4EKIA 2GRLA 3LFPA 4YARA 2A6CA 4Z5DA 1UXCA 3MLFA 2EWTA 2CROA 5GAHi 2R63A 4DE9A 3B7HA
chains in the Genus database with same CATH topology
3RZZA 1PRAA 2JVLA 1ZVVA 3SCFA 2IVQA 1CQTA 4PU7A 2ICPA 1O4XA 3H5TA 2XJ3A 1LLIA 2WUSR 4Z5CA 1YSEA 2XSDC 4JCYA 1R69A 4PU8A 2IVBA 4I6UA 3OQNA 1PNRA 2AWIA 1QP7A 2L8NA 3S8QA 2MQKA 3SCHA 1LCDA 1SQ8A 4GHJA 2KEIA 1QPZA 1ADRA 2PPXA 1JFSA 1OCTC 2PUDA 3L1PA 1B0NA 1PRUA 4X4BA 2LYQA 3F51A 1RPEL 2XI8A 3GN5A 1HF0A 5A7LA 4IA8A 1ZS4A 3CLCA 1PRVA 1ZZ9A 3R1FA 2H8RA 2AW6A 2IVGA 4Y42A 2R1JL 1BDHA 3EUSA 3O9XA 1LMB3 2PUGA 2LYLA 4X4DA 1BDIA 4OB4A 2AXZA 3JXDL 3F6WA 3IVPA 1QP4A 2PUEA 1QQBA 4JQDA 1WIZA 1ZZBA 2PIJA 3FYAA 3QWGA 2BJCA 1Y7YA 4MCXA 2PUAA 4YG7B 2O49A 4YBAA 2JCGA 3KXAA 3HZIB 2EBYA 1GT0C 4GQMA 1QP0A 2AXUA 4FN3A 1JH9A 2LYRA 2MEZA 2D5VA 3OQOA 3OQMA 2EF8A 1WH6A 3JXCL 1LQCA 1JWLA 1UTXA 2O4AA 4YG1A 2AXVA 1ZZ7A 2LYPA 1UXDA 4X4HA 3ZHMA 3D1NI 2PE5A 1QQAA 2IUOA 2XIUA 2LYSA 3ZKCA 3QF3A 4PU4C 1PERL 1DW9A 2BNOA 3CROL 3FMYA 4IWRA 2ICTA 3CECA 1ZPQA 3DNVB 2KEJA 2HINA 3BD1A 2FJRA 1X2LA 3FYMA 4X4IA 3LISA 1L1MA 3OMTA 2LYJA 1ZZ8A 3QQ6A 4O8BA 1ZZCA 3OP9A 5K98B 1OSLA 3VK0A 3JXBC 2LCVA 3BDNA 4MCTA 4I6TA 3SCGA 4I6RA 2PUCA 1POUA 2XCJA 1NERA 1WH8A 4PU3C 2KZ8A 2HSGA 1AU7A 2OR1L 1XWRA 3KJXA 4J1WA 1CJGA 3U3WA 1IC8A 2CSFA 2PUBA 3KZ3A 3BS3A 2AUWA 1RZRD 1DWKA 1RZSA 2BNMA 4FBIA 4J1XA 1RZRA 1Y9QA 1X57A 2WIUB 1ZZ6A 2IU7A 4Z59A 3GBFA 4X4FA 1E3OC 1R63A 1ZAYA 3G5GA 4Z5HA 4IVZA 3TRBA 4I8TA 3F52A 3G7DA 4X4EA 4JCXA 1VPWA 1NEQA 1JFTA 4NDWA 1EFAA 2GRLA 1LCCA 4X4GA 3UFDA 2LYKA 3LFPA 2O38A 1S7EA 4YARA 2KEKA 2A6CA 2B5AA 3ZHIA 4Z58A 4Z5DA 4YG4A 1UXCA 2GRMA 2KPJA 2BNNA 3MLFA 2EWTA 4F8DA 2CROA 2PUFA 4X4CA 2R63A 3PXPA 2IV1A 2L49A 3GN5B 2OFYA 3QYXA 1WETA 1ZUGA 1RIOA 2GZUA 3B7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZZ A;  1PRA A;  2JVL A;  1ZVV A;  3SCF A;  2IVQ A;  1CQT A;  4PU7 A;  2ICP A;  1O4X A;  3H5T A;  2XJ3 A;  1LLI A;  2WUS R;  4Z5C A;  1YSE A;  2XSD C;  4JCY A;  1R69 A;  4PU8 A;  2IVB A;  4I6U A;  3OQN A;  1PNR A;  2AWI A;  1QP7 A;  2L8N A;  3S8Q A;  2MQK A;  3SCH A;  1LCD A;  1SQ8 A;  4GHJ A;  2KEI A;  1QPZ A;  1ADR A;  2PPX A;  1JFS A;  1OCT C;  2PUD A;  3L1P A;  1B0N A;  1PRU A;  4X4B A;  2LYQ A;  3F51 A;  1RPE L;  2XI8 A;  3GN5 A;  1HF0 A;  5A7L A;  4IA8 A;  1ZS4 A;  3CLC A;  1PRV A;  1ZZ9 A;  3R1F A;  2H8R A;  2AW6 A;  2IVG A;  4Y42 A;  2R1J L;  1BDH A;  3EUS A;  3O9X A;  1LMB 3;  2PUG A;  2LYL A;  4X4D A;  1BDI A;  4OB4 A;  2AXZ A;  3JXD L;  3F6W A;  3IVP A;  1QP4 A;  2PUE A;  1QQB A;  4JQD A;  1WIZ A;  1ZZB A;  2PIJ A;  3FYA A;  3QWG A;  2BJC A;  1Y7Y A;  4MCX A;  2PUA A;  4YG7 B;  2O49 A;  4YBA A;  2JCG A;  3KXA A;  3HZI B;  2EBY A;  1GT0 C;  4GQM A;  1QP0 A;  2AXU A;  4FN3 A;  1JH9 A;  2LYR A;  2MEZ A;  2D5V A;  3OQO A;  3OQM A;  2EF8 A;  1WH6 A;  3JXC L;  1LQC A;  1JWL A;  1UTX A;  2O4A A;  4YG1 A;  2AXV A;  1ZZ7 A;  2LYP A;  1UXD A;  4X4H A;  3ZHM A;  3D1N I;  2PE5 A;  1QQA A;  2IUO A;  2XIU A;  2LYS A;  3ZKC A;  3QF3 A;  4PU4 C;  1PER L;  1DW9 A;  2BNO A;  3CRO L;  3FMY A;  4IWR A;  2ICT A;  3CEC A;  1ZPQ A;  3DNV B;  2KEJ A;  2HIN A;  3BD1 A;  2FJR A;  1X2L A;  3FYM A;  4X4I A;  3LIS A;  1L1M A;  3OMT A;  2LYJ A;  1ZZ8 A;  3QQ6 A;  4O8B A;  1ZZC A;  3OP9 A;  5K98 B;  1OSL A;  3VK0 A;  3JXB C;  2LCV A;  3BDN A;  4MCT A;  4I6T A;  3SCG A;  4I6R A;  2PUC A;  1POU A;  2XCJ A;  1NER A;  1WH8 A;  4PU3 C;  2KZ8 A;  2HSG A;  1AU7 A;  2OR1 L;  1XWR A;  3KJX A;  4J1W A;  1CJG A;  3U3W A;  1IC8 A;  2CSF A;  2PUB A;  3KZ3 A;  3BS3 A;  2AUW A;  1RZR D;  1DWK A;  1RZS A;  2BNM A;  4FBI A;  4J1X A;  1RZR A;  1Y9Q A;  1X57 A;  2WIU B;  1ZZ6 A;  2IU7 A;  4Z59 A;  3GBF A;  4X4F A;  1E3O C;  1R63 A;  1ZAY A;  3G5G A;  4Z5H A;  4IVZ A;  3TRB A;  4I8T A;  3F52 A;  3G7D A;  4X4E A;  4JCX A;  1VPW A;  1NEQ A;  1JFT A;  4NDW A;  1EFA A;  2GRL A;  1LCC A;  4X4G A;  3UFD A;  2LYK A;  3LFP A;  2O38 A;  1S7E A;  4YAR A;  2KEK A;  2A6C A;  2B5A A;  3ZHI A;  4Z58 A;  4Z5D A;  4YG4 A;  1UXC A;  2GRM A;  2KPJ A;  2BNN A;  3MLF A;  2EWT A;  4F8D A;  2CRO A;  2PUF A;  4X4C A;  2R63 A;  3PXP A;  2IV1 A;  2L49 A;  3GN5 B;  2OFY A;  3QYX A;  1WET A;  1ZUG A;  1RIO A;  2GZU A;  3B7H A; 
#chains in the Genus database with same CATH topology
 2JVL A;  3VWS A;  3H5T A;  1YSE A;  3QOW A;  1PNR A;  2IVB A;  2L8N A;  1QPZ A;  1LCD A;  3G0T A;  1OCT C;  5DTQ A;  2XI8 A;  5A7L A;  3CLC A;  1PRV A;  3R1F A;  4EKG A;  2H8R A;  2IVG A;  1BDH A;  1LMB 3;  4WVL A;  2AXZ A;  3IVP A;  1QQB A;  2BJC A;  4YBA A;  2JCG A;  2PXE A;  2AXU A;  4FN3 A;  5DRY A;  2EF8 A;  3JXC L;  2VEO A;  3QF3 A;  2XXP A;  2V3C C;  3CRO L;  3GZD A;  2HIN A;  3FYM A;  3SX0 A;  4X4I A;  4O8B A;  3OP9 A;  4ER0 A;  4MCT A;  2XCJ A;  1WH8 A;  1CJG A;  3U3W A;  3BS3 A;  1RZS A;  3ME5 A;  5DTR A;  1R63 A;  3F52 A;  2LLW A;  4X4E A;  3R09 A;  1EFA A;  3UFD A;  2PXD A;  2B5A A;  2PUF A;  4X4C A;  3DM5 A;  1U2Z A;  2L49 A;  2M4H A;  2JQE A;  2OFY A;  3QYX A;  2PXF A;  1RIO A;  2GZU A;  1PRA A;  2IVQ A;  1R69 A;  4I6U A;  3LQX A;  1NW3 A;  2KEI A;  1ADR A;  2LYQ A;  1RPE L;  1HF0 A;  4IA8 A;  1ZZ9 A;  2AW6 A;  3EUS A;  2PUG A;  4JQD A;  1ZZB A;  2PIJ A;  3QWG A;  1Y7Y A;  4MCX A;  5JUW A;  4YG7 B;  2O49 A;  2EBY A;  1QP0 A;  1JH9 A;  2MEZ A;  3NRO A;  3TEL A;  1JWL A;  2HCN A;  3SR4 A;  2O4A A;  3UWP A;  4X4H A;  3ZKC A;  3KL4 A;  4IWR A;  3BD1 A;  3A9Y A;  2LYJ A;  1OSL A;  2LLV A;  3QQ6 A;  1ZZC A;  5K98 B;  3JXB C;  2PUC A;  4I6R A;  4ER3 A;  4PU3 C;  5GAG i;  1XWR A;  4OBM A;  3GZC A;  1IC8 A;  2CSF A;  2AUW A;  1Y9Q A;  1X57 A;  2WIU B;  1ZZ6 A;  5DSX A;  3GZD C;  4IVZ A;  3TRB A;  4I8T A;  1VPW A;  1NEQ A;  1JFT A;  4NDW A;  2O38 A;  1S7E A;  3ZHI A;  2HCS A;  5DTM A;  4HRA A;  2GRM A;  2PXT A;  3PXP A;  3GN5 B;  2PXV A;  1ZUG A;  3RZZ A;  1ZVV A;  3SCF A;  2ICP A;  3NXH A;  2ODR D;  3OWQ A;  4Z5C A;  2XSD C;  3OQN A;  1QP7 A;  2AWI A;  3S8Q A;  2MQK A;  1SQ8 A;  4GHJ A;  2PXP A;  2J7U A;  3L1P A;  2PUD A;  1B0N A;  1PRU A;  3GN5 A;  2LNM A;  3ZPX A;  4ER5 A;  4ER6 A;  4Y42 A;  2R1J L;  2LYL A;  3JXD L;  2XXA A;  3GUU A;  2PXL A;  5DRT A;  4GQM A;  3OQO A;  2FFH A;  1WH6 A;  1UTX A;  4YG1 A;  2AXV A;  1ZZ7 A;  1UXD A;  3ZHM A;  2YBD A;  2IUO A;  2LYS A;  2PXB A;  1PER L;  2L1P A;  3FMY A;  3CEC A;  2FJR A;  3LIS A;  3OMT A;  1ZZ8 A;  2MXD A;  3VK0 A;  2PXQ A;  2KZ8 A;  2HSG A;  1AU7 A;  2OR1 L;  2PUB A;  3KZ3 A;  1HQ1 A;  1RZR D;  1DWK A;  3QFI A;  4Z59 A;  1E3O C;  4X4F A;  4Z5H A;  3TEP A;  3A9X A;  3G7D A;  4JCX A;  1LCC A;  4X4G A;  2LYK A;  2KEK A;  4Z58 A;  3PE5 A;  4YG4 A;  2KPJ A;  2BNN A;  4F8D A;  4EQZ A;  1QZX A;  3TFL A;  2IV1 A;  2PXU A;  2PXK A;  3M9L A;  1WET A;  1CQT A;  4PU7 A;  1O4X A;  2XJ3 A;  1LLI A;  2WUS R;  4JCY A;  3OKZ A;  4PU8 A;  3MEJ A;  4EK9 A;  3SCH A;  2PPX A;  1JFS A;  4X4B A;  3F51 A;  3NDB B;  4ER7 A;  1ZS4 A;  1MFQ C;  2J7W A;  3O9X A;  4X4D A;  1BDI A;  4OB4 A;  3F6W A;  1QP4 A;  2PUE A;  1WIZ A;  3FYA A;  2PUA A;  3QOX A;  3KXA A;  3HZI B;  1GT0 C;  2LYR A;  2D5V A;  3OQM A;  1LQC A;  2LYP A;  3D1N I;  5DT2 A;  2PE5 A;  1QQA A;  2XIU A;  4PU4 C;  1DW9 A;  2BNO A;  2ICT A;  3DNV B;  1ZPQ A;  2KEJ A;  1X2L A;  1L1M A;  1QB2 A;  2LCV A;  3BDN A;  3NZL A;  4I6T A;  3SCG A;  1POU A;  2XXQ A;  1NER A;  1DUL A;  4Q2J A;  3KJX A;  4J1W A;  3A9Z A;  4DE8 A;  2BNM A;  4FBI A;  2HFZ A;  4J1X A;  1RZR A;  2IU7 A;  1ZAY A;  3GBF A;  4EZI A;  3G5G A;  4EKI A;  2GRL A;  3LFP A;  4YAR A;  2A6C A;  4Z5D A;  1UXC A;  3MLF A;  2EWT A;  2CRO A;  5GAH i;  2R63 A;  4DE9 A;  3B7H A; 
#chains in the Genus database with same CATH homology
 3RZZ A;  1PRA A;  2JVL A;  1ZVV A;  3SCF A;  2IVQ A;  1CQT A;  4PU7 A;  2ICP A;  1O4X A;  3H5T A;  2XJ3 A;  1LLI A;  2WUS R;  4Z5C A;  1YSE A;  2XSD C;  4JCY A;  1R69 A;  4PU8 A;  2IVB A;  4I6U A;  3OQN A;  1PNR A;  2AWI A;  1QP7 A;  2L8N A;  3S8Q A;  2MQK A;  3SCH A;  1LCD A;  1SQ8 A;  4GHJ A;  2KEI A;  1QPZ A;  1ADR A;  2PPX A;  1JFS A;  1OCT C;  2PUD A;  3L1P A;  1B0N A;  1PRU A;  4X4B A;  2LYQ A;  3F51 A;  1RPE L;  2XI8 A;  3GN5 A;  1HF0 A;  5A7L A;  4IA8 A;  1ZS4 A;  3CLC A;  1PRV A;  1ZZ9 A;  3R1F A;  2H8R A;  2AW6 A;  2IVG A;  4Y42 A;  2R1J L;  1BDH A;  3EUS A;  3O9X A;  1LMB 3;  2PUG A;  2LYL A;  4X4D A;  1BDI A;  4OB4 A;  2AXZ A;  3JXD L;  3F6W A;  3IVP A;  1QP4 A;  2PUE A;  1QQB A;  4JQD A;  1WIZ A;  1ZZB A;  2PIJ A;  3FYA A;  3QWG A;  2BJC A;  1Y7Y A;  4MCX A;  2PUA A;  4YG7 B;  2O49 A;  4YBA A;  2JCG A;  3KXA A;  3HZI B;  2EBY A;  1GT0 C;  4GQM A;  1QP0 A;  2AXU A;  4FN3 A;  1JH9 A;  2LYR A;  2MEZ A;  2D5V A;  3OQO A;  3OQM A;  2EF8 A;  1WH6 A;  3JXC L;  1LQC A;  1JWL A;  1UTX A;  2O4A A;  4YG1 A;  2AXV A;  1ZZ7 A;  2LYP A;  1UXD A;  4X4H A;  3ZHM A;  3D1N I;  2PE5 A;  1QQA A;  2IUO A;  2XIU A;  2LYS A;  3ZKC A;  3QF3 A;  4PU4 C;  1PER L;  1DW9 A;  2BNO A;  3CRO L;  3FMY A;  4IWR A;  2ICT A;  3CEC A;  1ZPQ A;  3DNV B;  2KEJ A;  2HIN A;  3BD1 A;  2FJR A;  1X2L A;  3FYM A;  4X4I A;  3LIS A;  1L1M A;  3OMT A;  2LYJ A;  1ZZ8 A;  3QQ6 A;  4O8B A;  1ZZC A;  3OP9 A;  5K98 B;  1OSL A;  3VK0 A;  3JXB C;  2LCV A;  3BDN A;  4MCT A;  4I6T A;  3SCG A;  4I6R A;  2PUC A;  1POU A;  2XCJ A;  1NER A;  1WH8 A;  4PU3 C;  2KZ8 A;  2HSG A;  1AU7 A;  2OR1 L;  1XWR A;  3KJX A;  4J1W A;  1CJG A;  3U3W A;  1IC8 A;  2CSF A;  2PUB A;  3KZ3 A;  3BS3 A;  2AUW A;  1RZR D;  1DWK A;  1RZS A;  2BNM A;  4FBI A;  4J1X A;  1RZR A;  1Y9Q A;  1X57 A;  2WIU B;  1ZZ6 A;  2IU7 A;  4Z59 A;  3GBF A;  4X4F A;  1E3O C;  1R63 A;  1ZAY A;  3G5G A;  4Z5H A;  4IVZ A;  3TRB A;  4I8T A;  3F52 A;  3G7D A;  4X4E A;  4JCX A;  1VPW A;  1NEQ A;  1JFT A;  4NDW A;  1EFA A;  2GRL A;  1LCC A;  4X4G A;  3UFD A;  2LYK A;  3LFP A;  2O38 A;  1S7E A;  4YAR A;  2KEK A;  2A6C A;  2B5A A;  3ZHI A;  4Z58 A;  4Z5D A;  4YG4 A;  1UXC A;  2GRM A;  2KPJ A;  2BNN A;  3MLF A;  2EWT A;  4F8D A;  2CRO A;  2PUF A;  4X4C A;  2R63 A;  3PXP A;  2IV1 A;  2L49 A;  3GN5 B;  2OFY A;  3QYX A;  1WET A;  1ZUG A;  1RIO A;  2GZU A;  3B7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...