2OG1A

Crystal structure of bphd, a c-c hydrolase from burkholderia xenovorans lb400
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
285
structure length
285
Chain Sequence
TALTESSTSKFVKINEKGFSDFNIHYNEAGNGETVIMLHGGGPGAGGWSNYYRNVGPFVDAGYRVILKDSPGFNKSDAVVMDEQRGLVNARAVKGLMDALDIDRAHLVGNSMGGATALNFALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFKLYAEPSYETLKQMLQVFLYDQSLITEELLQGRWEAIQRQPEHLKNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFVPLDHGLKLLWNIDDARLHVFSKCGHWAQWEHADEFNRLVIDFLRHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and structural insight into the mechanism of BphD, a C-C bond hydrolase from the biphenyl degradation pathway
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Hydrolase
molecule keywords 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
total genus 107
structure length 285
sequence length 285
chains with identical sequence B
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2007-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2og1A00
4C6HA 5JIBA 3WWCA 4AN1A 3H2KA 2IX9A 4H0CA 4Z49A 3G0CA 2WFLB 3O4HA 1HDEA 3FCYA 3WA6A 3FLBA 3DDUA 3I2FA 4P93A 5AKLA 3K2IA 1OXMA 4A16A 1WPRA 3H19A 5HQ3B 1O6GA 4J0CA 4NVRA 3STXA 2Q0XA 4UHCA 1T2NA 1H2YA 4EY5A 2PKYX 2WIKA 4UFNA 3HXKA 3LIIA 4KE8A 5ALUA 5FPQA 4BDTA 4I19A 3DKRA 4H7JA 1YB7A 2OAGA 3V48A 4W1QA 4WFIA 5A7FA 3ESCA 1DQYA 3W2TA 5ALGA 5AJHA 1L7QA 4QE3A 4XWGA 2WHPB 4YX9A 4ARAA 4HXEB 2VA9A 4EY6A 2C7BA 4AMYA 5A71A 4DYHA 4JNCA 5ALRA 1K6EA 2XMCA 4AQDA 5E4YA 3EQ7A 3D7RA 1QIEA 5ALOA 3S2ZA 2AXEA 3HEAA 1QJ4A 3PDCA 5KWJA 3FLAA 4G9EA 3C5VA 2ACKA 5IVHA 3NWOA 5HF5A 1CUZA 1EDDA 3R3VA 3U1TA 4HRXA 2HADA 2R8BA 2HRQA 4UPDA 3DCNA 4C4XA 3AZOA 3I6ZA 3FYUB 3CCBA 2XUPA 1AKNA 4NZZA 3WJ1A 2EDAA 3DOHA 1Z68A 4QNNA 1YA8A 4H7IA 1XZLA 3O0DA 4I3FA 2HA2A 1CUUA 4AX4A 3YASA 3BIXA 3E0XA 2Y6UA 2WJ3A 1WB6A 5AI0A 2J4FA 1ORVA 2O2GA 5D3KA 5T4FA 4FWBA 4FLFA 5DJ5A 4DMHA 1UOPA 3G9UA 1BCSA 3H0CA 4RE6A 5JZBA 5HF8A 3DLTA 2DQYA 1FFAA 4X97A 2XQGA 5LZ2A 3AIKA 3BF8A 7YASA 4H7FA 1IMJA 3LP5A 1C7JA 2BFNA 5CBKA 1K4YA 3K6KA 4C87A 4QLOA 1R9MA 2XUQA 5T4EA 4F0JA 4EB0A 4BE4A 5HK9A 5ALMA 1MN6A 1ZIXA 2XB6A 3RM3A 3DD5A 5HFAA 3B5EA 1MTZA 1QOZA 2XUFA 3C8HA 5LKRA 1YS2X 5JAHA 3D5EA 1R9NA 2Z3WA 4J0JA 1QIDA 1UOOA 2WG2A 1B41A 1UK9A 1G4HA 1EX9A 4RNCA 3A2NA 1W4LA 1TKRA 3N0TA 4G9GA 1FFDA 4DTCA 5JYCA 1JJBA 2G63A 5DTJA 5DYWA 2WHQA 3OURA 4X95A 4U2GA 5CTAA 5D3ZA 2OCGA 1QTRA 3L1JA 5AKZA 1XRPA 1ODCA 3WL8A 3TGLA 3S8YA 2X5XA 2JBWA 1AC5A 5T4HA 3QZUA 3OTQA 1CFJA 3JW8A 3WIOA 2XMRA 3WWEA 3R40A 4MQMA 4QDTA 4C4YA 1H2WA 1SCIA 2V9ZA 1LZLA 1XZFA 4Y2VA 2XUGA 3CN7A 1J2EA 5LP1A 5A6VA 1WM1A 1JU4A 1YCDA 5D7BA 2PVSA 4H7EA 3F9CA 5KWIA 3R0VA 1XRRA 1L7RA 1XQXA 1C7IA 1XZGA 1UOQA 1ETHA 3AIOA 3DL4A 6YASA 4J03A 4Q3KA 4X7BA 4X3CA 2ZJ7A 4PO3X 2OQIA 3GROA 2G4LA 1W52X 3VISA 2DHCA 4WJLA 2VJAA 1E8MA 1WB5A 4OB8A 3NUZA 1J07A 5ALEA 3FCXA 2XQIA 1CUCA 3G0BA 5AKGA 2HIHA 3WKAA 4MWSA 3HI4A 2AJLI 4ROTA 1CUHA 2I3ZA 5T4BA 1DTEA 4OU5A 3GA7A 3IIIA 4YK7A 5CT6A 4XVCA 3F98A 4V2IA 3BXPA 4Q34A 1XRQA 1CRLA 3D2AA 4GBGA 2O2IA 1ZD5A 5AKYA 3IURA 1TCAA 3R41A 1UKAA 3JYHA 3I6YA 3WJ2A 1LGYA 4WFKA 5FP0A 2OQVA 3ICWA 5C8VA 2B9VA 2HA4A 2E3JA 3STYA 4S0XA 1BS9A 1X70A 4QWMA 4I4CA 1I6WA 3O4JA 3SWWA 5AICA 3R3YA 5EFZA 4JEIA 1R50A 3WQHA 5CH3A 2PU7A 1DX6A 2WIGA 3QMMA 4Q3LA 1VA4A 2GBFA 5I8PA 4B9AA 5CT5A 1AX9A 4RE5A 2XUAA 3R3UA 3L1HA 5IKXA 3ESDA 1E5TA 1VKHA 3WWOA 3QMVA 1QLWA 4MEAA 4UBKA 4BE9A 5ALLA 4JH0A 3V1MA 4J0IA 2ZJFA 5FRDA 4EY8A 4KAFA 2ORYA 3W9UA 1ODSA 5AK4A 4OB6A 1QIJA 4DGQA 4UUQA 4FLEA 5C8XA 4Q05A 1XLUA 3I2JA 2YXPX 4C89A 1TAHA 3F96A 3G0IA 2ZYHA 4RPCA 1QO7A 3EQ9A 2XLCA 2XQJA 3O9VA 5CT4A 3M83A 1XZKA 5FV4A 4CFSA 1XLVA 5LIPA 4PQEA 3A2LA 3IBTA 1YR2A 3AZPA 2WSLA 2H7YA 4W1PA 3WK6A 5CT8A 1ZGCA 4B6GA 1E3QA 2IIVA 5ALQA 3VKFA 3LIPA 4GDMA 4LXHA 2OGTA 2FJPA 1CQZA 1XZEA 3PE6A 4PSUA 4IO0A 4N5IX 3NGMA 1JI3A 1U2EA 2OXEA 3FBWA 2XMGA 4TVKA 4KAAA 1ZIYA 2XUJA 1ISPA 3I2IA 1SCKA 4PNZA 1JMYA 1YAHA 2J4CA 4Y2QA 2QUBA 4N8DA 2O7VA 1E8DA 3O4GA 3A6ZA 2NW6A 4MEBA 2QXTA 1BE0A 1JJIA 3IUQA 3C70A 4FBMA 4H7KA 5AK3A 3H2IA 3A70A 3DYIA 4KAJA 3FYUA 4X90A 2OGZA 4FNMA 5JD6A 2B20A 4EA6A 4ZREA 3M82A 1W75A 2PSEA 2OPHA 1ZD2P 4QDOA 1EHYA 5ALDA 3CN9A 1LPOA 5ALIA 3BF7A 1WPXA 5CMLA 4BCBA 1A7UA 1HQDA 3WL5A 3K9BA 4FKBA 2QZPA 2C0QA 3R3XA 5ALZA 2HU7A 2JGJA 4H35A 2Z5GA 1CEXA 1AQLA 4QEKA 1XROA 1T4MA 3E4DA 2EDCA 1UK7A 3PFBA 3ZI7A 5KREA 3BE8A 4G4GA 5CXXA 4QZVA 5DYYA 4W63A 3WYNA 1YA4A 3GFFA 1U4NA 3ANSA 4UHFA 1W76A 3R3WA 4OUKX 4N8SA 1JFRA 4GEGA 3W9BA 2DCMA 5A7GA 1E8NA 2BAGA 4E14A 3WYDA 4HVTA 2ZYSA 2C58A 1YS1X 5DTIA 1OCEA 1XQVA 4ZWNA 1Q0RA 5K3AA 2Z8ZA 4DMFA 2QS9A 1A8SA 2CJPA 1XRMA 4KRYA 4LXIA 4Y2JA 3C45A 1CPYA 1LZKA 3G8YA 1WOMA 5ALYA 5E4TA 1AMNA 4BAZA 1UZAA 5LKAA 4N8EA 1JKMA 3GBSA 1KU0A 1EK2A 5EHQA 2I3DA 4AB1A 5ALFA 2HA3A 1QZ3A 1XKTA 2DHDA 4BDSA 3G9XA 4UFOA 3IUJA 4PSCA 5EGNA 1CUAA 4BZWA 3PF9A 1MX1A 3PF8A 1EDEA 3VJKA 4BAGA 2DSNA 5CXUA 3ZWQA 2QRUA 1XRNA 2C5GA 5EIEA 5JZSA 4FDMA 4WY8A 3A2MA 2QT9A 1EI9A 4AZ0A 5CURA 4HZGA 4BC1A 1JJFA 2HHAA 4BP8A 1XZMA 1H2ZA 3FYTA 4UHHA 3ZLTA 2GYWA 2ZVDA 3VVLA 2WIFA 4BVLA 4H7DA 5AH0A 2PPLA 4IH4A 3NOXA 4PSDA 1EVEA 1BEZA 5IVDA 5LYYA 4L9AA 1CV2A 5HCUA 1H2XA 1IUNA 5HK8A 4H18A 4NMWA 2VJDA 3Q0TA 4B0PA 1ZI9A 2C0PA 1RYYA 1GPNA 1U65A 2O7RA 2HDWA 2VJCA 1VOTA 3KD2A 2WFLA 4ETWA 4E15A 2ONCA 4LHEA 2HA6A 4MWTA 4MJ3A 2JGEA 1GPKA 5EI5A 2H9YA 1TCBA 4X85A 5HZGA 1ODTC 4DNFA 4UBNA 1TRHA 5K5EA 1FSSA 5AOBA 4ZXFA 3W05A 2QMQA 2JIDA 2HU5A 3VXKA 3OPMA 5AM4A 1A8QA 3B3QA 1R1DA 4G8CA 3FSGD 1HL7A 1GGVA 3HYSA 2G5PA 2GZSA 1ZJ5A 4IH9A 4BZZA 2IITA 1P0QA 2OCKA 1QIGA 3I2GA 1VZ2A 2HM7A 2VATA 3WL7A 1LLFA 4BVJA 5DYTA 4Y2RA 2XMSA 1XZAA 3FSGA 4W9RA 3BIWA 1XZCA 1LBTA 2BJHA 3KDAA 2OG1A 2WG0A 4J0HA 1K8QA 4L72A 4F60A 2DR0A 5ALNA 5F4ZA 3FYUC 4Y2UA 5AIAA 2UZ0A 2RHWA 4WDRA 1SFRA 4K6GA 1EINA 4OYYA 2GBCA 1W1IA 1N1MA 4RGYA 5JD4A 2XUKA 4KYVA 2PSDA 1MJ5A 5AKJA 2WLSA 2YH2A 4K5QA 3EQ8A 3QITA 1DX4A 2AJCA 4E46A 4FMPA 1THTA 5HF9A 2WFZA 5AM3A 2WFMA 1DQZA 4U2DA 3MVEA 1NU6A 4F5ZA 5AIBA 5HF6A 1VE7A 4G8BA 5E4JA 2VJBA 5IVIA 4HTAA 3F8SA 2JGLA 2D5LA 1XZDA 5AI6A 2X8BA 2ZYIA 2H1IA 5EHXA 2WHPA 1LNSA 4LYDA 5JAOA 4UBIA 4M0MA 1SOMA 2AJDA 3W04A 2CMFA 4BYMA 5DNUA 1QIIA 4CIBA 2X76A 5AM1A 5EIHA 5AKKA 4EY7A 3H2GA 2JF0A 5K3EA 2WUGA 5JD5A 1FFEA 4K6KA 3ED1A 3FAKA 4FTWA 2PSHA 5AI8A 1F0PA 2PX6A 2XQFA 2PSFA 5ALJA 1AGYA 4EY4A 3AUKA 5D6OA 3BDVA 2HA7A 1CUGA 5YASA 5K3CA 1AZWA 4B7ZA 3G7NA 4AN0A 3H17A 1UKCA 4OD0A 4TGLA 3H04A 1P0PA 3QMWA 1J06A 3ZPXA 1FFBA 3STUA 3WKCA 4P92A 3X3HA 4Y9SA 4INZA 4KE6A 5AM0A 1Y37A 1P0MA 3WKEA 1BN7A 4G5XA 4K2AA 1GXSA 1SC9A 2GBGA 5LZ5A 4BBZA 4J3JA 3C5WP 4FFVA 4G1FA 5HKAA 4OCZA 5AM5A 2BGRA 2VEOA 2CKMA 2WU4A 4EBBA 4IHAA 4ZI5A 3WZLA 4AO7A 5HKBA 1XLWA 4KRXA 4DSZA 5AHXA 5CH8A 4KR0A 5JZ9A 5I7UA 3WZMA 3H1BA 2XQKA 3HRHA 1YASA 4LYEA 2WTNA 3TJMA 1CR6A 1PJAA 3WLAA 3D2BA 4KE9A 5BOVA 1MPXA 4DMCA 3FNBA 4CIAA 4G8DA 4EHBA 1QFMA 2EEPA 4CG1A 2WQZA 3QM1A 2V96A 4DNOA 3G9ZA 4OYLA 1FJ2A 1LPAB 2P8SA 3DJYA 2GYUA 4A5SA 1VJ5A 3I2HA 3E3AA 2H7XA 3AFIA 3I28A 5AO9A 3SC2A 4AMZA 1QIMA 4QDZA 1USWA 4W1SA 4PW0A 1XZIA 2WIJA 1QONA 3H1AA 1Y7IA 2QR5A 5AP9A 1DWOA 3V9AA 5FXMA 3MUOA 5IVKA 5JALA 1DT5A 4DNPA 2WUFA 4X94A 3GZJA 3LCRA 1Q83A 1WHSA 2WUEA 2JGFA 2WIDA 2XMBA 3KXPA 2GZRA 2I78A 1UK8A 1VE6A 5FKJA 5FPPA 2BKLA 1JU3A 4L3WA 3KWJA 1WCYA 3KOOA 3FVTA 1R3DA 3AILA 2XDWA 4UBJA 1CVLA 2K2QB 3T52A 3WA7A 3AZQA 4PF1A 3D3NA 1UKBA 5I9IA 1XFDA 3ZLVA 1F0NA 2Y1KA 5JASA 3N2ZB 1BCRA 3VJMA 2ACEA 2R11A 1KEZA 4B80A 5AKEA 4Y2TA 4WCVA 2QKYA 2HU8A 1PV1A 3WKBA 2VT7A 3C43A 3WK8A 4BAUA 5ALVA 4GI1A 5C7YA 1DU4A 1EA5A 1XQWA 4CCYB 1YAJA 3C6BA 4BCDA 3C87A 2ROQA 1GQSA 3DL7A 1S8OA 5AKXA 3PUIA 3QH4A 1DT3A 3UUFA 2V97A 3WK5A 2XLBA 1ZOIA 1IZ8A 2JGKA 3QBJA 3WI7A 3MUNA 2PL5A 2ZSIA 4P9NA 4FLMA 4K6HA 3D0KA 4IH1A 2PUHA 4UBLA 4KEAA 2XUOA 3B12A 1UK6A 1IVYA 1QFSA 4BRSA 2VAVA 1MT3A 4Q3OA 4A23A 2RI6A 3HSSA 1M33A 4FHZA 4CI9A 3I2KA 4X92A 4MQLA 4B81A 2ECFA 2JEZA 4G4JA 3QPDA 4G4IA 1H22A 4XJVA 2VAXA 4ZRDA 4J0GA 1FFCA 4XIIA 1X2EA 5JARA 5EIAA 2GBIA 1EDBA 2HFKA 2PSJA 3VDXA 4HS9A 3I1IA 3I1YA 4X6YA 1GZ7A 2CBGA 3BWXA 4MYDA 2WJ4A 4M0FA 1LBSA 3PI6A 3FWHA 4UBMA 1CUFA 2WM2A 1VLQA 1CUVA 1R88A 5AM2A 3DKKA 3R3ZA 2OAEA 1MNQA 1TCCA 1UWCA 1CIJA 1CUDA 1LPMA 3CCCA 1N8SA 4Q1VA 4KJXA 3QPAA 3UMJA 3ZLUA 1E66A 1MAAA 2CUTA 2BCEA 4N5HX 2OCLA 3E1GA 3JWEA 2QJWA 4X00A 5E2IA 4OU4A 2PUJA 3GELA 4U2FA 2OLEA 3EBLA 5LZ4A 1Y7HA 5CT9A 1QIKA 2Z8XA 4Y2YA 1TK3A 4DSAA 2CZQA 3RK4A 2XMDA 4DLNA 3F67A 1MNAA 4BTLA 4DM7A 4UHDA 1QIFA 1LPSA 5BWCA 2JGIA 5ESRA 5HQ3A 3CXUA 2HRRA 2B61A 3U0VA 4NS4A 4DIUA 5K3DA 1ACJA 4UFPA 1ZI8A 4ZGBA 2XUIA 1THGA 3TEJA 3OC0A 4U2CA 2HFJA 1EK1A 2VQ6A 4GLBA 3O4IA 3P2MA 5FOQA 1J1IA 4QWWA 2W6CX 5H3HA 2DQZA 1CLEA 3M81A 5AI4A 3F97A 1DINA 3AINA 2QVBA 1KU6A 5K3FA 1RWQA 5HFNA 1EVQA 2B4KA 1H23A 5EHZA 5AKIA 3QPCA 4Y2XA 5SYNA 3IA2A 5CH5A 1VXOA 2HL6A 1C4XA 1GT6A 5AK6A 1ZICA 3KSRA 3ILSA 2WU3A 2QTBA 1A88A 3IB3A 4UHEA 3WK7A 1G42A 4QDUA 3AJAA 4B85A 2V98A 4YASA 2JEYA 5ALSA 3D2CA 4X6XA 1IUPA 1N5MA 1LPBB 3PFCA 1Q84A 3BL8A 1LPNA 1XZHA 2Y2UA 3O95A 2XUDA 2G5TA 3D4LA 3IDAA 3FLEA 3LLCA 1CUJA 2Y6VA 2XMQA 1ZI6A 4B84A 4W1RA 2OGSA 1GKLA 1BU8A 3FOBA 3DYVA 1VZ3A 3IVMA 3PUHA 4H77A 3OM8A 3ESAA 3HC7A 4F21A 1YB6A 1DWQA 1JT2A 5KBYA 2WTMA 2BUAA 1UXOA 1F8UA 5BV7A 1JMKC 2AJ8A 4J0DA 3WK4A 1QE3A 3EF3A 3VVMA 4AO8A 5C81A 2BGNA 1OILA 4FOLA 1LPPA 1DWPA 2QOEA 2ZJ6A 3MGAA 2D0DA 1HPLA 3VJLA 4HAIA 2JGMA 1ZGBA 5FLKA 2I03A 4B82A 4JYMA 1EH5A 4GWLA 2RONA 1VXRA 5DLPA 5LZ9A 1N5RA 3GUUA 2HA0A 2VF2A 3RLIA 3RARA 3HJUA 2C5FA 1VA5A 1W6RA 3EIOA 3QVMA 2WHRA 2YYSA 1QTIA 3W06A 4OPMA 1A8UA 1EB9A 5AI9A 3WIBA 1L7AA 2PM8A 2GYVA 3HLKA 4J7AA 4U2EA 3BDIA 1BN6A 4CG2A 3DEAA 5ALTA 5A7HA 2DFPA 2RAUA 3IULA 3Q8WA 2C4HA 3G0GA 1GQRA 1CQWA 3STTA 5K3FB 4B9EA 3H18A 2ZSHA 4QLAA 3KWFA 3STVA 5FUMA 5JANA 5ALWA 4OSEA 1HLGA 4BP9A 4CG3A 2J3DA 4HXFB 2HA5A 1XKLA 4Q82A 4D9JA 3V1LA 4H7HA 2AJBA 4ITVA 1EXWA 1ZD4A 4ARBA 4KACA 1QGED 5ISMA 2PBLA 1B6GA 3OG9A 1ZD3A 1MU0A 2QUAA 4HXGA 2FUKA 3ICVA 3V1KA 4YPVA 2XE4A 1TIBA 5LZ7A 5AOCA 1TQHA 5ALKA 3HACA 5ALHA 1BEEA 3SK0A 1MX5A 1CUYA 5FDFA 5DNWA 1R4ZA 2RHTA 2Z3ZA 4QA9A 4GHWA 3QYJA 4CCYA 3G02A 3RKSA 2LIPA 1D07A 4Y2PA 4BRZA 4ZV9A 1SCQA 2W22A 1NU8A 4B0OA 1P0IA 2H7CA 3WWDA 1K63A 4BC0A 5IH7A 4JYPA 4JUIA 4WFJA 5DWDA 3H2HA 2XUHA 4GXNA 2WILA 4X93A 3G9TA 2XT0A 3ZV7A 4BVKA 4O08A 2BUBA 4AZ3A 4PV7A 3DS8A 3IUMA 3D59A 3HABA 5AOAA 2O2HA 4QDXA 4M0EA 3L1IA 4X91A 5AI5A 3C6YA 3DNMA 4WY5A 2WKWA 1BRTA 4ZV7A 1ORWA 4HRYA 2J3QA 1MO2A 4FNGA 1WHTA 1AURA 4J0KA 2BUCA 1HBJA 1E89A 1G66A 4BTVA 4Y7DA 5JAPA 1QIHA 3BJRA 4EUSA 1F6WA 5SYMA 4AO6A 1BROA 1XRLA 4U2BA 4GW3A 5AK5A 2Y2VA 2ES4A 3WWPA 5A62A 5CRIA 1MX9A 2CB9A 3DQZA 4WDQA 2PU5A 4OB7A 4LXGA 1ZJ4A 4XX1A 1CUXA 4CCWA 3STWA 3TRDA 3HZOA 4C4ZA 5ALPA 3AIMA 4B83A 5CW2A 5AKHA 3LS2A 4MXDA 2ZYRA 1IZ7A 1YSCA 4FFWA 3PICA 3UUEA 2VTVA 4X6UA 4C01A 5ALXA 4EZIA 1QO9A 5J3JA 4UHBA 1CUBA 4BB0A 4KE7A 4FBLA 2FX5A 4L0CA 4MYSA 3I6MA 4BATA 1ACLA 4AXBA 2QM0A 5JATA 1IUOA 1NX9A 3BJMA 4DNQA 4Y2SA 1XZJA 1CUEA 2RGUA 3ANTA 4TPKA 3WKDA 3M3DA 1MAHA 3FVRA 3IUNA 1U8EA 3C6ZA 4C88A 2OCIA 5LLSA 1UT6A 3H2JA 2QXUA 4UBOA 2DHEA 4LKOA 3ESBA 2YASA 1WB4A 2CEKA 2WUDA 5K3BA 4LIPD 2FJ0A 3C8DA 1X2BA 5JAUA 5LZ8A 1XZBA 4P08A 5JADA 1PFQA 1CUSA 1CUIA 2WJ6A 1UFOA 2VT6A 3T4UA 3SX4A 2XMZA 2VSQA 1XQYA 1RP1A 5C8ZA 1GPLA 3WK9A 3C6XA 5DNVA 1K5PA 1CUWA 2RIPA 1HKHA 2XI4A 4IQ4A 3WMRA 1O6FA 3DOIA 5EHNA 4X71A 4BCCA 3G0DA 3WL6A 1Q0ZA 4GECA 1EB8A 2QJRA 1GKKA 5BWBA 3V1NA 2WG1A 1AUOA 5A2GA 1G5FA 4DMKA 3OOSA 3O9MA 4E11A
chains in the Genus database with same CATH superfamily
3I61A 3CWCA 1TZ2A 3SX2A 1QQBA 2BTEA 1JVBA 3CV3A 4B3SB 3ZI4A 1L3CA 4REOA 3WWCA 4HNAB 1MA3A 2YCLA 1Q0UA 1C9KA 2OO3A 4AN1A 3H2KA 2GN1A 4O4HF 1NQTA 1OROA 1SUCA 4Z49A 2J85A 2R65A 1OWOA 2EP8A 4O4JF 3TQQA 1PX0A 1U2GA 4EABA 1UXHA 3AFOA 1X1AA 4HQNA 4I50A 1QGUA 3PRHA 3FCYA 5TR9A 4H0NA 1H5QA 1RI1A 1GL6A 2XZTA 3E9MA 3DDUA 3G2QA 3I2FA 4MHSA 4B73A 2BFCA 4JYZA 1SKYB 3K2IA 5HHTA 5JPCA 2JLUA 2CLFB 3I23A 3N7UA 3C97A 3OD5A 3DR5A 3ZE1B 2PJDA 4PZLA 3H4VA 3P1JA 3LPNA 4ZO9A 1JVNA 1X19A 2YUIA 2AKEA 4AI6A 2JJ1A 1RCFA 1SN7A 2BHSA 4KIFA 4X9XA 1DJQA 3ICPA 2Q3CA 4IDGA 4Y67A 1TMGE 3M4JA 2PBFA 1I8TA 4CLEA 1PBTA 2Q0QA 1XX6A 5JQGB 4NNPA 1KAMA 1KC1A 3MS2A 4H7JA 3FDZB 4NEGA 4LBWA 4AM8A 4LF9B 2JA1A 3OLQA 4AN4A 5JYDA 3W5HA 5L3SA 2COUA 4NQRA 3AR7A 4XLZA 3DV0A 2P4QA 3W2IA 1JDBB 5CA1A 4W1QA 5LM3A 3R8FA 3HXOA 1QU2A 4MO9A 3GLSA 3VZBA 4TMXA 1OLXB 5K4HA 3ESCA 3JARA 1UQUA 4G63A 1DQYA 2O8BA 3NTQA 1NJ2A 1BXKA 5T57A 1E0AA 2D0OB 2A0XA 1I0ZA 1JDSA 3LRXA 3PQ6A 5BQFA 1YBFA 4XWGA 3S5UA 4XIYA 1AE1A 1CD5A 2XYPA 5EJIA 2G9QA 1Z88A 3C3JA 5CVEA 2C7BA 4B87A 3EVFA 4QXMA 4DY6A 4ZOQI 3MGCA 2B7BA 2CJFA 3R20A 3R5FA 3IJEB 3BS4A 2VWPA 5A4IS 1K6EA 2XMCA 4PFQA 5E7IA 4O0MA 1TADA 3FYDA 2QTAA 5A0FA 1OREA 2FRXA 3TWOA 3D7RA 4AQDA 1QIEA 5E6RB 3N7TA 2R1TA 2WM8A 4Y9UA 1QZTA 1Y9JA 4B6JA 3L0PA 4Z5XA 4G23A 5BVGA 4YGYA 1ICEA 3AP2A 1EWRA 1FLAA 1DUSA 2XADA 3C5VA 3IUSA 4LWPA 3T7KA 1GCOA 3QVTA 5HF5A 1OXKB 2H17A 3T1TA 1SQGA 3R3VA 4JWTA 3U1TA 4JAVC 5KX5A 2EJCA 2HADA 4G26A 5HKLA 3EZ2A 4UPDA 1TUIA 1YQ9A 4C4XA 1R0WA 4XGKA 3VH4A 3W3AH 4TSFD 3B60A 4M7WA 1A97A 1DBWA 2GFIA 3AZOA 3C1AA 4KFSA 5DRYA 3I58A 5H81A 4YGXB 4Z4HA 4M9XA 2R9VA 2DWPA 1E2LA 3KUDA 1C30A 1PSDA 3VX3A 3K92A 4CPDA 2HNKA 1JP7A 1ZHHA 1NPTO 4GOMD 2WD9A 2EDAA 1NVVR 3F90A 4PVDA 4XYLA 5B7GA 4E5UA 2NUAB 4GLJA 3KUUA 1P73A 1PVVA 4I8IA 2RMKA 2HA2A 4UAGA 1A2BA 1KR5A 4G24A 1LI4A 1OF1A 3NOVA 4KVFA 3UF0A 4PXSA 4F3KA 3ND5A 4M36A 3NBMA 4NHEA 3CEJA 3OETA 2WEKA 5F5XA 3N8GA 3R7NA 2NZWA 4HGOA 3FPEA 1YZYA 1V47A 4NFHA 2Y0BA 1J21A 3MWKA 3OWHA 5IHPA 4TS1A 1MBZA 3HYLA 4OHCA 1BQ3A 1FMLA 3T61A 2JNWA 5JT1A 1C3VA 2I7CA 1W7AA 2VJKA 3EBPA 4MS3B 5IARA 4MRVA 1PR2A 3BGDA 1GCAA 3KM0A 4I3GA 3QG5A 4F2HA 5CDTA 3BSSA 1WKVA 1G6KA 1J0EA 1GZHB 1XRJA 3EOBI 3L93A 4JLNA 1Z7WA 2DWCA 5F2EA 3UYKA 3ZCUA 1HZJA 1E0DA 3UC5A 2X22A 2YFQA 3FDZA 2QBYA 4YMSA 1S2MA 3DPUA 3OPNA 4Q4CA 2XQGA 3HJBA 4YJHA 2AOUA 3AJDA 4COKA 4E6EA 3RVJA 5LXTA 1XNGA 3VVCA 3FNFA 1IB6A 3BF8A 1JHUA 1IMJA 2OCPA 5CVUA 3H8SA 3KSMA 3CRZA 5CBKA 3WMWA 4C87A 3COYA 4RJIA 5LB2A 4QLOA 4WXMA 3WIEA 1MG0A 4KNWA 3ZHOA 3V00A 3K0AA 1L5HB 1I7SB 3BWYA 1HG0A 2NTYC 4F71A 1I4EB 2P6RA 3O73A 1SCUB 2I3AA 3IH5A 2IKQA 1XA0A 5HA5A 4HDCA 4K03A 5ALMA 3DBRA 3GEGA 4YLYA 1SQFA 2W83A 1MQAA 1WBBA 4I5EA 1FU7A 3E05A 3JPYA 5ELMA 1RFGE 2QL7A 4KHPB 3NHJA 5JECA 3BFJA 1JZQA 3VR2A 3EH1A 4JUBA 4RCYA 4UU7A 5H0IA 3K16A 5DGIA 3VNSA 4CXMA 3C8HA 3DTYA 1SXQA 1E3SA 3HUUA 5DVZA 1PN3A 3BFVA 1JR6A 1R9NA 1G2OA 1QAQA 2YJNA 2ZRAA 1FTNA 3NJ4A 4B6RA 3GP8A 3ZNOA 3UMRA 1U99A 4ZT7A 3TL2A 5B7QA 2DYKA 1HSOA 3GUYA 2FP4B 1RPAA 4C2BA 1L5MA 1QIDA 1G7TA 1QGZA 2FZWA 3SX0A 1PR5A 5LNK1 5BQXA 3QTBA 5JRDS 3OIGA 1E2GA 1G4HA 1W4LA 1RSZA 4IXNA 5JNUA 3KPYA 1N6RA 3LGAA 3N0TA 4GVXA 3VYSB 4YHBA 3SXPA 4ZCTA 4EMBA 1H6BA 5AVVA 2Q50A 3OY7A 1ULUA 2M98A 5BR4A 4YYZA 2D2FA 5FD8A 2IE0A 2FWJA 3MTGA 3CNQS 3H97A 4DOMA 3E23A 4DMGA 1VG8A 4MW9A 4IZ6A 1XL1A 4M9RA 5B1IA 4EHNA 2WHQA 2J9YB 4NIMA 4OJMX 3V7FA 3OURA 3H6HA 3C14C 4LZLA 4ME6A 5D3ZA 4BNWA 4J4HA 6REQA 5L51A 3DDNA 2ILVA 4X7PA 2HI0A 2K87A 1P18A 3R7FA 4IMJB 4PZZA 1XRPA 4BJ1A 1ODCA 1L4KA 3HDYA 4GPAA 1DC8A 4F85A 3TUZC 2I4TA 3TGLA 3R0XA 3KKZA 3OKAA 2EYUA 4TKMA 121PA 2X5XA 2DR2A 3QTTA 2BJWA 2O14A 2WVGA 1Z38A 3B6MA 4GOKA 3PIRA 4PINA 4R31A 1KP2A 2PGOA 3FGOA 1QKJA 1NJFA 1W2HA 4BKUA 3LQFA 5T4HA 2P2CA 4KO8A 4NTZA 1BWPA 2VN8A 4KO3S 1C3XA 4Z4QA 2BM1A 2GN6A 5GIPE 4TRRA 3JW8A 1U0OC 2GN8A 4MQMA 3AM4A 4IIVA 4KU4A 3RFVA 1E2KA 5BOSB 1SCIA 1VJ0A 4GGPA 2HHLA 4LJ6A 2ZRPA 1M6WA 1U9YA 1P60A 1FS4A 1L1EA 1YHYA 1IPHA 1C9JA 2GH1A 2N46A 2PT9A 2WJAA 1RQLA 3ASYA 2OLKA 4PWYA 2AI1A 1JU4A 1EFPA 3L43A 4JA0A 2OYRA 1XL0A 3RU7A 4CRWB 2IH4A 1SOUA 2AG0A 4D79A 1EM6A 2PVSA 1A69A 4FFBB 5BVHA 1NBEA 4FD2A 3WRYA 2P0EA 4HWKA 2Y8EA 2X0EA 1YKGA 3LK7A 3ZU5A 2J87A 3W5DA 2CXTA 1E2JA 1T10A 2XYQA 1KSGA 4CF5A 4YV2A 5BNIA 3IESA 2VTBA 4DR6B 4C4OA 3FIUA 3G8DA 4I2VA 3R5TA 2QEQA 3KKQA 1ZFNA 1FRQA 2ZWOA 1HDXA 1TGYA 3D02A 4TXLA 4JI1B 1BMQA 1ETHA 5DX0A 5DE3A 1JILA 4J03A 2BMEA 1DC5A 1M34B 5E3IA 1H8HA 4P4UA 5TPZD 4IEIA 4X3CA 4EGJA 2XSZD 5LU9A 1E1CB 5JD3A 2R6DA 1V7PC 3T5DA 3TLYA 1L7XA 1XI2A 3KKNA 4DQXA 2YS7A 3P0RA 4FMDB 1GLGA 4G97A 2X0JA 1W5TA 2O9JA 4FZVA 1YDHA 1GPMA 1JEDA 3EDCA 4RFVA 4WJLA 2VJAA 3AEQB 2JLAA 4P31A 4Q7MB 1J07A 2NVOA 3KWLA 4KYUA 1X7WB 2CLMB 1D0IA 1JSXA 4HN2A 4PHGA 3RAJA 4DG9A 3BXZA 5ALEA 2BW0A 1CY4A 2GAIA 1CEEA 1B1AA 4FN5A 4PYRA 1Z45A 4GSKA 2O7QA 4HEQA 4JUFA 2XQIA 4DTIA 1A7AA 4TROA 2QVCA 3PFNA 3PKIA 2O2XA 5DW3A 2OZKA 4OQXA 3GP5A 4P84A 4O33A 4ZALA 2HW8A 4PM4A 1W1WA 2V55B 1IY9A 1U8CB 1ORDA 1QANA 1T4GA 3P0JA 3TXYA 3V8QA 4BFVA 3DHEA 3GARA 3OCXA 2H8KA 1JLLB 3L5KA 1CUHA 4FS3A 3BVPA 2E4YA 4RD0A 4ZOAA 5FUXA 2GPWA 3G0OA 4TVBA 1SQ0A 2R0QC 3LWZA 4M55A 2HT6A 1DTWB 1TOAA 4MB6A 4CVNA 1UC9A 1Z28A 3F98A 3DO6A 3KQVA 3SJUA 1GPH1 1QX3A 1ZRMA 2FV8A 3PS9A 1F5NA 4NYIQ 3EMVA 4FQ7A 5ELLA 4DIFA 6REQB 4V2IA 1XPRA 4Q34A 3K1JA 1JA1A 4DBZA 5ERXA 2QAGC 4CODB 2CCJA 4S1TA 2O2IA 2WWTA 1ZD5A 1ECJA 1JKJA 3Q87B 1FLVA 3HADA 1TCAA 2WZDA 4W5OA 2G1AA 1YUMA 3ELBA 1F9AA 3FPCA 2NZUG 1XELA 5KWEA 2JJ8A 1ZK0A 4HDKB 5BW4A 3HHEA 3UK6A 2WF8A 5JY6A 2ILTA 3BSWA 4KVZA 3KLNA 2QRNA 2G9NA 3ESQA 1QE0A 4CKBB 2I8AA 4TTSA 2L42A 1DC4A 1ADYA 1WU8A 2BLLA 1MVLA 2PX8A 3FRIA 4WMLA 1EHCA 2YIVX 3LUPA 4JQYA 2WD8A 2XDYA 1YDEA 3VR0A 2OKGA 2E3JA 3STYA 2P9HA 1LLDA 4M38A 3A6KA 4RMHA 3LXMA 4BPBA 2EKLA 5TMPA 1NP3A 2D5AA 4DZZA 1FNCA 1YK0A 4WINA 3X43A 4I4CA 4RK6A 4ZRNA 1I6WA 4QNRA 1UPXA 2KW5A 2Z1MA 3GW8A 2XNHA 2C9CA 5KS2A 3MT0A 2HLDA 5FPHA 2OGUA 2Z5LA 3V2GA 1P4GA 4DN6A 2HBQA 1YS4A 2GARA 4YUVA 1O1YA 3C8MA 4EAAA 5C5DA 2H18A 5GONB 3TCNA 4BFCA 3WQHA 2NSLA 2Q3MA 2DFLA 3C16C 3V7WA 4QEDA 3GXBA 3PC8A 4PTYA 2QIPA 5GJCA 1XMJA 3KL2A 3LHFA 1BG6A 4EARA 1S6YA 2WMYA 3GGDA 3GUCA 3EPJA 4KPGA 3GRCA 1OIXA 3IOBA 4B9AA 1H9CA 3U3OA 2DH5A 1AX9A 3BIJA 3FA2A 1C3LA 3MCAA 1PZGA 4RE5A 3BMNA 4RZQA 3AW8A 3D6TB 3V42A 2X3YA 2I1LA 2VYVD 3M4NA 1WXEA 3RREA 1Z4LA 3QU4A 3WWOA 1TK9A 4GL2A 3JATB 2ACWA 4WT7A 4EHFA 4C2TA 1O96B 4N48A 3T9FA 1ORHA 3D64A 4RJKA 4UBKA 4U4AA 2I6SA 4BJ6A 1WDTA 3DULA 3RYTC 3COZA 5CX1A 5DGXA 3GFVA 1EVKA 2IYRA 1W0JA 2AN1A 2C2WA 1PEAA 1P1BA 2V74B 4TXJA 5B1HA 1P2BA 1S4QA 3HSYA 4KQWA 1E59A 5REQA 3NEJA 2B83A 5FFMA 2GHTA 4I9HA 2NXJA 3E5NA 4EHHA 4GSLA 1LY1A 3QWFA 1JBQA 4YQEA 4DGQA 2Z1NA 1VJTA 2O8FA 4CEIB 5L7YA 2EARA 3M5CA 2YL2A 4O63O 4NZMA 1FS5A 1OKKA 4Q05A 4IOMA 4EJMA 2BFFB 3QMPA 4DXDA 1R15A 1KYWA 3BG5A 3TD6A 3GY0A 4XQ9A 3PPXA 3G0HA 3G0IA 1MQSA 1QZXA 2PZGA 1F51E 2DH6A 2Y27A 3DVSX 3UK0A 1LK5A 3JQBA 3IGFA 1U11A 3DE2X 4KXWA 3V3KA 3VAZA 3X1JA 4F8YA 3NYRA 2EL9A 1Y8AA 3IEPA 4YAKA 4IIXA 1NTOA 1OA0A 4POAA 3TIGA 4XFJA 3UXHA 2H16A 4EG1A 4TKUB 4L08A 3SEQA 3F2IA 2I34A 4FGJA 1M8PA 2FQ1A 3KDPA 4M60A 4AMBA 1M6NA 1X74A 4KH0A 5LIPA 1ZC3A 2QN1A 2YIDA 4HX2A 3G8BA 5C1DA 3KQSA 4K3VA 3GJ5A 3EEFA 2WSLA 5J5AA 3CZRA 2Z09A 4JLJA 3WK6A 3G82C 1ZGCA 3HE3A 4ARSA 1KDRA 3UWPA 3FNIA 1O9HA 4ZU1X 3WGTA 3W5AA 3BL5A 2FZLA 3MYYA 1DAMA 1WNFA 1KO5A 2RK4A 1WD5A 1RYEA 4TSKA 1Z4JA 3IQHX 1CZNA 4FBGA 5LYJF 3DLHA 4G2NA 4IFTA 4Q3NA 1HC7A 4R6WA 3C2QA 4LS3A 3HR7A 1CY1A 3PBKA 3V1UA 2IXGA 1CQZA 2IL1A 3HR4A 3BWVA 2BEUB 2AQ8A 2G25A 3PYLA 4PGHA 4PSUA 4D9HA 4IO0A 2J6CA 3K0CA 4W9NA 3ZVLA 4N5IX 1M5UA 1O87A 2ZR7A 3DWGA 4A3SA 4M9SA 8GPBA 1YZGA 4ICIA 2PX2A 3O4FA 4YJFA 1FXWF 2GPBA 3KZVA 1NXWA 2J6IA 2VDWA 3FBWA 2PO7A 2Y0EA 2YMLA 1WBJB 4R51A 3ZHSA 1PVOA 4WBXC 3MINA 3KSDO 3F0TA 5T8KA 1FZTA 1WHSB 1SHTX 4LNUA 3OZWA 2VDRB 3MF4A 2ZJOA 4MINA 2R1ZA 4X8MA 1NQVA 3OFSA 3BT7A 1SUFA 2V4MA 3OZDA 4IS2A 4MQFA 3U5TA 1CJVC 2D1SA 1OR8A 3PPYA 4L75A 3AVUA 1CDOA 3FXAA 3O4GA 4PGFA 3VUEA 5F3WB 3OU6A 4HAOA 2ZBPA 2B1QA 2PQMA 2NO5A 3HKBB 3KQMA 5IM4A 4G1BA 1GN9A 4J16A 5J40A 4MWOA 1UFRA 4W8OA 1YE3A 2HWYA 2HLNA 2ODQA 4JJIA 4DJFC 4J3FA 5AK3A 1Z82A 3W8FA 4CTNA 3OF2A 3EVEA 1HDRA 2OGZA 4TLBA 2GD0A 1C1DA 1I4LD 2O5RA 3PEVA 2JAPA 4ZREA 2LZ0A 4DWJA 2E0IA 1NATA 1KI6B 3CKYA 3CXRA 4AS1A 1J9GA 3MWDB 1EP3B 5THKA 3CGWA 3EAFA 3THWA 1OB2A 3EMDA 3VGPA 2P9CA 2OPHA 6PFKA 3LQ1A 1ZD2P 3SYTA 5M3BA 4C1BA 1M83A 1C8KA 3D6FA 2PUFA 1QQ5A 1NJ5A 2H4WA 4B4WA 4K3UA 3WDKA 1W4RA 2MR6A 2PQ0A 1Z3CA 1LPOA 1BDMA 3HHPA 3MTEA 4LJ4A 4FKZA 5ALIA 5EIFA 3RSCA 3QX3A 2OVFA 5BN3A 4E70A 4FCWA 4FDLA 1GILA 1MV5A 3HP4A 2D1FA 2Q1WA 1TXGA 4I1SA 1C8BA 1W46A 1E58A 3E7FA 2PUVA 3KEOA 3B2EA 2VP9A 2IEGA 3A1VA 3ZWDA 4JOSA 1Z73A 2FWNA 3K96A 1AHHA 3L0DA 4J90A 2CLDX 5ALZA 1UMCB 4UQLA 3KT3A 2X13A 4R9SA 4RZIA 5DSXA 1O8CA 2JGJA 4A8HA 1UJNA 3BKWA 4HYQA 5J4VA 3VR4H 2ZSKA 2O05A 3CEAA 2V5UA 4OOEA 2J3EA 1AQLA 3FVWA 1NVBA 4LHXA 3K9NA 4J1TC 2G5GX 2VXOA 3IUBA 3D0OA 4KN8A 2Q4EA 1EIZA 3A10A 1LXCA 5K3SA 3W3ZB 4BJ3A 2OV3A 3DZJA 3CWZA 1UK7A 3TSWA 2AW3A 4P3NA 2YW9A 3JQ8A 5G40A 4HAUA 1WUTA 3HCPA 4I4IA 3KO8A 4Z2YA 5KREA 1GNTA 1QH1A 4MYCA 2UUCB 2HGZA 7REQA 1L2TA 3CE9A 4ND5A 1PJZA 2G17A 3GP3A 2C9OA 5CXXA 4IEEA 4DJDC 4QZVA 1VYTA 1TLFA 3W5BA 3MGGA 2YZ2A 4GLFA 2GRAA 3WYNA 4L6IA 1G21A 1EWQA 1GR0A 4FW9A 4GGOA 3GFFA 2ZS9A 1Q0PA 1E9EA 5KTYA 2DBQA 4OFXA 2C4VA 1C41A 3ANSA 4KYTA 1WU7A 3PL5A 5EXEA 1OD6A 3U9SA 2A67A 3KPJA 4PC2A 2IXEA 4OUKX 4KXFB 4KR2A 4N8SA 2PFKA 4YDSA 3A6PC 2R8PA 1PQPA 3FOAA 1JFRA 2YJTD 3UQYS 4GEGA 4PAMA 2YN0A 2BFEA 5CB6A 3QEBZ 3ZHQA 1XJCA 3IMEA 5L3SB 1E8NA 4FGUA 1YJXA 1TTTA 3L8EA 1Y3IA 2P4UA 4HGYA 4X1YA 3CUKA 4M1ZA 3CVWA 3C8UA 2GF2A 1Y6JA 3UB4A 3WYDA 1ORRA 2ZYSA 1T9BA 3TVTA 5GQSA 1I2AA 2F62A 2HJ9A 3LI2A 3VO9A 1XQVA 4MPJA 1FNNA 3F5DA 3ORQA 3BWBA 3CC8A 3RSZA 3OIFA 1H0HA 1JI0A 1F2DA 1RWMA 1T8SA 4RCZA 3W8DA 3WHPA 2YVLA 2GNAA 4IQFA 4YRMA 2HF9A 5DOZA 1P8AA 2RGNC 5CUQA 5IC6A 5KYVA 5KYWB 5CD1A 3EUWA 4WASA 1M75A 1VCIA 1ZL2A 3INNA 4FYIA 4TTRA 2V7GA 3I3OA 3N8KA 3QX7A 5JC1A 2PLNA 4DUGA 3FJOA 2WU1A 3KJNA 2VP6A 3CR8A 4NESA 1QGYA 4RA9A 1NI4A 3USCS 4KIWA 2IYOA 2CL6X 3CLSC 5DEOA 3UNXA 1K88A 3IMCA 4S12A 4GFDA 4O1IA 4B5KA 1NBME 3G8YA 2I4LA 3RYCB 1SEVA 2B8EA 4UHJA 4GMDA 4EZEA 5ALYA 2P11A 2C1ZA 4A8JA 5EJ5A 4RMIA 4XTRA 2MU1A 2CLOB 2F17A 1RTKA 1YHZA 3NO4A 3DMPA 4B4VA 1UZAA 3HDVA 4B5LA 3B7WA 3NHBA 1EVZA 1VJDA 1KU0A 2XH8A 3RJZA 3TDNA 3ACCA 1EK2A 3ZUGA 4RTNA 5LMNB 2NSJA 4EGQA 4CMIA 1JMVA 3DZHA 4FGKA 4OP1A 4IHJA 3IOEA 2RKOA 1M0SA 3KETA 3RV3A 4TV9F 1JDVA 1AJEA 4RA9B 5DF1A 3MEQA 2YMQA 3A8TA 1DRVA 1NQOA 1XKTA 2JJQA 1PJ4A 3UHOA 3CFYA 4QOJA 1LTHR 1KJ9A 4TX1A 4KUGA 3GIDA 4UFOA 3TGWA 4DJEC 3JWJA 3GJ3A 1V4NA 3IUJA 2B1GA 4CTOA 2QP9X 3TQCA 2ZCJA 5DX1A 4D0RA 1NR1A 1OLUB 2DSTA 2X0FA 1FXWA 4UXHA 5EL0A 1EE9A 4ZEOA 5B6IA 1GPDG 1DRUA 1UANA 4NONA 1LK0A 4TKZA 4S24A 1RYZA 5TRTA 3DMDA 4CF4A 4DA8A 5CXUA 5HOQA 3OJCA 2ZK7A 2V7TA 3DKVA 2C5GA 1DAGA 4G0YA 5E2AA 2A88A 3K5IA 3SIRA 1U02A 4R1QA 4R8RA 4MHOA 3U7EB 4OAOA 4U39A 4D4HA 4WY8A 1UC4B 1PF7E 3AX6A 4KXVA 2WRZA 3AEXA 4PAQA 1EI9A 3WWZA 1WZCA 3KV3O 3SR3A 1KO7A 4J7UA 5KOJB 1DMSA 3GCWA 1EMDA 2CC2A 1X8KA 3OTGA 1IWPB 3A36A 4TXNA 3SOZA 5AJTA 1P4HA 4OQZA 1W5EA 1G3IA 2FETA 2R79A 4TV8A 1JDPA 3URKA 3VOAA 3SQWA 3FUUA 4UHHA 3DV0B 4AJEA 4YRIA 3UJNA 3HFJA 3WLIA 3LUCA 1QORA 4BV3A 2QLJA 1E1DA 5D1NA 2FMFA 2FQXA 2BOVA 2QMZA 1XHLA 3PC3A 5H9VA 3OIYA 3GMIA 4UATA 1JHPA 3BL6A 3PEYA 2FF5A 1XG5A 2CMKA 1E2MA 2W4MA 4LX8A 3DAFA 1WS6A 2ZE5A 1BEZA 1J0XO 2QGNA 4C5AA 5IVDA 1E64A 2HDOA 1ZNZA 2A0WA 2Q3BA 4RSHA 5A4AA 5IAKA 4ES6A 4MUYA 3TKAA 3HKEB 5HCUA 4B35A 2ZSUA 1L4NA 3GR6A 4P7BA 3WXBA 5HK8A 3KQHA 2V5AA 3JQAA 2F7SA 5C31A 1G18A 3F3SA 4NMWA 3PK0A 1RXCA 2KPOA 2OHXA 2GF0A 3Q0TA 3LU1A 1PT8A 4N3CA 5CG2A 1SXPA 5HDBB 4Q39A 1W34A 3INGA 4BQSA 3OIWA 3OJFA 4YLEA 1W94A 2O7RA 1L7OA 1NW5A 2HDWA 2FEOA 1VOTA 4DM4A 1IY8A 1PBNA 4G5FA 4F4DA 1AQIA 3KD2A 5H8WA 5F98A 1PZNA 3JYQA 2WFLA 4F4FA 1B0AA 2X58A 1DBVO 3MT9A 1YGYA 4PZ0A 2ECQA 3A9CA 3DOEA 4G5QA 1R0BA 3DZDA 1XVIA 2KX7A 4MJ3A 4X63A 5A5FA 2E21A 1E69A 4RVOA 5IM4F 3FNHA 2H1CA 5EI5A 5B12A 2VJLA 1B74A 3ZDCA 3JQCA 3LKZA 2AXQA 1B0PA 2H9YA 3O3OB 4KODA 4NRDA 3NPMA 1KO1A 1TCBA 4X1OA 1XDBA 4H16A 4B4KA 2WI8A 2C5SA 2WAMA 5WRFA 4KQHA 2WYUA 4ZXFA 1VP9A 3W05A 5B3AA 2Z6VA 2GOYA 1IBCA 3LUDA 2CJYA 4L5BA 1PYGA 3W5JA 4IBOA 2PQ6A 1N8NA 5HUJA 2XEXA 3ABZA 1A8QA 1VBKA 1YFZA 1GQOA 4WEQA 3KBOA 2RGYA 1R0RE 4PNHA 2IOQA 2LTAA 1W36B 5A02A 3RS9A 3VR4D 1GZ6A 1JU9A 3RB8A 2HB6A 3IJPA 3D43A 5C9ZA 2Y93A 2QN9A 3FSGD 3UJ9A 1OFVA 5I5EA 1ZNYA 5HR5A 2HBYA 4KREA 2V7EA 1Y9DA 4QRHA 5AQ1A 1P9OA 2A33A 1W49A 2G5PA 2GZSA 3GJ0A 4IH9A 4BZZA 3G85A 3C6QA 1PE0A 3I2GA 2HM7A 3CF2A 2FVYA 2OFOA 1UDWA 3LVRE 5DYTA 3FDIA 1BGVA 4LWOA 4Y2RA 3UATA 4PZEA 5D5QA 2WWVD 1U0EA 4ER6A 4ESVA 1R6VA 4HMOA 4L2IB 2A9JA 3HA3A 4TL9A 3GNLA 4C7OA 4W9RA 2O6HA 1G7RA 4H3HB 1RHMA 2C8JA 3AFGA 1D5WA 3IERA 3DHWC 3KDAA 4LJRA 4Q9NA 2OG1A 3C15C 2F9MA 1VL2A 3WLEA 2VXYA 4XH9B 1LF5A 3WLFA 1BMFD 1Z0UA 1F0YA 3RK0A 2YV2A 1G8AA 2J46A 2VDKB 2P0YA 2P2SA 3Q5DA 3RJTA 4F60A 1SU7A 2DR0A 5ALNA 2P1ZA 3EGVA 3WLJA 2RCNA 2P1DA 4S2UA 5LLDA 1JBEA 3N8NA 5AIAA 2UZ0A 4X6LA 4ZQHA 3FFXA 4K87A 4YUAA 2JB9A 3K70B 1ZUNA 3PJFA 5DYNA 4CT4B 1DNPA 1KSFX 3MMSA 3HZZA 1LC3A 4YALA 1IY1A 4K9SA 4B6EA 5KDDA 3TTVA 5EPUA 4E21A 1DIHA 1N1MA 2QRVB 3ELYA 3FCUB 4GKVA 4RGYA 1TQDA 4BNHA 2FPGA 1O03A 3DBRB 2B6HA 4FGZA 5TS2A 5FTKA 3NWPA 1SB9A 3VPXA 3KALA 2CZCA 1GPJA 3DE0X 3FPKA 3HCWA 4J2TA 2F3TA 4NE7A 1NNSA 2PIDA 4CL3A 5K0FA 4KYVA 8MHTA 5KTTA 5FUVA 3N8DA 3FHTA 5CA1F 3LX8A 4K5QA 2B37A 1VI2A 1OAKA 4KBFA 4KXNA 3EGOA 5TT1A 4ZN6A 3PUZA 1DX4A 2FOXA 5GGXA 2ZPUA 3L4KA 5LQKA 1THTA 1ZVQA 3KWMA 4DQ0A 1AN0A 3EIHA 5AM3A 3I64A 3B1WA 3QNMA 4RVCA 4BZPA 4JDUA 3F6YA 4KN6A 1I2BA 1FTYA 4JBHA 3LFTA 4JUCA 3O91A 3V2HA 1KDPA 3C41J 3TE7A 3TINA 2O57A 3LT5A 4M4SA 5K3OA 3MVEA 1NU6A 1Q44A 4TMWA 3MWJA 5H4HA 2KSQA 3A1SA 5FWNA 3QWHA 4EQZA 2O2DA 4MGIR 8ADHA 1DCTA 3Q2KA 1NHWA 1VE7A 3HFGA 4I8DA 3MELA 2FZKA 2HMUA 4JR2A 3QBDA 5E4JA 4BNZA 3CT6A 1GV1A 3PC7A 4HTAA 5BSMA 3CLSD 4K1LA 4Z0PA 3IILA 2JGLA 2D5LA 4QM7A 3E18A 3ND9A 2VUUA 4MQEB 3EGXB 3LCMA 2EL7A 4L74A 4MKGA 5EHXA 2WHPA 3ICEA 4QXAA 5FWXB 2BI7A 4I55F 4CDGA 2IZ6A 5AJZA 1J5XA 4KBGA 4F5EA 1HDZA 1OLUA 4TUYA 1P4RA 2F1RA 4IGEA 1SOMA 3A1UA 1FUIA 2RDMA 4YWJA 3LA8A 4I81A 2CMFA 5JH7A 3EXG2 4KO4S 4F96A 3TMKA 4MVJM 3Q72A 3D7MA 2OZPA 3ICCA 3MGBA 5GM1A 4DR1B 3AJRA 1Z75A 1WVMA 4YCNA 2I2XB 5AM1A 4N41A 1RM3A 1MV8A 3BWCA 3P2IA 1WEKA 2HSZA 4A2PA 4RC9A 3TOXA 3MJSA 2EBFX 1MG5A 4A8TA 2WV9A 1XU7A 3X1ZA 4EY7A 1GVNB 1RLJA 3E8SA 2HCTA 1JB9A 3UAOA 5JH7F 2BT4A 5CX1B 5JD5A 2XKJE 4CU5A 1HFKA 2GN9A 1Z4IA 1KVUA 4K6KA 1R4MB 2FXVA 1PZXA 1W4ZA 4RH3A 4O3MA 1BAPA 1HURA 1F8FA 3P19A 2FPRA 2P90A 4HWSA 2X0KA 2O4CA 4MP3A 2VRNA 1TUGA 3VPGA 4Q1FA 2Q4BA 3H1TA 3ZI0A 2GJ8A 3NXKA 3PXEA 1N5JA 3VZCA 4YCMA 2QPLA 1RTTA 5K3CA 2YRXA 3NP9A 3F4LA 1TA4A 4E33A 3GAZA 3AHGA 3NC0C 1K06A 4DV1B 5HQJA 3G7NA 3ILHA 3A9VA 1V6SA 2PV0A 1Y34E 1Z5OA 2WAAA 4IZHA 4PANA 1KDOA 4OD0A 1P5HA 4DILA 3D4PA 3NI2A 3IAM1 1JAIA 2O3QA 3H04A 3ZPXA 1J06A 3OMLA 3GPBA 1CF4A 4N4AA 4MI1A 3EAGA 2ODPA 1GGNA 1HFWA 3ID6C 3IKVA 2XGSA 4UMEA 3E1KA 2PS0A 3HVHA 4KIUA 2DETA 5EN4A 4JL5A 5I48A 1DMRA 3CBGA 4P92A 4WVLA 3DL2A 1EAYA 3G5TA 5DCWA 3HPQA 4LOLA 4HZIA 1Y9EA 4MITA 1T25A 4OBEA 3TX6A 4ZHQF 1DBQA 3NBQA 3SLRA 4ETNA 1P0MA 3ZK8A 4DUPA 3ROXA 2NXNA 3PPIA 1BN7A 4URUR 3ZGXA 3LY9A 4B2LA 3A1CA 1GXSA 4KQXA 1I7DA 1TVKB 1AUQA 3LVFO 3NKLA 3L41A 3LJKA 5LZ5A 4FFRA 2GCOB 2MIIA 4NYMR 5HKAA 3F73A 1P2FA 3RGGA 2X6TA 1SPBS 3AUUA 3HNPA 3T38A 2BGRA 2ASEA 1AUXA 1PZFA 4GZ5A 5DHSA 5EHGA 4ENVA 5BWMA 1ZINA 3HCNA 2A5FA 1TYAE 1J2UA 3D6UA 3U7IA 3VR1A 3ZEIA 5LQJA 3BE5A 4B3HA 1DJNA 4ZI5A 3WZLA 5CM9C 2ZLBA 2HQ1A 3D3QA 1QYVA 5F12A 1U7OA 4KR0A 4FOTA 5JZ9A 1JIJA 5I7UA 2X0DA 3L3BA 3GVIA 1YASA 3NPAA 3DOFA 3V6MA 2EP7A 3AUSA 1FVHA 4JC5A 4WZBE 1EP1B 3RKRA 2XCUA 5FQNA 4DMCA 2FQQA 1R6XA 2EEPA 4PCAA 4EBFA 4DA9A 1EDZA 3AHEA 2WQZA 1U9ZA 2Y68A 1YFJA 1XVLA 1BHQ1 2ZE6A 3QEMA 3QM1A 2QQGA 4TT8A 1I4TD 1Y8QB 2QGFA 3VHXA 5C37A 3NETA 1NOKA 5JCPA 4QYXA 5LDDC 2F9LA 1KKUA 4J4TA 4NMLA 3JAKB 2P5UA 2PL1A 1LPAB 2J3MA 2OPBA 2GZ1A 2I6XA 2P8SA 3BXOA 3C3XA 1V11A 3DJYA 4M1OA 5P8WA 2VYVA 4XPIB 4ZZ1A 1RKVA 3H0KA 4ABTA 4PZCA 4MKXA 1GRCA 3DF7A 1EXVA 3I2HA 3E3AA 2HZ7A 2WWHA 1J2TA 2V7UA 4LVCA 3KJFA 2FZVA 2QLLA 1Z26A 1ZVKA 2ZRBA 3AFIA 4MWBA 4QU0A 4K9NA 3PNMA 3OEHA 3SZRA 4ESEA 5I7RA 2QENA 1KI7A 1QIMA 1TAGA 1Y3FE 1XEXA 1ZUD1 4K28A 1YJBA 1ZWLA 4UJ3A 3ZWVA 3U5ZB 2P6OA 4YYEA 1YMVA 1N6NA 1BCRB 5D85A 5JI2E 2BMFA 3AR4A 3W5CA 4N18A 3K9HA 4PW0A 3B6EA 3NORA 1SPXA 4IFEA 1Z6QA 1Q91A 3OLVA 5DGDA 2H9IA 4QHTA 1M76A 2WJWA 4K0KB 1K7SN 2SCUB 4B40A 3JR7A 4XX0B 2FQYA 5JZVA 2FFRA 3V9AA 2R1VB 1ETUA 1UINA 3MUOA 2B1RA 1SVIA 2QN8A 1GTL1 1G9TA 2W6JD 3K1TA 4LRQA 1GNLA 2MYNA 2P40A 4RIIA 5FF9A 3FNQA 5ICGA 2IYEA 1WHSA 2WUEA 3KXPA 2VIIA 1B76A 1ZIPA 4D3ZA 2QZ9A 1U8YA 3EDQA 5DXAA 4OKNA 2G76A 3GT3A 4C6TA 2P9BA 3FCOA 4TWBA 3LC1O 4LTMA 4DDHA 2QMHA 1JS1X 4B3BA 4EH1A 2I0FA 3LMKA 2FWAA 4F6CA 3TJZA 2BKLA 2AF4C 4PLGA 3QEOA 4NCJA 4RPHA 3RUIA 1PW7A 2WKPA 1GNRA 2D0PB 3MJ4A 3VI4B 3KWJA 1E3JA 1WCYA 4E4TA 1E5LA 4Z53A 1VMIA 2EIHA 2HJGA 2SCUA 3R5XA 4D9GA 3F6CA 2ZRQA 2NSYA 5JCXA 2BN4A 4EO4A 7ADHA 2C94A 2XDWA 1NBIA 3CLHA 4UBJA 1KP3A 4Q00A 1Q6YA 1ULBA 3DE1X 4C2AA 1N2JA 2ZW9A 4OI2A 2XOKA 3JU3A 5IJ9B 5LNK6 3R1IA 1ZVVA 5FPSA 4ZAYA 5IEBA 1XFDA 3IQWA 4R2WA 5G41A 2XUGA 5F7JA 5EWLB 5EWJA 1G3UA 1UMBA 3PTLA 4Q48A 3E2MA 4F38A 1SUSA 2HLHA 4LJYA 2AOTB 2NU9B 1QRRA 2ATIA 4RDCA 3ZZMA 1URPA 1ZC4A 2G07A 4KQMA 1CP2A 2J9FB 2XYVA 3ETDA 4UUNA 3VQTA 5JJ5A 3G2MA 4IRUB 2R11A 2A4KA 3AUXA 3MMZA 4H6PA 2JASA 1L1FA 5BQOA 3I30X 3KKPA 1XA4A 2DHRA 4Q19A 3O1LA 1PV1A 2I66A 2EWVA 1M6YA 5T3UA 1IXSB 3MLBA 4EPYA 3FTCA 1UMCA 3WK8A 3RQSA 1AHPA 1YIDA 5BNTA 1DU4A 1RJFA 4TLEA 5EA2A 4D3DA 1AXEA 3KKLA 3TYXA 3COVA 4D25A 1OYVA 1L5WA 2IF2A 4IS3A 3AHJA 1TM4E 3I0NA 1QHEA 3GA0A 2GKSA 3BMOA 3R09A 1YAJA 3C6BA 2IOFA 3C74A 4YIKA 5AVKA 2OSBA 3T7EA 2GS9A 4PN7A 2UYCA 1PU2A 2COKA 4QG3A 1GQSA 3DL7A 3S3TA 2RJNA 3O1JC 1Y98A 2B9EA 4DIEA 1I4DD 3PUIA 2C95A 2C99A 1EAMA 2KE5A 4L5CA 4DCVA 4XRGA 1L8LA 3KVVA 1Z12A 4G5RA 3W3AD 5HUQA 3CNHA 3Q7TA 1SXIA 1EK5A 1PGPA 2Q8PA 2XLBA 3B1ZA 4B43A 2XWBF 4RM3A 3UGTA 2DFVA 3QBJA 2UUBB 2NN3C 3PZRA 4XGRA 1UC8A 3K30A 3IR6A 2O0MA 4M1TA 3JQDA 4G0VA 5I8WA 1KWKA 2VUHB 3ZXUB 1OV4A 2QUKA 3BOSA 4P9NA 4EYSA 2ZDGA 3A1EA 1OLXA 4RPLA 3UEOA 2WNHA 3IAS6 1HTWA 1OX4A 2H48A 1V8BA 1FVXA 4KSBA 2RGCA 4KZKA 4UDXX 1XEWY 4C5BA 2WAXA 2WVAA 4BFTA 2P3LA 2RGXA 2P9QA 1VHWA 4RQBA 4UBLA 4HT3B 3VNUA 3VZSA 3ZDAA 5EAIA 4NBNA 1V5FA 3ISVA 4L8YA 4ZI3A 1ABBA 2JBHA 2XUOA 1GCGA 2YRWA 1PGNA 2BP7A 3ZU2A 1U1FA 3DOJA 1P4JA 2VAVA 1MT3A 1RKUA 1TUEA 4TYNA 4LY0A 4J9VA 4M8NE 2C2GA 4KWCA 4A23A 4PX3A 1G6Q1 1XFAA 2NOAA 1HSZA 2O48X 2XSZA 5A5GA 3R7BA 3RVSA 3HSSA 2FPLA 2O3UA 1ONBA 2BTQB 2EX4A 3A27A 5BYAA 1QU3A 2IU0A 2GCNA 4HB4A 4EF5A 3ERCA 1GY8A 2BZ1A 2BIFA 4MR9B 4BNUA 5BPHA 1QTNA 1U2QA 4MQLA 4RAQA 1Q16A 1P19A 2FRVA 4RCVA 4XUDA 5AXAA 4DSTA 2Q21A 4ZQEA 2OR3A 4PU0A 3HO1A 1VBFA 3THXA 3TTUA 1OXVA 2JL1A 4JT8A 4YECA 5AW2A 2BF7A 1S89A 4JVMA 4NK5A 1ZD1A 1I14A 1WXIA 2DPXA 4Y1RB 2E85A 3ESXA 2OWEA 1F6DA 4Z0NA 1TM3E 4XB6B 1DBSA 1T9GS 2NXCA 3KJQA 1HXHA 3FRJA 3R9IA 1X2EA 2QTRA 2IUTA 4U02A 4YP1A 2M6SA 5CNJA 1Y5MA 2VG8A 3CVJA 4HEA1 1EDBA 2HFKA 2M9MA 4MROA 3QEMB 3VDXA 1QF7A 1WUHS 3AKYA 3I1IA 1HDOA 1SU6A 2HPZA 3DLPX 5H9WA 1O57A 2DMRA 4X6YA 3G2PA 5DGTA 1GO2A 1GZ7A 3HB5X 4RD4A 3SM3A 1ZOLA 4EF4A 2CDAA 4MYDA 2E6UX 4HBGA 3TFWA 2IPAB 4MS4B 1I7PA 4U2KA 3HY4A 1GSIA 3ET4A 1E5VA 2Z9CA 4M0FA 3CLRD 1E9CA 1LBSA 1M1NA 2ZIFA 4L5AA 1EFHA 2C4WA 1T0UA 3NT2A 3PI6A 1U3GA 5IN5A 3OE5A 3TZEA 3D6NB 4UBMA 1CUFA 1Q7RA 3E9ZA 1CUVA 1KTVA 3OAAA 1ZSNA 1HWYA 4QC2A 1H2FA 3AC0A 3ZW8A 5FLYA 1UR5A 4JLPA 3ULKA 3ZYCA 4E5SA 5AM2A 4BKRA 2OAEA 2C8VA 1P80A 3VTAA 3LE8A 3JYOA 1MNQA 2RG1A 3LQYA 2FHPA 3ETHA 3DMRA 2UXCB 1TCCA 1UWCA 3GLUA 1LPMA 1DV2A 4M0KA 3SR4A 1J7KA 2E4AA 3S99A 2HQRA 2IHJA 1DXOA 4JBYA 3V2IA 3R0IA 4UU8A 4Q1VA 4A6EA 1LDMA 3QYFA 4F1WA 5BR7A 1E4EB 1Y3BE 4BO8A 4CLOA 2MOKA 2XNSA 2YTZA 3BD8A 3NNDA 1GTVA 2HPAA 3PIDA 3QPAA 4JJZA 4MR8B 4TLCA 3T9DA 3U7FB 1H8EA 5EMKA 2BSQA 3DW1X 2C9YA 4E94A 2GI4A 2XD4A 4CMGA 2BCEA 4N5HX 2AG8A 3E1GA 4X00A 2ZSAA 2RKBA 4N54A 4TT3A 1QXSA 1YGPA 2EZ9A 3GHHA 3ICOA 2DKOA 3Q98A 3QU7A 4HOYA 1KTIA 4NOMA 5E9QA 3KQUA 3QBTA 1MC8A 1USUA 3LFHA 2NTJA 2PKQO 1A4RA 3SF0A 3A1TA 3QJ5A 4J16C 4WZAB 2OLEA 4CG0A 1LCIA 1N6HA 2BISA 1VGQA 4B45A 1U2DC 3EF0A 5H82A 3ZHBA 3KZCA 3Q3HA 2IZ0A 3P7MA 4LY6A 3FPSA 1G20E 3RRMA 3OT4A 2BHLA 5K0LA 4B8ZA 2OB2A 2EATA 1HX7A 4JJ6A 4DSAA 4MVJP 2CZQA 2XMDA 3Q7PA 4WESA 1WF6A 1X8LA 2ZRDA 3F67A 4DLNA 3RABA 3PVSA 1ILEA 3NTUA 4RKEA 5DK6A 1RHRA 1KIAA 2FPKA 4UAUA 5EHIA 2ICAA 4RL6A 2W6ID 2RHOA 5IJ9A 2BLNA 4BGEA 1C30B 2CYBA 3LWDA 1RRCA 1LJ8A 2GERA 4H3KB 3SVTA 3IQDB 2E9SA 1Y6RA 3WGUA 2PKEA 3N58A 5JSYA 5MGNA 1PFKA 5KI6A 3VR6A 2IH5A 1DLJA 1RFLA 1SKUA 2MJLA 1QBGA 5KNDD 1DL5A 1N3BA 2HUPA 1JHRA 1GYRA 3TPCA 4D9BA 3D7SA 4ZAWA 4GPZA 3UAVA 4ZGBA 2NPFA 4QGGA 1N2BA 3RFFA 3EGDA 3RIYA 1N25A 1MOZA 1RABA 2EBWA 1W0JD 3TEJA 1LX7A 1QHHB 4GKBA 4N82A 3J81k 1M2GA 3VR3A 2NUTA 4E07A 2QX4A 4ZYUA 3PX2A 2C4MA 2IHUA 2UYQA 1EK1A 3H5LA 3I37X 3T4EA 4K86A 4F84A 5LOVB 1BXGB 4MYTA 2Q2NA 3VC1A 3WGNA 3O4IA 3F8WA 3P2MA 1X1EA 2WJGA 1J1IA 5IKPA 1JFFB 1LB1B 5FCDA 2N0SA 4IJQA 5J5VA 2W6CX 1NP6A 3MT8A 4WFQA 5DNAA 3R0ZA 3HVJA 3ROEA 2GEKA 3U4AA 4WLNA 1Y3DE 2DQZA 1YNOA 3M81A 4BJHB 1ZMXA 1DINA 3IO3A 2QVBA 4FSHA 4N5NA 4LXUA 4C3UA 4G0NA 4S1OA 1AGPA 4MVWA 1KU6A 4XWYA 5HFNA 1Z8NA 3QWIA 2B0JA 1U9CA 1TPYA 4BIMA 4RWZA 2G1UA 3IV6A 3JRWA 1OMOA 2O1WA 5EHZA 1HYHA 5JJCA 3IKTA 3LW8A 2J9GA 3QPCA 1DHRA 1T0BA 3LD9A 4NF2A 4CKEB 1V48A 1I0IA 3RBXA 4UUBA 2EKQA 2P6UA 3OX1A 4NNJA 3NHLA 2CLLB 4YFVA 1NSFA 4LHYA 3VSEA 2ZBDA 5BR8B 1YHNA 4KC0A 2R7KA 1WY5A 2I6GA 1XZQA 4O5AA 4PICA 4ZA2A 3ZY5A 1NVDA 1ZICA 2D5IA 3KSRA 1EFVB 3SYRA 4YNBA 4IUYA 2GB4A 3OBIA 3IB3A 1Y3HA 1NPYA 2CVZA 1FDRA 4UHEA 1FA9A 1G42A 4Y3UA 1BXGA 1R0CA 4UTNA 3FDXA 4ZCPA 1SD2A 3VKWA 1ZONA 4WLVA 2O2YA 4WZBB 1E3MA 1U1IA 3N2GB 1XXHA 3JALB 3GEEA 3TBHA 1DTSA 4LJKA 1N5MA 1B73A 3UV3A 4JYCA 2B4YA 1W5AA 2QD3A 4UUMA 3MHTA 2FMKA 1GCUA 1YBHA 2Z98A 5ULLA 3HUDA 2H2GA 3PFCA 2PS9A 2C8KA 2DWOA 4GSYA 4MVXA 2VDOB 4JBWA 4XM1A 5FOSA 4V1CI 1XZHA 1I3NA 1M10A 3MN1A 4YXFA 3F7TA 3O1IC 2PVPA 4JJAA 3NCTA 1NF9A 2FRDA 3BB4A 4MRRA 5LR6A 1VJGA 4DQDA 4M8LA 1PS9A 1CY7A 2OSVA 2JPDA 3EWSA 5E1MA 4O2AA 1N33B 1WO8A 5HIAA 2PEYA 5HRCA 1XCBA 3NBAA 4C20A 1CUJA 2H51A 1KO8A 4H4DA 4M1KA 2FW6A 4NHOA 4XVRA 4BX9A 4RD3A 3DPSA 1RWXA 3PR1A 4DARA 1T9CA 3AR2A 4BY9E 4JR1A 2WT9A 2ZBQA 3BB3A 4FOOA 5BNZA 3R5JA 3A9RA 2JK0A 4JUAA 1U3WA 2V3VA 4RIGA 3BPSA 4Y18A 2GM4A 1DGQA 3OECA 5DI9A 3GU3A 1RWBA 4I9NA 5LXTB 5ICMA 1ZAYA 1KGDA 2O4UX 4CR6A 3ZJTA 4NV3A 4JI7B 1Z5ZA 3VNAA 5THQA 1Z33A 2Z8YM 3I8SA 4CEJB 4IX9A 2CEAA 4G0XA 3CVVA 1A9TA 4EYKA 3LSYA 4FFDA 5LBUA 3RAFC 5F9HA 1VSBA 1AKVA 3AYZB 3FSRA 4NC9A 2CFCA 2NTEA 3PDIB 2EHJA 2YJ3A 2RHBA 3GT7A 1QE3A 1RJ9B 4HB3A 4P5DA 5CFQA 1XRSB 2YN4A 2CJWB 1Q0TA 4GDFA 4ACAA 3O4VA 4LA4A 5FNZA 1OILA 2O07A 2Q99A 2RCYA 4K9OA 5CNMA 2FI1A 4LMRA 4JI5B 1VRVA 1JKJB 1U3DA 5B58T 3TR5A 4KKVA 1DWPA 1T36B 4UULA 4URZR 3VTZA 3HP1A 3LP6A 2QOEA 3DEHA 2ZJ6A 5TVGA 4NFLA 3ZE9A 3Q7IA 1ZISA 3MGAA 3OEWA 1HE5A 2D0DA 2H85A 3FZNA 1HPLA 1D9ZA 4MTCA 1WCV1 1CY2A 1IBLB 1RD4A 4BJ5A 2PZJA 5IKMA 4EA7A 5BRJA 1ML3A 4F4IA 3BE6A 2YCBA 4DM3A 4M22A 4XD7D 3OJEA 2VDNB 3E3MA 1NRJB 1A9XA 1VXRA 3EJWA 4YJ3F 1FRVA 2NACA 1N5RA 1QVRA 4GOOD 3T7JA 2A1UB 4EW1A 1R9JA 1GA1A 2CL0X 2DGDA 4ENTA 2O0KA 1U8AA 2VF2A 4X8OA 1YONA 3HJUA 3L07A 4X41A 4HQOA 2JFHA 4JROA 4AJKA 2AX3A 5G02A 4DA4A 2ID4A 4ALLA 2E4VA 4YJ3A 3WRWA 3FOEC 1E6WA 4JI3B 2Z43A 2CXRA 2CV0A 1QTIA 4WN3A 1ZR4A 1W85A 2BH2A 3LUHA 3B9RA 2YXDA 1PTJC 2A7XA 3PQ8A 3WGZA 3W9YA 3TEMA 4LYAA 4Z9FA 3IALA 3TZCA 1O9BA 1B1CA 3OFJA 3UAYA 1FYVA 3DEAA 2OFPA 10MHA 5LB4A 2QUZA 5A7HA 4FHDA 1OT3A 4PVCA 4TWZA 3I42A 1NF8A 4W5WA 3DZ8A 3DZBA 4QEZA 3T1QA 3PUYA 4MAMA 5BQ3A 3D2LA 5FEUA 4JY7A 2RAUA 2C4HA 3KDSE 3NV7A 2VOJA 2YHBA 1W0KD 1VPEA 3I6BA 5HIKA 4AECA 4QFMA 4B9EA 3TTWA 4BO4A 1EFCA 2CUNA 3I4FA 3H18A 4E2FA 4D0LB 2XJ9A 5FUMA 1NWHA 3U4MA 3GLIB 2IYNA 4PLYA 4IIEA 2PR2A 5JANA 3AF2A 1JJAA 4CM1A 1I2ZA 5H16A 4XTCS 4JFAA 3AHFA 3UUGA 4CG3A 2J3DA 1WF3A 4C0WA 3VPFA 5HJEA 3HA5A 3WLMA 5BV1A 1O5TA 4ON9A 1HMYA 1QYRA 2P75A 2IGBA 2ZP1A 4GYJA 4OJQA 3DB1A 4IF6A 3REOA 3H5NA 2YIJA 5FPYA 1RZUA 3CPEA 1JHOA 3DGEC 4L8LA 3L6BA 3JAMA 5HP4A 3QF7A 1FUKA 2FPMA 3KR1A 1XTQA 3OC6A 2FFQA 2E6KA 2FR8C 2XVAA 3R9XB 1M1XB 1T0HB 1ZOPA 2CXSA 1AA6A 4IW3B 1SAYA 5FADA 4KACA 4O2AB 4N0EA 3GEPA 1QGED 2W90A 5ISMA 4Y1GA 4GKJB 2CWWA 4Q02A 2OXTA 2QTFA 3EZLA 3PWSA 1N0HA 4XUGB 5K9ZA 3B36A 1ZD3A 1BVUA 3EVTA 3IL2A 2AR9A 2VQDA 4LF5B 4HLNA 4IEFB 4OOFA 4IG4A 4YCDA 1XJ5A 4MDHA 1I10A 4ZANA 5CAEA 3TRKA 1TIBA 1E1KA 5ESDA 1SA0A 3QHAA 5LZ7A 1MGOA 3JCZA 4XR4A 1X7YB 4KX5A 1HNXB 4QFCA 2QX8A 4IMRA 1VMDA 4URYR 2DKNA 3UK2A 1KYTA 2QPAA 1FNSA 1ECBA 3GFTA 1BEEA 4ZEMA 1TQ2A 2GA9A 3HL0A 5KTOA 5EXPA 3T5BA 4Z3KA 7AT1A 1N2CA 2J5KA 3UWSA 3A1FA 2GCIA 2VH2A 5DNWA 4CNBA 4H7PA 2RK3A 1ISJA 2EKPA 2Q45A 2PMEA 3RHSA 2QN3A 1EVJA 1OFUX 1TCUA 2ZVQX 4JI4B 4G1CA 1OQAA 1X1SA 4F9EA 1PT7A 4ZPJA 1PG2A 1W9MA 3UMCA 4CCYA 1R4MA 4FOSA 1N5DA 1E18A 2Q28A 2PX5A 4IUCS 3NX4A 4TTIA 1K1EA 1RU3A 5HE8A 3KOWA 1E6MA 9ATCA 3CT4A 3ZHCA 4D1YA 4D4JA 2DTXA 5KC9A 1Y8QA 1ZS9A 3DEYX 4U9IS 4ZV9A 3N0VA 4LJLA 3U4CA 3ZWKA 3WMGA 1ECPA 2E18A 3AP1A 4AWAA 3L79A 1A9XB 2PS1A 2QYSA 4MR9A 5DLDA 5CAEB 2PLAA 3S7ZA 5DN6D 2X7HA 3VPDA 4BC0A 3K5WA 4JYPA 4J94A 4JUIA 5EUMA 2PX0A 1R5JA 5EWLA 3OEEA 2YHIB 2ORED 4B48A 1V16A 1HEIA 1CCWA 4E5DA 4OM8A 4BOYA 2ZXUA 1WAMA 2ZSEA 1PWHA 2QNRA 3G9TA 3DHVA 4GO1A 1P81A 4HDSB 4KXUA 2XT0A 4BNFA 2HJSA 3D6AA 3E7DA 5H7XA 4EX7A 4KH1A 3Q4GA 4AZ3A 2EBHX 5JVDA 4NK4A 4L73A 1XAGA 4A8PA 4EVSA 3BH6A 3D59A 3P97A 5F7ZA 4R7ZA 3I8OA 5G0WA 3ZZ1A 3FHCB 3UB2A 4RULA 1L5RA 4QYIB 4JI0B 5E9JA 5FT9A 2V3WA 3KR2A 4RELA 4B6SA 4DDVA 8LDHA 2BKVA 2WNIA 4D82A 3CF4A 1PZEA 3DNMA 3CTMA 5BYBA 4G56A 3IBCA 1AO3A 4M1WA 1D1PA 2XWJI 4QPCA 3RVQA 4DCGA 3NAQA 4QU8A 3FW1A 4QX6A 4YRLA 4GF5A 1ORWA 4L78A 2B7CA 1P75A 3ED5A 1D5CA 1T9HA 3FI9A 1YTUA 1NE7A 4JYBA 1G1MA 1V39A 3P9KA 4FNGA 4RZXA 1PUXA 4GXTA 3DXYA 4J0KA 2OCBA 2X2FA 5TQ0A 4O29A 4TYWA 1D6MA 2R97A 4Y2GA 3KC2A 2XITA 1OYOA 3E81A 4BTVA 9MHTA 3HDHA 3DZIA 4KZPA 4Y7DA 5CM8B 1JEYA 3IJ5A 2AFIE 3A58B 1NW6A 4ZC8A 4BVAA 1T8WA 1G2PA 2E4WA 3B1FA 3PCTA 3Q7EA 3IQXA 4KWHA 4QNMA 4QPZA 1NFFA 2ZUFA 3QX8A 1T2EA 2DWUA 2ZQYA 4GW3A 4XM0A 5AK5A 1FB5A 2ES4A 4ZI2A 1TU3A 5D3MB 2NX2A 2C7GA 3Q8XB 4ED9A 1SULA 1MX9A 1IATA 3GLGE 2H54A 2AF3C 2ADOA 2O0LA 2Z4TA 4OB7A 4LXGA 1Q22A 4ZOLB 5ED0A 5ED4A 1CS4C 1ZSVA 1OPXA 4P5PA 1CUXA 1VKZA 2R5NA 2EBUA 4FJ0A 5FOXA 2IHNA 1LD3A 3T34A 3A2KA 2OO7A 5AJVB 2AE1A 3OLXA 2PMWB 1N0IA 4CIVA 4I4LA 1EWVA 3BTUA 3G5MA 3QFCA 5HTOA 4KUHA 1NV9A 1DEHA 2J7KA 3NVAA 3NASA 5AKHA 2ID9A 3FUXA 4RS3A 1JG4A 5AK0A 5EJ7A 2RG7A 1L4GA 3N6RA 2CJXA 5IPFA 3T7IA 2BF4A 1SXHA 2JD0A 4D46A 1OA1A 3V8NA 1AV7A 1MRSA 4WCFB 3GGSA 2H1VA 2VHXA 4TL6A 4P4SA 2GEFA 1U0TA 3UUEA 1HF3A 4UW9A 4P2BA 3QEAZ 1YZ3A 1P7PA 2I67A 2O2ZA 4GMKA 1G4UR 4F9FA 3MJFA 4XE5A 2IUFA 1XB2A 5ELXA 4X6UA 5J5CA 3T1YB 4RPJA 5KYYB 5J3JA 4ZYYA 2GPJA 2REOA 4ZVVA 1H8ED 1Q50A 2Q5FA 3ITDA 4HTFA 4LRWA 3VRHA 2VRCA 1JEEA 1W1UA 4ZJYA 3MCUA 2NYVA 1F06A 3GLGA 2CVPA 3I6MA 1FP4A 1NP7A 2YHIA 1C9DB 3AESA 3EXFA 5J4KA 1S7CA 2BKAA 2HDNB 4AXBA 3Q8KA 4RNDB 4LOAA 4XUEA 1IUOA 2P5SA 3EBOA 3K09A 1R8YA 4XWTA 3TX2A 3J7TA 1KFEB 5DWQA 4JL6A 1T0IA 4DNQA 2Y4OA 2B0CA 4Y2SA 3VNQA 2UZ1A 1KXJA 4TRJA 4Y1FA 3HZHA 3NTXA 3LOPA 5C0OE 4FKMA 5U4XA 3KYCB 4K9KA 1K3UB 5CLGA 3RHTA 1TQ6A 3DJFA 3RLFA 3UWOA 3G7UA 4PLHA 4A7PA 3AY7A 2HR1A 1O96A 4E5YA 4Z86A 4H27A 2YNMD 1MAHA 1X80B 3SNHA 3K5HA 4D4IA 4GR9A 1F2UB 1SH7A 2JI4A 3OQIA 4FYWA 3T1HB 3KHTA 2R5FA 3M1LA 3PNVA 2WOJA 4NXNB 3OKFA 4IDDA 4D9FA 2WJVA 2YWRA 4XLLA 1OC4A 4YMVA 2QTVB 1VCOA 1IAQA 2ZS8A 3SQLA 2X0IA 3EY4A 4LDZA 3VU0A 4TT3D 2I2FA 2NM0A 5JCOC 4ZV4A 4GOXA 3CUYA 1VL5A 1IBRA 1TYBE 3IKJA 3OTWA 1H3EA 2A86A 4LMBA 5K0SA 1U7UA 1TZCA 3H9EO 3MT7A 4QPNA 1A1VA 7MHTA 1J97A 2PRIA 3R7WB 3DB2A 4C7BA 2GA8A 3F3MA 2EYQA 1G8SA 1M6HA 4IXMA 5J2UF 5CFOA 2D4HA 5F1YA 1QK5A 1G5PA 1HRKA 1TMKA 2CEKA 2W2VA 2ZBRA 3L0IB 3OQBA 3PNKA 4LIPD 5K3BA 4BBPA 5KYXB 5HGJA 1JPJA 4A73A 3TCKA 3VR3D 3BXHA 4LUCA 2I62A 4EWLA 2YOGA 1F2UA 2O2EA 1XZBA 2ZREA 3ZU3A 4HNAA 1PFQA 4IDQA 4GX5A 1J1ZA 2A5JA 4OXXA 4Q5IA 3I12A 5ICEA 2O8VA 3ANXA 2XKAA 3JSAA 4L4SA 5DP2A 2W70A 2ZGVA 3AXSA 3K71B 5FPTA 2VSQA 3KJEA 1XQYA 3NWBA 4GMGA 4M87A 3SNKA 4AG5A 2I71A 1RP1A 5IXJA 3OQIB 1Z62A 3E9DA 4UCXA 1ISMA 3ROMA 5C8ZA 4GX2A 1PV2A 1RJEA 2YYYA 2ST1A 4ZVKA 5LDHA 3C6XA 1OTHA 1PJSA 1WL8A 2GM9A 2HWXA 3ANLA 3GUVA 1WDKA 4KWIA 3HNRA 2K5UA 1K5PA 2PMCA 1DRKA 4FU0A 1L9XA 1P77A 1DIAA 1XWIA 1ODJA 2REBA 1MW9X 2WMDA 1CUWA 1VBNA 3GNSA 4FPXA 4N7MA 4OQEA 4P32A 5K45A 1AMOA 4ND4A 3IEUA 4JP1A 4YCLA 4DT1A 2Q1XA 1JDBC 1XMPA 5EKTA 1SQ5A 2ZM6B 1ESDA 2RK6A 1E3IA 1E20A 2FK7A 3A3NA 3EODA 3TFQA 1QMGA 5H3LA 1E5XA 1GYQA 4NEQA 5F73A 5CLQA 5ES3A 3PLNA 4X71A 4N6OA 4NBLA 4BCCA 4XEUA 3GLGB 2OHGA 4LFAB 4QSMA 2NUAA 1SBCA 1IIRA 4AX8A 3NG1A 1POWA 4GECA 1YIOA 1IZYA 4OHVA 3I5AA 2I2WA 1GKKA 2B5WA 5TPZA 4DL9A 4BNMA 4LGVA 2Z56A 3L8FA 2WG1A 1AUOA 2ACVA 2X9NA 2Z2YA 4NYMQ 1J09A 3VOSA 4MLPA 2BHTA 2GK6A 2PCJA 2V9CA 2OV2A 3GB9A 5TMDA 3AEUB 1T3GA 3WHIA 4TYYA 4IR7A 4JB8A 1KRWA 1ZBQA 3FUTA 2R6GA 2VPYA 4Q4AB 4O02B 5JIBA 5C3UA 3FMVA 4CIXA