2OGFA

Crystal structure of protein mj0408 from methanococcus jannaschii, pfam duf372
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
121
structure length
121
Chain Sequence
SLRVEETEVFKKYFKNLTDRERAVFEGGITLGALFHQFVGTPVSKYNKESLERAIEEAMKNQPCVYDIKVKIRNVGEKYVSLDGKMLDVDLKIKINKTVAHLKLEYIPEIDYPLMYVKKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein MJ0408
publication title Crystal structure of hypothetical protein MJ0408 from Methanococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Structural genomics, unknown function
total genus 34
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.25: Dihydroneopterin aldolase.
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04038 DHNA Dihydroneopterin aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.20 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 7,8-dihydroneopterin aldolase (MptD) 2ogfA00
2I52A 2OGFA 2IECA
chains in the Genus database with same CATH superfamily
2OGFA 2A84A 3CFHL 4DE5A 3IMEA 4MUNA 3CI0I 4G5YA 2GW4A 1UFVA 3INNA 3COWA 3MXTA 1V8FA 3COVA 3Q12A 4MQ6A 3QTTA 3ISJA 2GR7A 5KWVA 2GR8A 3CFAL 2A86A 3IOCA 2A7XA 3IVCA 5EXCA 4EF6A 1N2HA 1N2IA 2IECA 2X3FA 3COZA 4MUHA 2EJCA 3IMGA 2G2SA 5G2FA 3AG6A 3UY4A 3HL6A 2G3DA 2A52A 3AG5A 3IOBA 4G5FA 2A50A 1IHOA 2G5ZA 4BHRA 2I52A 3IVGA 4MUJA 3IUBA 3IVXA 4EFKA 4MUIA 3IMCA 4MUGA 4DDKA 4MUKA 2A54A 2RETA 3IODA 1N2BA 2G16A 2A88A 2A53A 5HG0A 4MUEA 1N2EA 4DDHA 3LF4A 3MUEA 4DDMA 4MULA 1N2JA 3UA0A 3EMOA 3LE8A 4IXJA 3CFIA 3CI0K 1N2OA 3CFFL 5BW0B 3IOEA 4FZJA 3UK2A 2LMEA 2A56A 3N8HA 1MOPA 3COYA 3IUEA 3Q10A 1N2GA 4MUFA
chains in the Genus database with same CATH topology
2I52A 2OGFA 2IECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I52 A;  2OGF A;  2IEC A; 
#chains in the Genus database with same CATH topology
 2OGF A;  2A84 A;  3CFH L;  4DE5 A;  3IME A;  4MUN A;  3CI0 I;  4G5Y A;  2GW4 A;  1UFV A;  3INN A;  3COW A;  3MXT A;  1V8F A;  3COV A;  3Q12 A;  4MQ6 A;  3QTT A;  3ISJ A;  2GR7 A;  5KWV A;  2GR8 A;  3CFA L;  2A86 A;  3IOC A;  2A7X A;  3IVC A;  5EXC A;  4EF6 A;  1N2H A;  1N2I A;  2IEC A;  2X3F A;  3COZ A;  4MUH A;  2EJC A;  3IMG A;  2G2S A;  5G2F A;  3AG6 A;  3UY4 A;  3HL6 A;  2G3D A;  2A52 A;  3AG5 A;  3IOB A;  4G5F A;  2A50 A;  1IHO A;  2G5Z A;  4BHR A;  2I52 A;  3IVG A;  4MUJ A;  3IUB A;  3IVX A;  4EFK A;  4MUI A;  3IMC A;  4MUG A;  4DDK A;  4MUK A;  2A54 A;  2RET A;  3IOD A;  1N2B A;  2G16 A;  2A88 A;  2A53 A;  5HG0 A;  4MUE A;  1N2E A;  4DDH A;  3LF4 A;  3MUE A;  4DDM A;  4MUL A;  1N2J A;  3UA0 A;  3EMO A;  3LE8 A;  4IXJ A;  3CFI A;  3CI0 K;  1N2O A;  3CFF L;  5BW0 B;  3IOE A;  4FZJ A;  3UK2 A;  2LME A;  2A56 A;  3N8H A;  1MOP A;  3COY A;  3IUE A;  3Q10 A;  1N2G A;  4MUF A; 
#chains in the Genus database with same CATH homology
 2I52 A;  2OGF A;  2IEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...