2OH0E

Crystal structure of protein kinase a in complex with pyridine-pyrazolopyridine based inhibitors
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
336
structure length
336
Chain Sequence
VKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and synthesis of pyridine-pyrazolopyridine-based inhibitors of protein kinase B/Akt.
pubmed doi rcsb
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
source organism Bos taurus
molecule tags Transferase
total genus 107
structure length 336
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2oh0E01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2oh0E02
4YC3A 3C13A 2EXMA 4XG4A 2VAGA 5ANKA 3SXRA 3JUHA 4TL0A 4CQGA 4F99A 1XQZA 5IUGA 2YCQA 5HOAA 1QPCA 3NDMA 5JT2A 4IVAA 4O7SA 5HIBA 1YI6A 2ZVAA 5EHYA 4RLKA 3FLNC 4AT3A 5I9UA 4EH6A 2V62A 3LQ8A 3V3VA 1KV1A 2G01A 2PVFA 5BMSA 3CJGA 3ITZA 4N4SA 1M2RA 4D4YA 3QRUA 5J7BA 2QKRA 3UO4A 5BNJA 1G8SA 2C1AA 4FL1A 3IGGA 2R64A 4PP7A 2WQOA 3D2KA 4L52A 4NT4A 3BHHA 2R0UA 2XM9A 5C9CA 3P08A 5H9BA 4DT9A 3GCQA 4XV1A 4CKJA 2ZM3A 3QLFA 2DYLA 5DR9A 5IQGA 4I3ZA 2ZV2A 3PP1A 4IQ6A 4J98A 5CF8A 3SGCA 2XBJA 3ORIA 3UYSA 4JQ8A 1V0OA 4FIHA 2IPXA 3N4VA 3QLGA 1CM8A 4B4LA 1U4DA 3FMEA 3LVPA 4QP8A 3TZ9A 3VS4A 3H4JA 3W33A 5TR6A 4E5AX 3IKAA 4IWOA 5FBOA 2BAKA 4YZBA 3GC0A 2OF2A 4F6WA 4BBFA 1OL5A 3GC8A 3QGWA 4D2VA 5AEPA 4APPA 2Z8CA 1H25A 3LJ0A 2C6LA 4FSMA 1O6KA 4IZ5A 4K18A 4TKSA 1K9AA 4S32A 3ZLXA 2P3GX 2X2KA 4LUEA 2OJIA 4ZAUA 4BI0A 5LMBA 3GXLA 3FJQE 4OBOA 3PPZA 2P55A 2VNYA 3LE6A 3OCSA 4CCUA 2W1ZA 2CGWA 3F7WA 3C50A 3CPBA 5ETFA 5TF9A 2C5NA 3M42A 5AR8A 5LVPA 2IN6A 2W1FA 3FE3A 3VNTA 1PXKA 3D4QA 3TZ8A 4PMSA 1ZYJA 2A0CX 3PY0A 4K9YA 4W4VA 1URCA 3HNGA 5H2UA 2BZKB 3SG9A 4GRBA 5GZ9A 2OKRA 4FNXA 3TV7A 2OZOA 3FY2A 3NNVA 3E5AA 2HIWA 4NM7A 2Y4PA 4EC8A 3BKBA 1UWJA 2R3FA 3NUPA 1KWPA 2R7IA 4IM2A 2XK4A 3AT2A 2BROA 3OHTA 3Q60A 4BDBA 5L4QA 4DH7A 3NWWA 3ZRKA 4OT6A 4X6RA 2IVSA 4LV5A 5CY3A 3W8QA 1VJYA 2XJ0A 3R2BA 4C0TA 2PUIA 4MXXA 3D15A 4U8ZA 1ERKA 3QALE 5EFQA 1KE9A 3U55A 4TXCA 2ZM4A 4D5KA 5HX6A 4JOAA 4QP3A 3WOWA 3VUGA 2WFYA 4Y5HA 2QVSE 2B53A 4IX4A 2J6MA 2Y6MA 3FZTA 5ICPA 5L6WL 3NUNA 3DK7A 5E9EA 4G17A 2LAVA 4RWKA 2B54A 4PV0A 3KRJA 3OUNB 3FY0A 4CLJA 2C69A 3TZ7A 2BAQA 4BIBA 1FMOE 2VWBA 4RLLA 2J9MA 2YWPA 3GNIB 3NYOA 2OFVA 4I5HA 4XBUA 3UO6A 4BKZA 4IWQA 4HCVA 3UVQA 4L68A 4IADA 2WMUA 4I6QA 3DKOA 2UZTA 5DR2A 3IDBA 4EWQA 4YC6A 3BRBA 3KFAA 2GNIA 2ZOQA 3MVMA 4HGTA 1Q99A 2PVJA 3VQHA 3A4PA 3OZ6A 4LG4A 3T3UA 4WUAA 3TDVA 4G5JA 1QPJA 4ANNA 4A4LA 1OL2A 3R02A 2GQGA 3MJ1A 4I92A 3QGYA 4U81A 2PTKA 5IZFA 4QYHA 3LLTA 2WMRA 2OXXA 2Y6OA 2X8DA 5B2KA 4O7NA 2CCHA 4GIIA 4BIEA 5HHWA 3DXQA 3NEWA 4I4FA 3ROYA 2YCFA 4FA2A 1ZYCA 5F20A 5KHWA 5IQAA 4RA4A 4IAKA 2C6MA 2O64A 5HG8A 5CF6A 3MIYA 5AA9A 4KIKA 2VX1A 3F2AA 4YZCA 3CR0A 2QKWB 3DB6A 2OXYA 4FOBA 1WBVA 4O2ZA 5HESA 4EQUA 1OL1A 3VW8A 3TDWA 3FYKX 3FZSA 5HCXA 3UOJA 5IEVA 2VO3A 1U54B 3LFDA 4RC4A 2OK1A 3DT1A 4ZY5A 2E9VA 3MVHA 3MV5A 2QURA 4AAAA 1ZY5A 2HCKA 4M14A 4ARKA 4A4OA 4BZOA 1KUTA 4PRJA 1E9HA 2X7GA 3PE2A 4QPMA 5BUIA 1ZMVA 5HO7A 4NWMA 2QOHA 2WTJA 4U42A 3ZZWA 4EOPA 3VJNA 3FHRA 3NCZA 5AP3A 2SRCA 1PKDA 2QHNA 3F3WA 3PA5A 2CSNA 4G16A 4MBJA 4QTBA 5GHVA 3MWUA 5HBHA 3R7VA 4Z55A 2X9EA 3IDCA 2EXCX 2JD5A 4AUAA 4DTAA 4L3JA 2C0IA 2J5FA 5AP1A 4L7FA 5C03A 3VUDA 3ZOSA 2W99B 4C33A 5CXZA 5FXSA 3TV6A 2FVDA 3KRLA 4I6BA 5ANDA 3RM6A 5TT7A 3FI4A 3OWLA 5HCYA 1MUOA 1XH7A 3HUCA 5EDPA 3HV5A 3CD3A 3C4WA 2HELA 3E8DA 3F5GA 4X3FA 3HZTA 3NNWA 4G1WA 2BZJA 2R0IA 3A8WA 4KIQA 2Z7RA 4X7QA 5AP4A 5ANGA 1BLXA 5AV0A 3AC2A 1ZAOA 4QYFA 4MXCA 3KXGA 3KGAA 4MWIA 4AACA 5I4NA 1WFCA 3AMYA 3PWDA 3P5KA 3NVKI 5IQIA 1J7LA 4HGSA 3C4XA 2ITWA 4UY9A 2XEZA 4ORKA 2DUVA 2J7TA 2BDWA 5H3QA 4CLIA 3Q9YA 3ZO1A 4DCAA 4O86A 3DZOA 4J99A 2F2CB 3FPMA 3IECA 4K8AA 3HV7A 3LMHA 2R3PA 3GU5A 2X39A 1BI8A 4R3CA 5FEEA 3TN8A 4MTAA 5KMJA 4RJ6A 2OIQA 2VO7A 5I9WA 4J71A 4MD9E 5HKMA 3DS6A 1UU8A 4YLJA 4YLKA 2XK9A 4MHAA 5IEYA 3VWAA 3GUBA 3QQLA 2WTDA 3HMNA 5IDNA 2YITA 3QL8A 3FDNA 3GU8A 3OBGA 4DHFA 4C62A 3SC1A 3IW7A 5GJGA 4YC8A 4RIWB 3VW6A 4V0GB 2IW8A 1Q5KA 3T9IA 3R8LA 3R8VA 1J91A 1V0PA 2UW8A 3QQJA 2BDFA 3SRVA 4AWIA 2W5HA 5LCKA 3SOAA 2WTWA 4A9UA 2IZTA 4J95A 1NW1A 3FV8A 3OXTA 3VO3A 4C37A 3QZGA 3PY1A 4L3PA 4C3RA 3D5UA 4X2GA 4PMMA 4CFUA 2QD9A 4DFZE 4OTGA 2UW3A 3EZRA 3H9FA 1S9JA 3LJ2A 2OJFE 2WQBA 3ERKA 2W1IA 1GIHA 5EM7A 5TOZA 4F4PA 4BR3A 4ZLOA 3H9OA 3TCPA 4BY9E 2VWXA 4G9RA 5AR7A 5I0BA 4FBXA 3H0ZA 3P79A 4ZY6A 2W5AA 1FPUA 1YXSA 3FKLA 4FKQA 4FK3A 3ZS5A 1W98A 3EQHA 2PULA 3OVVA 3QX2A 4GCJA 4WNOA 4DGMA 3A2CA 4M0ZA 3AD4A 5ETCA 4O21A 1UV5A 5CAVA 5EW3A 5HX8A 3NNXA 3C4ZA 2VO6A 3U51A 3I79A 2PU8A 5IKWA 1SNXA 1H1RA 3WF8A 1LUFA 3ANQA 4IE9A 4JG6A 3TI1A 3UMXA 4D9TA 3V6SA 5CASA 5I9VA 5IQCA 2BAJA 1YDRE 3C1XA 4KUJA 1KV2A 4O81A 4IIRA 4PDSA 1OIRA 4JI9A 1H8FA 2VTOA 2ZB1A 4ZS4A 3R01A 4USFA 3EKNA 4U6RA 4K2RA 3ZHPC 4NL0A 2W4JA 2WGJA 4DAWA 5CSPA 4O84A 3LHJA 4FV0A 3K5VA 4MD8E 2OJJA 4NCTA 4MVFA 1GZNA 4A9RA 4D0WA 3EQDA 3G6HA 4QTEA 4DF3A 5CU2A 4V05A 4PMPA 1OL6A 4YJSA 3QTUA 3I5NA 3ZSHA 2GQRA 3NZ0A 3FXXA 3DBQA 2BKKA 4D55A 2BR1A 3VIDA 4XG8A 1H1WA 3G9LX 4GG7A 4BCIA 1Q4LA 2WIHA 4YUQA 4WG5A 3DJ5A 3PXKA 1MQ4A 1XJDA 3RAHA 3Q5IA 2R3MA 4JBPA 3ZTXA 3EHAA 3ODZX 4R1YA 3UGCA 3PSCA 4FIIA 1TQMA 1ZOGA 3ZRLA 2XIKA 2GQSA 4FSWA 3AC3A 4L43A 5AWMA 2KULA 4L45A 4NW6A 4GT5A 3ZC5A 5IQDA 1XWSA 3ZFYA 1OIQA 4V04A 4D4RA 2WPAA 5KMMA 1Q8TA 3TZMA 3Q2MA 3REPA 4ZJJA 3SOCA 3OC1A 4EHZA 4FL2A 4RT7A 1A9UA 2ZAZA 5A14A 3TJCA 4EYMA 2R9SA 2RG6A 3RCDA 1R3CA 2GFCA 2WOTA 3QF9A 4O38A 5L3AA 4N70A 3F3UA 2IW6A 4TZRA 3LZBA 3RP9A 3TKHA 4FODA 3FC1X 4F7NA 4HNFA 2HXQA 2EU9A 4J8NA 2FYSA 5AR5A 4AA4A 4G34A 4YPDA 3T8OA 4FTRA 2XK8A 4ANOA 3QUPA 2PY3A 3FZPA 3LQ5A 3SLSA 2Y9QA 3ALOA 4UV0A 4S31A 3WIGA 3EQRA 4UBAA 4ENXA 4IW0A 3MSSA 1UU3A 1LP4A 2ESMA 2PZ5A 3UC3A 4O6EA 3Q9WA 4BHNA 4PDPA 3FMNA 3W18A 4EQMA 3W2OA 4DE4A 4J7BA 5HE1A 3UJGA 1OB3A 3E88A 3QQFA 3BU6A 3UC4A 4PNKA 2YCSA 3MI9A 2XJ2A 3FMDA 4BGHA 2RFSA 3LXNA 4FK6A 2PVNA 4Y85A 4LV8A 3MPTA 3KU2A 3S2PA 1QMZA 4EJNA 1JKLA 1PMEA 3QTQA 2BHEA 3PRFA 5FEDA 1P14A 3QD0A 4GUEA 1XH5A 2RL5A 2OBJA 4BDAA 4DC2A 4O96A 1H1QA 2Z60A 2QOBA 3HP2A 3EN7A 3A4OX 4Q9SA 3ZUUA 4XG3A 2UW4A 3O2MA 4PMTA 5EYMA 2Z7LA 5AX9A 4E4XA 4FTLA 3KQ7A 2ZJWA 2IW9A 3HRBA 2UVYA 4R6VA 3BV2A 3M2WA 3IW5A 3Q6WA 3GGFA 5JSMA 3ZO4A 5HI2A 2BTSA 4FTCA 3FYJX 5IDPA 1OKYA 3HRFA 3RMFA 1P2AA 3H3CA 4II5A 2RG5A 2EB3A 4U9AA 4E8AA 4AOTA 4XV9A 1OECA 2C5YA 3HMOA 2CKOA 3CKWA 3I81A 4LOOA 3A7GA 4RX7A 2PE2A 4D1ZA 4QQTA 4D2SA 1U5QA 5CSVA 5CENA 4YNEA 1OM1A 3CE3A 3QQGA 2BRHA 4M13A 3N4UA 4XUFA 4XOZA 5EI6A 2UW0A 1ZY4A 2C0TA 4NK9A 4O7RA 2O8YA 4UXLA 3GC7A 4Y72A 3CQUA 5J5SA 5JFSA 5M4FA 4G3DA 3WE4A 5EW8A 4BWXA 3GQLA 1PW2A 2B9HA 3FI2A 3WI6A 4F7JA 4ZSLA 5L8JA 4K6ZA 3EN9A 2XBAA 3CKXA 3ID6C 2ZMCA 4IX5A 2P0CA 3KMWA 3UZPA 2IVTA 4JAJA 4YZ9A 3VBVA 5L8LA 3AMBA 4U97A 2HY0A 3ZLWA 2F49A 4IZ7A 4OBPA 2Z2WA 3QA8A 3LFEA 3ZONA 2WTCA 2R7BA 4IM0A 1TQPA 4O7TA 3R1QA 2WTKB 1SMHA 4ZTRA 3EFJA 3F3TA 3Q04A 3R04A 2PWLA 5EW9A 3F5XA 3U9NA 2JLDA 2I1MA 3E63A 3QTZA 4XRJA 1S9IA 4KRDA 3TNWA 3V8SA 4WA9A 1M7NA 3AC5A 5C8NA 4P5ZA 5D1JA 4TYGA 4FKOA 2XIZA 5M4IA 4F70A 1FVTA 4WRGA 4FI1A 2CCIA 3MH3A 3MY5A 4U5JA 5AR4A 3I6UA 2XUUA 3BLRA 4RIXA 4FTOA 3O8UA 3ORLA 3K5UA 2QOIA 2XNNA 3F9NA 4WG4A 5CEMA 4IAZA 4I0SA 5KMOA 2ITUA 4QO9A 4PDOA 1XH4A 3FQHA 4G3CA 2VTIA 5D11A 5D7VA 3TG1A 4D4SA 4E4LA 4EBWA 3ZEWA 2OW3A 1ZZ2A 3BBTB 3BZ3A 5KMLA 2OGVA 4OAUC 3VBTA 4E4NA 1UU7A 2R3IA 3LCOA 3QRKA 5L2TA 4FZDB 5CU6A 5DEYA 2JBOA 3F88A 3OWJA 5DGZA 4M67A 2WD1A 3O71A 2GNFA 3HV6A 4XYFA 4DG2E 4FKIA 4UZHA 5CSWA 5FWKK 1OBGA 3Q3BA 5E8SA 2XJ1A 5M09A 4AX8A 4K77A 4IH8A 4QTDA 5D41A 5CT7A 4RIWA 4LRMA 2P2HA 3MBLA 3ZSGA 4EH9A 3KREA 2E9NA 1ZLTA 4EHVA 4AZWA 5KMNA 1OPLA 3LM0A 2YJSA 1NVSA 4HOKA 2W96B 3F7ZA 3L1SA 4IHPA 3ZFXA 1NT2A 3UZRA 2HWPA 3JR1A 3RAKA 1U46A 3DTCA 3GC9A 4GK4A 1OUKA 4JDJA 4TRLA 4X2NA 5FRIA 5I5ZA 3RM7A 4O91A 3I0QA 3E8NA 4ITJA 3ATTA 5DIAA 1RQQA 4O22A 2OSCA 3MB6A 2UUEA 5CT0A 3QYZA 3HA6A 4WG3A 1PXIA 3QQKA 5DVRA 1PMNA 2CNQA 3PXRA 1ND4A 1EH4A 4WNPA 4CCBA 3SW7A 5GJDA 4FEXA 3R83A 4EI4A 3ZDUA 4AN9A 2WMVA 3HX4A 4CFMA 4RIOA 3F2NA 2ITNA 3RPSA 4EH4A 3OTUA 4GJ3A 4W9WA 4ZY4A 4IAFA 5CEOA 4USEA 2UVXA 3DNDA 2YA9A 2C68A 4BCOA 5HTBA 3ODYX 4EJ7A 2NPQA 5FXQA 3BGZA 3TIYA 5DMZA 3ZO3A 2FSLX 4DLJA 2IO6A 3ULIA 4QYYA 3AC8A 5CNOA 2VWWA 4DFLA 3KN6A 1MRVA 2PUPA 4ZTLA 2PMNX 3R8ZA 2YDKA 3OEZA 4ZSEA 4YZNA 5E8UA 1R1WA 1ZWSA 4BWPA 2ITQA 4HYSA 2Y4IC 2BRBA 2B9FA 3QHWA 3WIKA 4FSRA 4F1OA 4GH2A 2NNWB 1HCLA 5EM5A 5CTPA 1OGUA 5JQ8A 4RJ8A 4XEYA 3DAJA 3AXWA 3RVGA 3VVHA 4HPTE 3ZU7A 4CRSA 1YHWA 3TTJA 3UIXA 4P90A 4H1MA 2VRXA 3D5VA 3NAXA 4OT5A 4N6YA 1RJBA 5E8XA 5AP5A 1STCE 5M06A 2E9OA 1OMWA 3CD8A 5CVFA 4X21A 5AUXA 4MQ2A 1FINA 2EWAA 4IX3A 3TACA 4TYIA 4RA5A 3NUXA 3DCVA 3HMPA 2EXEA 1PJKA 2C47A 2XCKA 4FV6A 4BCMA 2WMTA 2BZHB 3EB0A 4UEUA 5HD4A 3PG1A 3QU0A 4EOSA 3OROA 5FTOA 1YHVA 3KK8A 4YBKA 3JYAA 4E6QA 1L8TA 3UODA 2R3OA 2HY81 3ZLSA 4ASZA 1FQ1B 3R9NA 3UDBA 2CKPA 4F7SA 2XNOA 3U87A 4WNMA 3QTRA 3VBXA 4DTBA 5IF1A 4FV5A 4ASEA 5C1QB 2C6TA 3QQHA 3F5UA 1H0WA 2XIXA 4FL3A 4ZXTA 2RF9A 4C2VA 4DA5A 3EN4A 3A61A 4P4CA 4IB1A 4I41A 4OW8A 2QOCA 3VQUA 1H01A 3CSVA 3QWJA 3VBYA 3R7EA 3SW4A 4YHFA 4EBVA 3D83A 1GAGA 4BZDA 4NEUA 4D9UA 1YQJA 5IA3A 1GJOA 3LM5A 5IQHA 4O0SA 1ZZLA 1XKKA 2ITXA 1M14A 3HKOA 3EH9A 4EK4A 5JRSA 3E8EA 4E3CA 2B0QA 4ZTNA 2JEDA 4P7EA 4XMOA 5D7AA 5DG5A 3I7CA 5EM8A 4RX9A 2E9UA 5T3QA 3R71A 4B8LA 4AS0A 5CAUA 4FNWA 3PJ2A 4LM5A 4X2JA 2WQEA 3F2RA 3EQFA 2Q0BA 4C36A 4FZAB 3OY1A 3DBDA 4YSMA 3R7UA 4DH8A 3R28A 5LVMA 2ZV7A 3NYNA 3ORMA 4U40A 4C4IA 5LVOA 4O0XA 4MD7E 3EYGA 4FSYA 1UWHA 4P2KA 1OKVA 1ZXEA 4NFMA 3AGLA 2X7FA 1YVJA 2FH9A 5I9ZA 3O8PA 3II5A 5CVGA 2C6IA 4ZZOA 3VS2A 5I3RA 3IPHA 3VUKA 2XKCA 2R3LA 3NLBA 2WOUA 3LCTA 4DEGA 3N4TA 4F6SA 2BRMA 3FZ1A 4PTEA 4ID7A 1FOTA 3E87A 4MK0A 3VBQA 3IQ7A 3G2FA 3QFVA 4DG0E 2GTNA 3V8WA 4EOQA 1PYEA 3EQPA 4M69A 4RJ4A 3TKIA 4RFZA 5ACBC 3D7TA 4HVGA 3P0MA 4JQEA 5DT4A 4YZDA 4EQCA 2X6DA 3G33A 4FTQA 2QO9A 3SVVA 4F9YA 3W1FA 2YZLA 3JY9A 3FLZA 4Y95A 2HXLA 4U41A 3NNUA 3HGKA 2JKMA 4FGRA 2RKUA 3U6JA 3HUBA 3G90X 3BWJA 3UNJA 3UP2A 2ITOA 4ERWA 3GFEA 2Y0AA 1DI9A 4RC2A 4QP1A 1R0EA 2VTAA 3QZFA 4HYHA 2YAAA 4CV8A 3RAIA 4AZSA 2CJMA 3L8SA 4FKPA 4CNHA 4I22A 1KE8A 5HVJA 1Y8YA 4FICA 3G0EA 5H8GA 5DR6A 5B2LA 4BHZA 5CAQA 3O96A 4L67A 4ACCA 4EOMA 3TNHA 4G9CA 4BCQA 3D2IA 4C34A 4LL5A 4PPCA 5C01A 3HMIA 3AOXA 5HORA 5KKRC 4LOPA 1CDKA 4K1BA 4PL4A 5FLFA 1T45A 4IAAA 1REJA 5DFPA 3D7ZA 2BIKB 3JVRA 5KE0A 4KABA 4MNEB 2AYPA 4KKHA 3PIYA 2GFSA 4GMYA 1LR4A 3P23A 2V7OA 4NJ3A 4KIOA 4X6QC 5CSXA 4I0RA 3AD6A 4C4HA 4M12A 4F0FA 5IMEA 2C0OA 3KULA 1YRPA 3TUDA 4RWLA 5E8ZA 2ZV9A 5HCZA 3ZZEA 4C58A 2HAKA 2P33A 5J5TA 2YERA 4GYGA 2R3GA 2R3KA 5EDRA 3KMUA 3NGAA 4YZMA 3VC4A 5A4TA 2GCDA 2YM3A 5KKRB 4DBXA 3OTVA 2YLFA 4OBQA 4GVAA 4YHTA 5HLPA 3U4WA 3OT8A 2CNVA 3WYXA 3EKKA 4RWIA 2HZ4A 5BVDA 4PPBA 5DRBA 3EYHA 3RWQA 4TN6A 2CDZA 4H3QA 1CKJA 3KY2A 5C4KA 4KBAA 3DJ7A 3EIDA 3UOLA 4JVGA 2CHLA 3F69A 3MTFA 3ORPA 1UVRA 3UMWA 2WMQA 3S4QA 3A8XA 4RJ3A 3QKLA 4A9SA 4AN3A 4BDIA 4AZEA 1H00A 4IBMA 2JDVA 2YFXA 2ONLC 1E1VA 4OTWA 4NJDA 4NM0A 3QTSA 5D10A 1FVVA 4JR7A 4YTIA 3VULA 1KE7A 3MFUA 4FVQA 2X81A 4C38A 2VU3A 3NIZA 2XKEA 3RPRA 5CQWA 1WVYA 3CIKA 4EWHA 5JGDA 3MPAA 4KD1A 5JGBA 2EUFB 2RFEA 4WBBB 1H1PA 5ANJA 2WAJA 4JS8A 2ERZE 2FGIA 4FKUA 4B99A 4IM3A 1O6YA 1ZARA 4ACHA 4C59A 2WZJA 3KF4A 4F9WA 2J0LA 2QLQA 3NUSA 4QOXA 2FSTX 3PJ3A 5CF5A 1WVWA 5E4HA 4CGAA 3QC9A 3DLSA 3BX5A 2UZBA 4ZJIA 1PXMA 5A4QA 4E5WA 3WE8A 5JRQA 3Q4TA 1WVXA 4KBCA 2BILB 2F2UA 4CYJA 4CZYB 2OWBA 2WQNA 2UZUE 5IG1A 3V5PA 4QTAA 2VTHA 2WELA 4IDTA 4X0MA 5CZHA 1FBNA 3I7BA 5K3YA 1YKRA 5M07A 1SVHA 3LMGA 2NO3A 4MXOA 3O50A 4OTIA 4K0YA 4RIYB 4RBLA 3E62A 4XHKB 4CFVA 1O9UA 3CY3A 5BYZA 4E6AA 3HDMA 1WBPA 1ZYDA 2REIA 4C3PA 5HQ0A 3LCDA 4CZUA 3NUYA 3HAMA 2JDRA 3PP0A 1Q3DA 2OZAB 4PDYA 1OKZA 3TWJA 4EHGA 4L6QA 1FGKA 2C5XA 5FTQA 3R8MA 4MBIA 3QZIA 4G6NA 4NIFB 4WBOA 1E1XA 2O63A 5AM7A 4ZS0A 4G5PA 5J9LA 5HBJA 3G5DA 4NSTA 4Y5QA 2W17A 4A9TA 1GIIA 4L9IA 4F0GA 4QMMA 1WZYA 1YXVA 3FI8A 4I4EA 3FXWA 4GUBA 3COMA 4RSSA 4AZFA 4DLIA 3LMIA 3BCEA 4HGLA 4IZYA 4DEHA 4EKKA 5I9XA 3FL4A 2JC6A 2VD5A 4XG6A 5EYKA 3WZUA 1Z9XA 4O7YA 2XIRA 3LJ1A 4FKVA 4CYIA 5J95A 3UQFA 4M8TA 3QQUA 3ACKA 1PY5A 3IOKA 2AC5A 4IX6A 3OWKA 4AW2A 1J3HA 2BPMA 5EYCA 5GNKA 1Q61A 3IONA 4CZTA 3CS9A 3MH1A 2VTMA 4GFGA 3B2WA 2PK9A 2ZV8A 3D5XA 4GU9A 4E5BA 2C3KA 4OLIA 5I9YA 3H9RA 4YJUA 3BU3A 3NVMB 3VS3A 5HO8A 2PVLA 4KAOA 4XBRA 3NW6A 4YTFA 2NRYA 1PMUA 3LFQA 3OCBA 4FTAA 5CEKA 3BLQA 4L3LA 3V51A 5GIOE 3F66A 4F1TA 2FSMX 5KZIA 5LWMA 1JWHA 4UMTA 5M53A 4ITIA 3QTXA 5K5NA 3AGMA 3OD6X 4AGCA 4EOIA 4LYNA 4U3ZA 1CMKE 3QAME 2F7XE 2ACXA 4LI5A 4KS7A 2V5QA 2HZIA 3EQCA 3U6IA 3KK9A 5AR3A 4LRKA 4EEVA 5E8VA 2P2IA 4RG0A 2AUHA 2BDJA 3K2LA 2Q83A 4O7VA 2GDOA 3S95A 2O3PA 3VAPA 5AA8A 3PA4A 5IU2A 4XP3A 1GZKA 2BUJA 4O1OA 3O7LB 2VTPA 3KXNA 5BVOA 4FEVA 5J79A 4QMYA 3DK6A 3EQBA 3MH2A 4IVCA 1X8BA 4JT3A 2B9IA 4L8MA 4XV2A 3OUKA 4EH2A 4Y8DA 4R3PA 4FSZA 5ANOA 3ZSIA 4FEUA 4HVIA 4LMNA 4R77A 2W06A 1MQBA 3VS1A 3W8LA 2CKEA 5I3OA 4I21A 4BKJA 4L46A 4LFIA 4ALUA 2OLCA 3BQCA 5KMIA 2O2UA 5BVEA 5HE3A 1P4OA 1DAYA 2JKQA 2WXVA 2YCRA 3GCPA 3F5PA 3ZM9A 4F09A 5LMKA 5CXHA 4C02A 4CMTA 3COHA 2JAMA 3RCJA 1YXXA 1YWVA 3GB2A 4J96A 3BYSA 3NUUA 4JDIA 4FTJA 4O6LA 1YWRA 3R21A 4XG2A 3PWYA 1IR3A 4AE6A 2X9FA 3BPRA 1FGIA 5AFVA 4LOQA 1ZYLA 1MRYA 2BFYA 5AP6A 4E6DA 2YDJA 1BMKA 5EKNA 5KMKA 3FMKA 1FMKA 3SA0A 5BYYA 1KE5A 2JIUA 3U54A 5IUIA 2PVHA 2VTSA 4BC6A 4EK8A 5LWNA 1JBPE 3HMMA 2I40A 4BRXA 4Z3VA 5HU3A 4HCTA 2OXDA 3W10A 1AD5A 4FZ7A 4RQKA 5ACKA 3JXWA 4LGDA 4RFYA 1H1SA 4YHJA 2WIPA 2XVDA 4D5HA 4CTBA 4MKCA 4WO5A 2E2BA 3E7OA 3Q2JA 2QOLA 3EOCA 4OGRA 5DNRA 2JDOA 2RFDA 2UW6A 3DLZA 5EG3A 4FEQA 1W8CA 4GG5A 4U79A 1WCCA 3SG8A 4GEOA 4BCHA 5HIEA 3BE9A 3RI1A 3VBWA 3RPVA 3C5UA 3FHIA 3MN3A 4JBQA 2DS1A 5DE2A 3HAVA 2UW9A 3O17A 2GTMA 3AT4A 3GU7A 4I1ZA 3LFSA 3V01A 4QP4A 4H3PA 3FMJA 4JX7A 5FD2A 2YABA 3PIXA 2PZPA 3R8UA 4IZAA 2VTRA 4ALVA 4ANSA 5K4JA 3KN5A 3PSDA 4HPUE 4DH5A 4EH3A 2FA2A 3DZQA 4FNYA 4FX3A 2VGOA 4FZFB 3RZFA 4OTDA 5K5XA 5KNJA 2A27A 4FTKA 3BGPA 1Q24A 3VF8A 5DN3A 1JLUE 2GHLA 4TNDA 1MP8A 1SYKA 4ANBA 3VHKA 4GV1A 3GENA 4QMNA 3P1AA 5E1EA 4BDDA 5M44A 2OFUA 3K54A 3RINA 4DN5A 4TWPA 4QRCA 4GKIA 2GNHA 5GZ8A 4ZOGA 4Q5EA 4BWKA 4U45A 4F7LA 4AZTA 5J9YA 4KNBA 3ZXTA 3BHVA 3R22A 3IS5A 4D0XA 1JSUA 2E9PA 1H26A 3W2CA 3C4EA 3QRTA 4E4MA 3LXKA 5M55A 2UV2A 5AUZA 3P7CA 2YJRA 5DRDA 5HNIX 2H96A 5A54A 3NAYA 5HG5A 4HVDA 5FM2A 3COIA 2R5TA 1Q3WA 3MA3A 4NZWB 2XH5A 3ORZA 4QMSA 2QOKA 3HA8A 5KBRA 3V5TA 2GU8A 4YR8A 4IVDA 2B52A 2C4GA 4ZTQA 2YEXA 5EQEA 3AT3A 4IB3A 4NM5A 2CGXA 4IJPA 5EHOA 5FG8A 3RPOA 1RDQE 4QMZA 2JFMA 5JFXA 4QT1A 3R2YA 3QWKA 3EN5A 5EI8A 3FZOA 3S3IA 3DBEA 4BF2A 4O1PA 3EL7A 3L9LA 3QD3A 4CRLA 1I44A 4FGBA 3DDPA 3Q6UA 3S00A 3UNZA 5J8IA 2VWUA 4AW5A 4CQEA 4E20A 1CKPA 1SM2A 3W2RA 4L01A 3BWFA 3NX8A 4RPVA 2A4LA 3ORKA 4FKSA 3OBJA 4NYEA 5FBNC 3RK9A 5ITAA 2PPQA 3DU8A 4I5MA 3GOPA 4Z9LA 3H30A 4IB5A 5BVNA 4H36A 1BYGA 2F7ZE 4YTCA 5EOLA 4B8MA 1BL6A 3WYYA 4YU2A 3C51A 1BL7A 1GY3A 3A62A 3R00A 3FC2A 3FLYA 3PXZA 3PXQA 4FT7A 3UYTA 1U5RA 3UPXA 5BUEA 4NTTA 3UZTA 2QLUA 3HECA 4BDCA 1U54A 3ZRMA 4RGJA 4F9BA 3OWPA 4HGEA 4QP6A 2X8EA 2OZAA 4BZNA 5IA0A 4JQ7A 3RK5A 2OO8X 3NS9A 4FE2A 3CQEA 5DYJA 2F57A 4IB0A 2YIYA 1J7IA 2UZWE 1W83A 4DGNA 3SAYA 4Z7HA 3AQVA 2B7AA 3FL5A 4PWNA 3ULZA 3KCFA 2W1EA 4OTHA 2PYWA 5DT3A 4I94A 3TNIA 4EOOA 3PLSA 2W1GA 4CXAA 2HW6A 5AP0A 2YIQA 4LGHA 4ASDA 5HZNA 3LKMA 1OI9A 3MA6A 3QZHA 4QMLA 5CU4A 5K0XA 1YI3A 4UWBA 5M4UA 3QTIA 1L3RE 3BLHA 3HYHA 4AZVA 4AG8A 5KX8A 1ZMUA 3ORNA 5IH5A 5HG7A 5ANIA 3PY3A 3GVUA 4FG7A 3DJ6A 2R4BA 5AJQA 3DA6A 5AUUA 2X1NA 3OEFX 3JY0A 2XK7A 5HTIA 2RSVA 3L9MA 1OL7A 3FKNA 5E7RA 1MRUA 1XO2B 2J50A 4ZK5A 3ZEPA 4BFMA 2R2PA 2PVYA 2OG8A 3FAAA 4HJOA 3DKCA 4BTMA 3GCVA 3UVRA 3SQQA 1UA2A 2CN8A 3QRIA 4JX3A 3WBLA 4L00A 2C3IB 4QMPA 3KC3A 4HZSA 4QQJA 4NTSA 4S30A 3SHEA 3OT3A 4C57A 3FQEA 5BX0A 4JNWA 4U80A 3KXHA 2GNLA 4QYGA 4LMUA 2PMOX 5C8KA 2OIDA 1NA7A 3R8PA 3TJDA 3GEQA 4CMOA 4DEEA 2W5BA 4JDKA 4MX9A 5FP6A 5M4CA 2YM4A 4CD0A 5A3XA 3DQWA 2VTNA 3DBFA 2Y8OA 3UNKA 5AV1A 3QXPA 4KBKA 1F5QA 3GU6A 5BPYA 5GINE 4Q2AA 5IA5A 1XHAA 2W1DA 4ANLA 3E7VA 4C4JA 4KSQA 3UBDA 4YO6A 4DCEA 2XA4A 3RWPA 3VJOA 4D4VA 2XMYA 4V01A 3CTJA 4J52A 3FLQA 2IG7A 3PJ8A 4YSJA 4DFBA 2WHBA 4V0GA 4C7TA 4BYIA 2QI8A 4M84A 4EC9A 3R9OA 2PVKA 4QYEA 2YIXA 2VN9A 5F1ZA 2J4ZA 4ZJVA 2XZSA 4WT6A 3KL8A 3Q9ZA 3RTPA 4GKHA 2OU7A 5EKOA 4APCA 3QTWA 1TQIA 2QU5A 1VZOA 3C7QA 2QONA 3KA0A 4Y73A 4UN0C 4EONA 4OAVB 3GT8A 5IA2A 4K33A 4AGWA 3BV3A 3ELJA 3KRWA 5L2SA 3CQWA 1OKWA 4C8BA 3TT0A 2QO7A 4JBVA 4M15A 4NM3A 2VWYA 4U0IA 2ITTA 4EHEA 5K9IA 1BX6A 4QP9A 4EK6A 4WD5A 4KIKB 4HVSA 2XYNA 3CGFA 4QP2A 3ZCLA 3CJFA 3DNEA 4FKLA 3LXPA 5GIPE 4ZZMA 3MVLA 3C5IA 4UXQA 3CC6A 2WEIA 3I0OA 2PZYA 4IC7A 4YO4A 1HOWA 4BTJA 4O82A 5E1SA 4RC3A 4BIDA 4PUZA 4F64A 3CXWA 3SXSA 2OI4X 2HZNA 2G15A 3IO7A 4W8EA 5HIDA 4EUTA 2UZDA 3Q9XA 2NRUA 4QMWA 1LPUA 2PVRA 4X3FC 4UALA 2A2AA 5CYIA 5G6VA 5TE0A 4QPAA 2YACA 4E73A 5AUYA 5TKDA 4YJQA 2FSOX 4G3FA 5FP5A 2J90A 2VWVA 3I6WA 2F4JA 3HLLA 1TKIA 1W82A 2WU7A 2XNBA 2Y4IB 2W1CA 4BTKA 1GNGA 4FIFA 4LGGA 4WKQA 5HLWA 5AAFA 5M08A 1GIJA 3N51A 4YLLA 5CQUA 1Q8UA 3JVSA 4X3FB 1OIYA 2HZ0A 5FGKA 3G15A 1KOBA 3O7LD 4TTHB 1APME 4F1MA 4AP7A 3DY7A 5J7HA 3BI6A 5CAOA 4RJ5A 5J9ZA 3PXYA 3OOMA 4JBOA 4W9XA 3G6GA 4CMUA 2QOFA 3W2PA 1WBTA 4Y46A 1CKIA 2PMLX 2VTJA 2WMXA 2JAVA 3NUAA 4FT0A 5CWZA 4MYGA 3L9PA 3CGOA 2C3LA 4BYJA 3DFAA 4AXAA 4S2ZA 5E92A 4FUXA 1UKHA 2G1TA 2QC6A 4OUCA 3R63A 2ITYA 2PZRA 2QOQA 2VTQA 3BHTA 3F82A 3MIAA 4L44A 3ET7A 3IK3A 4XJ0A 3NPCA 1M2PA 3E64A 3VRZA 3FI3A 3GU4A 3VUHA 2GPHA 4GJ2A 3RBWA 4IJ9A 3RGFA 2PSQA 3ANRA 3LFFA 4GU6A 3OS3A 4CV9A 3ORTA 3KRXA 1F3MC 3ZUTA 1R0PA 4FTTA 3WZDA 5L2WA 2YN8A 3SD0A 4ACDA 2YM8A 3PFQA 3ENMA 3UOHA 3M1SA 4G6LA 5JN2A 3JPVA 5J1VA 3QBNA 3UO5A 3ZFMA 3UPZA 1LEZA 4XP0A 4CFFA 3ZYAA 3QKMA 2I0EA 3KXXA 5CSHA 3UE4A 4CT2A 4FKRA 1F0QA 5IQBA 2F9GA 1H28A 4AT5A 3C0IA 1SNUA 1WBWA 2X4ZA 2J51A 2UZOA 3SRVB 3U8WA 4R7BA 5A6NA 4XX9A 2JDTA 5E8WA 3QKKA 4D1XA 4DBNA 4BDFA 3WARA 1RE8A 3K3JA 5FXRA 1Y6BA 3OF0A 2PE0A 3D5WA 3W2SA 5M51A 5FUTA 5HICA 2VTLA 4FKJA 4DFXE 4ENYA 4P5QA 3PPJA 3ROCA 4EK5A 4YBJA 4B6LA 4ACMA 4EKLA 4N0SA 5CEIA 1H07A 3Q53A 3PVGA 1BKXA 2WNTA 5AIRA 4KKEA 3IDPA 5LOHA 4UB7A 2ZDTA 5ANEA 2X2LA 2X0GA 3BE2A 3IOPA 4FR4A 4NCTC 4AF3A 3L8VA 4L42A 3C4CA 3UVPA 3BQRA 1Q8ZA 2XM8A 4YURA 3DPKA 4Q5HA 2VNWA 4C4EA 3E3PA 1VR2A 1Q97A 4G31A 3QC4A 4XRLA 4O0YA 5DH3A 2G2HA 4I5PA 3DAEA 4JRNA 1PRYA 1WAKA 4FKWA 4KIPA 1ZOEA 4IEBA 2HENA 4W4WA 4XV3A 5JEBA 3FMMA 4FSUA 4QMXA 3ZDIA 1IA9A 2WO6A 4JRVA 3TIZA 1BI7A 2XCHA 4I93A 1YXUA 2C1BA 4A9YA 1YOLA 2IZUA 4IACA 4D2RA 3LFAA 3AMAA 3UIUA 1PXNA 2YM5A 3DKFA 2G9XA 3P7BA 5JKGA 2OICA 4HW7A 4FIEA 4E93A 4E7WA 4IC8A 4ZIMA 4ANQA 5EYDA 2QO2A 4TYJA 2W4KA 5D9HA 5AIKA 5E90A 3PE1A 4OTQA 1YOJA 4RQVA 2C5OA 3VF9A 1QPDA 2BIYA 4XG9A 4M7IA 3I1AA 1SVEA 5CZIA 3NSZA 4F63A 2F7EE 3HDNA 4TW9A 5CF4A 4FG9A 2CLXA 2O0UA 3D14A 3LCKA 4FT3A 3NW7A 4IWDA 5AUWA 5TO8A 4BCGA 4M66A 2I0HA 2C5VA 3DK3A 1Y57A 4UZDA 4R1VA 2ITVA 1YHSA 3PSBA 3TV4A 2KTYA 5LCJA 2NP8A 4FV2A 1O6LA 1PF8A 1QPEA 2J0MB 2ETMA 4N57A 2QU6A 3TEIA 2GNJA 3BEAA 3DQXA 3I4BA 3TNPC 5K4IA 4O7WA 2WTIA 2X2MA 1A48A 1JPAA 1YOMA 3R1SA 3AD5A 2XEYA 3ATSA 3BGQA 4TYHB 5ETIA 2PVMA 1HCKA 1M7QA 4NW5A 5CU3A 4JIAA 3WZJA 2UZNA 3MFRA 4PTCA 4RZVA 2RFNA 1UNHA 2UZLA 3PIZA 1U59A 1Z57A 2CMWA 4EZ5A 2C6DA 4FZ6A 2YLEA 4M0YA 4BTFA 4QD6A 2ZYBA 4FTIA 2QG5A 3AC4A 4GVJA 3ZBFA 4QPSA 4NKAA 4UYAA 4MAOA 2Z7QA 1H0VA 3QCXA 4FKTA 3P86A 3D94A 3R30A 5DI1A 5CVHA 2GNGA 1BUHA 2JITA 2ZB0A 1OZ1A 4GYIA 4AW1A 5LQFA 3ZUVA 3RNYA 2R3QA 4KKGA 3UQCA 2V0DA 3B2TA 3FSKA 4B7TA 3MH0A 3MDYA 4FNZA 3E93A 3EFLA 5A46A 2HWOA 3QD4A 2QNJA 2YAKA 2XK3A 1H4LA 4YJVA 3G51A 4YTHA 2VGPA 3ZMMA 1V1KA 4G3EA 4JDHA 3H0YA 4UMRA 3GQIA 2IZSA 4LQMA 3NYVA 3IW6A 4BL1A 3G0FA 4YJPA 4RX8A 2GHGA 1QCFA 2V7AA 5L2QA 3O0GA 3OW4A 4U7ZA 1I09A 2XP2A 4I23A 4D28A 4PPAA 3RNIA 4CKRA 4BGQA 5L8KA 4R78A 4H1JA 3Q4UA 2WEVA 2WKMA 4UX9A 5AV2A 3DBCA 3HEGA 3KXMA 4YJNA 5AP7A 1XH9A 4FF8A 4EYJA 2XRUA 2XK6A 3OXIA 3W55A 3WF7A 4EH7A 4EORA 4BCPA 4FV3A 4TWOA 3LFCA 1IEPA 4QQ5A 5DT0A 5H8EA 4I0TA 4TWCA 2W9ZB 5A4CA 4O0WA 5A4EA 5JMSA 3U6HA 3PLAE 3DOGA 1WBSA 2C6OA 3R7YA 5DA3A 1OUYA 2W4OA 2IWIA 3V5QA 5FDPA 5IQFA 5LARA 3S1HA 3ZC6A 4BBEA 3AC1A 4AOIA 4J97A 2BFXA 3E8CA 3POZA 4RJ7A 5LXMA 3CLYA 1PXJA 4OTRA 4DFYA 4PX6A 4QMQA 4GS6A 5IA4A 4W4YA 3MW1A 4DGGA 4MXAA 2OF4A 3U9CA 4WIHA 4BBMA 2XKFA 3HRCA 1ZYSA 2IVVA 4RVKA 3HVCA 3RJCA 3R1YA 3KB7A 2BTRA 4X2KA 1Q8YA 3V5JA 4TNBA 3EZVA 1UKIA 4HNIA 4CEGA 4UMPA 3DTWA 1TVOA 1DS5A 2ETKA 1JKTA 2BRNA 4ITHA 1ZOHA 2HW7A 5KHXA 5F94A 5IISA 3C0HA 4I6HA 2WMAA 3P9JA 4O2PA 2YZAA 3HP5A 4HYUA 4I5CA 2ERKA 4F6UA 3NMUF 5B0XA 4ERKA 5AMNA 2CLQA 1IASA 4GT3A 4BICA 2C3JA 5HVYA 4MQ1A 4WSYA 4FG8A 3EQIA 4TYEA 5FEQA 2V55A 4C4GA 3A7FA 4FIGA 3KMMA 4RIXB 2BZIB 4N6ZA 2H8HA 3IW8A 4S34A 4XS2A 4D2WA 4ZTMA 4R3RA 3D9VA 5HLNA 3PTGA 4CTCA 3OW3A 5AAEA 3FUPA 4JLCA 4BN1A 4EUUA 2OIBA 3FMHA 3PRIA 4RFMA 3DXNA 3R7OA 4JAIA 5J87A 4FT9A 3THBA 5D12A 3MJ2A 2JDSA 3O8TA 4H58A 4RZWA 4C61A 5CS6A 4O27B 1OPJA 3A7JA 3OXZA 4FYOA 4IFCA 3C0GA 5HNBA 4MXZA 3NIEA 2PE1A 3QHRA 3BYUA 4TPTA 4Y83A 5ETAA 3VS0A 4FTUA 4WUNA 2OJ9A 5EHLA 4TY1A 5KUPA 2XKDA 3B8QA 5A9UA 5H8BA 3DGKA 4LUDA 5F9EA 2WMBA 3LIJA 4ZSAA 2VZ6A 5LVLA 1P4FA 1J7UA 4F0IA 4YNOA 3IG7A 3KKVA 2PZIA 3MTLA 3QCSA 4QMOA 4DFNA 5LJJA 1B38A 3ZH8A 4M97A 2JKKA 4MWHA 4NKSA 3ORXA 4GK3A 4C4FA 2QOOA 4ZZNA 3FZRA 2AC3A 4NFNA 4BCKA 4IVBA 1YDSE 4ZMFA 4FTMA 5IUHA 3GI3A 3PZHA 2IZRA 2W05A 1KE6A 4LL0A 2YWVA 2XNEA 4RWJA 5CNNA 3R9HA 3TNQB 3ZXZA 3O23A 2BRGA 4DEBA 5CX9A 4F9AA 2YM6A 4MEDA 2BALA 5HE2A 3KVXA 2GS2A 3Q32A 3ZBXA 4AU8A 1YWNA 3PJ1A 4GFOA 4QP7A 2J2IB 4WNKA 4UMQA 1K3AA 3F3VA 3Q4CA 4A07A 2QR8A 4BKYA 2VTTA 5M57A 3L9NA 3NR9A 4HCUA 4QMTA 4U3YA 3TXOA 4FT5A 3QXOA 1VYZA 4IXPA 4O0TA 1FVRA 1PKGA 4DH1A 3MESA 3TUCA 5AAGA 2JFLA 1REKA 2VWZA 2FO0A 2WTVA 3EFKA 3QCQA 4GW8A 4AGUA 3OOGA 4MXYA 3L8PA 5HE0A 1LEWA 2PMIA 3Q52A 3UOKA 2R3NA 4USDA 4ZLYA 5L2IA 4UWYA 4B0GA 4DGLC 4GL9A 2C6KA 1NVRA 1SVGA 5AR2A 4O7ZA 5HVKA 3QX4A 4IANA 4CFXA 1WBOA 3COKA 3C9WA 3CBLA 1PXOA 2J0IA 4FMQA 1NY3A 5CAPA 2YIRA 3EL8A 4G3GA 4ACGA 5DLSA 4DYMA 3FWQA 5CANA 5JQ5A 4JXFA 3BEGA 4RX5A 3CY2A 4ZLZA 4JIKA 3KF7A 3PYYA 3DKGA 2B4SB 4PF4A 1NVQA 3BELA 4AW0A 1NXKA 4RRVA 3G9NA 2DWBA 2EVAA 3PG3A 5E8YA 5L6PA 1Q41A 3MS9A 1V0BA 2UW7A 4HYIA 4FEWA 4JG8A 2O5KA 2VUWA 2LGCA 3A99A 2W1HA 3QYWA 3GBZA 4PQNA 3VUIA 4XLVA 5E8TA 3BHUA 4PTGA 5AX3A 5AADA 2B55A 4ONAA 3SV0A 3TL8A 4MNEA 3KCKA 3KXZA 5FTGA 1JNKA 4JR3A 5K0KA 2FUMA 4AGDA 3EMGA 4ASXA 3VS6A 4CSVA 1WMKA 3E92A 5JFWA 2BVAA 2WQMA 2GMXA 3FLWA 3R1NA 2P4IA 3NYXA 2DQ7X 3I60A 4U44A 4GSBA 4ZEGA 4I24A 4MF0A 3UIBA 4GK2A 2QHMA 3HV3A 5CLPA 4K11A 2PUUA 4TT7A 4S33A 5EM6A 1XR1A 5HBEA 4BI2A 1OIUA 3V8TA 2H6DA 2IJMA 2X4FA 3MYGA 3Q4ZA 2CPKE 3CCNA 4KA3A 2X6EA 4JJRA 4BB4A 3BHYA 4BI1A 4RVTA 3AG9A 4MF1A 3EJ1A 3RHKA 3RZBA 1W84A 2G2IA 1XH6A 5EI2A 1PXLA 4XNEA 4DT8A 1G3NA 3PJCA 2VO0A 3V5LA 3P7AA 4DEIA 4JL9A 2WMSA 1AGWA 5BVFA 4TYHA 1VEBA 1Y8GA 1URWA 2VX0A 3OY3A 4E26A 4NU1A 4CFWA 3QCYA 3R6XA 4R7IA 3OG7A 4AT4A 3R9RA 2YHVA 1IG1A 4Q9ZA 1T46A 3VRYA 2QG7A 5DEWA 4BVUA 4Z16A 3VUTA 2JKOA 1JSTA 4FVRA 1G5SA 2RIOA 4OR5A 4B9DA 4CVAA 4U43A 3MY1A 3O51A 3P78A 4BCFA 4L7SA 2BHHA 1OBDA 5KCVA 3T9TA 4H3BA 5GZAA 5M56A 4F65A 2XNPA 4O7LA 4ZTSA 4HZRA 1CTPE 1B6CB 4M68A 1YDTE 2ONLA 5BVWA 4QMVA 5EK7A 4KRCA 4AOJA 4FV8A 5E91A 3BYVA 3WILA 5F95A 3QUEA 1Q8WA 4WRSA 4PL3A 3VUMA 3ZM4A 3NW5A 5C8MA 3FBVA 5IEXA 1GZ8A 5DHJA 1YW2A 5AM6A 2FB8A 3PXFA 2R3JA 4FV9A 5DOSA 3CTQA 3PA3A 5HG9A 3VS7A 4FVPA 1DAWA 4FV1A 1W0XC 2XNMA 4WOVA 4EOKA 4CG8A 4FC0A 1PXPA 4RIYA 2ETRA 5EQPA 2XB7A 3SDJA 2XS0A 5T68A 4D1SA 4ANMA 4IAYA 4EOJA 2C6EA 2JIVA 4QNYA 2UVZA 5AP2A 3U4UA 3PZEA 2QODA 3TUBA 3LXLA 4M69B 4G6OA 1KOAA 4NIFA 3D7TB 2GHMA 5DWRA 3RHXA 4FUYA 4PL5A 2B9JA 3I5ZA 3F3ZA 4FOCA 4NUSA 4DEAA 1Y91A 2BCJA 4XH6A 2CNUA 3UG2A 1ATPE 2BKZA 2I0VA 2YIWA 3F61A 2GS7A 3BU5A 4KINA 2HYYA 4ZSGA 5C4LA 2WTKC 4FV7A 3QRJA 4DG3E 3D0EA 3PDTA 3R7GA 3P4KA 3LW0A 4IWPA 5DPVA 3HV4A 5IMXA 5GJFA 2I0YA 1K2PA 4FSTA 4F08A 2ZMDA 5JGAA 3VN9A 3CPCA 5KBQA 1Y6AA 5J1WA 4FSQA 3SX9A 5F4NA 3UQGA 4BDEA 3CEKA 4RVLA 1PYXA 4FSNA 2A1AB 2XIYA 4GIHA 4M3QA 3VHEA 3GP0A 4EK3A 4EZ7A 5CU0A 3MGYA 1JKSA 5HNGA 3QA0A 1KSWA 2QQ7A 3E3BX 4J1RA 3DFCB 4R8QA 4KWPA 3DB8A 5JK3A 3A7IA 3R9DA 5AUTA 4PNIA 4O83A 3LOKA 1XBBA 1GZOA 5BQ0A 3BBWA 4PP9A 2WU6A 2W0JA 3EWHA 5BYLA 1J1BA 5JH6A 3LLAA 3A7HA 3Q96A 3RPYA 3EQGA 5HU9A 1DM2A 2ZDUA 4ZMEA 2VV9A 4YJOA 3GFWA 2X7OA 2ITZA 5IH4A 4MH7A 5BVKA 4ZP5A 3KULB 1J1CA 1M17A 3PVWA 3POOA 4YGAA 2QCSA 3W2QA 1H27A 5KZ0A 5C26A 5IA1A 5HTCA 3FSFA 2ZM1A 4KB8A 4AA5A 2OJGA 1JQHA 1IRKA 3CP9A 4DEDA 3K3IA 1GOLA 4XP2A 4R5YA 4A06A 2YM7A 5B7VA 4EZ3A 3CTHA 3LCSA 2J0JA 3EN6A 4BDHA 2J5EA 2WB8A 2R3HA 4DGOA 3C4FA 4I6FA 1SZMA 4L53A 4C35A 3MFSA 3FLSA 4BDGA 4DINA 3T3VA 4G2FA 2R3RA 3FKOA 4QTCA 4QNAA 1XBAA 2W7XA 4XLIA 1OPKA 4XOYA 4HVHA 4PY1A 3OP5A 3TM0A 3FMLA 3OFMA 4IMYA 1RW8A 4CG9A 2YDIA 3H10A 1Z5MA 5FDXA 4OTPA 3FQSA 1JVPP 4BDJA 3FEGA 3WF6A 3L8XA 1UU9A 5CEPA 2QR7A 2H34A 3MPMA 3MB7A 3UTOA 4AA0A 3QD2B 4WSQA 2J0KA 4X3JA 3RALA 2HK5A 4IDVA 2C30A 4H39A 4CFNA 2V22A 4AE9A 3LFBA 4C3FA 4CT1A 3WF5A 2O65A 5EOBA 3RK7A 2W9FB 4AQCA 5IPJA 4UYNA 3SXFA 3ALNA 4IFGA 3WZEA 3EFWA 3N9XA 4W8DA 3IGOA 3UP7A 5A6OA 4OTFA 5AV3A 3UIMA 3V5WA 3BYOA 4FKGA 4YJRA 4WHZA 3OCGA 5FQDC 1G8AA 5A4LA 5CI6A 2PHKA 3DDQA 4AFEA 4AN2A 4DITA 4GFMA 2I7QA 2CGVA 4D2TA 4JG7A 3V04A 3QUDA 4EL9A 5L6OA 1ZMWA 3A60A 5AV4A 4W4XA 1OITA 5FM3A 3SKCA 4C2WA 1Q62A 1IAHA 1JKKA 3BYMA 4R7HA 1M2QA 2XRWA 2Z02A 3LQ3A 3HL7A 2VX3A 3WF9A 4J53A 2XNGA 3WZKA 1JSVA 1IAJA 4UWCA 3PPKA 2XYUA 1IA8A 5HD7A 1ZRZA 3LFNA 3Q5ZA 4QMUA 5BUJA 2YISA 4QQCA 2JIIA 3GCUA 3NRMA 4X2FA 5LMAA 5B2MA 1OVEA 2PUNA 4O0VA 4ZSJA 3R73A 1XBCA 2GS6A 4O0UA 5HGIA 5EH0A 2BMCA 3ENHA 3LPBA 2OH4A 3BIZA 2OH0E 1H24A 3PVUA 4BGGA 1W7HA 1JAMA 1M52A 2VWIA 3UG1A 3S0OA 2H9VA 4ALWA 1PHKA 1YI4A 3GCSA 4RMZA 4KSPA 3KEXA 5DBXA 2PL0A 5HO6A 5BMMA 4AFJA 3DAKA 4BDKA 3PVBA 5JFVA 3OCTA 4DTKA 5CALA 3W16A 4CKIA 3DXPA 4J8MA 2UZEA 4F9CA 4E6CA 1YXTA 3KVWA 4Z7GA 2WMWA 1B39A 3FPQA 4D58A 4EOLA 3JS2A 5CI7A 3KRRA 5JZJA 2Q0NA 5G1XA 1WBNA 3F6XA 4YP8A 4BCNA 2IVUA 3B8RA 4MCVA 4O0RA 4H05A 4YPSA 5KO1A 1CSNA 1UNLA 1A06A 1JOWB 2HOGA 4RVMA 4DH3A 5IH6A 4R5SA 2CN5A 3MY0A 5T6KA 3ZLYA 3MFTA 2CGUA 1PMVA 3VS5A 3M11A 5HEZA 2UW5A 2CKQA 4DFUA 4YJTA 1H08A 5JZNA 4ZTHA 4IAIA 5EDQA 1UNGA 3W32A 1AQ1A 3PUPA 4BCJA 2ITPA 5IQEA 1R78A 4MNFA 3ACJA 5LVNA 1VYWA 3GOKA 2B1PA 4FYNA 3RAWA 1XH8A 3TTIA 1R39A 4KS8A 3MVJA 2GSFA 1QL6A 2UZVA 1DI8A 4XG7A 4I20A 5CEQA 2A19B 4MBLA 5AUVA 4FTNA 3ZO2A 3TKUA 4TWNA 2Z7SA 1P5EA 3FXZA 2I6LA 3R0TA 3IW4A 5EQYA 2JBPA 5C27A 2X8IA 2Y7JA 4FV4A 3DV3A 4EH5A 3V6RA 2JGZA 4UMUA 5LMKC 2G2FA 2RGPA 4LRJA 3NCGA 4NH1A 2XF0A 3RKBA 4A7CA 4A4XA 3ETAA 4YMJA 4E1ZA 4FIJA 3LAUA 3OMVA 4XCUA 4D2PA 4GT4A 4EH8A 3R7IA 2EB2A
chains in the Genus database with same CATH superfamily
4YC3A 3C13A 2EXMA 4XG4A 2VAGA 5ANKA 3SXRA 3JUHA 3AKKA 4TL0A 4CQGA 4F99A 1XQZA 5IUGA 2YCQA 5HOAA 1QPCA 3ML1A 3NDMA 5JT2A 4IVAA 4O7SA 5HIBA 1YI6A 2ZVAA 5EHYA 4RLKA 3FLNC 4AT3A 5I9UA 4EH6A 2V62A 3LQ8A 3V3VA 1KV1A 2G01A 2PVFA 5BMSA 3CJGA 3ITZA 4N4SA 1M2RA 4D4YA 3QRUA 5J7BA 2QKRA 3UO4A 5BNJA 1G8SA 4FRFA 2C1AA 4FL1A 3IGGA 2R64A 4PP7A 2WQOA 3D2KA 4L52A 4NT4A 3BHHA 2R0UA 2XM9A 5C9CA 3P08A 5H9BA 4DT9A 3GCQA 4XV1A 4CKJA 2ZM3A 3QLFA 2DYLA 5DR9A 5IQGA 4I3ZA 2ZV2A 3PP1A 4IQ6A 4J98A 5CF8A 3SGCA 2XBJA 3ORIA 3UYSA 4JQ8A 1V0OA 4FIHA 2IPXA 3N4VA 3QLGA 1CM8A 4B4LA 1U4DA 3FMEA 3LVPA 4QP8A 3TZ9A 3VS4A 3H4JA 3W33A 5TR6A 4E5AX 3IKAA 4IWOA 5FBOA 2BAKA 4YZBA 3GC0A 2OF2A 4F6WA 4BBFA 1OL5A 3GC8A 3QGWA 4D2VA 5AEPA 4APPA 2Z8CA 1H25A 3LJ0A 2C6LA 4FSMA 1O6KA 4IZ5A 4K18A 4TKSA 1K9AA 4S32A 3P5JC 3ZLXA 2P3GX 2X2KA 4LUEA 2OJIA 4ZAUA 4BI0A 5LMBA 3GXLA 3FJQE 4OBOA 3PPZA 2P55A 2VNYA 3LE6A 3OCSA 4CCUA 2W1ZA 2CGWA 3F7WA 3C50A 3CPBA 5ETFA 5TF9A 2C5NA 3M42A 5AR8A 5LVPA 2IN6A 2W1FA 3FE3A 3VNTA 1PXKA 3D4QA 3TZ8A 4PMSA 1ZYJA 2A0CX 3PY0A 4K9YA 4W4VA 1URCA 3HNGA 5H2UA 2BZKB 3SG9A 4GRBA 5GZ9A 2OKRA 4FNXA 3TV7A 2OZOA 3FY2A 3NNVA 4AXFA 3E5AA 2HIWA 4NM7A 2Y4PA 4EC8A 3BKBA 1UWJA 2R3FA 3NUPA 1KWPA 2R7IA 4IM2A 2XK4A 3AT2A 2BROA 3OHTA 3Q60A 4BDBA 5L4QA 4DH7A 3NWWA 3ZRKA 4OT6A 4X6RA 2IVSA 4LV5A 5CY3A 3W8QA 1VJYA 2XJ0A 3R2BA 4C0TA 2PUIA 4MXXA 3D15A 4U8ZA 1ERKA 3QALE 5EFQA 1KE9A 3U55A 4TXCA 2ZM4A 4D5KA 5HX6A 4JOAA 4QP3A 3WOWA 3VUGA 2WFYA 4Y5HA 2QVSE 2B53A 4IX4A 2J6MA 2Y6MA 3FZTA 5ICPA 5L6WL 3NUNA 3DK7A 5E9EA 4G17A 2LAVA 4RWKA 2B54A 4PV0A 3KRJA 3OUNB 3FY0A 4CLJA 2C69A 3TZ7A 2BAQA 4BIBA 1FMOE 2VWBA 4RLLA 2J9MA 2YWPA 3GNIB 3NYOA 2OFVA 4I5HA 4XBUA 3UO6A 4BKZA 4IWQA 4HCVA 3UVQA 4L68A 4IADA 2WMUA 4I6QA 3DKOA 2UZTA 5DR2A 3IDBA 4EWQA 4YC6A 3BRBA 3KFAA 2GNIA 2ZOQA 3MVMA 4HGTA 4AQKA 1Q99A 2PVJA 3VQHA 3A4PA 3OZ6A 4LG4A 3T3UA 4WUAA 3TDVA 1G8JA 4G5JA 1QPJA 4ANNA 4A4LA 1OL2A 3R02A 1TFFA 2GQGA 3MJ1A 4I92A 3QGYA 4U81A 2PTKA 5IZFA 4QYHA 3LLTA 2WMRA 2OXXA 2Y6OA 2X8DA 5B2KA 4O7NA 2CCHA 4GIIA 4BIEA 5HHWA 3DXQA 3NEWA 4I4FA 3ROYA 2YCFA 4FA2A 1ZYCA 5F20A 5KHWA 5IQAA 4RA4A 4IAKA 2C6MA 2O64A 5HG8A 5CF6A 3UDSA 3MIYA 5AA9A 4KIKA 2VX1A 3F2AA 4YZCA 3CR0A 2QKWB 3DB6A 2OXYA 4FOBA 1WBVA 4O2ZA 5HESA 4EQUA 1OL1A 3VW8A 3TDWA 3FYKX 3FZSA 5HCXA 3UOJA 5IEVA 2VO3A 1U54B 3LFDA 4RC4A 2OK1A 3DT1A 4ZY5A 2E9VA 3MVHA 3MV5A 2QURA 4AAAA 1ZY5A 2HCKA 4M14A 4ARKA 4A4OA 4BZOA 1KUTA 4PRJA 1E9HA 2X7GA 3PE2A 4QPMA 5BUIA 1ZMVA 5HO7A 4NWMA 2QOHA 2WTJA 4U42A 3ZZWA 4EOPA 3VJNA 3FHRA 3NCZA 5AP3A 2SRCA 4O4CA 1PKDA 2QHNA 3F3WA 3PA5A 2CSNA 4G16A 4MBJA 4QTBA 5GHVA 3MWUA 5HBHA 3R7VA 4Z55A 2X9EA 3IDCA 2EXCX 2JD5A 4AUAA 4DTAA 4L3JA 2C0IA 2J5FA 5AP1A 4L7FA 5C03A 3VUDA 3ZOSA 2W99B 4C33A 5CXZA 5FXSA 3TV6A 2FVDA 3KRLA 4I6BA 5ANDA 3RM6A 5TT7A 3FI4A 3OWLA 5HCYA 3BL7A 1MUOA 1XH7A 3HUCA 5EDPA 3HV5A 3CD3A 3C4WA 2HELA 3E8DA 3F5GA 4X3FA 3HZTA 3NNWA 4G1WA 2BZJA 2R0IA 3A8WA 4KIQA 2Z7RA 4X7QA 5AP4A 5ANGA 1BLXA 5AV0A 3AC2A 1ZAOA 4QYFA 4MXCA 3KXGA 3KGAA 4MWIA 4AACA 5I4NA 1WFCA 3AMYA 3PWDA 3P5KA 3NVKI 5IQIA 1J7LA 4HGSA 3C4XA 2ITWA 4UY9A 2XEZA 4ORKA 2DUVA 2J7TA 2BDWA 5H3QA 4CLIA 3Q9YA 3ZO1A 4DCAA 4O86A 3DZOA 4J99A 2F2CB 3FPMA 3IECA 4K8AA 3HV7A 3LMHA 2R3PA 3GU5A 2X39A 1BI8A 4R3CA 5FEEA 3TN8A 4MTAA 5KMJA 4RJ6A 2OIQA 2VO7A 2XANA 4O4BB 5I9WA 4J71A 4MD9E 5HKMA 3DS6A 1UU8A 4YLJA 4YLKA 2XK9A 4MHAA 5IEYA 3VWAA 3GUBA 3QQLA 2WTDA 3HMNA 5IDNA 2YITA 3QL8A 3FDNA 3GU8A 3OBGA 4DHFA 4C62A 3SC1A 3IW7A 5GJGA 4YC8A 4RIWB 3VW6A 1W2DA 4V0GB 2IW8A 1Q5KA 3T9IA 3R8LA 2IF8A 3R8VA 1J91A 1V0PA 2UW8A 3QQJA 2BDFA 3SRVA 4AWIA 2W5HA 5LCKA 3SOAA 2WTWA 4A9UA 2IZTA 4J95A 1NW1A 3FV8A 3OXTA 3VO3A 4C37A 3QZGA 3PY1A 4JMQA 4L3PA 4C3RA 3D5UA 4X2GA 4PMMA 4CFUA 2QD9A 4DFZE 4OTGA 2UW3A 3EZRA 3H9FA 1S9JA 3LJ2A 2OJFE 2WQBA 3ERKA 2W1IA 1GIHA 5EM7A 5TOZA 4F4PA 4BR3A 4ZLOA 3H9OA 3TCPA 4BY9E 2VWXA 4G9RA 5AR7A 5I0BA 4FBXA 3H0ZA 3P79A 3BLAA 4ZY6A 2W5AA 1FPUA 1YXSA 3FKLA 4FKQA 4FK3A 3ZS5A 1W98A 3EQHA 2PULA 3OVVA 3QX2A 4GCJA 4WNOA 4DGMA 4QEBA 3A2CA 4M0ZA 3AD4A 5ETCA 4O21A 1UV5A 5CAVA 5EW3A 5HX8A 3NNXA 3C4ZA 2VO6A 3U51A 3I79A 2PU8A 5IKWA 1SNXA 1H1RA 3WF8A 1LUFA 3ANQA 4IE9A 4JG6A 3TI1A 3UMXA 4D9TA 3V6SA 5CASA 5I9VA 5IQCA 2BAJA 1YDRE 3C1XA 4KUJA 1KV2A 4O81A 4IIRA 4PDSA 1OIRA 4JI9A 1H8FA 2VTOA 2ZB1A 4ZS4A 3R01A 4USFA 3EKNA 4U6RA 4K2RA 3ZHPC 4NL0A 2W4JA 2WGJA 4DAWA 5CSPA 4O84A 3LHJA 4FV0A 3K5VA 4MD8E 2OJJA 4NCTA 4MVFA 1GZNA 4A9RA 4D0WA 3EQDA 3G6HA 4QTEA 4DF3A 5CU2A 4V05A 4PMPA 1OL6A 4YJSA 3QTUA 3I5NA 3ZSHA 2GQRA 3NZ0A 3FXXA 3DBQA 2BKKA 4D55A 3PFYA 2BR1A 3VIDA 4XG8A 1H1WA 3G9LX 4GG7A 4BCIA 3BL9A 1Q4LA 2WIHA 4YUQA 4WG5A 3DJ5A 3PXKA 1MQ4A 1XJDA 3RAHA 3Q5IA 2R3MA 4JBPA 3ZTXA 3EHAA 3ODZX 4R1YA 3UGCA 3PSCA 4FIIA 1TQMA 1ZOGA 3ZRLA 2XIKA 2GQSA 4FSWA 3AC3A 4L43A 5AWMA 2KULA 4L45A 4NW6A 4GT5A 3ZC5A 5IQDA 1XWSA 3ZFYA 1OIQA 4V04A 4D4RA 2WPAA 5KMMA 1Q8TA 3TZMA 3Q2MA 3REPA 4ZJJA 3SOCA 3OC1A 4EHZA 1XMLA 4FL2A 4RT7A 1A9UA 2ZAZA 5A14A 3TJCA 4EYMA 2R9SA 2RG6A 3RCDA 1R3CA 2GFCA 2WOTA 3QF9A 4O38A 5L3AA 4N70A 3F3UA 2IW6A 4TZRA 3LZBA 3RP9A 3TKHA 4FODA 3FC1X 4F7NA 4HNFA 2HXQA 2EU9A 4J8NA 2FYSA 5AR5A 4AA4A 4G34A 4YPDA 3T8OA 4FTRA 2XK8A 4ANOA 3QUPA 2PY3A 3FZPA 3LQ5A 3SLSA 2Y9QA 3ALOA 4UV0A 4S31A 3WIGA 3EQRA 4UBAA 4ENXA 4IW0A 3MSSA 1UU3A 1LP4A 2ESMA 2PZ5A 3UC3A 4O6EA 3Q9WA 4BHNA 4PDPA 3FMNA 3W18A 4EQMA 3W2OA 4DE4A 4J7BA 5HE1A 3UJGA 1OB3A 3E88A 3QQFA 3BU6A 3UC4A 4PNKA 2YCSA 3MI9A 2XJ2A 3FMDA 4BGHA 2RFSA 3LXNA 4FK6A 2PVNA 4Y85A 4LV8A 3MPTA 3KU2A 3S2PA 1QMZA 4EJNA 1JKLA 1PMEA 3QTQA 2BHEA 3PRFA 5FEDA 1P14A 3QD0A 4GUEA 1XH5A 2RL5A 2OBJA 4BDAA 4DC2A 4O96A 1H1QA 2Z60A 2QOBA 3HP2A 3EN7A 3A4OX 4Q9SA 3ZUUA 4XG3A 2UW4A 3O2MA 4PMTA 5EYMA 2Z7LA 5AX9A 4E4XA 4FTLA 3KQ7A 2ZJWA 2IW9A 3HRBA 2UVYA 4R6VA 3BV2A 3M2WA 3IW5A 3Q6WA 3GGFA 2X0OA 5JSMA 3ZO4A 5HI2A 2BTSA 4FTCA 3FYJX 5IDPA 2AEGA 1OKYA 3HRFA 3RMFA 1P2AA 3H3CA 4II5A 2RG5A 2EB3A 4U9AA 4E8AA 4AOTA 4XV9A 1OECA 2C5YA 3HMOA 2CKOA 3W0MA 3CKWA 3I81A 4LOOA 3A7GA 4RX7A 2PE2A 4D1ZA 4QQTA 4D2SA 1U5QA 5CSVA 5CENA 4YNEA 1OM1A 3CE3A 3QQGA 2BRHA 4M13A 3N4UA 4XUFA 4XOZA 5EI6A 2UW0A 3O5AA 1ZY4A 2C0TA 4NK9A 4O7RA 2O8YA 4UXLA 3GC7A 4Y72A 3CQUA 5J5SA 5JFSA 5M4FA 4G3DA 3WE4A 5EW8A 4BWXA 3GQLA 1PW2A 2B9HA 3FI2A 3WI6A 4F7JA 4ZSLA 5L8JA 4K6ZA 3EN9A 2XBAA 3CKXA 3ID6C 2ZMCA 4IX5A 2P0CA 3KMWA 3UZPA 2IVTA 4JAJA 4YZ9A 3VBVA 5L8LA 3AMBA 4U97A 2HY0A 3ZLWA 2F49A 4IZ7A 4OBPA 2Z2WA 3QA8A 3LFEA 3ZONA 2WTCA 2R7BA 4IM0A 1TQPA 4O7TA 3R1QA 2WTKB 1SMHA 4ZTRA 3EFJA 3F3TA 3Q04A 3R04A 2PWLA 5EW9A 3F5XA 3U9NA 2JLDA 2I1MA 3E63A 3QTZA 4XRJA 1S9IA 4KRDA 3TNWA 3V8SA 4WA9A 1M7NA 4DHIB 3AC5A 5C8NA 4P5ZA 5D1JA 4TYGA 4FKOA 2XIZA 5M4IA 4F70A 1FVTA 4WRGA 4FI1A 2CCIA 3MH3A 3MY5A 4U5JA 5AR4A 3I6UA 2XUUA 3BLRA 4RIXA 4FTOA 3O8UA 3ORLA 3K5UA 2QOIA 2XNNA 3F9NA 4WG4A 5CEMA 4IAZA 4I0SA 5KMOA 2ITUA 4QO9A 4PDOA 1XH4A 3FQHA 4G3CA 2VTIA 5D11A 5D7VA 3TG1A 4D4SA 4E4LA 4EBWA 3ZEWA 2OW3A 1ZZ2A 3BBTB 3BZ3A 5KMLA 2OGVA 4OAUC 3VBTA 4E4NA 1UU7A 2R3IA 3LCOA 3QRKA 5L2TA 4FZDB 5CU6A 5DEYA 2JBOA 3F88A 3OWJA 5DGZA 4M67A 2WD1A 3O71A 2GNFA 3HV6A 4XYFA 4DG2E 4FKIA 4UZHA 5CSWA 5FWKK 1OBGA 3Q3BA 5E8SA 2XJ1A 5M09A 4AX8A 4K77A 4IH8A 4QTDA 5D41A 5CT7A 4RIWA 4LRMA 2P2HA 3MBLA 3ZSGA 4EH9A 3KREA 2E9NA 1ZLTA 4EHVA 4AZWA 5KMNA 1OPLA 3LM0A 2YJSA 1NVSA 4HOKA 2W96B 3F7ZA 3L1SA 4IHPA 3ZFXA 1NT2A 3UZRA 2HWPA 3JR1A 3RAKA 1U46A 3DTCA 3GC9A 4GK4A 1OUKA 4JDJA 4TRLA 4X2NA 5FRIA 5I5ZA 3RM7A 4O91A 3I0QA 3E8NA 4ITJA 3ATTA 5DIAA 1RQQA 4O22A 2OSCA 3MB6A 2UUEA 5CT0A 3QYZA 3HA6A 4WG3A 1PXIA 3QQKA 5DVRA 1PMNA 2CNQA 3PXRA 1ND4A 1EH4A 4WNPA 4CCBA 3SW7A 5GJDA 4FEXA 3R83A 4EI4A 3ZDUA 4AN9A 2WMVA 3HX4A 4CFMA 3PUFC 4RIOA 3F2NA 2ITNA 3RPSA 4EH4A 3OTUA 4GJ3A 4W9WA 4ZY4A 4IAFA 5CEOA 4USEA 2UVXA 3DNDA 2YA9A 2C68A 4BCOA 5HTBA 3ODYX 4EJ7A 2NPQA 5FXQA 3BGZA 3TIYA 5DMZA 3ZO3A 2FSLX 4DLJA 2IO6A 3ULIA 4QYYA 3AC8A 5CNOA 2VWWA 4DFLA 3KN6A 1MRVA 2PUPA 1W2CA 2PMNX 4ZTLA 2YDKA 3OEZA 4ZSEA 3R8ZA 4YZNA 5E8UA 1R1WA 1ZWSA 4BWPA 2ITQA 4HYSA 2Y4IC 2BRBA 2B9FA 3QHWA 3WIKA 4FSRA 4F1OA 4GH2A 2NNWB 1HCLA 5EM5A 5CTPA 1OGUA 5JQ8A 4RJ8A 4O4EA 3DAJA 3AXWA 4XEYA 3RVGA 4HPTE 3VVHA 3ZU7A 1YHWA 3TTJA 3UIXA 4CRSA 4P90A 4H1MA 2VRXA 3D5VA 3NAXA 4OT5A 4N6YA 1RJBA 5E8XA 5AP5A 1STCE 5M06A 2E9OA 1OMWA 3CD8A 5CVFA 4X21A 5AUXA 4MQ2A 1FINA 2EWAA 4IX3A 3TACA 4TYIA 4RA5A 3NUXA 3DCVA 3HMPA 2EXEA 1PJKA 2C47A 2XCKA 4FV6A 4BCMA 2WMTA 2BZHB 3EB0A 4UEUA 5HD4A 3PG1A 3QU0A 4EOSA 3OROA 5FTOA 1YHVA 3KK8A 4YBKA 3JYAA 4E6QA 1L8TA 3UODA 2R3OA 2HY81 3ZLSA 4ASZA 1FQ1B 3R9NA 3UDBA 2CKPA 4F7SA 4DDGA 2XNOA 3U87A 4WNMA 3QTRA 3VBXA 4DTBA 5IF1A 4FV5A 4ASEA 5C1QB 2XARA 2C6TA 3QQHA 3F5UA 1H0WA 1ST0A 2XIXA 4FL3A 4ZXTA 2RF9A 4C2VA 4DA5A 4AAYA 3EN4A 3A61A 4P4CA 4IB1A 4I41A 4OW8A 2QOCA 3VQUA 1H01A 3CSVA 3QWJA 3VBYA 3R7EA 3SW4A 4YHFA 4EBVA 3D83A 1GAGA 4BZDA 4NEUA 4D9UA 1YQJA 5IA3A 1GJOA 3LM5A 5IQHA 4O0SA 1ZZLA 1XKKA 2ITXA 1M14A 3HKOA 3EH9A 4EK4A 5JRSA 3E8EA 4E3CA 2B0QA 4ZTNA 2JEDA 4P7EA 4XMOA 5D7AA 5DG5A 3I7CA 5EM8A 4RX9A 2E9UA 5T3QA 3R71A 4B8LA 4AS0A 5CAUA 4FNWA 3PJ2A 4LM5A 4X2JA 2WQEA 3F2RA 3EQFA 2Q0BA 4C36A 4FZAB 3OY1A 3DBDA 4YSMA 3R7UA 4DH8A 3R28A 5LVMA 2ZV7A 3NYNA 3ORMA 4U40A 4C4IA 5LVOA 4O0XA 4MD7E 3EYGA 4FSYA 1UWHA 4P2KA 1OKVA 3TMOA 1ZXEA 4NFMA 3AGLA 2X7FA 1YVJA 2FH9A 5I9ZA 3O8PA 3II5A 5CVGA 2C6IA 4ZZOA 3VS2A 5I3RA 3IPHA 3VUKA 2XKCA 2R3LA 3NLBA 2WOUA 3LCTA 4DEGA 3N4TA 4F6SA 2BRMA 3FZ1A 4PTEA 4ID7A 1FOTA 3E87A 4MK0A 3VBQA 3IQ7A 3G2FA 3QFVA 4DG0E 2GTNA 3V8WA 4EOQA 1PYEA 3EQPA 4M69A 4RJ4A 3TKIA 4RFZA 5ACBC 3D7TA 4HVGA 3P0MA 4JQEA 5DT4A 4YZDA 4EQCA 2X6DA 3G33A 4FTQA 2QO9A 3SVVA 4F9YA 3W1FA 2YZLA 3JY9A 3FLZA 4Y95A 2HXLA 4U41A 3NNUA 3HGKA 2JKMA 4FGRA 2RKUA 3U6JA 3HUBA 3G90X 3BWJA 3UNJA 3UP2A 2ITOA 4ERWA 3GFEA 2Y0AA 1DI9A 4RC2A 4QP1A 1R0EA 2VTAA 3QZFA 4HYHA 2YAAA 4CV8A 3RAIA 4AZSA 2CJMA 3L8SA 4FKPA 4CNHA 4I22A 1KE8A 5HVJA 4AXCA 1Y8YA 4FICA 3G0EA 5H8GA 5DR6A 5B2LA 4BHZA 5CAQA 3O96A 4L67A 4ACCA 4EOMA 3TNHA 4G9CA 4BCQA 3D2IA 4C34A 4LL5A 4PPCA 5C01A 3HMIA 3AOXA 5HORA 5KKRC 4LOPA 1CDKA 4K1BA 4PL4A 5FLFA 1T45A 4IAAA 1REJA 5DFPA 3D7ZA 2BIKB 3JVRA 5KE0A 4KABA 4MNEB 2AYPA 4KKHA 3PIYA 2GFSA 4GMYA 1LR4A 3P23A 2V7OA 4NJ3A 4KIOA 4X6QC 5CSXA 4I0RA 3AD6A 4C4HA 4M12A 4F0FA 5IMEA 2C0OA 3KULA 1YRPA 3TUDA 4RWLA 5E8ZA 2ZV9A 5HCZA 3ZZEA 4C58A 2HAKA 2P33A 5J5TA 2YERA 4GYGA 2R3GA 2R3KA 5EDRA 3KMUA 3NGAA 4YZMA 3VC4A 5A4TA 2GCDA 2YM3A 5KKRB 4DBXA 3OTVA 2YLFA 4OBQA 4GVAA 4YHTA 5HLPA 3U4WA 3OT8A 2CNVA 3WYXA 3EKKA 4RWIA 2HZ4A 5BVDA 4PPBA 5DRBA 3EYHA 3RWQA 4TN6A 2CDZA 4H3QA 1CKJA 3KY2A 5C4KA 4KBAA 3DJ7A 3EIDA 3UOLA 4JVGA 2CHLA 3F69A 3MTFA 3ORPA 1UVRA 3UMWA 2XAMA 2WMQA 3S4QA 3A8XA 4RJ3A 3QKLA 4A9SA 4AN3A 4BDIA 4AZEA 1H00A 4IBMA 2JDVA 2YFXA 2ONLC 1E1VA 4OTWA 4NJDA 4NM0A 3QTSA 5D10A 1FVVA 4JR7A 4YTIA 1TZDA 3VULA 3AKJA 1KE7A 3MFUA 4FVQA 2X81A 4C38A 2VU3A 3NIZA 2XKEA 3RPRA 5CQWA 1WVYA 3CIKA 4EWHA 5JGDA 3MPAA 4KD1A 5JGBA 2EUFB 2RFEA 4WBBB 1H1PA 5ANJA 2WAJA 4JS8A 2ERZE 2FGIA 4FKUA 4B99A 4IM3A 1O6YA 1ZARA 4ACHA 4C59A 2WZJA 3KF4A 4F9WA 2J0LA 2QLQA 3NUSA 4QOXA 2FSTX 3PJ3A 5CF5A 1WVWA 5E4HA 4CGAA 3QC9A 3DLSA 3BX5A 2UZBA 4ZJIA 1PXMA 5A4QA 4E5WA 3WE8A 5JRQA 3Q4TA 1WVXA 4KBCA 2BILB 2F2UA 4CYJA 4CZYB 2OWBA 2WQNA 2UZUE 5IG1A 3V5PA 4QTAA 2VTHA 2WELA 4IDTA 4X0MA 5CZHA 1FBNA 3I7BA 5K3YA 1YKRA 5M07A 1SVHA 3LMGA 2NO3A 4MXOA 3O50A 4OTIA 4K0YA 4RIYB 4RBLA 3E62A 4XHKB 4CFVA 1O9UA 3CY3A 5BYZA 4E6AA 3HDMA 1WBPA 1ZYDA 2REIA 4C3PA 5HQ0A 3LCDA 4CZUA 3NUYA 3HAMA 2JDRA 3PP0A 1Q3DA 2OZAB 4PDYA 1OKZA 3TWJA 4EHGA 4L6QA 1FGKA 2C5XA 5FTQA 3R8MA 4BJJA 4MBIA 3QZIA 4G6NA 4NIFB 4WBOA 1E1XA 2O63A 5AM7A 4ZS0A 4G5PA 5J9LA 5HBJA 3G5DA 4NSTA 4Y5QA 2W17A 4A9TA 1GIIA 4L9IA 4F0GA 4QMMA 1WZYA 1YXVA 3FI8A 4I4EA 3FXWA 4GUBA 3COMA 4RSSA 4AZFA 4DLIA 3LMIA 3BCEA 4HGLA 4IZYA 4DEHA 4EKKA 5I9XA 3FL4A 2JC6A 2VD5A 4XG6A 5EYKA 3WZUA 1Z9XA 4O7YA 2XIRA 3LJ1A 4FKVA 3NFFB 4CYIA 5J95A 3UQFA 4M8TA 3QQUA 3ACKA 1PY5A 3IOKA 2AC5A 4IX6A 3OWKA 4AW2A 1J3HA 2BPMA 5EYCA 5GNKA 1Q61A 3IONA 4CZTA 3CS9A 3MH1A 2VTMA 4GFGA 3B2WA 2PK9A 2ZV8A 3D5XA 4GU9A 4E5BA 2C3KA 4OLIA 3W0RA 5I9YA 3H9RA 4YJUA 3BU3A 3NVMB 3VS3A 5HO8A 2PVLA 3W0SA 4KAOA 4XBRA 3NW6A 4YTFA 2NRYA 1PMUA 3LFQA 3OCBA 4FTAA 5CEKA 3BLQA 4L3LA 3V51A 5GIOE 3F66A 4F1TA 2FSMX 5KZIA 5LWMA 1JWHA 4UMTA 5M53A 4ITIA 3QTXA 5K5NA 3AGMA 3OD6X 4AGCA 4EOIA 4LYNA 2NYAA 4U3ZA 1CMKE 3QAME 2F7XE 2ACXA 4LI5A 4KS7A 2V5QA 2HZIA 3EQCA 3U6IA 3KK9A 5AR3A 4LRKA 4EEVA 5E8VA 2P2IA 4RG0A 2AUHA 2BDJA 3K2LA 2Q83A 4O7VA 2GDOA 3S95A 2O3PA 3VAPA 5AA8A 3PA4A 5IU2A 4XP3A 1GZKA 2BUJA 4O1OA 3O7LB 2VTPA 3KXNA 5BVOA 4FEVA 5J79A 4QMYA 3DK6A 3EQBA 3MH2A 4IVCA 1X8BA 4JT3A 2B9IA 4L8MA 4XV2A 3OUKA 4EH2A 4Y8DA 4R3PA 4FSZA 5ANOA 3ZSIA 4FEUA 4HVIA 4LMNA 4R77A 2W06A 1MQBA 3VS1A 3W8LA 2CKEA 5I3OA 4I21A 4BKJA 4L46A 4LFIA 4ALUA 2OLCA 3BQCA 5KMIA 2O2UA 5BVEA 5HE3A 1P4OA 1DAYA 2JKQA 2WXVA 2YCRA 3GCPA 3F5PA 3ZM9A 4F09A 5LMKA 5CXHA 4C02A 4CMTA 3COHA 2JAMA 3RCJA 1YXXA 1YWVA 3GB2A 4J96A 3BYSA 3NUUA 4JDIA 4FTJA 4O6LA 1YWRA 3R21A 4XG2A 3PWYA 1IR3A 4AE6A 2X9FA 3BPRA 1FGIA 5AFVA 4LOQA 1ZYLA 1MRYA 2BFYA 5AP6A 4E6DA 2YDJA 1BMKA 5EKNA 5KMKA 3FMKA 1FMKA 3SA0A 5BYYA 1KE5A 2JIUA 3U54A 5IUIA 2PVHA 2VTSA 4BC6A 4EK8A 5LWNA 1JBPE 3HMMA 2I40A 4BRXA 4Z3VA 5HU3A 4HCTA 2OXDA 3W10A 1AD5A 4FZ7A 4RQKA 5ACKA 3JXWA 4LGDA 4RFYA 1H1SA 4YHJA 2WIPA 2XVDA 4D5HA 4CTBA 4MKCA 4WO5A 2E2BA 3E7OA 3Q2JA 2QOLA 3EOCA 4OGRA 5DNRA 2JDOA 2RFDA 2UW6A 3DLZA 5EG3A 4FEQA 1W8CA 4GG5A 4U79A 1WCCA 3SG8A 4GEOA 4BCHA 5HIEA 3BE9A 3RI1A 3VBWA 3RPVA 3C5UA 3FHIA 3MN3A 4JBQA 2DS1A 5DE2A 3HAVA 2UW9A 3O17A 2GTMA 3AT4A 3GU7A 4I1ZA 3LFSA 3V01A 4QP4A 4H3PA 3FMJA 4JX7A 5FD2A 2YABA 3PIXA 2PZPA 3R8UA 4IZAA 2VTRA 4ALVA 4ANSA 5K4JA 3KN5A 3PSDA