2OH0E

Crystal structure of protein kinase a in complex with pyridine-pyrazolopyridine based inhibitors
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
336
structure length
336
Chain Sequence
VKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Design and synthesis of pyridine-pyrazolopyridine-based inhibitors of protein kinase B/Akt.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 107
structure length 336
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2oh0E01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2oh0E02
3NUNA 3BLQA 2F2CB 3MW1A 4IAFA 1KOBA 2UZBA 4ID7A 3W18A 3EQFA 3FI3A 1NVSA 5FTOA 1ZY5A 3SG8A 2I40A 3ORMA 4X3JA 5FXSA 3NVMB 1XBBA 3BGZA 4AACA 5I9VA 4NEUA 4LV8A 4NKSA 3ORPA 4HNIA 2JBPA 4C8BA 3E63A 5IPJA 2XIKA 3LCOA 1NXKA 4DEGA 3S1HA 5F95A 1P4OA 4U8ZA 4KIOA 1CKPA 4CMUA 2RL5A 1ZYDA 5IZFA 2OGVA 2JFLA 3Q6UA 2DS1A 3F61A 3QCSA 1SVHA 1U5RA 5FDXA 5HO6A 1F0QA 4I23A 3R8PA 4BDHA 2X9EA 4KNBA 1CTPE 4YJQA 3MFUA 2GMXA 4DG3E 1TKIA 4D1XA 3RZBA 5C26A 4Z16A 5JFXA 2IZUA 4U43A 4XV1A 3BWFA 2OXXA 3PXKA 2ZB1A 4XLIA 1KOAA 5L2WA 3E62A 1V0BA 2VO0A 4D2WA 4RGJA 4OAUC 5DYJA 4YJUA 3QFVA 4FBXA 5JH6A 4OLIA 3BHYA 4CT2A 1H1SA 3LIJA 3FMNA 3V6RA 2UZOA 4FIIA 3HAVA 1EH4A 3R9DA 1H26A 4BBFA 5DVRA 3R1NA 3PXZA 3A7GA 4C36A 1G3NA 3C0IA 4FX3A 2VTRA 3G15A 3HL7A 2X9FA 2XF0A 3EZVA 2R3RA 3RCDA 3MIAA 3HMPA 3OEZA 4QMOA 4CYJA 4DH3A 4PP7A 1KE9A 4XV9A 4NU1A 2VGOA 3MDYA 4DFXE 4E5BA 3LMIA 4QTEA 2JLDA 3TUDA 1Y57A 3QBNA 5JZJA 4E5AX 1BI7A 4JG6A 3RJCA 3G90X 3DDPA 2WMXA 3EYHA 5T6KA 1FVRA 3C7QA 2QOIA 2UVXA 4HZRA 4BVUA 2W17A 3U9NA 3ZUVA 4X2JA 3A60A 5CQWA 4CEGA 5H9BA 3H9OA 3QLFA 4M3QA 3MA6A 4HVHA 4I6BA 5ANOA 3LQ3A 4LGGA 4J52A 4FTIA 5HQ0A 4EH2A 3CQEA 3R1QA 5AP1A 2OZOA 3FWQA 4AGWA 4GKHA 4ANBA 1BX6A 4PDPA 4XBRA 3W2OA 4ZZOA 4EONA 3R1SA 2QG5A 5KMLA 5IUGA 4LM5A 4C7TA 2XNGA 2XJ0A 3OD6X 4IC8A 4F1OA 4EI4A 4UN0C 5A4LA 4O6LA 1CSNA 1RQQA 2YITA 3O8PA 4APPA 3BRBA 5CAOA 4L7FA 1Q8ZA 2OW3A 2DUVA 3QYZA 4BL1A 5BNJA 2CGXA 5J5TA 1CKJA 3QU0A 4LOPA 3TL8A 5IQBA 2R3OA 3TXOA 3ID6C 2O65A 2ETKA 2PUNA 3BYUA 2C6MA 3MVJA 3GBZA 4MF1A 4CFUA 1FVTA 5A4QA 4QD6A 2QURA 3LM5A 2X0GA 2EXEA 4OBQA 3DJ5A 3W8LA 3R2YA 5T68A 1K2PA 4XP3A 5E91A 5LVNA 4CZYB 4N57A 2R3HA 5FXQA 5A54A 5AUTA 2GHMA 3UDBA 4ANMA 4CMOA 3IK3A 3ENHA 4CNHA 5CXZA 2OIQA 3DB8A 3EN9A 3D4QA 2C6LA 4GFOA 4PL5A 5AUYA 2KULA 2YLEA 3W32A 5IA3A 2YAAA 5KKRC 5DNRA 5HO7A 3GENA 4KSQA 1Q61A 4MNEA 4NM0A 4AT3A 1B6CB 3D5VA 5CAPA 4ANLA 4BIBA 2YCFA 2O3PA 3DOGA 2C0OA 4ITJA 4O81A 1WAKA 4H39A 4JI9A 4F0FA 4GVJA 3KCFA 4RT7A 4XG8A 4W8EA 4DH7A 2G2IA 5EKOA 1KE7A 3ZBXA 2HY0A 4ZAUA 2QLQA 5L6OA 4PPAA 2OJFE 4FK3A 1S9JA 3EZRA 2WEIA 4MK0A 4S33A 3HRBA 2XJ1A 1ZMUA 3ZXZA 1LEWA 1U59A 3W33A 1LPUA 4UB7A 4EWQA 4A06A 1VZOA 1OUKA 4KS8A 5CI7A 5HZNA 1KE8A 2BUJA 2P0CA 4BTMA 2CSNA 1SYKA 2PZ5A 2WPAA 2RFSA 2J7TA 5TF9A 5AM6A 3UNZA 2QOHA 3B2WA 3DFAA 2YM6A 3VF9A 3ZDIA 2YWVA 1DI9A 1DI8A 4BCMA 1H0WA 2XNBA 5JSMA 2JKQA 2LGCA 1H1QA 3D7TA 3IG7A 4BFMA 4OTPA 2IVUA 4FIFA 4EK8A 4D9UA 3VS5A 3S2PA 2QODA 4BRXA 3QKLA 1E1XA 2H96A 5HO8A 4M8TA 2C3IB 2IVSA 3C50A 4JS8A 4D2PA 5L2TA 1YRPA 3NUAA 3TG1A 4O84A 1P5EA 3NX8A 2VTOA 5CAQA 3UZRA 3W1FA 3ZONA 4XMOA 3ZRMA 4EOLA 5LMBA 3EN7A 3DBDA 2YM8A 1Z57A 4BZNA 4X21A 3O51A 1GZ8A 3PA5A 2RFNA 3AT3A 3R83A 5GZ8A 4CKRA 4F7JA 5EYMA 5BYZA 4BCFA 2QQ7A 3R7GA 3W2QA 4JVGA 3PPKA 3ULZA 2QHNA 3RVGA 2VWBA 3QTZA 4G3FA 5IA4A 3PY0A 2R7IA 3EN5A 3IKAA 3QGWA 3LM0A 4PPCA 2FYSA 3FC2A 3EJ1A 2PVMA 3HLLA 4QMTA 1BYGA 3MB7A 3PP1A 3QD0A 4Y83A 5J87A 3CE3A 3ZYAA 3VUKA 2C6IA 4I41A 3D5UA 1YXTA 3CKWA 3PJ2A 3R7OA 1PY5A 5AAFA 1A9UA 3MYGA 2NRYA 4WUAA 2GNIA 3LCSA 4F70A 3ZZEA 2YAKA 5FP5A 3NVKI 4CCUA 4LMUA 2CJMA 4UV0A 3E8CA 4X3FC 3GVUA 4YJPA 4JBVA 3RAIA 3R0TA 3U4UA 4BCOA 3OC1A 4JIKA 3NZ0A 3Q6WA 5E9EA 4XRJA 1KWPA 3QZHA 4FKJA 4TT7A 2PVRA 2XNMA 3JY9A 2YHVA 2FA2A 5AM7A 4FNWA 3FYJX 4G3EA 3S3IA 5I0BA 2ESMA 4IX4A 4WRGA 3BQRA 2CMWA 1GZKA 3JVRA 4IHPA 2UW0A 3D9VA 4AGDA 2PZIA 5AP6A 3ZSIA 1PXJA 4JG7A 4QP2A 1ZARA 4TWPA 3KULB 3VRYA 4C4IA 5IF1A 3KCKA 4O0SA 3VULA 3BE9A 3CJFA 4UXLA 2EUFB 4JBOA 4UZHA 4JT3A 4O91A 3KVXA 2XK4A 2W96B 5HD7A 4Q9SA 3ACKA 2J51A 2Y6OA 5EHOA 3DGKA 3QCXA 2LAVA 4DGMA 3OBJA 5CS6A 3RAWA 5FTGA 3VF8A 5IQHA 3HX4A 4F4PA 5JMSA 3WF8A 5EM8A 2B52A 3VQHA 3P78A 4F9WA 1UU9A 5IUIA 5IMEA 3ZEWA 4GFMA 4ASEA 5I9UA 4TYIA 1OIUA 5HVJA 1GOLA 3MS9A 2XYUA 3OY3A 3KRWA 3DXPA 2WMSA 5C8MA 3ZSGA 3QTSA 3D0EA 1O9UA 4NKAA 4ZTRA 4E5WA 1Y8GA 4CTCA 2EB3A 3AC4A 1E9HA 3LJ2A 3MVLA 5D7VA 3FLNC 4F6SA 4CMTA 1Y6AA 3I81A 4QOXA 4W4WA 3R2BA 4WNPA 4AN9A 4DCEA 2F57A 2B7AA 4BDEA 3LXLA 5L8JA 3BE2A 2BAKA 2JIVA 2B0QA 1ZYJA 4DBNA 3LFDA 2C1BA 3OUNB 4MWHA 2BHEA 3CTJA 3TDVA 3LJ1A 3F3UA 1Q24A 1REKA 2J0LA 2QKRA 4X3FB 4EYJA 5H2UA 4D55A 4UWYA 4TY1A 1YDSE 3LVPA 3R9OA 2YISA 3QUDA 3THBA 4QYGA 1BLXA 1PXLA 3UC3A 1FGKA 2XJ2A 3R9HA 2YDKA 1ND4A 1MP8A 5E8ZA 3RNIA 2OG8A 4NFNA 4IWPA 5L2QA 2IJMA 3NNWA 3FLYA 5I3OA 3V5WA 2XS0A 2YM7A 5IQFA 5D9HA 4EBWA 5IQGA 5FBOA 1CDKA 3NUYA 4TRLA 3UP2A 2VO7A 3PWYA 3DS6A 3NUSA 3FC1X 2UZLA 3G0FA 3DZQA 3EQIA 4OTIA 5F20A 3D2KA 1FQ1B 3BU5A 3U9CA 4CFMA 5CYIA 2BFYA 4FTAA 4CD0A 3OWLA 1ZOEA 2CGWA 3GI3A 3KK8A 3QKMA 2VTJA 4IACA 4FR4A 3KMUA 5M55A 4MBIA 4E6AA 2H34A 2UW6A 1XH4A 4GV1A 2GNFA 3DNDA 5HX8A 3I5ZA 5I9ZA 4D1ZA 4K33A 5EHLA 3NMUF 2OJIA 4EZ5A 4MQ2A 3I60A 3QL8A 3HA6A 4XP2A 3UOKA 2YACA 3R7EA 2EXMA 4JLCA 4NJ3A 2HELA 2RGPA 4B9DA 4BDDA 3R9NA 4UMPA 2OU7A 4KAOA 4YTIA 4CFWA 3MFRA 3QWKA 3PE1A 5EI2A 3FLQA 3O96A 3RINA 1WVWA 1IA8A 3KF4A 5BVNA 2O5KA 4H3QA 2QO7A 3HV3A 4CT1A 1DM2A 3D83A 1BMKA 3KXMA 4RA4A 4E4MA 4EC8A 2ZV9A 4QMLA 3VW6A 5ETFA 4EK3A 2ITYA 3MPAA 5BVWA 4IM2A 4O7WA 4KINA 4KKEA 3D5XA 5IEYA 3OBGA 4E8AA 3U4WA 5L8LA 3LFAA 1P14A 1Y91A 2CGUA 2QOKA 3P23A 5DBXA 4FOCA 2XRUA 4QQ5A 4NIFA 4RQKA 3LMHA 1ZOGA 2RKUA 3DFCB 4S2ZA 3RWQA 5A4TA 3S00A 3MESA 4WT6A 5IEXA 1XBAA 3E93A 4G5JA 3SVVA 4I21A 1SNXA 1R1WA 4FT5A 5BYLA 4FIJA 3LZBA 5BVOA 3TNWA 2W1FA 3QQGA 4MEDA 4RIWA 3UBDA 5A3XA 3MH2A 2GDOA 3KXGA 3CLYA 4ZZMA 1BL7A 4NZWB 4HVSA 5AA8A 2YIQA 5JGDA 2XKCA 2ZB0A 4ONAA 2GS7A 1ZWSA 3AMYA 3NW6A 4IB1A 4PMTA 5KE0A 5C4LA 3BEAA 2BVAA 2VRXA 3NUUA 4MXXA 4A4LA 2ERKA 4LUDA 1A06A 4AFJA 3ZCLA 3LQ5A 3ZSHA 4O1PA 3PY1A 2F2UA 4XG9A 4EOQA 2P4IA 4KBCA 3ZLXA 4TYHB 1PXOA 3MI9A 3PFQA 3F5XA 4FYOA 4YNOA 1JKSA 3MH3A 3QC9A 4EOIA 2XEZA 3A2CA 4YJSA 3PTGA 3GOPA 3UP7A 2VUWA 4J96A 4XG4A 4CFXA 4DA5A 1ZAOA 3GGFA 3FPMA 4CLIA 4M84A 3BV2A 3H0ZA 4JBPA 5KUPA 5AADA 2NO3A 3BV3A 3GCSA 4QMYA 5EM7A 1Q8UA 4FEWA 1J91A 3T3VA 1JAMA 4XHKB 4FYNA 4R1YA 5A14A 4PTEA 3IW5A 4DG0E 3NPCA 3PPZA 4FV0A 4ITHA 4EKKA 1O6KA 4CQGA 4H1JA 3ELJA 5CT0A 2VD5A 4GSBA 4AS0A 1H8FA 4AN2A 5FEEA 4WNOA 1YWNA 3A99A 4DEDA 5HE1A 4E1ZA 4JDJA 4E20A 4F9YA 4L9IA 4HPTE 5HIDA 2O8YA 3VHEA 3BHTA 1YDRE 5C1QB 3RALA 2NRUA 4IADA 5EM5A 1UNGA 2XIXA 2QU5A 2I7QA 1FGIA 3HV4A 2OF4A 2WQEA 2JDRA 4L45A 4DT8A 5C03A 2WTDA 4H3PA 2Z7LA 3C4WA 3GU8A 5E8UA 4O7LA 4FV8A 1PXMA 1PW2A 2HZ0A 3UIMA 4UY9A 2A0CX 2W1ZA 2Y0AA 3EL8A 3Q5ZA 4FGRA 3MY5A 3LE6A 5M4IA 3IPHA 3QA8A 4UZDA 5EDPA 3P86A 2XRWA 3GNIB 3TKIA 4BF2A 2WU7A 4TYGA 3BYVA 5I5ZA 4FV4A 5J9LA 3K3IA 3O17A 4BTFA 1OPJA 4DGNA 2PYWA 5GZ9A 4FKRA 3UIBA 2X7GA 3M1SA 5AIRA 3ZU7A 4C58A 5FDPA 3K2LA 4NFMA 4KBKA 5FRIA 4M15A 4WG3A 5GNKA 2E2BA 3G33A 3VUTA 4BDCA 2W1HA 3OUKA 3CGOA 4F64A 3HMNA 2B54A 3FQSA 3TT0A 3VS3A 5G6VA 5EYKA 1M2RA 3L8XA 4IW0A 2WMBA 1ZZ2A 5CQUA 3S95A 4F9AA 3B8QA 3WILA 2BKKA 3C4CA 1G8SA 4ZK5A 1YOLA 1OL7A 3Q9XA 2R2PA 3A4PA 3RNYA 2PMLX 4D2VA 5CVFA 4M7IA 4O86A 1OIRA 5ANEA 4USDA 3POZA 4F7LA 3PVWA 1OZ1A 2X6DA 3R22A 4O82A 4CG8A 3FMJA 4YJTA 3ZRKA 5LARA 4BCIA 3N4VA 4FSZA 3UODA 5DOSA 1FBNA 4FSNA 4ZP5A 4YC8A 3QQHA 4RVMA 3ROCA 2OIBA 1WVXA 4TW9A 5AV3A 3UG2A 4FKTA 2GNGA 1R0EA 2AUHA 5AR5A 4Z7HA 5KBQA 3WIKA 2ITWA 4RWIA 4ACDA 5M4FA 4OW8A 4KIPA 2BRMA 4M69B 5HICA 4YLLA 4AP7A 3DY7A 4LGDA 5AIKA 1YOJA 3EFLA 3GC9A 4C3PA 1JPAA 4GH2A 4B0GA 3RP9A 1UVRA 3UO5A 4KRCA 4NCTC 3ZFYA 4J53A 5HG8A 1JSVA 3CTHA 3L8PA 4XNEA 2Q0NA 2B9FA 5FD2A 4DF3A 3VUHA 4ALUA 1S9IA 1HCLA 1MRVA 3LFQA 5GHVA 4BKYA 2C1AA 5I9YA 3ODYX 4B4LA 3SOCA 4GU6A 2VTLA 5J7BA 4R7BA 4R5SA 3PUPA 3EQBA 2C6TA 3R9RA 2HXQA 4X6RA 3EH9A 4F0IA 2VZ6A 4KABA 1IRKA 1Y8YA 1YXXA 3OCGA 4G6LA 4GFGA 4S32A 5AUZA 4B99A 4CYIA 4RZVA 2XCHA 2BZIB 2PK9A 3EN6A 4RWJA 2C6KA 3L9LA 4I3ZA 2CKEA 4L46A 3UMXA 4ZTHA 1XH6A 5HVKA 2ETRA 3JXWA 3LKMA 3U6HA 2UZWE 1KE6A 4YGAA 1T45A 3ZFXA 1OL6A 4EOJA 5CTPA 3FKNA 4GVAA 5ANKA 2ZDTA 4CV8A 4PTCA 2PVLA 3D15A 2YZAA 2W5HA 3O71A 5M08A 1MQBA 4YJVA 5AAGA 4I6FA 5AP7A 3ZLSA 4AA5A 4H58A 5M4UA 4I22A 4X2KA 2J6MA 5KO1A 3E7OA 3U8WA 3RK9A 1JQHA 4E4LA 4XV3A 4C59A 3SKCA 3Q9WA 4FTLA 2G2FA 3FUPA 3KEXA 4O22A 4QQTA 2P3GX 1UKHA 5CF8A 4BIEA 4RSSA 1CKIA 4QYHA 1ZOHA 3WF5A 2GNJA 2PVNA 2OIDA 3MIYA 3P7AA 4U81A 2C0TA 5G1XA 3C5UA 4W4VA 2GTNA 5DH3A 4EH4A 3H4JA 1YHSA 5F94A 3AC3A 3LJ0A 5AX3A 4YBJA 4BI2A 3CC6A 2R7BA 3KRRA 3PZHA 3FZSA 4WHZA 1H4LA 1LR4A 3PJ3A 4H1MA 4HGTA 2CCHA 4W9XA 4YTFA 5HBJA 1XH8A 3FL5A 3CQWA 2RG5A 4YTHA 2B9IA 2R0UA 5LVOA 1OBGA 2H6DA 3PIXA 3WF7A 3NUPA 4YP8A 1PMVA 3FXWA 4UEUA 2WKMA 4R1VA 3LLTA 4BI0A 1GAGA 2OZAB 3DU8A 1V0PA 2W9FB 4YC3A 2BRHA 4Q2AA 4YHTA 4QTAA 2VO6A 3DKFA 4FKPA 2ZVAA 1WBNA 4GL9A 4UMQA 2QONA 4X2GA 3RM6A 3KMWA 2KTYA 1RJBA 5AEPA 4USEA 4ZSEA 1FMKA 3LCKA 5LVMA 1KUTA 5FWKK 1XWSA 2PULA 4D4YA 4YTCA 4LFIA 5FQDC 4ZY6A 2QNJA 3TN8A 2X2LA 1OECA 3V8WA 4CLJA 2OI4X 3GCUA 3CKXA 4QPSA 3QQJA 4V04A 5EQYA 2Y4IC 1QMZA 4CTBA 4J98A 3NAXA 4RX9A 3NAYA 3EOCA 5HIBA 4OTGA 4ANSA 3TNQB 4O27B 1SZMA 4BZOA 5LWNA 4ZSJA 2B53A 4X2NA 4AF3A 4W4XA 3MA3A 2WEVA 2IW9A 3E3BX 4C4HA 4EZ3A 2ZV8A 4ASXA 4IEBA 4WG4A 2XBAA 5GJFA 2HW6A 4FSYA 4RIXB 2DQ7X 4I0RA 4TWOA 5ANDA 5CANA 3A7JA 4G9CA 3LFEA 4O7RA 2FVDA 4QTCA 4FSUA 2XIYA 3UE4A 4D5HA 5KMOA 3F2NA 4WSYA 3CEKA 2Y4PA 4AZTA 1U4DA 3BWJA 4I20A 1SNUA 4TWNA 4EYMA 2XNOA 3UOJA 4ZMEA 4BR3A 4FC0A 2VTPA 5IEVA 3MB6A 3H10A 3OW4A 3CPCA 2I0VA 3R6XA 3NGAA 4KIKA 4IZAA 4MD9E 4TWCA 4H05A 1HCKA 1P4FA 2PHKA 2PMNX 3E8DA 5J8IA 3NYOA 2BTSA 3PA4A 3QTIA 4AOTA 4L52A 3W2SA 3FYKX 4EBVA 4EOKA 4HYHA 3C4EA 3WE8A 3TACA 1KE5A 3MJ2A 2WMRA 5CSWA 5DWRA 4Z55A 5AUUA 5IU2A 4I0TA 2VWIA 3QQLA 4FTQA 2JBOA 4L7SA 2Y4IB 2HK5A 4NW6A 4EH6A 5B7VA 4DFUA 3N51A 3OT3A 2ITPA 1UWJA 3G0EA 4FTOA 2XK6A 4K77A 5AUWA 5C01A 4X7QA 2R3MA 3FXXA 1PRYA 4YC6A 3NRMA 2C5XA 4BZDA 2CN5A 2UUEA 1NA7A 4FZ7A 4PNIA 5FUTA 5HNIX 4II5A 2BRNA 2ERZE 1Q8TA 2YIWA 3CGFA 2A4LA 3PP0A 2BZJA 4JAIA 4QYEA 3P08A 2I0YA 4OTDA 2PSQA 1H27A 3P0MA 4FT3A 4IJ9A 3MH0A 4R5YA 3DBQA 3I4BA 4JBQA 4BYIA 3AT4A 2VWXA 4AT4A 4I6HA 2GFSA 3V8TA 4Y8DA 4DBXA 3T9IA 4RVTA 3A7FA 2A1AB 2W9ZB 3AD4A 1E1VA 3A7HA 4CFFA 2QI8A 3A8WA 3BX5A 1YKRA 3ANQA 3AD6A 2HZ4A 3ORXA 1K3AA 4XH6A 4DEHA 3AMBA 2R64A 4YBKA 2XZSA 4KS7A 4G3CA 1RW8A 3S4QA 4MXOA 2A27A 2C68A 4FTTA 1LUFA 4OUCA 5L3AA 4ERWA 2ZMDA 2BRGA 3EQCA 3QGYA 2ZV7A 3PVUA 3QQUA 4FTCA 4RA5A 5AV0A 5A6NA 5KMJA 3VBTA 4FKLA 5HCXA 5KNJA 5K0KA 5BX0A 3UOLA 4A9SA 1KSWA 2WIPA 3CP9A 4EJNA 2X7FA 2Z60A 3COHA 3D14A 3VN9A 3ZS5A 3C0HA 3ZM9A 2YCRA 2XKEA 3PYYA 1W0XC 2BIYA 4FSRA 4FL3A 4ARKA 2CKOA 4E3CA 3ZLWA 3QD4A 1ZZLA 4GT4A 2IVVA 4BKZA 4DH8A 2VNWA 4D2SA 3TUCA 4E7WA 2ZJWA 3UO4A 3D94A 5EDRA 5ETCA 4RLLA 4EH7A 4GCJA 2EU9A 2R3PA 2YM3A 4ANQA 4IB3A 3E3PA 4FEQA 4AN3A 4BCHA 3COIA 4FICA 3LXPA 3O8UA 4LRKA 3FLZA 2WZJA 3KFAA 5D1JA 5B2KA 5HTBA 5IDPA 3DZOA 4HNFA 2PPQA 4DTAA 3IDCA 3KVWA 5HE3A 3R8UA 4E4NA 3Q52A 2A2AA 5EW3A 3NCZA 1OM1A 5D10A 4BCJA 4I94A 2WD1A 3KXNA 5B0XA 5LMAA 4F9BA 4I5CA 4PF4A 3T8OA 4NM3A 4YNEA 4FKSA 4C57A 4D5KA 3U54A 3PSBA 4QO9A 5CVHA 3D5WA 2W99B 2YCSA 4L01A 4BB4A 4EK5A 5KMNA 4DFZE 3Q9ZA 4EC9A 2WU6A 2XB7A 4YURA 4CVAA 5EDQA 2HY81 5E8WA 3F88A 1PJKA 2F7ZE 3OWJA 5CSVA 3TIYA 3W2CA 4DEIA 5J1VA 4AW2A 2QOFA 4GYIA 1H01A 2JITA 4LV5A 1U5QA 4FNXA 4FNZA 5AV2A 2W06A 3FLSA 2OK1A 3Q4TA 3TZ7A 4M97A 4K1BA 1TVOA 4ZMFA 4AU8A 5LJJA 4O83A 4NYEA 3NW7A 5E1EA 4G16A 5KMKA 3OTVA 4I24A 4IQ6A 5HE0A 3W8QA 4PX6A 5DG5A 3DXQA 5BPYA 5D7AA 4GT5A 3ZO4A 2IW6A 4GYGA 4JL9A 3L9MA 3QKKA 4QP6A 3TTIA 3C4FA 4IM0A 4L6QA 4YJNA 2FGIA 3UZPA 1OL1A 2EB2A 2YN8A 1BI8A 2WMUA 4J7BA 3SHEA 3UPXA 4F08A 2YJSA 4C37A 4N6YA 4IVCA 2UW8A 5AP2A 1KV1A 3LXNA 4LOQA 1PMNA 1NW1A 2UVYA 3F6XA 3TKUA 2GNHA 4Y5QA 4ZTMA 4YLJA 3ORIA 2VN9A 3R7YA 4QPMA 4R3CA 4BDJA 5D41A 2GPHA 4CFVA 3RZFA 5CY3A 4U41A 3W2RA 5HBHA 4K9YA 4D2RA 2JAMA 4BYJA 3SG9A 3QXPA 1STCE 3VC4A 3BHVA 3F3VA 1H1WA 2XM8A 4AGCA 3BCEA 5CENA 3RHKA 4DCAA 4R3RA 4IDVA 5GJGA 2O63A 4QMUA 4DYMA 4AZFA 3FL4A 4G3DA 4ACMA 4ZSLA 5L6PA 4GG5A 1PKDA 5FP6A 2NPQA 3GCQA 4JR3A 1M52A 4AAAA 3OWPA 5HNGA 4GUEA 4ASDA 1MRUA 3EIDA 3OTUA 4OTRA 2OH4A 3GCPA 2F4JA 2ITQA 3E92A 4Y72A 3FPQA 3VIDA 3ZH8A 4FK6A 2J0IA 2FH9A 4F99A 3PZEA 1YXSA 4RJ6A 3RGFA 3EHAA 1OIYA 2VWYA 2RFEA 3OG7A 2XIRA 4U5JA 2H8HA 1Q8WA 3I0OA 1WCCA 4PPBA 2VTAA 3R8MA 3TEIA 2GS6A 5EOLA 5BVEA 4OTWA 5BVKA 4FG7A 3COKA 3WI6A 5HKMA 4GS6A 2YZLA 4HYUA 2JGZA 3JPVA 3LQ8A 3REPA 4TXCA 5J9ZA 2F49A 4EOPA 2AC3A 3PXYA 4FA2A 1UKIA 4NJDA 4FV9A 3R8ZA 3UVRA 4BTKA 5KX8A 2A19B 4MNEB 1YWVA 2WTKB 3QA0A 3EN4A 2B9HA 3GC8A 2PZRA 3Q4ZA 4GUBA 3JS2A 4R6VA 3CPBA 5DRBA 3FHRA 3NYXA 4CRSA 3UZTA 4QRCA 3WE4A 4QP9A 4BHZA 3VWAA 1XH9A 3FY2A 4FKGA 3OROA 2X8DA 3FI2A 4H3BA 4P90A 5LXMA 3HUBA 3P5KA 1YI6A 4DEBA 1PMUA 4O7NA 2X7OA 3QWJA 2OWBA 4NK9A 4E6QA 4DTBA 1PKGA 4U9AA 3CR0A 3V6SA 5CVGA 1PXKA 4B8MA 3JVSA 1YQJA 2R3FA 3RPSA 1PXIA 5AR2A 2IVTA 3VBYA 2C5VA 3KRLA 4AQCA 2FB8A 2WMWA 4EUUA 2FSLX 2WNTA 3R00A 2WMTA 4Z9LA 1XHAA 5BUIA 3ERKA 3GOKA 4ZY4A 1R3CA 4ZTSA 3SD0A 1ZLTA 4QMMA 2V22A 5AR4A 3PXFA 4FV7A 3A61A 4FSQA 3BGQA 3OHTA 3PSDA 4TYHA 2OICA 2ZM1A 5DA3A 5KBRA 4FSTA 1XKKA 5HU9A 3LXKA 3DT1A 5HHWA 4OBPA 5EKNA 1WBWA 1IASA 3PIYA 2ITOA 3DLZA 3ZO2A 4RIYA 3PG1A 4ZLOA 2WXVA 4O0VA 2BDJA 2R0IA 2VX0A 4FTKA 4L8MA 5JFSA 4RLKA 3DKCA 1VEBA 2R3IA 4NT4A 3V3VA 1L8TA 2UZTA 5EOBA 1AGWA 4HVDA 3CY2A 3PDTA 3K3JA 5M06A 2ZV2A 4GW8A 4BDKA 3GXLA 2CKQA 3R8LA 5CAVA 1PXNA 4PTGA 3U6JA 3TCPA 3MWUA 4BGGA 5LMKA 4C62A 2XKDA 3DB6A 3SW4A 3BYSA 4ZTLA 3T9TA 3GQLA 4OT6A 4KKGA 4RVKA 4XOYA 3CD8A 3DBFA 4MCVA 4DGGA 2OSCA 5TO8A 2Y9QA 1ZMWA 3DTWA 1QPDA 2HIWA 3LCDA 4GG7A 5IA5A 4APCA 4MKCA 4Z7GA 4DFBA 3ACJA 5A46A 1Q99A 3K54A 1M7QA 4XRLA 5DEYA 4FE2A 4BDBA 1BL6A 3WYXA 2O64A 2XYNA 3FKOA 3C4ZA 4PL4A 2XNEA 2XP2A 3FI8A 4OR5A 3VHKA 4J99A 4PL3A 4TNDA 3VUGA 4BY9E 5TR6A 1H1PA 4WBOA 3LFNA 4GKIA 2J9MA 2VX1A 4ALWA 3OS3A 4YJRA 4OTFA 5BVDA 3RTPA 1OIQA 4IVAA 2BDFA 2QG7A 2CNQA 4IXPA 5AX9A 2VV9A 5BVFA 3NUXA 5AR8A 4XG6A 1FMOE 3UO6A 4I5HA 3DJ6A 3LFSA 5LQFA 5DIAA 4PDYA 4FG9A 2WTIA 2XK3A 3DAEA 1Q97A 3SDJA 1SMHA 4X2FA 2UW9A 5CZHA 3ORLA 2Y6MA 2QOLA 5DRDA 3BU3A 1GY3A 1I44A 3FZRA 4N70A 3CTQA 5CWZA 4FKOA 3RAKA 2WGJA 3RPYA 1DAWA 3DKGA 3R7UA 4KBAA 2YWPA 4ZJVA 1JWHA 5JQ8A 3QHWA 4IWDA 2WOTA 4AW1A 3Q96A 2W4KA 5CEPA 2PMIA 3FBVA 3PRIA 2JD5A 5J5SA 3GC0A 1XH5A 4O7SA 2XBJA 4MHAA 2E9OA 1UU8A 4F9CA 1R0PA 3GQIA 3P7BA 5DT4A 5CEKA 5IQCA 3BKBA 5JFWA 4RFYA 3UMWA 3Q2JA 4R78A 5HCZA 2YJRA 2X6EA 2JDTA 2REIA 3BELA 1F5QA 4L00A 5HGIA 4C35A 2F9GA 4N4SA 4ALVA 4KD1A 2G15A 4EEVA 2UW4A 4WNMA 5GIPE 1LEZA 4BHNA 4G3GA 5DMZA 3SRVA 3CBLA 4PMSA 2E9UA 4M69A 5DFPA 4JQ7A 3GUBA 3MTFA 4WOVA 4Y73A 2P55A 2ZDUA 4YO6A 4YPDA 3Q4UA 3RCJA 3ZDUA 5M09A 5GIOE 4QPAA 4MQ1A 5F4NA 3HMOA 2V0DA 4XJ0A 3UC4A 4E93A 5CU0A 4BIDA 1GZNA 3RK5A 3QX2A 4HGLA 2C3JA 3F69A 3WZJA 4D1SA 2YEXA 4KSPA 4LGHA 4M0YA 3BBWA 4XS2A 4MF0A 5M51A 2CNUA 3ZHPC 4O7ZA 3QXOA 4Q5EA 3G9NA 5KZIA 5I9WA 1IR3A 4ITIA 5C27A 4I5MA 1Q62A 2UW3A 3R21A 4RX8A 3ATTA 3VBQA 4UYAA 5ANGA 4A07A 4F1TA 3PJ1A 4IANA 3FSFA 4WRSA 2YM5A 3UOHA 5I4NA 3LLAA 4O38A 5DR9A 3UJGA 5EK7A 4Z3VA 2PVFA 5FEDA 2C6DA 2YA9A 3HV5A 3FMLA 1GNGA 4YZBA 4BDGA 1JOWB 2WTVA 5CI6A 5GJDA 1UNHA 3BEGA 4XLVA 4FV6A 2WQOA 4ACGA 3FQHA 2V7AA 1R78A 1T46A 4QMXA 4G6OA 4A7CA 2R3JA 3R01A 2J0JA 2Z2WA 2RF9A 3L8VA 2G2HA 3NS9A 5CALA 4F1MA 4BWPA 2R3GA 4PQNA 1ZRZA 4IWQA 2R3LA 4O2PA 3RM7A 3SA0A 1G8AA 1JNKA 1VJYA 4FMQA 1WBVA 5E90A 5K5XA 3UNJA 5EYDA 1OITA 3UQGA 5DLSA 3DKOA 3V5PA 4JQEA 4ERKA 4JX7A 4NH1A 3V5TA 1JSTA 5JN2A 5LOHA 1J7UA 3NLBA 4MXYA 3VVHA 4BWXA 2ITZA 3AQVA 4K11A 2R5TA 4BDIA 1WZYA 2CCIA 1SVEA 3GU4A 4FUXA 2J50A 3IGGA 4QQJA 4ORKA 2CDZA 3ALOA 4NCTA 4XG7A 2ZM4A 2RFDA 2ZM3A 3MVHA 3FZPA 3UTOA 4TTHB 5DR2A 2NP8A 5CEMA 3G51A 3BZ3A 4D2TA 2BPMA 5J79A 2CLXA 3F7WA 2J0MB 2F7XE 2PMOX 2QOCA 3FI4A 4U40A 3RAHA 3WARA 1U54A 4RWLA 5CU2A 4IAYA 1H07A 2R9SA 2YM4A 1UU7A 3QRUA 3V5LA 3VUMA 4EH8A 1F3MC 2ZOQA 4A9YA 4RIWB 5JEBA 3BYMA 4I5PA 2C47A 3A8XA 3KXHA 4I6QA 1H1RA 5HNBA 4CSVA 4TPTA 2XNNA 4G31A 2VTIA 1FOTA 3U51A 2IN6A 2GTMA 3EQPA 2DYLA 3I1AA 1L3RE 4Q9ZA 4P4CA 4F6WA 3QQKA 2WMVA 4AZVA 2WQNA 3QTRA 2UW7A 5L2IA 1Q8YA 3KRXA 4PWNA 4M14A 2EWAA 3WF6A 4EUTA 1R39A 4FV2A 3U55A 3M2WA 3QD3A 3SQQA 4DINA 3IONA 5AMNA 3TKHA 4WO5A 3TNPC 1DS5A 4FVQA 5CZIA 3PWDA 5IQEA 2Q83A 3PPJA 1WVYA 3ALNA 3P7CA 4CCBA 5CF5A 3OMVA 3IDBA 3VS1A 3JYAA 5TE0A 4DGOA 2ITXA 2JC6A 3BYOA 2JDVA 2RSVA 3QRKA 3F3TA 5EQPA 4ENYA 4IFCA 3HECA 4QP1A 4C02A 2BROA 1Z5MA 3WZEA 3A7IA 4UYNA 4TYJA 5DN3A 4QP8A 5A6OA 3LW0A 3UPZA 5BMMA 3UNKA 1VYWA 3NCGA 2NNWB 4QMZA 4A4XA 3EL7A 1QPCA 5DE2A 5IH5A 4YSJA 3QCQA 4YUQA 2C3KA 3PRFA 1YHWA 4HCVA 2XVDA 2CPKE 4M12A 3OXIA 4K18A 3FY0A 3SGCA 2X2MA 3QRTA 1Q4LA 5IMXA 2WFYA 4UBAA 5CSHA 2BDWA 3O0GA 4ZEGA 2ACXA 2W7XA 3IS5A 3G9LX 3KREA 5DHJA 3NNVA 2VU3A 1V0OA 4QMWA 4QNAA 4U42A 4DE4A 4XP0A 5DPVA 5BUJA 4JDKA 4XG2A 3R30A 5IUHA 3V8SA 5IISA 2UW5A 3ZOSA 5HLWA 4FIGA 4WBBB 4JXFA 4E6CA 4S31A 3FXZA 3NIEA 3LFCA 4AOJA 4AXAA 1UWHA 3GT8A 4TZRA 1JKTA 1O6LA 3TNIA 3KMMA 1TQPA 4ZS4A 2C69A 4FKIA 4FV1A 5HEZA 2I0EA 4YPSA 1W84A 4WSQA 3Q53A 4ZIMA 2J90A 3UGCA 5LWMA 5LCKA 1IAJA 4MNFA 4RJ3A 4TN6A 4O1OA 4BTJA 5L4QA 2VTHA 2QCSA 4E4XA 4QT1A 3DAJA 4GMYA 4MD7E 5IA1A 5GINE 3O2MA 4QMSA 3EMGA 4G34A 3WZDA 1UU3A 2VAGA 2X8IA 4J71A 1JSUA 1OMWA 1YWRA 1QPEA 1B38A 3CCNA 3P79A 4O6EA 4BDFA 5M44A 5KHWA 1OKZA 2BAQA 2YCQA 4L68A 5C9CA 4EHGA 3Q9YA 2HZIA 3TV7A 2QKWB 4GK4A 4RG0A 3AMAA 2R4BA 4YJOA 3DJ7A 4G2FA 4K2RA 2W5AA 1ZXEA 3VRZA 2QC6A 3SLSA 2WMAA 4A4OA 2JFMA 4AZEA 5IA2A 2E9PA 5E8XA 4QMNA 4O7YA 3R02A 5HI2A 2ONLC 1XJDA 5K5NA 5EFQA 4L53A 3BBTB 4XV2A 4UMUA 4IX5A 4L44A 5EH0A 4OBOA 4CXAA 3RPRA 4ZLZA 4RX7A 4RC2A 2W1GA 5B2LA 3IO7A 3OFMA 3QLGA 4AZWA 4P2KA 4AE6A 5K4JA 1PHKA 3S0OA 3ZLYA 4ZZNA 4NUSA 3TM0A 4MTAA 4FL2A 3GU7A 4G1WA 4NWMA 3DNEA 3NEWA 3H0YA 3D2IA 2WTJA 4YSMA 4O21A 2E9NA 3R73A 5AP5A 5A4EA 4FV3A 4M67A 2QVSE 3P1AA 4HJOA 4NM5A 4U45A 4NM7A 5JGBA 3QZIA 2QOBA 3Q60A 1GIJA 3MH1A 4IZYA 4ZXTA 3VS0A 2PVHA 3A4OX 3E7VA 2UZEA 3BHUA 4PDSA 4RZWA 3FEGA 2VGPA 5HD4A 5DT3A 3N4TA 1OGUA 4Q5HA 4IDTA 3VS7A 1SM2A 4Y5HA 4QP3A 1W8CA 3AOXA 3O7LB 2JKKA 4WNKA 1WBTA 4YO4A 5BUEA 5CAUA 2G9XA 4BICA 2XIZA 3MFSA 4HYSA 3ENMA 1H00A 3O8TA 4AE9A 5JZNA 3VJOA 4M66A 4FVPA 3KKVA 2ITTA 4EZ7A 4JAJA 2J4ZA 2PVJA 4FT9A 5AR3A 4UALA 5JT2A 3QTWA 4QMVA 2DWBA 3DAKA 3DBEA 4QQCA 4RC3A 5H8EA 3P9JA 2IW8A 4C0TA 2GFCA 3VO3A 2V7OA 1V1KA 3V5JA 5AUXA 1OBDA 1REJA 1ATPE 3HRFA 3FZTA 4TYEA 4IVBA 1YHVA 3ZUUA 2X1NA 3EFJA 4C4FA 4DEEA 2X4ZA 2ITUA 4V0GB 5CT7A 2QLUA 2WELA 4LQMA 5FEQA 1WMKA 1Q5KA 2X39A 3C5IA 5AJQA 4GIHA 4B7TA 5FTQA 4JX3A 4JOAA 5E92A 4UMRA 5J95A 3UQFA 4U80A 4DGLC 4NL0A 1IG1A 3AD5A 1B39A 3VUIA 4HW7A 5AUVA 4M0ZA 5JRSA 2O2UA 4USFA 2Z7RA 3FV8A 5E1SA 3PY3A 4YLKA 2AYPA 4W9WA 2J0KA 5AP0A 2PWLA 2W05A 2VTNA 4AUAA 5FM3A 3POOA 5CSXA 3DA6A 4RFMA 4XCUA 3RWPA 4MX9A 4ZS0A 3HVCA 1PMEA 4J8NA 4MWIA 4O0TA 3DK3A 2IZRA 2PZPA 4YZDA 5DR6A 4LRJA 3VBWA 2FSMX 4D0XA 3KY2A 3FMKA 4BCQA 4HGSA 4Y95A 5HG5A 4GK2A 2CNVA 1JLUE 2J5FA 1OKYA 3KK9A 5FGKA 3OP5A 3U87A 4L42A 3I79A 4GU9A 3Q3BA 4LMNA 4RX5A 4EL9A 2XUUA 5DGZA 5CEQA 4JDIA 4YZNA 1IA9A 2GS2A 3PXRA 3DLSA 2BIKB 4FSMA 3VQUA 5KCVA 4DITA 4FZDB 5EI8A 4FTMA 4OTHA 4WIHA 4FTJA 3F66A 1AD5A 2WB8A 2SRCA 3I7CA 3OW3A 4C3RA 3HP2A 5KMIA 4ZSGA 3ETAA 3OXTA 1VR2A 3NDMA 3QC4A 2GQRA 4YZ9A 3ITZA 5ANIA 4HCUA 5HOAA 5B2MA 5EYCA 4F09A 1RE8A 2VTMA 3II5A 3TJDA 4C34A 3LCTA 5EM6A 4HYIA 4U3ZA 4WKQA 1RDQE 2PE0A 3ZC6A 1MRYA 5H3QA 4NW5A 4FTRA 3LOKA 3RMFA 3KB7A 5K0XA 4IH8A 4F0GA 3Q32A 2JIUA 2Y7JA 3FSKA 4D28A 1OPKA 2C3LA 1GIHA 2CHLA 4KUJA 4FZFB 3KA0A 3MV5A 4EORA 3W10A 4DLJA 1TQIA 4CRLA 3G6HA 2BZHB 3TJCA 3TWJA 1NT2A 2JAVA 5E8SA 3TTJA 1XH7A 3FMHA 3G6GA 3WOWA 5ITAA 3KULA 4TNBA 4ZJIA 3QTUA 4CFNA 4W4YA 3QRIA 5IQDA 1J1BA 1MUOA 3HGKA 2PVKA 5FM2A 4YHFA 5HU3A 3DQWA 3CQUA 2XKFA 2HOGA 4G17A 2PZYA 1G5SA 3TUBA 4JJRA 3BHHA 4AW0A 3MPMA 4O96A 5AV1A 4AFEA 3NYNA 4KIKB 2FO0A 3Q4CA 3V04A 4ZSAA 4BGQA 4IIRA 4IM3A 1O6YA 2C30A 3VBVA 2BRBA 2EXCX 1YI4A 1QPJA 3C0GA 4O0YA 4ACCA 5AA9A 3QD2B 3RPOA 2VTQA 5EHYA 4Y85A 4DHFA 4FKQA 4UMTA 3V5QA 3AC2A 3R04A 3IW7A 4N6ZA 1H25A 4FKUA 2BALA 4AOIA 2GNLA 1YXVA 3EQDA 3E8NA 3AGMA 4AWIA 2C5NA 3M11A 2JKOA 3L9PA 5CXHA 2G01A 2BILB 5H8BA 5JQ5A 4JR7A 2IO6A 1Z9XA 2BKZA 1URCA 2VWZA 4MH7A 4XG3A 5D11A 3ZMMA 3WF9A 4BCKA 4X3FA 5A4CA 4BCGA 5HE2A 4FF8A 4IJPA 1JVPP 3AGLA 3CSVA 3KXXA 2C5YA 3EB0A 3GC7A 1H28A 2WTKC 2WIHA 2VWVA 1FINA 5AAEA 2P2IA 4DG2E 3FMEA 1UA2A 2XA4A 4IFGA 4QNYA 3OXZA 4BN1A 3ET7A 5LVPA 2HAKA 3QALE 4AG8A 3EWHA 3OWKA 5FLFA 1PYEA 3BLHA 3VS2A 3ZTXA 4EKLA 4RJ8A 5I3RA 1YDTE 3LFFA 3EQHA 3WBLA 2PY3A 3VW8A 1ZY4A 4F65A 4GRBA 3HAMA 3MY0A 2UZVA 2CGVA 3W2PA 3HKOA 3UYTA 5L8KA 1XBCA 4YMJA 3IGOA 3OCBA 3FZOA 3UIUA 2XEYA 4I1ZA 5KKRB 1M2PA 5CNNA 4D4SA 4FTUA 3F5UA 4F7NA 2HW7A 4R3PA 2XCKA 4WUNA 3F3ZA 3P4KA 3ZC5A 2ETMA 3CY3A 4QTDA 3K5VA 3EYGA 2PUPA 2GCDA 2X2KA 1GZOA 5T3QA 5HG9A 4PNKA 2XK7A 1NY3A 3F7ZA 4MXAA 3DV3A 5JRQA 3MY1A 2VTSA 4P5ZA 3NNXA 4AT5A 4CQEA 3PJCA 1XR1A 3HA8A 2Z8CA 4IAZA 3PSCA 1I09A 4QYFA 2OFUA 4IX3A 4PUZA 4FGBA 4FVRA 3EKNA 4FOBA 5AR7A 4QP4A 5A9UA 4RC4A 2BHHA 5ANJA 5FG8A 5K4IA 3Q5IA 4ANNA 4EOMA 4F7SA 4F63A 4C33A 4EQUA 2UV2A 3QQFA 2WTWA 4C38A 2CN8A 4B8LA 5FXRA 3QTQA 3OEFX 3SC1A 2FUMA 3NNUA 4MXCA 3MSSA 4EOSA 1W7HA 1K9AA 1OI9A 3MGYA 5CX9A 5KMMA 2WMQA 2B1PA 1ZYCA 5HESA 5CF4A 4DN5A 3COMA 3L8SA 4RJ5A 4GIIA 4ASZA 4C4EA 2B9JA 3AT2A 4O0WA 3SXSA 4ZTNA 4C2WA 4MBLA 5TT7A 4QMPA 4FTNA 3TDWA 1H08A 4JDHA 5IKWA 3NSZA 5IG1A 3KU2A 3FZ1A 3KRJA 4IZ5A 5E8YA 3ZXTA 3JR1A 1PF8A 3IW6A 4D9TA 4C4GA 1QCFA 4PMPA 3GB2A 3OCTA 5DEWA 3QX4A 4RMZA 5EW9A 4A9UA 3QF9A 4O2ZA 4LYNA 3L9NA 1SVGA 3GP0A 4I4FA 3LMGA 2OXYA 2CLQA 4L67A 3SOAA 3C1XA 2QO2A 4LRMA 3RHXA 1YVJA 4RWKA 2V55A 4D58A 4HOKA 5TKDA 3SV0A 4HCTA 4BWKA 3EFWA 4R77A 4KIQA 2HZNA 3D7TB 3QAME 4KA3A 2UVZA 2W4OA 3R7VA 4BCNA 5BMSA 3N9XA 4HZSA 3HDMA 4RPVA 5LCJA 4FEXA 2VX3A 3DPKA 3EQGA 5IA0A 4M68A 4U6RA 2YLFA 2C6OA 2R3KA 4I92A 5HVYA 5TOZA 1M17A 4LL5A 4EH5A 3GEQA 4ZY5A 1Q3WA 1QL6A 5HLPA 5M57A 3TZMA 1APME 3OOGA 3OVVA 3ZO3A 5HTIA 3R28A 3MPTA 4YU2A 4ZOGA 3HUCA 3O7LD 1HOWA 3FHIA 3N4UA 3H9RA 5I9XA 4U97A 4LL0A 3FKLA 5F9EA 2ZYBA 3RK7A 3HEGA 3QRJA 3O50A 5AP3A 5C8NA 1DAYA 3V51A 3SXRA 3ATSA 4FNYA 3SW7A 4QMQA 1PYXA 4Y46A 1OKWA 5KZ0A 2YIRA 3TIZA 3RBWA 3PLAE 3IW8A 4V01A 4MXZA 3IOPA 4U79A 4DC2A 4MBJA 3PE2A 2V5QA 3AC5A 4R7IA 2OH0E 4CV9A 4D4VA 3BLRA 3HNGA 5HCYA 5M56A 4RJ4A 4M13A 4TKSA 3NW5A 1YI3A 1IAHA 3MJ1A 4O0UA 4FIHA 4B6LA 1MQ4A 2O0UA 2PTKA 4P7EA 3JUHA 2QHMA 1YOMA 3LAUA 4I0SA 4U44A 1A48A 3DBCA 4FI1A 3PG3A 1UNLA 4DEAA 2OBJA 4FODA 4QYYA 5IH6A 4RRVA 3NWWA 2GSFA 2IWIA 1XQZA 3W55A 3OF0A 4AA4A 3E87A 3HV7A 3OT8A 4OGRA 3W16A 3EQRA 3PVGA 4KWPA 2Z7QA 1OL5A 4C3FA 4JNWA 4CKJA 4G6NA 2I0HA 1BKXA 5M07A 3PJ8A 4QTBA 2X8EA 4UXQA 4IZ7A 5AV4A 2WQBA 3ULIA 1WBOA 3KC3A 4FL1A 4LOOA 2IG7A 4MAOA 4KRDA 5K3YA 5ACKA 5LMKC 2BMCA 3BQCA 1ZYSA 5E8TA 4WA9A 3GU5A 5JK3A 3WYYA 3JY0A 3HV6A 4YZMA 4EOOA 4PP9A 4K6ZA 4MVFA 5HX6A 3F2RA 3DTCA 3PLSA 5ACBC 4EQCA 2XH5A 5M4CA 4BCPA 4G9RA 4RVLA 2HWPA 4PDOA 3WZUA 5JKGA 1M7NA 3IOKA 4DH5A 4BGHA 1J7LA 1AQ1A 4GJ3A 1OVEA 5L6WL 4FT7A 4PMMA 3Q2MA 4IAIA 4EH9A 4ENXA 5AFVA 3ORKA 4UWCA 3F3WA 4V05A 4D0WA 2OKRA 2OJJA 3K5UA 4RBLA 5HG7A 1YXUA 2W4JA 4U3YA 4FEUA 3OZ6A 4N0SA 2JIIA 2YDJA 3FAAA 3NIZA 4H36A 4O7TA 3BPRA 2VNYA 3EFKA 3I5NA 4IAAA 3MTLA 3FE3A 4O0RA 4XBUA 3UYSA 4ACHA 3DK7A 3UG1A 4J97A 4BBMA 1XO2B 3BGPA 4FEVA 3H9FA 5FBNC 3PXQA 3R63A 1NVQA 4YZCA 4NSTA 1VYZA 4RIYB 2RG6A 4O0XA 3MFTA 4EJ7A 3B2TA 5IDNA 2BZKB 2GQGA 5CEOA 3VS6A 4XYFA 4AX8A 4ZTQA 5BYYA 4GT3A 4NTSA 3QYWA 1KV2A 1PXPA 3ORZA 1CMKE 4RQVA 1JKKA 3ZUTA 3QCYA 2UZUE 4JQ8A 1NVRA 1WBSA 4AGUA 2EVAA 4G5PA 4L43A 4AZSA 2RIOA 5F1ZA 4FUYA 3CIKA 1H0VA 4S34A 3FDNA 3HRCA 3SXFA 2ITNA 1J3HA 2PE2A 4EH3A 3PA3A 5HIEA 3NYVA 2WAJA 4C2VA 3ROYA 1FPUA 1IEPA 2XM9A 3MBLA 4E73A 3T3UA 5C4KA 2BFXA 4EK6A 3RI1A 3BI6A 5CU4A 3OOMA 4FIEA 3UQCA 2R3NA 2W5BA 3ORTA 4FZAB 3WIGA 3ZFMA 4CZUA 1URWA 4OT5A 4FSWA 1WFCA 1CM8A 4AW5A 2QOQA 1JBPE 4I93A 3C9WA 1Q41A 1WBPA 3DDQA 1YW2A 3HMMA 4EHEA 4F6UA 5CASA 2FSOX 1X8BA 3TNHA 2E9VA 4X6QC 4GEOA 2HYYA 3CS9A 1JKLA 2GHLA 3R71A 5BQ0A 1GIIA 3QTXA 3O23A 4C61A 4FZ6A 4BC6A 5AWMA 3KXZA 2FSTX 4NIFB 4DFNA 3GU6A 3KN5A 2OJGA 4A9RA 3B8RA 1M2QA 3C4XA 4I4EA 4IX6A 3TV6A 2PL0A 3CJGA 3PVBA 2Q0BA 3HZTA 4E26A 3ZO1A 1UV5A 2OZAA 3FJQE 1OUYA 3VBXA 5JGAA 5J9YA 4PV0A 4DFYA 2BTRA 3UIXA 2BCJA 2X4FA 3HMIA 3I0QA 3I6UA 3MVMA 2AC5A 4HPUE 3R7IA 3KQ7A 3LHJA 4WG5A 3M42A 4JRNA 4OTQA 1GJOA 2Z7SA 1ERKA 3DQXA 4JRVA 2W0JA 3OCSA 2I1MA 2JDOA 3L1SA 3NR9A 4IMYA 4HVGA 5GZAA 2UZDA 5CNOA 4DT9A 4FKWA 2VWUA 3QZFA 3WZKA 2HWOA 3IDPA 3F5PA 2P2HA 1Q3DA 1ZMVA 3TI1A 5IQAA 1W82A 2WOUA 5H8GA 3FMDA 4DFLA 5AP4A 1H24A 3TZ8A 4DLIA 1Y6BA 2JKMA 2Z02A 2IZTA 4NTTA 2YABA 3PIZA 1P2AA 3QZGA 1J1CA 3SRVB 1M14A 1OPLA 3ZZWA 4DH1A 3F5GA 5E8VA 4D4RA 4ZLYA 5L2SA 3ZEPA 5IQIA 1LP4A 2JDSA 3E5AA 3ZM4A 1ZYLA 2XMYA 4FV5A 3CXWA 4IAKA 4DAWA 3OY1A 4EHVA 2GU8A 4HVIA 2B55A 5HORA 2C4GA 2IZSA 3ANRA 3BU6A 4J8MA 4PRJA 2W1IA 3F82A 2YIYA 5IH4A 3DXNA 4LG4A 3V01A 3RKBA 4WD5A 2QR8A 3AC8A 4LI5A 4AA0A 3ODZX 3A62A 2XK8A 3RPVA 4CKIA 2HENA 5KHXA 2PUIA 4QP7A 4X0MA 5CSPA 4RIXA 4OAVB 3VJNA 4KKHA 3VAPA 3SX9A 3C51A 3QHRA 2XK9A 2CKPA 2YERA 2QD9A 4FKVA 4IWOA 2C0IA 4L3LA 2PE1A 3IW4A 2PU8A 3LFBA 5E4HA 2C6EA 2YFXA 4RIOA 4IBMA 4XX9A 2QU6A 3FLWA 2QO9A 4CZTA 2W1EA 4R8QA 4EK4A 5EI6A 2PUUA 2WO6A 3H3CA 2ZAZA 4XUFA 5CU6A 3HP5A 3VNTA 2HCKA 5CEIA 3ORNA 3CD3A 4MD8E 2OO8X 5ETAA 4RJ7A 2VO3A 2W1DA 4EQMA 2BR1A 5EQEA 3C13A 2HXLA 3R1YA 5C8KA 5CF6A 2W1CA 2J5EA 3I7BA 3HYHA 1W98A 2QOOA 5JFVA 2J2IB 3KL8A 4DTKA 3E64A 3DCVA 2OF2A 2ONLA 3AXWA 4J1RA 4ZJJA 2OJ9A 3MN3A 4E6DA 4R7HA 1OL2A 3AC1A 3AG9A 4EHZA 3FQEA 5M53A 2P33A 3DK6A 4V0GA 5ETIA 2WQMA 3QUPA 3H30A 2BAJA 5DI1A 2UZNA 2GQSA 3UVPA 3EKKA 3G5DA 4PY1A 4A9TA 4O7VA 2I6LA 4IVDA 4S30A 4K8AA 5HBEA 3IECA 4LUEA 4UWBA 2VWWA 2OFVA 3D7ZA 4P5QA 3TV4A 3UVQA 3ZRLA 4C4JA 5EG3A 3KN6A 2OXDA 4XOZA 2XNPA 3GFWA 3R8VA 5J7HA 4CGAA 5LVLA 3GCVA 4XEYA 3VUDA 5J1WA 4L3JA 4MYGA 4RFZA 3BIZA 2JEDA 2V62A 1J7IA 2G1TA 3Q04A 3TZ9A 5HLNA 2IPXA 3KGAA 2H9VA 1U54B 4ANOA 4IB0A 4GJ2A 4JIAA 2PVYA 2C5OA 1TQMA 2B4SB 2WHBA 2YIXA 3F2AA 4FG8A 5D12A 5CLPA 4JG8A 4BI1A 4IC7A 3LPBA 5K9IA 1U46A 2X81A 1OKVA 5HTCA 4J95A 3HDNA 1FVVA 2YDIA 3IQ7A 3KF7A 3G2FA 3E88A 2OLCA 2ZMCA 4U7ZA 5ICPA 4BDAA 4YR8A 1BUHA 4UX9A 4CG9A 5EW8A 1OB3A 3I6WA 3SAYA 4TL0A 2Y8OA 4BBEA 2ITVA 3GFEA 4HGEA 5CU3A 4U0IA 2WTCA 5DT0A 4GK3A 4K0YA 4L3PA 4IB5A 2VTTA 3VS4A 3ZBFA 1W83A 3E8EA 2F7EE 4W8DA 2R3QA 2GHGA 4EWHA 2QR7A 4YHJA 3F9NA 4IE9A 3FMMA 3QUEA 5E7RA 3U6IA 4BKJA 4FT0A 4KB8A
chains in the Genus database with same CATH superfamily
3NUNA 3BLQA 2F2CB 3MW1A 4IAFA 1KOBA 2UZBA 4ID7A 3W18A 3EQFA 3FI3A 1NVSA 5FTOA 1ZY5A 3SG8A 2I40A 3ORMA 4X3JA 5FXSA 3NVMB 1XBBA 3BGZA 4AACA 5I9VA 4NEUA 4LV8A 4NKSA 3ORPA 4HNIA 2JBPA 4C8BA 3E63A 5IPJA 2XIKA 3LCOA 1NXKA 4DEGA 3S1HA 5F95A 1P4OA 4U8ZA 4KIOA 4QDEA 1CKPA 4AAYA 4CMUA 2RL5A 1ZYDA 5IZFA 2OGVA 2JFLA 3Q6UA 2DS1A 3F61A 3QCSA 1SVHA 1U5RA 5FDXA 5HO6A 1F0QA 4I23A 3R8PA 4BDHA 2X9EA 4KNBA 1CTPE 4YJQA 3MFUA 2GMXA 4DG3E 1TKIA 4D1XA 3RZBA 5C26A 4Z16A 5JFXA 2IZUA 4U43A 4XV1A 3BWFA 2OXXA 3PXKA 2ZB1A 4XLIA 1KOAA 5L2WA 3E62A 1V0BA 2VO0A 4D2WA 4RGJA 4OAUC 5DYJA 4YJUA 3QFVA 4FBXA 5JH6A 4OLIA 3BHYA 4CT2A 1H1SA 3LIJA 3FMNA 3V6RA 2UZOA 4FIIA 3HAVA 1EH4A 3R9DA 1H26A 4BBFA 5DVRA 3R1NA 3PXZA 3A7GA 4C36A 1G3NA 3C0IA 4FX3A 2VTRA 3G15A 3HL7A 2X9FA 2XF0A 3EZVA 2R3RA 3RCDA 3MIAA 3HMPA 3OEZA 4QMOA 4CYJA 4DH3A 4PP7A 1KE9A 4XV9A 4NU1A 2VGOA 3MDYA 4DFXE 4E5BA 3LMIA 4QTEA 2JLDA 3TUDA 1Y57A 3QBNA 5JZJA 4E5AX 1BI7A 4JG6A 3RJCA 3G90X 3DDPA 2WMXA 3EYHA 5T6KA 3TMOA 1FVRA 3C7QA 2QOIA 2UVXA 4HZRA 4BVUA 2W17A 3U9NA 3ZUVA 4X2JA 3A60A 5CQWA 4CEGA 5H9BA 3H9OA 3QLFA 4M3QA 3MA6A 4HVHA 4I6BA 5ANOA 3LQ3A 4LGGA 4J52A 4FTIA 5HQ0A 4EH2A 3CQEA 3R1QA 5AP1A 2OZOA 3FWQA 4AGWA 4GKHA 4ANBA 1BX6A 4PDPA 4XBRA 3W2OA 4ZZOA 4EONA 3R1SA 2QG5A 5KMLA 5IUGA 4LM5A 4C7TA 2XNGA 2XJ0A 3OD6X 4IC8A 4F1OA 4EI4A 4UN0C 5A4LA 4O6LA 1CSNA 1RQQA 2YITA 3O8PA 4APPA 3BRBA 5CAOA 4L7FA 1Q8ZA 2OW3A 2DUVA 3QYZA 4BL1A 5BNJA 2CGXA 5J5TA 1CKJA 3QU0A 4LOPA 3TL8A 5IQBA 2R3OA 3TXOA 3ID6C 2O65A 2ETKA 2PUNA 3BYUA 2C6MA 3MVJA 3GBZA 4MF1A 4CFUA 1FVTA 5A4QA 4QD6A 2QURA 3LM5A 2X0GA 2EXEA 4OBQA 3DJ5A 3W8LA 3R2YA 5T68A 1K2PA 4XP3A 5E91A 5LVNA 4CZYB 4N57A 2R3HA 5FXQA 5A54A 5AUTA 2GHMA 3UDBA 4ANMA 4CMOA 3IK3A 3ENHA 4CNHA 5CXZA 2OIQA 3DB8A 3EN9A 3D4QA 2C6LA 4GFOA 4PL5A 5AUYA 2KULA 2YLEA 3W32A 5IA3A 2YAAA 5KKRC 5DNRA 5HO7A 3GENA 4KSQA 1Q61A 4MNEA 4NM0A 4AT3A 1B6CB 3D5VA 5CAPA 4ANLA 4BIBA 2YCFA 2O3PA 3DOGA 2C0OA 4ITJA 4O81A 1WAKA 4H39A 4JI9A 4F0FA 4GVJA 3KCFA 4RT7A 4XG8A 4W8EA 4DH7A 2G2IA 5EKOA 1KE7A 3ZBXA 2HY0A 4ZAUA 2QLQA 5L6OA 4PPAA 2OJFE 4FK3A 1S9JA 3EZRA 2WEIA 4MK0A 4S33A 3HRBA 2XJ1A 1ZMUA 3ZXZA 1LEWA 1U59A 3W33A 1LPUA 4UB7A 4EWQA 4A06A 1VZOA 1OUKA 4KS8A 5CI7A 5HZNA 1KE8A 2BUJA 2P0CA 4BTMA 2CSNA 1SYKA 2PZ5A 2WPAA 2RFSA 2J7TA 5TF9A 5AM6A 3UNZA 2QOHA 3B2WA 3DFAA 2YM6A 3VF9A 3ZDIA 2YWVA 1DI9A 1DI8A 4BCMA 1H0WA 2XNBA 5JSMA 2JKQA 2LGCA 1H1QA 3D7TA 3IG7A 4BFMA 4OTPA 2IVUA 4FIFA 4EK8A 4D9UA 3VS5A 3S2PA 2QODA 4BRXA 3QKLA 1E1XA 2H96A 5HO8A 4M8TA 2C3IB 2IVSA 3C50A 4JS8A 4D2PA 5L2TA 1YRPA 3NUAA 3TG1A 4O84A 1P5EA 3NX8A 2VTOA 5CAQA 3UZRA 3W1FA 3ZONA 4XMOA 3ZRMA 4EOLA 5LMBA 3EN7A 3DBDA 2AEGA 2YM8A 1Z57A 4BZNA 4X21A 3O51A 1GZ8A 3PA5A 2RFNA 3AT3A 3R83A 5GZ8A 4CKRA 4F7JA 5EYMA 5BYZA 4BCFA 2QQ7A 3R7GA 3W2QA 4JVGA 3PPKA 3ULZA 2QHNA 3RVGA 2VWBA 3QTZA 4G3FA 5IA4A 3PY0A 2R7IA 3EN5A 3IKAA 3QGWA 3LM0A 4PPCA 2FYSA 3FC2A 3EJ1A 2PVMA 3HLLA 4QMTA 1BYGA 3MB7A 3PP1A 3QD0A 4Y83A 5J87A 3CE3A 3ZYAA 3VUKA 2C6IA 4I41A 3D5UA 1YXTA 3CKWA 3PJ2A 3R7OA 1PY5A 5AAFA 1A9UA 3MYGA 2NRYA 4WUAA 2GNIA 3LCSA 4F70A 3ZZEA 2YAKA 5FP5A 3NVKI 4CCUA 4LMUA 2CJMA 4UV0A 3E8CA 4X3FC 3GVUA 4YJPA 4JBVA 3RAIA 3R0TA 3U4UA 4BCOA 3OC1A 4JIKA 3NZ0A 3Q6WA 5E9EA 4XRJA 1KWPA 3QZHA 4FKJA 4TT7A 2PVRA 2XNMA 3JY9A 2YHVA 2FA2A 5AM7A 4FNWA 3FYJX 4G3EA 3S3IA 5I0BA 2ESMA 4IX4A 4WRGA 3BQRA 2CMWA 1GZKA 3JVRA 4IHPA 2UW0A 3D9VA 4AGDA 2PZIA 5AP6A 3ZSIA 1PXJA 4JG7A 4QP2A 1ZARA 4TWPA 3KULB 3VRYA 4C4IA 5IF1A 3KCKA 4O0SA 3VULA 3BE9A 3CJFA 4UXLA 2EUFB 4JBOA 4UZHA 4JT3A 4O91A 3KVXA 2XK4A 2W96B 5HD7A 4Q9SA 3ACKA 2J51A 2Y6OA 5EHOA 3DGKA 3QCXA 2LAVA 4DGMA 3OBJA 5CS6A 3RAWA 5FTGA 3VF8A 5IQHA 3HX4A 4F4PA 5JMSA 3WF8A 5EM8A 2B52A 3VQHA 3P78A 4F9WA 1UU9A 5IUIA 5IMEA 3ZEWA 4GFMA 4ASEA 5I9UA 4TYIA 1OIUA 5HVJA 1GOLA 3MS9A 2XYUA 3OY3A 3KRWA 3DXPA 2WMSA 5C8MA 3ZSGA 3QTSA 3D0EA 1O9UA 4NKAA 4ZTRA 4E5WA 1Y8GA 4CTCA 2EB3A 3AC4A 1E9HA 3LJ2A 3MVLA 5D7VA 3FLNC 4F6SA 4CMTA 1Y6AA 3I81A 4QOXA 4W4WA 3R2BA 4WNPA 4AN9A 4DCEA 2F57A 2B7AA 4BDEA 3LXLA 5L8JA 3BE2A 2BAKA 2JIVA 2B0QA 1ZYJA 4DBNA 3LFDA 2C1BA 3OUNB 4MWHA 2BHEA 3CTJA 3TDVA 3LJ1A 3F3UA 1Q24A 1REKA 2J0LA 2QKRA 4X3FB 4EYJA 5H2UA 4D55A 4UWYA 4TY1A 1YDSE 3LVPA 3R9OA 2YISA 3QUDA 3THBA 4QYGA 1BLXA 1PXLA 3UC3A 1FGKA 2XJ2A 3R9HA 2YDKA 1ND4A 1MP8A 5E8ZA 3RNIA 2OG8A 4NFNA 4IWPA 5L2QA 2IJMA 3NNWA 3FLYA 5I3OA 3V5WA 2XS0A 2YM7A 5IQFA 5D9HA 4EBWA 5IQGA 5FBOA 1CDKA 3NUYA 4TRLA 3UP2A 2VO7A 3PWYA 3DS6A 3NUSA 3FC1X 2UZLA 3G0FA 3DZQA 3EQIA 4OTIA 5F20A 3D2KA 1FQ1B 3BU5A 3U9CA 4CFMA 5CYIA 4MUQA 2BFYA 4FTAA 4CD0A 3OWLA 1ZOEA 2CGWA 3GI3A 3KK8A 3QKMA 2VTJA 4IACA 4FR4A 3KMUA 5M55A 4MBIA 4E6AA 2H34A 2UW6A 1XH4A 4GV1A 2GNFA 3DNDA 5HX8A 3I5ZA 5I9ZA 4D1ZA 4K33A 5EHLA 3NMUF 2OJIA 4EZ5A 4MQ2A 3I60A 3QL8A 3HA6A 4XP2A 3UOKA 2YACA 3R7EA 2EXMA 4JLCA 4NJ3A 2HELA 2RGPA 4B9DA 4BDDA 3R9NA 4UMPA 2OU7A 4KAOA 4O4BB 4YTIA 4CFWA 3MFRA 3QWKA 3PE1A 5EI2A 3FLQA 3O96A 3RINA 1WVWA 1IA8A 3KF4A 5BVNA 2O5KA 4H3QA 2QO7A 3HV3A 4CT1A 1DM2A 3D83A 1BMKA 3KXMA 4RA4A 4E4MA 4EC8A 2ZV9A 4QMLA 3VW6A 5ETFA 4EK3A 2ITYA 3MPAA 5BVWA 4IM2A 4O7WA 4KINA 4KKEA 3D5XA 5IEYA 3OBGA 4E8AA 3U4WA 5L8LA 3LFAA 1P14A 1Y91A 2CGUA 2QOKA 3P23A 5DBXA 4FOCA 2XRUA 4QQ5A 4NIFA 4RQKA 3LMHA 2AQXA 1ZOGA 2RKUA 3DFCB 4S2ZA 3RWQA 5A4TA 3S00A 3MESA 4WT6A 5IEXA 1XBAA 3E93A 4G5JA 3SVVA 4I21A 1SNXA 1R1WA 4FT5A 5BYLA 4FIJA 3LZBA 5BVOA 3TNWA 2W1FA 3AKKA 3QQGA 4MEDA 4RIWA 3UBDA 5A3XA 3MH2A 2GDOA 3KXGA 3CLYA 4ZZMA 1BL7A 4NZWB 4HVSA 5AA8A 2YIQA 5JGDA 2XKCA 2ZB0A 4ONAA 2GS7A 1ZWSA 3AMYA 3NW6A 4IB1A 4PMTA 5KE0A 5C4LA 3BEAA 2BVAA 2VRXA 3NUUA 4MXXA 4A4LA 2ERKA 4LUDA 1A06A 4AFJA 3ZCLA 3LQ5A 1ST0A 3ZSHA 4O1PA 3PY1A 2F2UA 4XG9A 4EOQA 2P4IA 4KBCA 3ZLXA 4TYHB 1PXOA 3MI9A 3PFQA 3F5XA 4FYOA 4YNOA 1JKSA 3MH3A 3QC9A 4EOIA 2XEZA 3A2CA 4YJSA 3PTGA 3GOPA 3UP7A 2VUWA 4J96A 4XG4A 4CFXA 4DA5A 1ZAOA 3GGFA 3FPMA 4CLIA 4M84A 3BV2A 3H0ZA 4JBPA 5KUPA 5AADA 2NO3A 3BV3A 3GCSA 4QMYA 5EM7A 1Q8UA 4FEWA 1J91A 3T3VA 1JAMA 4XHKB 4FYNA 4R1YA 5A14A 4PTEA 3IW5A 4DG0E 3NPCA 3PPZA 4FV0A 4ITHA 4EKKA 1O6KA 4CQGA 4H1JA 3ELJA 5CT0A 2VD5A 4GSBA 4AS0A 1H8FA 4AN2A 5FEEA 4WNOA 1YWNA 3A99A 4DEDA 5HE1A 4E1ZA 4JDJA 4E20A 4F9YA 4L9IA 4HPTE 5HIDA 2O8YA 3VHEA 3BHTA 1YDRE 5C1QB 3RALA 2NRUA 4IADA 5EM5A 1UNGA 2XIXA 2QU5A 2I7QA 1FGIA 3HV4A 2OF4A 2WQEA 2JDRA 4L45A 4DT8A 5C03A 2WTDA 4H3PA 2Z7LA 3C4WA 3GU8A 5E8UA 4O7LA 4FV8A 1PXMA 1PW2A 2HZ0A 3W0QA 3UIMA 4UY9A 2A0CX 2W1ZA 2Y0AA 3EL8A 3Q5ZA 4FGRA 3MY5A 3LE6A 5M4IA 3IPHA 3QA8A 4UZDA 5EDPA 3P86A 2XRWA 3GNIB 3TKIA 4BF2A 2WU7A 4TYGA 3BYVA 5I5ZA 4FV4A 5J9LA 4F78A 3K3IA 3O17A 4BTFA 1OPJA 4DGNA 2PYWA 5GZ9A 4FKRA 3UIBA 2X7GA 3M1SA 5AIRA 3ZU7A 4C58A 5FDPA 3K2LA 4NFMA 4KBKA 5FRIA 4M15A 4WG3A 5GNKA 2E2BA 3G33A 3VUTA 4BDCA 2W1HA 3OUKA 3CGOA 4F64A 3HMNA 2B54A 3FQSA 3TT0A 3VS3A 5G6VA 5EYKA 1M2RA 3L8XA 4IW0A 2WMBA 1ZZ2A 5CQUA 3S95A 4F9AA 3B8QA 3WILA 2BKKA 3C4CA 1G8SA 4ZK5A 1YOLA 1OL7A 3Q9XA 2R2PA 3A4PA 3RNYA 2PMLX 4D2VA 5CVFA 4M7IA 4O86A 1OIRA 5ANEA 4USDA 3POZA 4F7LA 3PVWA 1OZ1A 2X6DA 3R22A 4O82A 4CG8A 3FMJA 4YJTA 3ZRKA 5LARA 4BCIA 3N4VA 4FSZA 3UODA 5DOSA 3ML1A 1FBNA 4FSNA 4ZP5A 4YC8A 3QQHA 4RVMA 3ROCA 2OIBA 1WVXA 4TW9A 5AV3A 3UG2A 4FKTA 2GNGA 1R0EA 2AUHA 5AR5A 4Z7HA 5KBQA 3WIKA 2ITWA 4RWIA 4ACDA 5M4FA 4OW8A 4KIPA 2BRMA 4M69B 5HICA 4YLLA 4AP7A 3DY7A 4LGDA 5AIKA 1YOJA 3EFLA 3GC9A 4C3PA 1JPAA 4GH2A 4B0GA 3RP9A 1UVRA 3UO5A 4KRCA 4NCTC 3ZFYA 4J53A 5HG8A 1JSVA 2IEWA 3CTHA 3L8PA 4XNEA 2Q0NA 2B9FA 5FD2A 4DF3A 3VUHA 4ALUA 1S9IA 1HCLA 1MRVA 3LFQA 5GHVA 4BKYA 2C1AA 5I9YA 3ODYX 4B4LA 3SOCA 4GU6A 2VTLA 5J7BA 4R7BA 4R5SA 3PUPA 3EQBA 2C6TA 3R9RA 2HXQA 4X6RA 3EH9A 4F0IA 2VZ6A 4KABA 1IRKA 1Y8YA 1YXXA 3OCGA 4G6LA 4GFGA 4S32A 5AUZA 4B99A 4CYIA 4RZVA 2XCHA 2BZIB 2PK9A 3EN6A 4RWJA 2C6KA 3L9LA 4I3ZA 2CKEA 4L46A 3UDSA 3UMXA 4ZTHA 1XH6A 5HVKA 2ETRA 3JXWA 3LKMA 3U6HA 2UZWE 1KE6A 4YGAA 1T45A 3ZFXA 1OL6A 4EOJA 5CTPA 3FKNA 4GVAA 5ANKA 2ZDTA 4CV8A 4PTCA 2PVLA 3D15A 2YZAA 2W5HA 3O71A 5M08A 1MQBA 4YJVA 5AAGA 4I6FA 5AP7A 3ZLSA 4AA5A 4BJJA 4H58A 5M4UA 3TYKA 4I22A 4X2KA 2J6MA 5KO1A 3E7OA 3U8WA 3RK9A 1JQHA 4E4LA 4XV3A 4C59A 3SKCA 3Q9WA 4FTLA 2G2FA 3FUPA 3KEXA 4O22A 4QQTA 2P3GX 1UKHA 5CF8A 4BIEA 4RSSA 1CKIA 4QYHA 1ZOHA 3WF5A 2GNJA 2PVNA 2OIDA 3MIYA 3P7AA 4U81A 2C0TA 5G1XA 3C5UA 4W4VA 2GTNA 5DH3A 4EH4A 3H4JA 1YHSA 5F94A 3AC3A 3LJ0A 5AX3A 4YBJA 4BI2A 3CC6A 2R7BA 3KRRA 3PZHA 3FZSA 4WHZA 1H4LA 1LR4A 3PJ3A 4H1MA 4HGTA 2CCHA 2ZFYA 4W9XA 4YTFA 5HBJA 1XH8A 3FL5A 3CQWA 2RG5A 4YTHA 2B9IA 2R0UA 5LVOA 1OBGA 2H6DA 3PIXA 3WF7A 3NUPA 4YP8A 1PMVA 3FXWA 4UEUA 2WKMA 4R1VA 3LLTA 4BI0A 1GAGA 2OZAB 3DU8A 1V0PA 2W9FB 4YC3A 2BRHA 4Q2AA 4YHTA 4QTAA 2VO6A 3DKFA 4FKPA 2ZVAA 1WBNA 4GL9A 4UMQA 2QONA 4X2GA 3RM6A 3KMWA 2KTYA 1RJBA 5AEPA 4O4EA 4ZSEA 4USEA 1FMKA 3LCKA 5LVMA 1KUTA 5FWKK 1XWSA 2PULA 4D4YA 4YTCA 4LFIA 5FQDC 4ZY6A 2QNJA 3TN8A 2X2LA 1OECA 3V8WA 4CLJA 2OI4X 3GCUA 3CKXA 4QPSA 3QQJA 4V04A 5EQYA 2Y4IC 1QMZA 4CTBA 4J98A 3NAXA 4RX9A 3NAYA 3EOCA 5HIBA 4OTGA 4ANSA 3TNQB 4O27B 1SZMA 4BZOA 5LWNA 4ZSJA 2B53A 4X2NA 4AF3A 4W4XA 3MA3A 2WEVA 2IW9A 3E3BX 4C4HA 4EZ3A 2ZV8A 4ASXA 4IEBA 4WG4A 2XBAA 5GJFA 2HW6A 4FSYA 4RIXB 2DQ7X 4I0RA 4TWOA 5ANDA 5CANA 3A7JA 4G9CA 3LFEA 4O7RA 2FVDA 4QTCA 4FSUA 2XIYA 3UE4A 4D5HA 5KMOA 3F2NA 4WSYA 3CEKA 2Y4PA 4AZTA 1U4DA 3BWJA 4I20A 1SNUA 4TWNA 4EYMA 2XNOA 3UOJA 4ZMEA 4BR3A 4FC0A 2VTPA 5IEVA 3MB6A 3H10A 3OW4A 3CPCA 2I0VA 3R6XA 3NGAA 4KIKA 4IZAA 4MD9E 4TWCA 4H05A 1HCKA 1P4FA 2PHKA 2PMNX 3E8DA 5J8IA 3NYOA 2BTSA 3PA4A 3QTIA 4AOTA 4L52A 3W2SA 3FYKX 4EBVA 4EOKA 4HYHA 3C4EA 3WE8A 3TACA 1KE5A 3MJ2A 2WMRA 5CSWA 5DWRA 4Z55A 5AUUA 5IU2A 4I0TA 2VWIA 3QQLA 4FTQA 2JBOA 4L7SA 2Y4IB 2HK5A 4NW6A 4EH6A 5B7VA 4DFUA 3N51A 3OT3A 2ITPA 1UWJA 3G0EA 4FTOA 2XK6A 4K77A 5AUWA 5C01A 4X7QA 2R3MA 3FXXA 1PRYA 4YC6A 3NRMA 2C5XA 4BZDA 2CN5A 2UUEA 1NA7A 4FZ7A 4PNIA 5FUTA 5HNIX 4II5A 2BRNA 2ERZE 1Q8TA 2YIWA 3CGFA 2A4LA 3PP0A 2BZJA 4JAIA 4QYEA 3P08A 2I0YA 4OTDA 2PSQA 1H27A 3P0MA 4FT3A 4IJ9A 3MH0A 4R5YA 3DBQA 3I4BA 4JBQA 4BYIA 3AT4A 2VWXA 4AT4A 4I6HA 2GFSA 3V8TA 4Y8DA 4DBXA 3T9IA 4RVTA 3A7FA 2A1AB 2W9ZB 3AD4A 1E1VA 3A7HA 4CFFA 2QI8A 3A8WA 3BX5A 1YKRA 3ANQA 3AD6A 2HZ4A 3ORXA 1K3AA 4XH6A 4DEHA 3AMBA 2R64A 4YBKA 2XZSA 4KS7A 4G3CA 1RW8A 3S4QA 4MXOA 2A27A 2C68A 4FTTA 1LUFA 4OUCA 5L3AA 4ERWA 2ZMDA 2BRGA 3EQCA 3QGYA 2ZV7A 3PVUA 3QQUA 4FTCA 4RA5A 5AV0A 5A6NA 5KMJA 3VBTA 4FKLA 5HCXA 5KNJA 5K0KA 5BX0A 3UOLA 4A9SA 1KSWA 2WIPA 3CP9A 3P5JC 4EJNA 2X7FA 2Z60A 3COHA 3D14A 3VN9A 3ZS5A 3C0HA 3ZM9A 2YCRA 2XKEA 3PYYA 1W0XC 2BIYA 4FSRA 4FL3A 4ARKA 2CKOA 4E3CA 3ZLWA 3QD4A 1ZZLA 4GT4A 2IVVA 4BKZA 4DH8A 2VNWA 4D2SA 3TUCA 4E7WA 2ZJWA 3UO4A 3D94A 5EDRA 5ETCA 4RLLA 4EH7A 4GCJA 2EU9A 2R3PA 2YM3A 4ANQA 4IB3A 3E3PA 4FEQA 4AN3A 4BCHA 3COIA 4FICA 3LXPA 3O8UA 4LRKA 3FLZA 2WZJA 3KFAA 5D1JA 5B2KA 5HTBA 5IDPA 3DZOA 4HNFA 2PPQA 4DTAA 3IDCA 3KVWA 5HE3A 3R8UA 4E4NA 3Q52A 2A2AA 5EW3A 3W0SA 3NCZA 1OM1A 5D10A 4BCJA 4I94A 2WD1A 3KXNA 5B0XA 5LMAA 4F9BA 4I5CA 4PF4A 3T8OA 4NM3A 4YNEA 4FKSA 4C57A 4D5KA 3U54A 3PSBA 4QO9A 5CVHA 3D5WA 2W99B 2YCSA 4L01A 4BB4A 4EK5A 5KMNA 4DDGA 4DFZE 3Q9ZA 4EC9A 2WU6A 2XB7A 4YURA 4CVAA 5EDQA 2HY81 5E8WA 3F88A 1PJKA 2F7ZE 3OWJA 5CSVA 3TIYA 3W2CA 4DEIA 5J1VA 4AW2A 2QOFA 4GYIA 1H01A 2JITA 4LV5A 1U5QA 4FNXA 4FNZA 5AV2A 2W06A 3FLSA 2OK1A 3Q4TA 3TZ7A 4M97A 4K1BA 1TVOA 4ZMFA 4AU8A 5LJJA 4O83A 4NYEA 3NW7A 5E1EA 4G16A 5KMKA 3OTVA 4I24A 4IQ6A 5HE0A 3W8QA 4PX6A 5DG5A 3DXQA 5BPYA 5D7AA 4GT5A 3ZO4A 2IW6A 4GYGA 4JL9A 3L9MA 3QKKA 4QP6A 3TTIA 3C4FA 4IM0A 4L6QA 4YJNA 2FGIA 3UZPA 1OL1A 2EB2A 2YN8A 1BI8A 2WMUA 4J7BA 3SHEA 3UPXA 4F08A 2YJSA 4C37A 3AKLA 4N6YA 4IVCA 2UW8A 5AP2A 1KV1A 3LXNA 4LOQA 1PMNA 1NW1A 2UVYA 3F6XA 3TKUA 2GNHA 4Y5QA 4ZTMA 4YLJA 3ORIA 2VN9A 3R7YA 4QPMA 4R3CA 4BDJA 5D41A 2GPHA 4CFVA 1XMLA 3RZFA 3UDTA 5CY3A 4U41A 3W2RA 5HBHA 4K9YA 4D2RA 2JAMA 4BYJA 3SG9A 3QXPA 1STCE 3VC4A 3BHVA 1G8JA 3F3VA 1H1WA 2XM8A 4AGCA 3BCEA 5CENA 3RHKA 4DCAA 4R3RA 4IDVA 5GJGA 2O63A 4QMUA 4DYMA 4AZFA 3FL4A 4G3DA 4ACMA 4ZSLA 5L6PA 4GG5A 1W2FA 1PKDA 5FP6A 2NPQA 3GCQA 4JR3A 1M52A 4AAAA 3OWPA 5HNGA 4GUEA 4ASDA 1MRUA 3EIDA 3OTUA 4OTRA 2OH4A 3GCPA 2F4JA 2ITQA 3E92A 4Y72A 3FPQA 3VIDA 3ZH8A 4FK6A 2J0IA 2FH9A 4F99A 3PZEA 1YXSA 4RJ6A 2A98A 3EHAA 1OIYA 3RGFA 2VWYA 2RFEA 3OG7A 2XIRA 4U5JA 2H8HA 1Q8WA 3I0OA 1WCCA 4PPBA 2VTAA 3R8MA 3TEIA 2GS6A 5EOLA 5BVEA 4OTWA 5BVKA 4FG7A 3COKA 3UDZA 3WI6A 5HKMA 4GS6A 2YZLA 4HYUA 2JGZA 3JPVA 3LQ8A 3REPA 4TXCA 5J9ZA 2F49A 4EOPA 2AC3A 3PXYA 4FA2A 1UKIA 4NJDA 4FV9A 3R8ZA 3UVRA 4BTKA 5KX8A 2A19B 4MNEB 1YWVA 2WTKB 3QA0A 3EN4A 2B9HA 3GC8A 2PZRA 3Q4ZA 4GUBA 3JS2A 4R6VA 3CPBA 5DRBA 3FHRA 3NYXA 4CRSA 3UZTA 4QRCA 1W2CA 3WE4A 4QP9A 4BHZA 3VWAA 1XH9A 3FY2A 4FKGA 3OROA 2X8DA 3FI2A 4H3BA 4P90A 5LXMA 3HUBA 3P5KA 1YI6A 4DEBA 1PMUA 4O7NA 2X7OA 3QWJA 2OWBA 4NK9A 4E6QA 3AKJA 4DTBA 1PKGA 4U9AA 3CR0A 3V6SA 5CVGA 1PXKA 4B8MA 3JVSA 1YQJA 2R3FA 3RPSA 1PXIA 5AR2A 2IVTA 3VBYA 2C5VA 3KRLA 4AQCA 2FB8A 2WMWA 4EUUA 2FSLX 2WNTA 3R00A 2WMTA 4Z9LA 1XHAA 5BUIA 3ERKA 3GOKA 4ZY4A 1R3CA 4ZTSA 3SD0A 1ZLTA 4QMMA 2V22A 5AR4A 3PXFA 4FV7A 3A61A 4FSQA 3BGQA 3OHTA 3PSDA 4TYHA 2OICA 2ZM1A 5DA3A 5KBRA 4FSTA 1XKKA 5HU9A 3LXKA 3DT1A 5HHWA 4OBPA 5EKNA 1WBWA 1IASA 3PIYA 2ITOA 3DLZA 3ZO2A 4RIYA 3PG1A 4ZLOA 2WXVA 4O0VA 2BDJA 2R0IA 2VX0A 4FTKA 4L8MA 5JFSA 4RLKA 3DKCA 1VEBA 2R3IA 4NT4A 3V3VA 1L8TA 2UZTA 5EOBA 1AGWA 4HVDA 3CY2A 3PDTA 3K3JA 5M06A 2ZV2A 4GW8A 4BDKA 3GXLA 2CKQA 3R8LA 5CAVA 1PXNA 4PTGA 3U6JA 3TCPA 3MWUA 4BGGA 5LMKA 4C62A 2XKDA 3DB6A 3SW4A 3BYSA 4ZTLA 3T9TA 3GQLA 4OT6A 4KKGA 4RVKA 4XOYA 3CD8A 3DBFA 4MCVA 4DGGA 2OSCA 5TO8A 2Y9QA 1ZMWA 3DTWA 1QPDA 2HIWA 3LCDA 4GG7A 5IA5A 4APCA 4MKCA 4Z7GA 4DFBA 3ACJA 5A46A 1Q99A 3K54A 1M7QA