2OH3A

Crystal structure of cog1633: uncharacterized conserved protein (zp_00055496.1) from magnetospirillum magnetotacticum ms-1 at 2.00 a resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
152
structure length
149
Chain Sequence
YTLAEFLAHAIALETEAAERYVELADMMEAHNNLDTATVFRDMARFSTLHGDEIKQRSRALELPKLMSWQYRWKTPPEVGDEHYLMTPYHALRYARDNEIRGMEYYKEAAANSADPEVKRLGADFAAEEAEHVVALDKWIEKTPRPSIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COG1633: Uncharacterized conserved protein
publication title Crystal structure of COG1633: Uncharacterized conserved protein (ZP_00055496.1) from Magnetospirillum magnetotacticum MS-1 at 2.00 A resolution
rcsb
source organism Magnetospirillum magnetotacticum
molecule tags Metal binding protein
total genus 51
structure length 149
sequence length 152
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02915 Rubrerythrin Rubrerythrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2oh3A01
3KA4A 2X170 3F35A 4MY7A 5E2DA 1Z6OM 5D8XA 4CVSA 3BKNA 4ZMCA 1RCEA 1JREA 4TOBA 2V2NA 3E6SA 3O7SA 3ISEA 4DYYA 2YJJA 4M32A 2V2OA 2IB0A 1MFRA 3KXUA 2GYDA 2CF7A 3SH6A 2WLAA 3AJQA 3BVFA 1VELA 5GU3X 3E6RA 3MPSA 1BG7A 3F32A 3O7RA 5D8OA 4DASA 2ZA8A 2V2MA 2XJMA 2CIHA 5FFEA 1RCGA 2CEIA 1QGHA 3BVEA 3F39A 3F34A 1JKVA 1S30A 2IU2A 3BVIA 3HL1A 5C6FA 5JKLG 4TO9A 1S3QA 3EGMA 4R42A 4M34A 5JKLA 2WLUA 4XKUA 5D8YA 3GE4A 4AM2A 1JIGA 3R2HA 1F30A 3PW1B 2V15A 3WVWA 4PG0A 3FVBA 4DYUA 5JKMA 2Z5QA 2OC5A 2W0OA 4ISPA 4II4B 2JD70 4RC8A 3E1OA 1DVBA 5ERKA 4U3GA 1TKOA 4Y08A 2FHAA 4ML5A 4DYZA 4TODA 2Z90A 3SIDA 4PGIA 3PW8C 5ERJA 1LB3A 3E1MA 5LG8A 4TOCA 3RAVA 4AM5A 3QVDA 4RC7B 5K52A 1UVHA 4ZKWA 3E1PA 3AF9X 5GOUA 5J8SA 2ZG7X 1LKMA 1IESA 4TOEA 3E2CA 4ZJKA 2HR5A 1JI5A 4CYAA 4MJYA 2YW7A 5CMQA 5D8RA 4ZTTA 3E1LA 2IY4A 3VNXA 3OJ5A 3F36A 4RC6A 4Z3BA 3RGDA 3A68A 1QYBA 1ZS3A 3PWQC 3Q4QA 3Q4RA 3FI6A 4AM4A 1F33A 3PVYA 5K53A 2JD80 3RE7A 1YUZA 2PYBA 3BT5A 4EVEA 2CN6A 4TOHA 5D8QA 3AJOA 2GYQA 5FFAA 2V2JA 3PW1A 1O9RA 3UNOA 2FZFA 3FSEA 2FL0A 4TOGA 1NNQA 2F7NA 2C2JA 2XGWA 3WVUA 5CZUA 1XZ1A 3SE1A 1RCCA 4II4A 2VZBA 3R2RA 3QD8A 3AJPA 3PVRA 4LQVA 2WTLA 1R03A 4ZL5A 1VJXA 3QB9A 2FJCA 2VXXA 4M35A 4RC6B 1AEWA 5GU0X 3PZAA 2YW6A 3Q4NA 3E1JA 1HRSA 2ZA7A 4DE6A 2V2LA 4ZL6A 3SHXA 2ZA6A 3PVYB 4CYBA 4RC7A 4IXKA 4TOFA 3NOZX 4ZKHA 5AXSA 2CN7A 1H96A 3PVTA 3BVKA 4OYNA 4TOAA 4CVRA 2Z5PA 3E1QA 1TJOA 3UOFA 2G4HA 4RC5B 3IS8A 4XKSA 4LQJA 1JTSA 3NP0X 4E6KA 2Y3QA 2BW1A 3KA9A 5D8PA 2ZG8X 1JYBA 1JGCA 5JACA 3WVVA 4EVCA 5LBHA 1RCIA 2XJOA 3ISFA 3PVRB 1BCFA 1OTKA 5D8SA 2BK6A 5LG2A 1SQ3A 3WNWA 1Z4AA 2C41A 5GN8B 1JI4A 3R2KA 4PGKA 5E1UA 2QQYA 3UOIA 2XKQA 2ZG9X 1LKOA 3R2OA 3RD0A 4ITTA 2Z6MA 3H7GA 2ITBA 2CLUA 3PVTB 4LQHA 2C2UA 4LPJA 1YV1A 3QHBA 4LPMA 5J9VA 4M33A 3GVYA 2BJYA 2V2PA 3IS7A 1NFVA 4DI0A 1L8IA 5FFBA 2C6RA 2D5KA 1DATA 1KRQA 4EVBA 3AF8X 2XJNA 2ZURX 3Q4OA 2HTNA 3ERZA 2C2FA 3KA3A 3EZUA 2CLBA 3F33A 4MUDA 5I4JA 4RC5A 4CVPA 3EZ0A 3OGHA 2FFXJ 1MOJA 5HQOA 2V2RA 4CMYA 3A9QA 1DPSA 2YJKA 2V2IA 3F37A 4CVTA 2FKZA 1TKPA 2Z5RA 3R2SA 4ISMA 5FFDA 1B71A 1J30A 4IWKA 4ERUA 4KVRA 3U90A 2V2SA 3ES3A 5GN8A 4CY9A 3R2MA 3T9JA 4LQNA 4EVDA 2CHIA 1XZ3A 1VLGA 1LKPA 5HJHA 3GHQA 5FFCA 3KA8A 3QZ3A 3HIUA 4ZLWA 4MN9A 3BVLA 3NP2X 1N1QA 3TA8A 5CMRA 4ZKXA 2OH3A 4ETRA 4TW3A 5HJFA 1NF6A 2VXIA 3KX9A 3QHCA 1EUMA 2JD60 1UMNA 4KVQA 1L8HA 4ITWA 5FEJA 2UX1A 5JKMG 1O9IA 2BKCA 3AK8A 3E1NA 1VEIA 1TK6A 3PW8A 5IX6A 4Z5SA 3F38A 3PWFA 4DYXA 1S2ZA 3R2LA 4REUA 1RCDA 4KVSA 1SOFA 2GS4A 3KA6A 4LYXA 1YUXA 3AK9A 2RBDA 5GU2X 4QUWA 4CMYV 1ZUJA 2CHPA 1NF4A 4A25A 4PG1A 2FG8A 2QF9A 2FG4A 4XGSA 1FHAA 4XKTA 5LS9A 1VEQA 3RBCA 1Z6OA 4DZ0A 3IQ1A 4P18A 3AF7X 1IERA 5J93A 3PWQA 3KWOA 1BFRA 5J8WA 4MKUA 5GU1X 4LYUA 4LPNA 1JKUA 1GWGA 4IWJA 4YKHA 1RYTA
chains in the Genus database with same CATH superfamily
3KA4A 2X170 3F35A 4MY7A 5E2DA 5JDOA 1Z6OM 5D8XA 4CVSA 3BKNA 4ZMCA 1RCEA 1JREA 4TOBA 2V2NA 3E6SA 4YXJA 3O7SA 3ISEA 3JZAB 2YJJA 4M32A 4DYYA 2V2OA 2IB0A 1MFRA 3KXUA 2GYDA 2CF7A 3SH6A 2WLAA 3AJQA 3BVFA 1VELA 5GU3X 3E6RA 3MPSA 1BG7A 3F32A 3O7RA 5D8OA 4DASA 2ZA8A 2V2MA 2XJMA 2CIHA 3GGYA 5FFEA 1RCGA 2CEIA 1QGHA 3FRRA 5JDOB 3BVEA 3F39A 3F34A 1JKVA 1S30A 2IU2A 3BVIA 3HL1A 5C6FA 5JKLG 4TO9A 1S3QA 3EGMA 4R42A 4M34A 5JKLA 2WLUA 4XKUA 5D8YA 3GE4A 4AM2A 1JIGA 3R2HA 1F30A 3PW1B 2V15A 3WVWA 4PG0A 3M6JA 3FVBA 4DYUA 5JKMA 2Z5QA 2OC5A 2W0OA 4ISPA 4II4B 2JD70 4RC8A 3E1OA 1DVBA 5ERKA 4U3GA 1TKOA 4Y08A 2FHAA 4ML5A 4DYZA 4TODA 2Z90A 3SIDA 4PGIA 3PW8C 5ERJA 1LB3A 4MXPA 3E1MA 5LG8A 4TOCA 3RAVA 4AM5A 3QVDA 4RC7B 5K52A 1UVHA 4ZKWA 2G38B 3E1PA 3AF9X 5GOUA 5J8SA 2ZG7X 1LKMA 1IESA 3KHKA 2V8UA 4KXRB 4TOEA 3E2CA 3KDQA 4ZJKA 2HR5A 1JI5A 4CYAA 4MJYA 2YW7A 5CMQA 5D8RA 4ZTTA 3E1LA 2IY4A 3VNXA 3OJ5A 3F36A 4RC6A 4Z3BA 3D19A 3RGDA 3A68A 3VV9A 1QYBA 1ZS3A 3PWQC 3Q4QA 3Q4RA 3FI6A 4AM4A 1F33A 3PVYA 5K53A 2JD80 3RE7A 1YUZA 2PYBA 3BT5A 4EVEA 3JZ9A 2CN6A 4TOHA 5D8QA 3AJOA 2GYQA 5FFAA 2V2JA 3PW1A 1O9RA 3UNOA 3V3KB 2FZFA 3FSEA 2FL0A 4TOGA 1NNQA 2F7NA 2C2JA 2XGWA 2N02A 3WVUA 5CZUA 1XZ1A 3SE1A 1RCCA 4II4A 2VZBA 3R2RA 3C1ZA 3DBYA 3QD8A 2MGYA 3AJPA 3PVRA 4LQVA 2WTLA 3GGZA 1R03A 4YVZA 4ZL5A 1VJXA 3QB9A 3UFBA 2FJCA 2VXXA 4M35A 4RC6B 1AEWA 5GU0X 3PZAA 2YW6A 4WJG4 3Q4NA 3E1JA 1HRSA 2ZA7A 4DE6A 2V2LA 4ZL6A 3SHXA 2ZA6A 4W4KB 3PVYB 4CYBA 2OKCA 4RC7A 4IXKA 4TOFA 3NOZX 4ZKHA 5AXSA 2CN7A 1H96A 3PVTA 3BVKA 4OYNA 4TOAA 4CVRA 2Z5PA 3E1QA 1TJOA 3UOFA 2G4HA 4RC5B 3IS8A 4XKSA 4LQJA 1JTSA 3NP0X 4E6KA 2Y3QA 2BW1A 3KA9A 5D8PA 2ZG8X 1JYBA 3N6OA 1JGCA 5JACA 3WVVA 4EVCA 5LBHA 1RCIA 2XJOA 3ISFA 3PVRB 1BCFA 1OTKA 5D8SA 2BK6A 5LG2A 1SQ3A 3WNWA 1Z4AA 2C41A 2Y44A 5GN8B 1JI4A 3R2KA 4PGKA 4E40A 3L0MA 5E1UA 2QQYA 4YXMA 3UOIA 2XKQA 2ZG9X 1LKOA 3R2OA 3RD0A 4ITTA 2Z6MA 3H7GA 2WWXB 2ITBA 2CLUA 3PVTB 4LQHA 2C2UA 4LPJA 1YV1A 3QHBA 4LPMA 5J9VA 3FRSA 4M33A 3GVYA 2BJYA 5HU6D 2V2PA 3IS7A 1NFVA 4DI0A 1L8IA 5FFBA 2C6RA 2D5KA 1DATA 1KRQA 4EVBA 3AF8X 2XJNA 2ZURX 3Q4OA 2HTNA 3ERZA 2C2FA 3C21A 3EZUA 3KA3A 2CLBA 3F33A 4MUDA 5I4JA 4RC5A 4CVPA 3EZ0A 3OGHA 2FFXJ 1MOJA 3VVAA 5HQOA 2V2RA 4CMYA 3A9QA 1DPSA 2YJKA 2V2IA 3F37A 4CVTA 2FKZA 1TKPA 2Z5RA 3R2SA 4ISMA 5FFDA 1B71A 1J30A 4IWKA 4ERUA 4KVRA 3U90A 2V2SA 3ES3A 5GN8A 4CY9A 3R2MA 3T9JA 4LQNA 4EVDA 2CHIA 1XZ3A 1VLGA 1LKPA 5HJHA 3GHQA 5FFCA 3KA8A 3QZ3A 3HIUA 4ZLWA 4MN9A 3BVLA 3NP2X 1N1QA 3TA8A 3LKDA 5CMRA 4ZKXA 2OH3A 4ETRA 4TW3A 5HJFA 1NF6A 2VXIA 3KX9A 3QHCA 1EUMA 2JD60 1UMNA 4KVQA 4W4LB 1L8HA 4ITWA 5FEJA 2UX1A 5JKMG 1O9IA 2BKCA 3AK8A 4X0JA 3E1NA 1VEIA 1TK6A 3PW8A 5IX6A 4Z5SA 3F38A 3PWFA 2V8TA 4DYXA 1S2ZA 3R2LA 4REUA 1RCDA 4KVSA 1SOFA 2GS4A 3KA6A 4LYXA 1YUXA 3AK9A 2RBDA 2AR0A 2CWLA 3C23A 4QUWA 5GU2X 4CMYV 1ZUJA 2CHPA 1NF4A 4A25A 4PG1A 2FG8A 3C1YA 2QF9A 2FG4A 4XGSA 1FHAA 4XKTA 5LS9A 1VEQA 3RBCA 1Z6OA 3W54A 4DZ0A 3IQ1A 4P18A 3AF7X 1IERA 5J93A 3PWQA 3KWOA 1BFRA 5J8WA 4MKUA 5GU1X 4LYUA 4LPNA 1JKUA 1GWGA 4IWJA 4YKHA 1RYTA
chains in the Genus database with same CATH topology
3KA4A 2X170 3F35A 4MY7A 5E2DA 5JDOA 1Z6OM 5D8XA 4CVSA 3BKNA 4ZMCA 1RCEA 1JREA 4TOBA 2V2NA 3E6SA 4YXJA 3O7SA 3ISEA 3JZAB 2YJJA 4M32A 4DYYA 2V2OA 2IB0A 1MFRA 3KXUA 2GYDA 2CF7A 3SH6A 2WLAA 3AJQA 3BVFA 1VELA 5GU3X 3E6RA 3MPSA 1BG7A 3F32A 3O7RA 5D8OA 4DASA 2ZA8A 2V2MA 2XJMA 2CIHA 3GGYA 5FFEA 1RCGA 2CEIA 1QGHA 3FRRA 5JDOB 3BVEA 3F39A 3F34A 1JKVA 1S30A 2IU2A 3BVIA 3HL1A 5C6FA 5JKLG 4TO9A 1S3QA 3EGMA 4R42A 4M34A 5JKLA 2WLUA 4XKUA 5D8YA 3GE4A 4AM2A 1JIGA 3R2HA 1F30A 3PW1B 2V15A 3WVWA 4PG0A 3M6JA 3FVBA 4DYUA 5JKMA 2Z5QA 2OC5A 2W0OA 4ISPA 4II4B 2JD70 4RC8A 3E1OA 1DVBA 5ERKA 4U3GA 1TKOA 4Y08A 2FHAA 4ML5A 4DYZA 4TODA 2Z90A 3SIDA 4PGIA 3PW8C 5ERJA 1LB3A 4MXPA 3E1MA 5LG8A 4TOCA 3RAVA 4AM5A 3QVDA 4RC7B 5K52A 1UVHA 4ZKWA 2G38B 3E1PA 3AF9X 5GOUA 5J8SA 2ZG7X 1LKMA 1IESA 3KHKA 2V8UA 4KXRB 4TOEA 3E2CA 3KDQA 4ZJKA 2HR5A 1JI5A 4CYAA 4MJYA 2YW7A 5CMQA 5D8RA 4ZTTA 3E1LA 2IY4A 3VNXA 3OJ5A 3F36A 4RC6A 4Z3BA 3D19A 3RGDA 3A68A 3VV9A 1QYBA 1ZS3A 3PWQC 3Q4QA 3Q4RA 3FI6A 4AM4A 1F33A 3PVYA 5K53A 2JD80 3RE7A 1YUZA 2PYBA 3BT5A 4EVEA 3JZ9A 2CN6A 4TOHA 5D8QA 3AJOA 2GYQA 5FFAA 2V2JA 3PW1A 1O9RA 3UNOA 3V3KB 2FZFA 3FSEA 2FL0A 4TOGA 1NNQA 2F7NA 2C2JA 2XGWA 2N02A 3WVUA 5CZUA 1XZ1A 3SE1A 1RCCA 4II4A 2VZBA 3R2RA 3C1ZA 3DBYA 3QD8A 2MGYA 3AJPA 3PVRA 4LQVA 2WTLA 3GGZA 1R03A 4YVZA 4ZL5A 1VJXA 3QB9A 3UFBA 2FJCA 2VXXA 4M35A 4RC6B 1AEWA 5GU0X 3PZAA 2YW6A 4WJG4 3Q4NA 3E1JA 1HRSA 2ZA7A 4DE6A 2V2LA 4ZL6A 3SHXA 2ZA6A 4W4KB 3PVYB 4CYBA 2OKCA 4RC7A 4IXKA 4TOFA 3NOZX 4ZKHA 5AXSA 2CN7A 1H96A 3PVTA 3BVKA 4OYNA 4TOAA 4CVRA 2Z5PA 3E1QA 1TJOA 3UOFA 2G4HA 4RC5B 3IS8A 4XKSA 4LQJA 1JTSA 3NP0X 4E6KA 2Y3QA 2BW1A 3KA9A 5D8PA 2ZG8X 1JYBA 3N6OA 1JGCA 5JACA 3WVVA 4EVCA 5LBHA 1RCIA 2XJOA 3ISFA 3PVRB 1BCFA 1OTKA 5D8SA 2BK6A 5LG2A 1SQ3A 3WNWA 1Z4AA 2C41A 2Y44A 5GN8B 1JI4A 3R2KA 4PGKA 4E40A 3L0MA 5E1UA 2QQYA 4YXMA 3UOIA 2XKQA 2ZG9X 1LKOA 3R2OA 3RD0A 4ITTA 2Z6MA 3H7GA 2WWXB 2ITBA 2CLUA 3PVTB 4LQHA 2C2UA 4LPJA 1YV1A 3QHBA 4LPMA 5J9VA 3FRSA 4M33A 3GVYA 2BJYA 5HU6D 2V2PA 3IS7A 1NFVA 4DI0A 1L8IA 5FFBA 2C6RA 2D5KA 1DATA 1KRQA 4EVBA 3AF8X 2XJNA 2ZURX 3Q4OA 2HTNA 3ERZA 2C2FA 3C21A 3EZUA 3KA3A 2CLBA 3F33A 4MUDA 5I4JA 4RC5A 4CVPA 3EZ0A 3OGHA 2FFXJ 1MOJA 3VVAA 5HQOA 2V2RA 4CMYA 3A9QA 1DPSA 2YJKA 2V2IA 3F37A 4CVTA 2FKZA 1TKPA 2Z5RA 3R2SA 4ISMA 5FFDA 1B71A 1J30A 4IWKA 4ERUA 4KVRA 3U90A 2V2SA 3ES3A 5GN8A 4CY9A 3R2MA 3T9JA 4LQNA 4EVDA 2CHIA 1XZ3A 1VLGA 1LKPA 5HJHA 3GHQA 5FFCA 3KA8A 3QZ3A 3HIUA 4ZLWA 4MN9A 3BVLA 3NP2X 1N1QA 3TA8A 3LKDA 5CMRA 4ZKXA 2OH3A 4ETRA 4TW3A 5HJFA 1NF6A 2VXIA 3KX9A 3QHCA 1EUMA 2JD60 1UMNA 4KVQA 4W4LB 1L8HA 4ITWA 5FEJA 2UX1A 5JKMG 1O9IA 2BKCA 3AK8A 4X0JA 3E1NA 1VEIA 1TK6A 3PW8A 5IX6A 4Z5SA 3F38A 3PWFA 2V8TA 4DYXA 1S2ZA 3R2LA 4REUA 1RCDA 4KVSA 1SOFA 2GS4A 3KA6A 4LYXA 1YUXA 3AK9A 2RBDA 2AR0A 2CWLA 3C23A 4QUWA 5GU2X 4CMYV 1ZUJA 2CHPA 1NF4A 4A25A 4PG1A 2FG8A 3C1YA 2QF9A 2FG4A 4XGSA 1FHAA 4XKTA 5LS9A 1VEQA 3RBCA 1Z6OA 3W54A 4DZ0A 3IQ1A 4P18A 3AF7X 1IERA 5J93A 3PWQA 3KWOA 1BFRA 5J8WA 4MKUA 5GU1X 4LYUA 4LPNA 1JKUA 1GWGA 4IWJA 4YKHA 1RYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KA4 A;  2X17 0;  3F35 A;  4MY7 A;  5E2D A;  1Z6O M;  5D8X A;  4CVS A;  3BKN A;  4ZMC A;  1RCE A;  1JRE A;  4TOB A;  2V2N A;  3E6S A;  3O7S A;  3ISE A;  4DYY A;  2YJJ A;  4M32 A;  2V2O A;  2IB0 A;  1MFR A;  3KXU A;  2GYD A;  2CF7 A;  3SH6 A;  2WLA A;  3AJQ A;  3BVF A;  1VEL A;  5GU3 X;  3E6R A;  3MPS A;  1BG7 A;  3F32 A;  3O7R A;  5D8O A;  4DAS A;  2ZA8 A;  2V2M A;  2XJM A;  2CIH A;  5FFE A;  1RCG A;  2CEI A;  1QGH A;  3BVE A;  3F39 A;  3F34 A;  1JKV A;  1S30 A;  2IU2 A;  3BVI A;  3HL1 A;  5C6F A;  5JKL G;  4TO9 A;  1S3Q A;  3EGM A;  4R42 A;  4M34 A;  5JKL A;  2WLU A;  4XKU A;  5D8Y A;  3GE4 A;  4AM2 A;  1JIG A;  3R2H A;  1F30 A;  3PW1 B;  2V15 A;  3WVW A;  4PG0 A;  3FVB A;  4DYU A;  5JKM A;  2Z5Q A;  2OC5 A;  2W0O A;  4ISP A;  4II4 B;  2JD7 0;  4RC8 A;  3E1O A;  1DVB A;  5ERK A;  4U3G A;  1TKO A;  4Y08 A;  2FHA A;  4ML5 A;  4DYZ A;  4TOD A;  2Z90 A;  3SID A;  4PGI A;  3PW8 C;  5ERJ A;  1LB3 A;  3E1M A;  5LG8 A;  4TOC A;  3RAV A;  4AM5 A;  3QVD A;  4RC7 B;  5K52 A;  1UVH A;  4ZKW A;  3E1P A;  3AF9 X;  5GOU A;  5J8S A;  2ZG7 X;  1LKM A;  1IES A;  4TOE A;  3E2C A;  4ZJK A;  2HR5 A;  1JI5 A;  4CYA A;  4MJY A;  2YW7 A;  5CMQ A;  5D8R A;  4ZTT A;  3E1L A;  2IY4 A;  3VNX A;  3OJ5 A;  3F36 A;  4RC6 A;  4Z3B A;  3RGD A;  3A68 A;  1QYB A;  1ZS3 A;  3PWQ C;  3Q4Q A;  3Q4R A;  3FI6 A;  4AM4 A;  1F33 A;  3PVY A;  5K53 A;  2JD8 0;  3RE7 A;  1YUZ A;  2PYB A;  3BT5 A;  4EVE A;  2CN6 A;  4TOH A;  5D8Q A;  3AJO A;  2GYQ A;  5FFA A;  2V2J A;  3PW1 A;  1O9R A;  3UNO A;  2FZF A;  3FSE A;  2FL0 A;  4TOG A;  1NNQ A;  2F7N A;  2C2J A;  2XGW A;  3WVU A;  5CZU A;  1XZ1 A;  3SE1 A;  1RCC A;  4II4 A;  2VZB A;  3R2R A;  3QD8 A;  3AJP A;  3PVR A;  4LQV A;  2WTL A;  1R03 A;  4ZL5 A;  1VJX A;  3QB9 A;  2FJC A;  2VXX A;  4M35 A;  4RC6 B;  1AEW A;  5GU0 X;  3PZA A;  2YW6 A;  3Q4N A;  3E1J A;  1HRS A;  2ZA7 A;  4DE6 A;  2V2L A;  4ZL6 A;  3SHX A;  2ZA6 A;  3PVY B;  4CYB A;  4RC7 A;  4IXK A;  4TOF A;  3NOZ X;  4ZKH A;  5AXS A;  2CN7 A;  1H96 A;  3PVT A;  3BVK A;  4OYN A;  4TOA A;  4CVR A;  2Z5P A;  3E1Q A;  1TJO A;  3UOF A;  2G4H A;  4RC5 B;  3IS8 A;  4XKS A;  4LQJ A;  1JTS A;  3NP0 X;  4E6K A;  2Y3Q A;  2BW1 A;  3KA9 A;  5D8P A;  2ZG8 X;  1JYB A;  1JGC A;  5JAC A;  3WVV A;  4EVC A;  5LBH A;  1RCI A;  2XJO A;  3ISF A;  3PVR B;  1BCF A;  1OTK A;  5D8S A;  2BK6 A;  5LG2 A;  1SQ3 A;  3WNW A;  1Z4A A;  2C41 A;  5GN8 B;  1JI4 A;  3R2K A;  4PGK A;  5E1U A;  2QQY A;  3UOI A;  2XKQ A;  2ZG9 X;  1LKO A;  3R2O A;  3RD0 A;  4ITT A;  2Z6M A;  3H7G A;  2ITB A;  2CLU A;  3PVT B;  4LQH A;  2C2U A;  4LPJ A;  1YV1 A;  3QHB A;  4LPM A;  5J9V A;  4M33 A;  3GVY A;  2BJY A;  2V2P A;  3IS7 A;  1NFV A;  4DI0 A;  1L8I A;  5FFB A;  2C6R A;  2D5K A;  1DAT A;  1KRQ A;  4EVB A;  3AF8 X;  2XJN A;  2ZUR X;  3Q4O A;  2HTN A;  3ERZ A;  2C2F A;  3KA3 A;  3EZU A;  2CLB A;  3F33 A;  4MUD A;  5I4J A;  4RC5 A;  4CVP A;  3EZ0 A;  3OGH A;  2FFX J;  1MOJ A;  5HQO A;  2V2R A;  4CMY A;  3A9Q A;  1DPS A;  2YJK A;  2V2I A;  3F37 A;  4CVT A;  2FKZ A;  1TKP A;  2Z5R A;  3R2S A;  4ISM A;  5FFD A;  1B71 A;  1J30 A;  4IWK A;  4ERU A;  4KVR A;  3U90 A;  2V2S A;  3ES3 A;  5GN8 A;  4CY9 A;  3R2M A;  3T9J A;  4LQN A;  4EVD A;  2CHI A;  1XZ3 A;  1VLG A;  1LKP A;  5HJH A;  3GHQ A;  5FFC A;  3KA8 A;  3QZ3 A;  3HIU A;  4ZLW A;  4MN9 A;  3BVL A;  3NP2 X;  1N1Q A;  3TA8 A;  5CMR A;  4ZKX A;  2OH3 A;  4ETR A;  4TW3 A;  5HJF A;  1NF6 A;  2VXI A;  3KX9 A;  3QHC A;  1EUM A;  2JD6 0;  1UMN A;  4KVQ A;  1L8H A;  4ITW A;  5FEJ A;  2UX1 A;  5JKM G;  1O9I A;  2BKC A;  3AK8 A;  3E1N A;  1VEI A;  1TK6 A;  3PW8 A;  5IX6 A;  4Z5S A;  3F38 A;  3PWF A;  4DYX A;  1S2Z A;  3R2L A;  4REU A;  1RCD A;  4KVS A;  1SOF A;  2GS4 A;  3KA6 A;  4LYX A;  1YUX A;  3AK9 A;  2RBD A;  5GU2 X;  4QUW A;  4CMY V;  1ZUJ A;  2CHP A;  1NF4 A;  4A25 A;  4PG1 A;  2FG8 A;  2QF9 A;  2FG4 A;  4XGS A;  1FHA A;  4XKT A;  5LS9 A;  1VEQ A;  3RBC A;  1Z6O A;  4DZ0 A;  3IQ1 A;  4P18 A;  3AF7 X;  1IER A;  5J93 A;  3PWQ A;  3KWO A;  1BFR A;  5J8W A;  4MKU A;  5GU1 X;  4LYU A;  4LPN A;  1JKU A;  1GWG A;  4IWJ A;  4YKH A;  1RYT A; 
#chains in the Genus database with same CATH topology
 3KA4 A;  2X17 0;  3F35 A;  4MY7 A;  5E2D A;  5JDO A;  1Z6O M;  5D8X A;  4CVS A;  3BKN A;  4ZMC A;  1RCE A;  1JRE A;  4TOB A;  2V2N A;  3E6S A;  4YXJ A;  3O7S A;  3ISE A;  3JZA B;  2YJJ A;  4M32 A;  4DYY A;  2V2O A;  2IB0 A;  1MFR A;  3KXU A;  2GYD A;  2CF7 A;  3SH6 A;  2WLA A;  3AJQ A;  3BVF A;  1VEL A;  5GU3 X;  3E6R A;  3MPS A;  1BG7 A;  3F32 A;  3O7R A;  5D8O A;  4DAS A;  2ZA8 A;  2V2M A;  2XJM A;  2CIH A;  3GGY A;  5FFE A;  1RCG A;  2CEI A;  1QGH A;  3FRR A;  5JDO B;  3BVE A;  3F39 A;  3F34 A;  1JKV A;  1S30 A;  2IU2 A;  3BVI A;  3HL1 A;  5C6F A;  5JKL G;  4TO9 A;  1S3Q A;  3EGM A;  4R42 A;  4M34 A;  5JKL A;  2WLU A;  4XKU A;  5D8Y A;  3GE4 A;  4AM2 A;  1JIG A;  3R2H A;  1F30 A;  3PW1 B;  2V15 A;  3WVW A;  4PG0 A;  3M6J A;  3FVB A;  4DYU A;  5JKM A;  2Z5Q A;  2OC5 A;  2W0O A;  4ISP A;  4II4 B;  2JD7 0;  4RC8 A;  3E1O A;  1DVB A;  5ERK A;  4U3G A;  1TKO A;  4Y08 A;  2FHA A;  4ML5 A;  4DYZ A;  4TOD A;  2Z90 A;  3SID A;  4PGI A;  3PW8 C;  5ERJ A;  1LB3 A;  4MXP A;  3E1M A;  5LG8 A;  4TOC A;  3RAV A;  4AM5 A;  3QVD A;  4RC7 B;  5K52 A;  1UVH A;  4ZKW A;  2G38 B;  3E1P A;  3AF9 X;  5GOU A;  5J8S A;  2ZG7 X;  1LKM A;  1IES A;  3KHK A;  2V8U A;  4KXR B;  4TOE A;  3E2C A;  3KDQ A;  4ZJK A;  2HR5 A;  1JI5 A;  4CYA A;  4MJY A;  2YW7 A;  5CMQ A;  5D8R A;  4ZTT A;  3E1L A;  2IY4 A;  3VNX A;  3OJ5 A;  3F36 A;  4RC6 A;  4Z3B A;  3D19 A;  3RGD A;  3A68 A;  3VV9 A;  1QYB A;  1ZS3 A;  3PWQ C;  3Q4Q A;  3Q4R A;  3FI6 A;  4AM4 A;  1F33 A;  3PVY A;  5K53 A;  2JD8 0;  3RE7 A;  1YUZ A;  2PYB A;  3BT5 A;  4EVE A;  3JZ9 A;  2CN6 A;  4TOH A;  5D8Q A;  3AJO A;  2GYQ A;  5FFA A;  2V2J A;  3PW1 A;  1O9R A;  3UNO A;  3V3K B;  2FZF A;  3FSE A;  2FL0 A;  4TOG A;  1NNQ A;  2F7N A;  2C2J A;  2XGW A;  2N02 A;  3WVU A;  5CZU A;  1XZ1 A;  3SE1 A;  1RCC A;  4II4 A;  2VZB A;  3R2R A;  3C1Z A;  3DBY A;  3QD8 A;  2MGY A;  3AJP A;  3PVR A;  4LQV A;  2WTL A;  3GGZ A;  1R03 A;  4YVZ A;  4ZL5 A;  1VJX A;  3QB9 A;  3UFB A;  2FJC A;  2VXX A;  4M35 A;  4RC6 B;  1AEW A;  5GU0 X;  3PZA A;  2YW6 A;  4WJG 4;  3Q4N A;  3E1J A;  1HRS A;  2ZA7 A;  4DE6 A;  2V2L A;  4ZL6 A;  3SHX A;  2ZA6 A;  4W4K B;  3PVY B;  4CYB A;  2OKC A;  4RC7 A;  4IXK A;  4TOF A;  3NOZ X;  4ZKH A;  5AXS A;  2CN7 A;  1H96 A;  3PVT A;  3BVK A;  4OYN A;  4TOA A;  4CVR A;  2Z5P A;  3E1Q A;  1TJO A;  3UOF A;  2G4H A;  4RC5 B;  3IS8 A;  4XKS A;  4LQJ A;  1JTS A;  3NP0 X;  4E6K A;  2Y3Q A;  2BW1 A;  3KA9 A;  5D8P A;  2ZG8 X;  1JYB A;  3N6O A;  1JGC A;  5JAC A;  3WVV A;  4EVC A;  5LBH A;  1RCI A;  2XJO A;  3ISF A;  3PVR B;  1BCF A;  1OTK A;  5D8S A;  2BK6 A;  5LG2 A;  1SQ3 A;  3WNW A;  1Z4A A;  2C41 A;  2Y44 A;  5GN8 B;  1JI4 A;  3R2K A;  4PGK A;  4E40 A;  3L0M A;  5E1U A;  2QQY A;  4YXM A;  3UOI A;  2XKQ A;  2ZG9 X;  1LKO A;  3R2O A;  3RD0 A;  4ITT A;  2Z6M A;  3H7G A;  2WWX B;  2ITB A;  2CLU A;  3PVT B;  4LQH A;  2C2U A;  4LPJ A;  1YV1 A;  3QHB A;  4LPM A;  5J9V A;  3FRS A;  4M33 A;  3GVY A;  2BJY A;  5HU6 D;  2V2P A;  3IS7 A;  1NFV A;  4DI0 A;  1L8I A;  5FFB A;  2C6R A;  2D5K A;  1DAT A;  1KRQ A;  4EVB A;  3AF8 X;  2XJN A;  2ZUR X;  3Q4O A;  2HTN A;  3ERZ A;  2C2F A;  3C21 A;  3EZU A;  3KA3 A;  2CLB A;  3F33 A;  4MUD A;  5I4J A;  4RC5 A;  4CVP A;  3EZ0 A;  3OGH A;  2FFX J;  1MOJ A;  3VVA A;  5HQO A;  2V2R A;  4CMY A;  3A9Q A;  1DPS A;  2YJK A;  2V2I A;  3F37 A;  4CVT A;  2FKZ A;  1TKP A;  2Z5R A;  3R2S A;  4ISM A;  5FFD A;  1B71 A;  1J30 A;  4IWK A;  4ERU A;  4KVR A;  3U90 A;  2V2S A;  3ES3 A;  5GN8 A;  4CY9 A;  3R2M A;  3T9J A;  4LQN A;  4EVD A;  2CHI A;  1XZ3 A;  1VLG A;  1LKP A;  5HJH A;  3GHQ A;  5FFC A;  3KA8 A;  3QZ3 A;  3HIU A;  4ZLW A;  4MN9 A;  3BVL A;  3NP2 X;  1N1Q A;  3TA8 A;  3LKD A;  5CMR A;  4ZKX A;  2OH3 A;  4ETR A;  4TW3 A;  5HJF A;  1NF6 A;  2VXI A;  3KX9 A;  3QHC A;  1EUM A;  2JD6 0;  1UMN A;  4KVQ A;  4W4L B;  1L8H A;  4ITW A;  5FEJ A;  2UX1 A;  5JKM G;  1O9I A;  2BKC A;  3AK8 A;  4X0J A;  3E1N A;  1VEI A;  1TK6 A;  3PW8 A;  5IX6 A;  4Z5S A;  3F38 A;  3PWF A;  2V8T A;  4DYX A;  1S2Z A;  3R2L A;  4REU A;  1RCD A;  4KVS A;  1SOF A;  2GS4 A;  3KA6 A;  4LYX A;  1YUX A;  3AK9 A;  2RBD A;  2AR0 A;  2CWL A;  3C23 A;  4QUW A;  5GU2 X;  4CMY V;  1ZUJ A;  2CHP A;  1NF4 A;  4A25 A;  4PG1 A;  2FG8 A;  3C1Y A;  2QF9 A;  2FG4 A;  4XGS A;  1FHA A;  4XKT A;  5LS9 A;  1VEQ A;  3RBC A;  1Z6O A;  3W54 A;  4DZ0 A;  3IQ1 A;  4P18 A;  3AF7 X;  1IER A;  5J93 A;  3PWQ A;  3KWO A;  1BFR A;  5J8W A;  4MKU A;  5GU1 X;  4LYU A;  4LPN A;  1JKU A;  1GWG A;  4IWJ A;  4YKH A;  1RYT A; 
#chains in the Genus database with same CATH homology
 3KA4 A;  2X17 0;  3F35 A;  4MY7 A;  5E2D A;  5JDO A;  1Z6O M;  5D8X A;  4CVS A;  3BKN A;  4ZMC A;  1RCE A;  1JRE A;  4TOB A;  2V2N A;  3E6S A;  4YXJ A;  3O7S A;  3ISE A;  3JZA B;  2YJJ A;  4M32 A;  4DYY A;  2V2O A;  2IB0 A;  1MFR A;  3KXU A;  2GYD A;  2CF7 A;  3SH6 A;  2WLA A;  3AJQ A;  3BVF A;  1VEL A;  5GU3 X;  3E6R A;  3MPS A;  1BG7 A;  3F32 A;  3O7R A;  5D8O A;  4DAS A;  2ZA8 A;  2V2M A;  2XJM A;  2CIH A;  3GGY A;  5FFE A;  1RCG A;  2CEI A;  1QGH A;  3FRR A;  5JDO B;  3BVE A;  3F39 A;  3F34 A;  1JKV A;  1S30 A;  2IU2 A;  3BVI A;  3HL1 A;  5C6F A;  5JKL G;  4TO9 A;  1S3Q A;  3EGM A;  4R42 A;  4M34 A;  5JKL A;  2WLU A;  4XKU A;  5D8Y A;  3GE4 A;  4AM2 A;  1JIG A;  3R2H A;  1F30 A;  3PW1 B;  2V15 A;  3WVW A;  4PG0 A;  3M6J A;  3FVB A;  4DYU A;  5JKM A;  2Z5Q A;  2OC5 A;  2W0O A;  4ISP A;  4II4 B;  2JD7 0;  4RC8 A;  3E1O A;  1DVB A;  5ERK A;  4U3G A;  1TKO A;  4Y08 A;  2FHA A;  4ML5 A;  4DYZ A;  4TOD A;  2Z90 A;  3SID A;  4PGI A;  3PW8 C;  5ERJ A;  1LB3 A;  4MXP A;  3E1M A;  5LG8 A;  4TOC A;  3RAV A;  4AM5 A;  3QVD A;  4RC7 B;  5K52 A;  1UVH A;  4ZKW A;  2G38 B;  3E1P A;  3AF9 X;  5GOU A;  5J8S A;  2ZG7 X;  1LKM A;  1IES A;  3KHK A;  2V8U A;  4KXR B;  4TOE A;  3E2C A;  3KDQ A;  4ZJK A;  2HR5 A;  1JI5 A;  4CYA A;  4MJY A;  2YW7 A;  5CMQ A;  5D8R A;  4ZTT A;  3E1L A;  2IY4 A;  3VNX A;  3OJ5 A;  3F36 A;  4RC6 A;  4Z3B A;  3D19 A;  3RGD A;  3A68 A;  3VV9 A;  1QYB A;  1ZS3 A;  3PWQ C;  3Q4Q A;  3Q4R A;  3FI6 A;  4AM4 A;  1F33 A;  3PVY A;  5K53 A;  2JD8 0;  3RE7 A;  1YUZ A;  2PYB A;  3BT5 A;  4EVE A;  3JZ9 A;  2CN6 A;  4TOH A;  5D8Q A;  3AJO A;  2GYQ A;  5FFA A;  2V2J A;  3PW1 A;  1O9R A;  3UNO A;  3V3K B;  2FZF A;  3FSE A;  2FL0 A;  4TOG A;  1NNQ A;  2F7N A;  2C2J A;  2XGW A;  2N02 A;  3WVU A;  5CZU A;  1XZ1 A;  3SE1 A;  1RCC A;  4II4 A;  2VZB A;  3R2R A;  3C1Z A;  3DBY A;  3QD8 A;  2MGY A;  3AJP A;  3PVR A;  4LQV A;  2WTL A;  3GGZ A;  1R03 A;  4YVZ A;  4ZL5 A;  1VJX A;  3QB9 A;  3UFB A;  2FJC A;  2VXX A;  4M35 A;  4RC6 B;  1AEW A;  5GU0 X;  3PZA A;  2YW6 A;  4WJG 4;  3Q4N A;  3E1J A;  1HRS A;  2ZA7 A;  4DE6 A;  2V2L A;  4ZL6 A;  3SHX A;  2ZA6 A;  4W4K B;  3PVY B;  4CYB A;  2OKC A;  4RC7 A;  4IXK A;  4TOF A;  3NOZ X;  4ZKH A;  5AXS A;  2CN7 A;  1H96 A;  3PVT A;  3BVK A;  4OYN A;  4TOA A;  4CVR A;  2Z5P A;  3E1Q A;  1TJO A;  3UOF A;  2G4H A;  4RC5 B;  3IS8 A;  4XKS A;  4LQJ A;  1JTS A;  3NP0 X;  4E6K A;  2Y3Q A;  2BW1 A;  3KA9 A;  5D8P A;  2ZG8 X;  1JYB A;  3N6O A;  1JGC A;  5JAC A;  3WVV A;  4EVC A;  5LBH A;  1RCI A;  2XJO A;  3ISF A;  3PVR B;  1BCF A;  1OTK A;  5D8S A;  2BK6 A;  5LG2 A;  1SQ3 A;  3WNW A;  1Z4A A;  2C41 A;  2Y44 A;  5GN8 B;  1JI4 A;  3R2K A;  4PGK A;  4E40 A;  3L0M A;  5E1U A;  2QQY A;  4YXM A;  3UOI A;  2XKQ A;  2ZG9 X;  1LKO A;  3R2O A;  3RD0 A;  4ITT A;  2Z6M A;  3H7G A;  2WWX B;  2ITB A;  2CLU A;  3PVT B;  4LQH A;  2C2U A;  4LPJ A;  1YV1 A;  3QHB A;  4LPM A;  5J9V A;  3FRS A;  4M33 A;  3GVY A;  2BJY A;  5HU6 D;  2V2P A;  3IS7 A;  1NFV A;  4DI0 A;  1L8I A;  5FFB A;  2C6R A;  2D5K A;  1DAT A;  1KRQ A;  4EVB A;  3AF8 X;  2XJN A;  2ZUR X;  3Q4O A;  2HTN A;  3ERZ A;  2C2F A;  3C21 A;  3EZU A;  3KA3 A;  2CLB A;  3F33 A;  4MUD A;  5I4J A;  4RC5 A;  4CVP A;  3EZ0 A;  3OGH A;  2FFX J;  1MOJ A;  3VVA A;  5HQO A;  2V2R A;  4CMY A;  3A9Q A;  1DPS A;  2YJK A;  2V2I A;  3F37 A;  4CVT A;  2FKZ A;  1TKP A;  2Z5R A;  3R2S A;  4ISM A;  5FFD A;  1B71 A;  1J30 A;  4IWK A;  4ERU A;  4KVR A;  3U90 A;  2V2S A;  3ES3 A;  5GN8 A;  4CY9 A;  3R2M A;  3T9J A;  4LQN A;  4EVD A;  2CHI A;  1XZ3 A;  1VLG A;  1LKP A;  5HJH A;  3GHQ A;  5FFC A;  3KA8 A;  3QZ3 A;  3HIU A;  4ZLW A;  4MN9 A;  3BVL A;  3NP2 X;  1N1Q A;  3TA8 A;  3LKD A;  5CMR A;  4ZKX A;  2OH3 A;  4ETR A;  4TW3 A;  5HJF A;  1NF6 A;  2VXI A;  3KX9 A;  3QHC A;  1EUM A;  2JD6 0;  1UMN A;  4KVQ A;  4W4L B;  1L8H A;  4ITW A;  5FEJ A;  2UX1 A;  5JKM G;  1O9I A;  2BKC A;  3AK8 A;  4X0J A;  3E1N A;  1VEI A;  1TK6 A;  3PW8 A;  5IX6 A;  4Z5S A;  3F38 A;  3PWF A;  2V8T A;  4DYX A;  1S2Z A;  3R2L A;  4REU A;  1RCD A;  4KVS A;  1SOF A;  2GS4 A;  3KA6 A;  4LYX A;  1YUX A;  3AK9 A;  2RBD A;  2AR0 A;  2CWL A;  3C23 A;  4QUW A;  5GU2 X;  4CMY V;  1ZUJ A;  2CHP A;  1NF4 A;  4A25 A;  4PG1 A;  2FG8 A;  3C1Y A;  2QF9 A;  2FG4 A;  4XGS A;  1FHA A;  4XKT A;  5LS9 A;  1VEQ A;  3RBC A;  1Z6O A;  3W54 A;  4DZ0 A;  3IQ1 A;  4P18 A;  3AF7 X;  1IER A;  5J93 A;  3PWQ A;  3KWO A;  1BFR A;  5J8W A;  4MKU A;  5GU1 X;  4LYU A;  4LPN A;  1JKU A;  1GWG A;  4IWJ A;  4YKH A;  1RYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...