2OHVA

Structural basis for glutamate racemase inhibition
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
264
structure length
258
Chain Sequence
b'MDTRPIGFLDSGVGGLTVVCELIRQLPHEKIVYIGDSARAPKKQIKEYTWELVNFLLTQNVKMIVFACNTATAVAWEEVKAALDIPVLGVVLPGASAAIKSTTKGQVGVIGTPMTVASDIYRKKIQLLAPSIQVRSLACPKFVPIVESNEMCSSIAKKIVYDSLAPLVGKIDTLVLGCTHYPLLRPIIQNVMGPSVKLIDSGAECVRDISVLLNYFDINGNYHQAVEHRFFTTANPEIFQEIASIWLKQKINVEHVTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate Racemase
publication title Structural basis for glutamate racemase inhibition
pubmed doi rcsb
source organism Streptococcus pyogenes m1 gas
molecule tags Isomerase
total genus 92
structure length 258
sequence length 264
ec nomenclature ec 5.1.1.3: Glutamate racemase.
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ohvA02
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ohvA01
2JFWA 2DX7A 2DWUA 3ISTA 4B1FA 3OJCA 2OHVA 1B74A 1JFLA 5EVCA 2VVTA 5ELLA 3S81A 2JFPA 5HRCA 5ELMA 2OHGA 2DGDA 2EQ5A 2JFNA 1ZUWA 2JFUA 2ZSKA 3OUTA 5HQTA 2JFQA 1IU9A 5HRAA 2JFVA 3UHOA 1B73A 3UHFA 2GZMA 2JFZA 2OHOA 2JFYA 2W4IA 5IJWA 5HJ7A 2JFOA 2JFXA 3HFRA 3ISVA 3UHPA 3S7ZA
chains in the Genus database with same CATH superfamily
1P0IA 3OCYA 3PFHA 1KI1A 2AE1A 2XNKA 5JVDB 5KSPA 3TXXA 4G1EB 1PQWA 4GMXA 4WHMA 4QOSA 5AVRA 5A0FA 3DBHB 2CXHA 3SDSA 3GELA 9ABPA 4QNMA 4RM2A 4F86A 1L5VA 3UQZA 3QU7A 2X0IA 1NFQA 3IUMA 1BD3A 2Z8YM 5JAHA 3IXLA 5TR9A 3FCEA 1QYVA 2RIPA 3LRTA 3OZWA 4MUIA 4H7KA 2D74A 2H8KA 2XRFA 2E37A 5KU1A 1ZVKA 4G0WA 2JANA 1JAHA 1W47A 2RGNC 2WWHA 4YC7A 1SXHA 4IO1A 4KN5A 3PI7A 4L5JA 4CM6A 4DCNA 1BS1A 2DXIA 2A3NA 3SOPA 3BG5A 5HHTA 4DIUA 4HXGA 1OB2A 4KI0A 2L0XA 3OG9A 1TTHA 1RHUA 2QRVB 3GARA 2HA0A 1II8B 3QKRB 4LCEA 3UW1A 5ER6A 4BLTA 4DANA 1JEDA 1HL7A 2PPLA 3DHVA 2HCJB 3FUVA 4GVXA 1ZRHA 3RF6A 1JH9A 2C1ZA 1K98A 1JTFA 1NV9A 1PQUA 1Z3CA 3N6XA 3AEXA 3BFPA 1KZ6A 2EQAA 3HP4A 4MW0A 4WFQA 3N05A 4AIRA 1ICIA 5BOSA 4XZ3A 1JR4A 1VHQA 1IM5A 1J24A 3ME5A 4U39A 1QPGA 2HTEA 2ID7A 2WSBA 1D2AA 1AS3A 1K6XA 4DDTA 3A0RB 3IPLA 3OZAA 1E94E 4PNHA 4CFZA 5BRAA 1TA9A 1QR6A 5F2NA 3V32A 3ZIAA 5JAPA 2BKVA 1T5HX 3FE2A 4B87A 4BOYA 4Y1RA 1QCDA 4A8PA 3E23A 3O4JA 3RNOA 3O93A 1UBFA 1CUHA 3TTUA 1EA5A 1LBIA 5JD4A 1JHUA 5AHKA 4YT5A 4M1EA 3O9MA 3TNDA 4JZYA 2G9UA 2QAIA 1LI5A 3F4KA 1T13A 2VT2A 3NTRA 1TGVA 1HSZA 2PY6A 2YZKA 4LQLA 3WK6A 2XOXA 1Q1ZA 4FYPA 4PZDA 4QGBA 2FMUA 4Q3EA 4OMDA 4U00A 4I3GA 5AVTA 1LPPA 1P39A 2R65A 4NU5A 4TYNA 1SBQA 2W6QA 1CE8A 2CXQA 5KNDA 4PZ0A 2G67A 4EMTA 3G0GA 1N6LA 2Q1XA 4HGRA 1G8SA 3LK6A 2G06A 2I33A 2ATVA 2Q2QA 2GZRA 2AHOA 2AI1A 3G6KA 1NAIA 1Z7EA 4GI1A 4JNCA 4DW8A 3HCNA 2GXQA 2TMDA 4HRXA 4QU5A 3FGOA 3P71T 2XKJE 2Z83A 4M0DA 3OT4A 3DJYA 4R8SA 3BWYA 3ZWCA 3ZCSA 3S55A 2WJHA 4EPYA 3OIYA 4QRIA 3UICA 2GETA 4CKEA 2HEIA 3TG8A 4LV6A 4O6VA 1BW9A 1HYGA 2IF0A 2OCIA 4NBTA 3BFJA 5IZ4A 4MQEB 1KE2A 1SAYA 2OY0A 2M6KA 1V6CA 3B8EA 3NT2A 4LISA 3IVXA 2J4CA 4W5JA 5JFOA 2VP4A 3QU9A 4DM3A 2PSDA 4DREA 4E4RA 4KFRA 5LA6F 3E5MA 3LQRA 4D4HA 2AN3A 3HSYA 1D8AA 1YCFA 2JJ1D 1P75A 3Q0EA 2DLNA 3NHKA 1XYVA 2WF7A 2P9ZA 4JCOA 5BSWA 4C5AA 4AYWA 1RNLA 2AT1A 4D8WA 5DNUA 4WUVA 2ONJA 4JI5B 2OHXA 3GLGA 4X97A 1K3FA 3RO7A 3B1XA 3TZBA 1Q0ZA 4JB3A 4LX8A 3ECSA 4RIEA 1ONSA 3U0BA 5C32A 2HWUA 3DAPA 1M6WA 1YS9A 5E6RB 1D2RA 1EINA 3AJAA 1OA1A 2ZBEA 1ETHA 4LBYA 4H77A 3T5AA 1CW2B 4ZICA 1I10A 3KYCB 4MX8A 2VJPA 3Q88A 4G2TA 1NXWA 4W82A 1OH8A 3W5AA 2NUBA 2GZMA 3W78A 2V98A 3KQVA 5B3KA 5AW1A 3C0KA 1WZUA 3SEFA 5C1PA 3D02A 4BZWA 1QYRA 3EVTA 3EXHA 4XM2A 1KAHA 3TMKA 3VTFA 3TTWA 2FPKA 4LXIA 3AFNA 5LUBA 3UFBA 3HQ4O 5LZ2A 2HPVA 1I2AA 2E89A 2PKXA 4OHZA 5CDSA 4Y30A 4G67A 3ROXA 1RTTA 4P7GA 5AM0A 5K3BA 2GNOA 3L92A 9GPBA 4JLPA 1Y6ZA 5E6UB 3J80A 3F5FA 3RVRA 4QAQA 2CJWA 2V7XA 2WJJA 1NPTO 3OT1B 4PYNA 2C9CA 1LVGA 1Z4OA 1UBUS 1W85A 2ZWIA 4O5AA 1FDOA 3BCUA 2HXYA 3CR8A 2FE1A 1F5SA 5F5LA 4ANFA 2RCNA 1G17A 3NV7A 4FOLA 1LZKA 1U2RA 3G23A 4PW0A 1E0JA 1VRVA 3I04M 4OI1A 3WIOA 1MX1A 3P4XA 4X7PA 5HJ5A 1T8RA 4LY6A 3OIWA 1WZ2A 1H2XA 2QKYA 3R44A 4M8NE 2O8DB 4NHOA 1NZDA 3I28A 2B36A 2XE8A 1UXJA 4WJKB 2VK1A 3GVCA 3OVMA 4MR8A 2FW7A 2XEXA 4RKEA 1FMFA 1V9LA 3PQ8A 2FN8A 5HA5A 5ENVA 2FGKA 3V33A 1Y8CA 3QH4A 1T9AA 3NX4A 4HX5A 4RTKA 3O75A 2DLCX 1ORWA 4XRRA 2HRRA 2VC2B 2QTHA 4Q47A 3RSFA 3WFIA 2WBLC 1XKTA 2VP2A 3M70A 4GO1A 4NJMA 4ERXA 1H9BA 2FAXA 3TM5A 1E89A 4CL3A 4D3XA 1GHTA 2J9GA 2QHXA 1SVNA 3OEWA 2DFKB 3R41A 3GLVA 1ILWA 1VPDA 2JIQA 1AD2A 2RAVA 5AJXA 4AJOA 1E8NA 3CEAA 3F46A 2HFJA 2GM5A 4BX2A 1XNQB 1YUMA 1D6JA 4RCYA 3CF4G 3QNWA 2ZJ7A 5EE1A 4L4XA 4NNJA 2E7ZA 2Z30A 4FXPA 4GNRA 4P4NA 1GYPA 4A15A 2PR7A 1TDJA 3AFOA 4Z0TA 9LDBA 3ETJA 1GIAA 4REMA 3F74A 1VG0B 3V4LA 1Y3AA 2E21A 3K5IA 2VQFB 4L5YA 2IUSA 2QSJA 2ZJOA 5LB4A 2XCSB 3PGKA 4IIVA 4CLOA 1HE4A 4N7RA 2HDOA 1KKMA 1GPDG 1YK1A 5DB4A 3K4PA 4TXNA 1T1IA 3RVNA 2ZYVX 2FFRA 3TBHA 2I78A 2Q5LA 1D2NA 1ZINA 3C8MA 3E5HA 4JL5A 3VVCA 1E6LA 2FXIA 4IJQA 4C2TA 1I80A 4FGKA 3GDFA 1MRZA 2EZUA 3JQFA 2O1SA 5GP1A 1LBTA 2ID4A 4J6FA 2IYLD 2IPOA 3I6BA 2K2QB 5SY9A 2EJTA 4BLPA 3C3CA 4YP9A 1QFMA 1VC2A 3DFMA 3VHXB 3W8FA 3W9YA 2CLFB 1BXZA 4HUQB 3QKIA 1SBIA 2YIMA 2Q4RA 3WK7A 3ZDYB 4H1UA 3TJZA 1A27A 3JR7A 4RQAA 1SBZA 3DVLA 4HAXA 5GQSA 1GSHA 4O2AB 1M34E 3TO5A 4HVCA 2ECQA 4JK3A 2FZCA 5DXFA 3O2QB 1J20A 4YMWA 5AJZA 1IK6A 2V7TA 3S2FA 1YFJA 4Q1VA 2UXBB 1YI0A 3H5IA 1YZUA 3VU1A 4CCWA 5IG2A 2FZWA 5H1YA 4CHGA 4G1VA 2IODA 3FYTA 3L3BA 4KQEA 3TRJA 2UUCB 1V37A 1V47A 1CP3A 1WE2A 3L49A 5CXXA 2OVBA 4KDRA 3UC5A 4H7DA 2D3WA 3TE6A 4ZOQI 5A4KA 5DX1A 2I99A 3WOVA 4OQLA 2VH5R 3Q7RA 1L4MA 3PUJA 4I1RA 4U9UA 3DA8A 4XOUA 2VZLA 1LJLA 1G6OA 4DG8A 1YR9A 3ESRA 1KMCA 4RTNA 2CZGA 4IMJB 5A5EA 5I7WA 4XYMA 5JZOA 4NSNA 1P6XA 1EJBA 4OBBA 5EERA 4JP3A 3MCWA 5JBIA 2QYHA 1JJ7A 2C92A 5LJIA 3THYB 4WOKA 4A82A 2WJGA 5KNDH 3FBGA 1W35A 1MT3A 1QS0A 4FLFA 4WLUA 3VI4B 2QMQA 3A37A 4D5EA 1A3CA 4CI0B 1PYGA 3M49A 4KHZA 1WCWA 3NP9A 1YIOA 3OZIA 4U4AA 2NZWA 4DV1B 4P08A 1GTSA 5F3WB 1D2CA 2E18A 1FVOA 1SHLA 4INPA 1VL5A 3MWEB 5EQDA 3QW4B 2ZULA 1KYXA 3LF1A 4X1KB 4O4JB 3PC3A 3R09A 1YZVA 5A9SA 3OLZA 4W5WA 3WJAA 2HH9A 2IJGX 4FZRA 3HY3A 3V2HA 3OLYA 5J58A 3KPJA 4PLGA 1XVLA 2WPNA 4BX8A 5JFTA 3DBRB 1LTQA 2BLNA 5DM0A 1YCGA 4EFMA 4M7WA 2WW8A 4LPKA 1U0GA 3S8YA 4HLUC 1MJFA 5GV8A 2IKSA 4C0JA 1ADBA 1U0TA 1F0PA 3BORA 1N8SA 4XDYA 1YQUA 1TE2A 1H85A 1M1NB 3PDJA 2LVBA 2GEJA 1I2CA 3BCRA 3E7WA 3GNQA 4O4IB 3AU9A 2W5UA 4X6XA 4Z0NA 1FFDA 1SK9A 2H4WA 2D54A 2R00A 3W7VA 4KFSA 3EWNA 4ZAFA 5JISA 3CO0S 4F5WA 1R9MA 4OI4A 4EJSA 4JP8A 4CM3A 1SOVA 1XKXA 4FINA 1KR5A 4BWYA 2JC3A 4JX9A 4DNXA 5JO0A 1JTEA 2CF5A 2AJLI 3CZ5A 3PFGA 1O6BA 4FDVA 4RLHA 3VPHA 2H1HA 4O59O 4PO8A 4WXRA 2BHSA 2ZLBA 3AUJB 4FWIB 4EKNB 3CW8X 4U3JA 4PQEA 3A58B 1RWXA 1NGSA 1SCUB 3T3NA 1SM4A 1OBFO 1XKQA 3MTDA 4OH7A 1XYYA 1QBGA 2BBSA 1RCUA 2DHCA 3T8YA 3MJFA 1T25A 3CB4A 2V7WA 3FVTA 3QQPA 4B2YA 3PVZA 2B1IA 2LDBA 3D0QA 1P9RA 1IAQA 1WMFA 2IOFA 4G89A 4OX9Y 2VF8A 4XVHA 1ZM4A 4MVWA 1XQYA 5BMVB 2JGNA 2B1JA 1TRKA 4MRMB 3FFBA 4YALA 4HB3A 3S2EA 1CS0B 5JD6A 5BR8B 3MB8A 5DM60 1U2DC 4AKIA 1QMGA 3W2FA 1YR3A 1JG6A 1HYQA 1BHO1 4HDMA 3A4YA 1JU4A 2PV7A 1YZQA 3CX3A 3EISA 4JL6A 16PKA 1XI2A 1SVOA 4NYMR 1U8TA 1VTKA 2AC4A 3U2QA 3C7CB 3NHYA 3OFSA 2H54A 3UUEA 2OBXA 4U7TB 3T5TA 2R8OA 4DC0A 4X94A 2NU7A 1SUCA 3F7NA 2UZAA 3ZQ6A 1RC0A 1B43A 3SEAA 4YRBA 2BIFA 1XD2B 1Z07A 4MW2A 4PU0A 2P3SA 2OFPA 2Z2YA 4KQJA 1WG8A 5ALSA 4DYVA 2FDXA 3HXMA 1JDJA 4JITA 3EQ7A 3DONA 2B5OA 4QHYA 1FFCA 1QSGA 5F9HA 4EZIA 2R84A 2J3DA 2JIZD 4YVFA 1Q1BA 3I23A 3D5TA 2EEPA 1J23A 1J0EA 4D0RA 1JFVA 3VHRA 1U9IC 4A8JB 3PR1A 3K8OE 4QVIA 3LWBA 1E1CB 1FOEB 1ODKA 2I1VB 5K0GA 2JI9A 2LKCA 2OPHA 2FFQA 4A7PA 3QYFA 3ZV4A 1F2UB 1XMXA 2D8AA 3FCYA 4ZO9A 3GHYA 5FBWB 1DQYA 1JN0A 4X92A 2OHOA 1GQRA 1V7CA 3HCEA 1OXBB 1B3BA 1QE3A 3PNLA 1O0CA 1IOWA 2X8AA 2X6RA 1L7QA 3FWNA 4O1HA 1EHYA 4UVGA 4Y6RA 5KTPA 4ER3A 3QUQA 4TYPA 4RMNA 4TMZA 4ZU6X 4KR9A 2A94A 2BGGA 4PYIA 3HM9A 3K6JA 4TKVA 2IDMA 3DP7A 1ZJ5A 1SUFA 2NNLD 1M34B 4O4HF 4E30A 2C4VA 2WJ6A 5HKBA 4FQ7A 5ANRB 4J2OA 1DAKA 4FGJA 2EP8A 4TV8B 2XCOA 1E2FA 1TCCA 5BW6B 1M2JA 4MEBA 3B5IA 5KSYA 2DLDA 2PL3A 4U7GA 2FPIA 4H7PA 2PWYA 1A8PA 1GU7A 1MHPA 3ROFA 4E7OA 1F4VA 1HGXA 1VLMA 4OK3A 2QNBA 5ETJA 3N58A 5JXJA 4XGRA 3EA5A 4J1TC 1QGUB 1SIUA 3JQAA 4UCXA 3SBEA 4BMXA 1H1LA 3FWHA 3MTEA 3K32A 3EGXB 2VNHA 1UBTS 3F8SA 5LD2C 1EJ6A 3LS2A 3F5QA 5EJ8A 1I7QB 4MUKA 1SXJB 3LD9A 1ZESA 4TVKA 3PC8A 1A9SA 3L40A 1IONA 3DCYA 1L4EA 4BLQA 4GFDA 3L9WA 4GLLA 4C3UA 10MHA 1SCAA 1PFGA 2VVTA 4ALKA 1QLJA 2WUDA 1AQ6A 3QPVA 1M2NA 2V58A 5A4JA 1AK1A 2QTZA 1VKHA 4G24A 2GB4A 4ZEVA 1RVV1 1Z06A 1N2XA 3KYIB 2QTTA 1MN6A 2WR8A 4UU0A 1UJ5A 4PVDA 1E1YA 1W5FA 1XTKA 2IZ0A 2Z2JA 2E48A 2GLUA 1BG6A 3D4IA 2V55B 4QUKA 4UBMA 4C06A 1S2DA 4CM8A 3QZUA 3HN2A 1WO8A 4BPRA 3EGDB 5KNCA 4TSFD 5GPBA 1IIBA 1GPNA 2PJRA 1NVMB 4I5EA 3UK6A 1JHQA 1AA9A 1KKLA 1YQEA 1MO6A 2R5FA 2O19A 1QCCA 5I45A 1A71A 3WKAA 1Z15A 4CUKA 3S7ZA 1EE2A 2N9UA 3PU6A 1UM9A 2G1AA 3ZIUA 4K9DA 4N48A 1UZMA 1DTWA 3SJZA 2QENA 2QZJA 4YMUA 4UPDA 3NBXX 2IU0A 1U7TA 3VO1A 2C4UA 3EGIA 1YR6A 1GNLA 1J5PA 1ODLA 4NS4A 5FT9A 5GIPE 1UPCA 2C07A 1FDTA 2ZQZA 1VG1A 2OPBA 3D8SA 2UZ0A 3AVUA 2JCGA 5DISB 2FYTA 2ZRHA 3SU8A 1FVXA 2WEKA 1N2SA 4EX7A 3GFGA 2WICA 4AQ7A 2AOUA 3NWJA 4Z3KA 3OPYA 2ZJZA 3CJRA 5E8JA 1C3JA 2V6FA 3SHQA 1TT5B 3VZDA 4DLSA 4ZCTA 1F4LA 4FI3C 1AM4D 2B5VA 3DZ8A 1OR8A 3MCAA 4AF7A 5KYUB 2XCTB 1Y0BA 3FPFA 5EP1A 1XA3A 2IYYA 2ZE5A 2QNIA 2H7CA 1MGOA 1N0IA 2BHRA 4C3ZA 4BE7B 3P0HA 2IELA 4GD3Q 3CWQA 3P9QA 2ZYWX 5HIMA 1YDWA 1GT91 4JL8A 4N5NA 5IVPA 4XTRA 5JZ9A 4TVBA 4EHLA 5DSXA 1F4PA 4L4YA 4B9EA 4FGUA 4WN9B 1ZGHA 3AOEA 3PDIB 1DQSA 1NC3A 4BJ6A 1T0BA 1ZY2A 5INTA 4M7PA 1UMCA 5LOVB 1JRLA 1K88A 1P18A 1HDOA 3K9BA 4G4GA 4E5PA 2OHJA 2R6AA 3RYHA 3H1PA 2BV3A 2C4HA 1ZH0A 4W1PA 3RG8A 1A9ZA 1P6UA 2C2HA 2MINA 2A58A 2YJ4A 1Y6QA 3KJFA 1GXSB 1K89A 2P35A 2GCGA 2PSJA 1YBAA 3IDQA 4FLEA 4QNNA 2C03A 4F4UA 1TCVA 1QYXA 3LSTA 4M60A 4LF6B 4BLRA 2DP4E 1FDRA 2XTZA 3P9SA 1EXMA 2JCVA 3R20A 4I55F 5AVXA 3U19A 2VDWB 2ZTLA 4G4SO 4NCKA 2CHEA 3GFSA 3OZXA 1ISHA 1O96A 4HKTA 2Z4SA 3TW8B 3NHPA 3RR2A 3V1YA 4EHDA 2Y6VA 3O8OB 5FWYB 5KQLA 1GZ4A 1U2ZA 3ZWAA 4NAUA 5HOQA 5FV4A 3NVKI 1YCDA 3MJEA 1ZA2A 3L07A 1LJ8A 2VLBA 3VH1A 4KK4A 1MXFA 4HMQA 2R9VA 1WU7A 4KQ2A 3HCBA 4YLGA 3RSQA 1XMOB 3BQNB 1H6CA 4RULA 1SUPA 4RMHA 2QAJA 3MRSA 5CITA 1Q7GA 5A4DA 5EWJA 4D41A 5CM9C 3R0XA 1SQ5A 4DIOA 1XMJA 3F4LA 3IAM1 2F6RA 1TM2A 4QYTA 3F49S 1NFFA 3EAGA 3UOWA 3L5OA 1HOXA 2FQQA 3I8OA 1Y4SA 4EJMA 1SFRA 4GRDA 4P82A 4J0FA 4CLEA 2V3VA 4F3RA 1VMIA 4TN1A 4RDHA 2ZS9A 4BNGA 2YV2A 3R9WA 1HM5A 1LLQA 1Y3BE 7MDHA 4JI0B 4Z6KA 4P7JA 1PIWA 2VQ6A 1L7VC 2JZOA 3AF2A 2OG1A 4JMPA 1ENYA 4J03A 4RQUA 4UHEA 4F3NA 3GLIA 3LSYA 1K75A 4DT1B 1VHTA 4CVNA 4DEXA 2EF0A 4PZUA 1L8AA 2D4AA 1PEYA 5C8YA 4QSHA 4GZMA 4Y1EA 2X0EA 3BJMA 3PXBA 5B5SA 5AQ1A 1SU7A 4EY5A 1WCV1 4FFLA 2CUTA 3IHWA 2V6IA 3IAM6 3NC4A 3STYA 1GQYA 4Q1DA 4KPUA 1PGOA 4UBIA 4KXUA 3ZBTA 2ENWA 5G0TA 2OBYA 4MUYA 1OV4A 3M89A 5DMXA 1D7OA 2ZYHA 3R0JA 1PR1A 3Q6NA 1Q0HA 1QGDA 4KDCA 2D0DA 2HT6A 3DOCA 1B6TA 3FYSA 1T9KA 4FNGA 4IH4A 1DP4A 4ZDWA 1Y7LA 3OM9A 5UKDA 2CDCA 4Y2SA 2P4SA 4DWJA 2CVOA 2ZYIA 4PC7A 1OAKA 3UFXB 1YA8A 4IO0A 2F62A 1XZKA 3BMCA 2FPLA 2GJ9A 3DEIA 1P5JA 4FKBA 4I0WB 4Q9LA 2POQX 3CBQA 3V2GA 1PR3A 1F2TB 3E8MA 4GOOD 4ZRDA 1T36B 3ETCA 4YJFA 5C2JB 1DAPA 2PX2A 1OU0A 5JCJD 1ISIA 2DX7A 5HCNA 3SNHA 4G5XA 4TMWA 1RRFA 5AI4A 4AF8A 2VCHA 2P9CA 4PRLA 3SS7X 3JPYA 3R24A 1Z8DA 3ADKA 3IRUA 4GL2A 3ZE9A 4Q21A 5TGDA 3BBLA 1ZVMA 3G17A 1NF2A 2GPAA 4AZ3A 4FCTA 1S6YA 5EXPA 4Y9RA 4MCHA 1LSOA 1Y48E 4Z7JA 5H3HA 3LL7A 3IFSA 5D5QA 5DT2A 3ETHA 5KJ1A 2PS0A 2BKLA 3W9SA 3AJ9A 4N8SA 2G70A 4R8KA 4ND3A 4UQPA 3SZOA 4CT5A 5BWNA 3COYA 3ZTYA 3OEED 2W4QA 3QEOA 4ZI7F 2FN9A 4JYCA 4ZZ1A 1EGVB 4K9MA 5KWJA 5K03A 1FBNA 3S1AA 2HPHA 4W1QA 1WY5A 1NL3A 4JLDA 4JJ8A 1R5NA 4Q00A 4PZEA 4ZRNA 3SKVA 3V4FA 4MVJE 4NJEA 4ZKDA 4JLNA 2GARA 1WVMA 2CDRA 4LC1A 4CDGA 5GIOE 1Y1LA 4LF9B 5CLJA 1QIEA 2PKCA 3JALB 1MJNA 4KIWA 4IV0A 3TQOA 1XAHA 2X2FA 4Q4HB 5DI9A 4TROA 1E1QD 4X65B 3BQ9A 3IT0A 5AVOA 2I87A 3MQFA 3WYEA 5HVNA 2G25A 1WQ1R 2EW1A 2DBZA 4S12A 1XTSA 5HJ2A 3UBMA 4DNQA 3ESDA 4EB0A 2P9TA 2B7BA 4YGXB 2F3SA 2PDAA 4HWTA 1YSCA 1EFLA 4BMVA 1U04A 3COJA 1NR1A 1VL0A 3OECA 1K6JA 3PCTA 4IWYA 4MYUA 1FMJA 1WSDA 5DGCA 4DA6A 3A06A 3T61A 3NTXA 1SKAA 3GJSA 5DTIA 1JEJA 3ZV6A 5JQGA 2AEEA 2VKQA 5K3AA 4UDYX 4UDNA 4CEHB 2DQYA 1ZI8A 2TS1A 2BT4A 4D2IA 1PRYA 2ERYA 1Q15A 1MIOB 3KJXA 2GKSA 5D00A 3TEMA 3GFPA 1U3UA 4RD3A 4HNRA 3UANA 2WKSA 4J07A 4IFEA 4NZNA 1C3OA 5H4HA 2YINC 4KXYA 2A6PA 2C9YA 4FNOA 3A6FA 2W6ZA 4GYKA 1ZUIA 1OBHA 3GCZA 4MW7A 4J29A 3EVNA 2Y4NA 2FOIA 2YXLA 1GRVA 3JASB 5DULA 2R8YA 3F7MA 1FVHA 3SC2B 3FJ1A 4JT8A 4ZT5A 2HZBA 2BGJA 1KI9A 2ZS7A 4KFUA 3UMYA 2WAAA 1EUCB 8MHTA 1OFUX 4HWKA 1V2HE 3PR3A 4BNDB 4IIJA 4N3GA 4EIWA 4TWIA 4D82A 1G1AA 1VE9A 3NDJA 3ZE2B 5E7IA 1FRZA 4FFBA 3U7HB 5E1MA 1WB9A 3RU2A 1HG0A 2BBOA 3U48A 5B2EA 3QPBA 1P6QA 2WLSA 3JAKB 5E9WA 4DJAA 5BSEA 3LLCA 4V1CA 7REQB 1YO6A 1VA5A 2CUKA 3HCPA 4L8LA 3VH2A 3EOBI 5F5XA 4JI4B 4Z8YA 2MSCB 4O02B 1UCFA 1ZNYA 4XUGB 3I4CA 2AQ8A 2A88A 4G8CA 3M6LA 1NUPA 3FZEA 4CMBA 2EZ8A 3BE5A 4X1OA 1RKBA 3B20A 4UXIA 3S44A 2AHRA 3L43A 4YLEA 4UTPA 3TLXA 5K99A 5LFAA 1MW8X 1D09A 4YQYA 2FGJA 1FVFA 3ROPA 4AS2A 2P4QA 1H2YA 1Z62A 1VIMA 4FI3F 1PHRA 4BFCA 1OB5A 1ZZEA 2BR4A 3CIFA 3DMTC 5K2OA 4RTPA 3Q7SA 3ETLA 1KZGB 3MK31 5JRDS 1WMAA 3LH5A 2GTPA 2A0UA 2O05A 2BFBA 1P1KA 3MRVA 4LC0A 3F9RA 2GN0A 4JT9A 5IH7A 1C4OA 1FQKA 2FWPA 5HS6A 4A6DA 4LZLA 1L4LA 1W4ZA 4EG6A 1K86A 2QJRA 1Y9JA 2QL5A 2R11A 2X7JA 1CUIA 3HNPA 3BZUA 2NP6A 4EHJA 1VBMA 3DC7A 4RJJA 3KCNA 4PLCA 3WMRA 3GLQA 1YE8A 4RKWA 1G21B 2R44A 2FZGA 1IVNA 1YUBA 2M6SA 2PUVA 3EUEA 1E7QA 3QWIA 4FILA 2XQKA 4OYRA 1F9AA 2IXTA 1U0BB 3L0DA 1DAEA 2NU8B 4MQ4A 5HGXA 5AOBA 4FIDA 1EFHA 3HJTA 4BGVA 2P11A 3LT2A 4ZXFA 2ZYDA 1AJEA 1KYYA 2WHQA 3L1UA 4N8EA 2V7EA 2ZBGA 1E5QA 3G9TA 5KYTA 1IHPA 1RM5A 3T3MB 4LFCB 4RHFA 2WHRA 4D26A 3OLVA 5GY7A 3DDCA 3OPXA 2JLWA 3WFJA 1MV5A 1C30A 2NZUG 3H2JA 1QIFA 3I4FA 4TZKA 5E3JA 5ISMA 4BLSA 3O8RA 1Q5PA 3C3XA 4XUCA 1PD1A 1UOQA 2QVXX 1V26A 2QSYA 5REQA 2Q5FA 3GRKA 3ZDQA 4C9BA 4EVRA 2WV9A 4UCFA 1GV0A 3OEHA 1IRXA 2X3YA 3RVBA 1KI7A 3VJRA 1D8TA 4ILKA 4BZZA 1IN7A 2JD0A 1R0BA 2EHJA 3LO5A 3DBIA 3GG2A 4QGAA 4TOIA 2JS7A 2FQYA 3BSWA 3LRPA 1OFGA 4X62B 4UJ3A 3WKBA 5JWOA 1A2BA 3R7SA 4QQKA 3TUIC 2OLJA 1NI4A 4CODB 3WNBA 1G2IA 3G1UA 3ZW7A 3HDJA 4EFDA 2AA3A 4NYIQ 4WRRA 4BFLA 2NU9A 1V39A 2VRCD 4GE0A 4RCVA 5EIBD 4DMFA 1KMMA 1EKXA 4AJJA 1V2GA 1T3GA 3N8HA 4GC9A 4RXTA 5IEJA 2BR5A 2HF7A 2HCTA 3TFQA 5JADA 1NOIA 3H9JA 5FBHA 3SYTA 1TGYA 1ULAA 3SVTA 1WBDA 2BP7A 1XD9A 3VBEA 2W42A 1FUIA 2AVNA 3D6FA 2VJKA 3V8BA 4HDOB 3T7IA 2AYXA 3Q2IA 1YHYA 2M98A 1B3RA 3AETB 4P5DA 2YV1A 3RJ5A 2UUBB 5AJHA 2YY7A 1PFKA 2FW0A 4HGOA 3LY8A 3TAXA 2AN9A 1H8ED 4GUDA 1R6VA 1YKFA 4IG9A 1U65A 1G5IA 4C6TB 3CLSC 3MCTA 3MMXA 1TCBA 1TAGA 3IJRA 5HCUA 2VA9A 3CA8A 5KBYA 1ZMXA 3SCZA 4BJ1A 3KSDO 1N1EA 5J4VA 2G7ZA 3T7SA 3SZLA 2J85A 4Q3KA 3RCBA 2H2GA 4Q4CA 4JI2B 5B55A 3OZCA 2IXBA 4H4EA 5T67A 4HZUB 4DM4A 3GUZA 3MT7A 2K7ZA 1ULZA 1OGYA 1YQXA 1MPTA 2W2LD 3KPUA 3Q9NA 2Q9AA 4MVYA 4IV8A 2FMIA 4O4LB 4Q5IA 4UULA 5KMGB 3KNZA 3L7OA 2O1WA 4H27A 1GQSA 5E4YA 1GTMA 3LUDA 1CULC 5HE8A 4FOOA 1BEUB 1WMEA 4QUEA 3GGGA 4FYXA 2IUTA 5A0VA 3WKEA 2ZBVA 1LSJA 3PC7A 4MWOA 2WKQA 5CIYA 3HBFA 4CG2A 1EXDA 1KK2A 1NXXA 2YWCA 3DL0A 2DPGA 1W29A 3JR3A 3L1VA 5HIIA 2PK3A 3D3EA 2AC2A 1I0LA 1LWOA 5ESDA 4ZV4A 3S8MA 3ZVRA 2PZMA 1P72A 3LBNA 3DMGA 2ETVA 1EBUA 1E2MA 2ZBUA 2HF8A 5C3UA 3TZLA 4CKBA 2J3HA 4MR9A 2ZWPA 3UMVA 3HS3A 1Q2XA 5JS6A 3DWFA 3GLGE 3TL3A 4C7MA 1R6TA 2H1WA 2HMYB 3Q1LA 4HB2A 4MO9A 4E5MA 2ZRKA 4NY1A 4JCCA 5CA0A 1RRCA 4KOAA 3D31A 1MJGM 1PX2A 4ZVLA 3KETA 4MQMA 4JC4A 1Y5LA 2WJZB 3EWAA 4QOJA 1GFIA 2CFOA 1RD4A 1AQNA 4JBWA 1Y8RA 2IDJA 2XKBA 1LPNA 1UADA 3TOSA 5C5DA 2RH4A 3H3FA 5A02A 5HMLA 2JLVA 1T2EA 5DTMA 1GL9B 2JIZA 3O8NA 3EF0A 2PGXA 1IG3A 2R4UA 4WCFC 3IKTA 3J81k 3L6UA 1H4QA 2XWQA 2B30A 2WJYA 1NRXA 3AM3A 1A96A 3AESA 4DMLA 4L8FA 1SXPA 1ZZGA 2Z0MA 1OW3B 2FX5A 3I1FA 4L9SA 3VNBA 1YS1X 4FLMA 3PQEA 4CW7A 1T43A 5CG1A 1R16A 1W59A 3EFOB 2ZYAA 1M2OB 2YQ4A 4J8PA 5TQ0B 4URVR 3ZHRA 5BQXA 3TX2A 4R6WA 3OJOA 2YV3A 4RBNA 2Y92A 1V5IA 3O4FA 1UIMA 5A5DA 4LDZA 3Q7IA 5AKZA 1KZ1A 1PGPA 2MCFA 2D2FA 4DSZA 1A5TA 1JUDA 3HMQA 2BMDA 3OJ0A 1K7SN 3GLHA 1AT1A 4JUFA 4IRXA 2AC7A 4B47A 5IK2D 2QGFA 4EGCB 1TEHA 3WLSA 2F4VB 4KJZA 2Q7XA 1D0IA 1KVQA 1N5JA 2XQIA 2BFPA 2V0CA 5IAJA 3I83A 4O2RA 2VK4A 3A6HA 3P0IA 4JLJA 1T0HB 1KAQA 2XX3A 4W9RA 2I7TA 1RS0A 2VUTA 2NU6A 4GR9A 3TIVA 1KDRA 1U7UA 3MBIA 3I2YX 2NYRA 1T3ZA 2GCEA 5MFZA 1L6IA 2E5FA 4GX0A 5KJEA 3WISA 3VTZA 4CCSA 5BV2P 2X42A 5C7IO 1PZFA 3WGMA 1TJ5A 1M67A 2W2TA 1I1HA 3MG9A 4O2BA 5JMPA 4E5VA 2O1XA 1H4TA 1ZW1A 2XUAA 5D01A 3QOXA 4J1NA 5DX8A 4O63O 5L3ZA 5IKEA 4Y2TA 2X6TA 2FR0A 4YP7A 3H2YA 4FFMA 5ALGA 1N2GA 4FT4A 2YRFA 4Y7CA 4AUKA 4D0GA 1CY8A 3IE0A 1L2TA 4ZOBA 1P81A 1GA1A 2ONYA 3HVJA 1JJVA 1GITA 4IDQA 4IDOA 4BFZA 3FTNA 1H0HA 1XMVA 2V8BA 2VJCA 3H8VA 5IHPA 5JANA 2RGYA 2DERA 1NQWA 1ZCJA 5FXMA 3EIWA 1W36B 1OVGA 3OZGA 5ALVA 3QWAA 1OYWA 5A62A 5KVCA 4KUHA 5ICFA 4XRGA 1N0HA 3ZXXA 1SC9A 4I3FA 5E0KB 2OCLA 1K8RA 2R96A 2PX5A 4Z0HO 3ZKWA 1J2UA 1JAZA 3JS5A 4RVUA 1C8LA 1Y1PA 4LY3A 1XCJA 1EBBA 2H06A 4H60A 3OZRA 4TSFA 3RUIA 5BOSB 3AR4A 4KQHA 1KSGA 3M3HA 3UK1A 4ZYWA 1RQ7A 1B1CA 4IW3B 3LCUA 1QQAA 1U0FA 1IZ0A 1HQDA 2RHHA 3L8MA 3PC2A 3QEKA 5A5VA 2XBMA 2AOTA 1V95A 1TT7A 1CZUA 1I4WA 4QUJA 4C29A 1BMFA 2YZ2A 5C1BA 2JGMA 3RWMB 2AFHA 4IHJF 1GUFA 3AVTA 2CXOA 5JE8A 2HIGA 2APJA 3ZHTA 4Y1RB 2YW2A 3D4LA 2X22A 2QJOA 3FR7A 5DGDA 3WRXC 5IVHA 2B4KA 1PYOA 1ZH6A 3H2HA 1XO1A 3D4NA 1D1SA 1IEQA 1NW5A 2VBIA 3GI1A 2YNMC 5HDQA 4QPCA 3WWEA 3CUUA 1JSLA 4MOWA 1QX4A 2HAEA 3C4JA 3I53A 2FG7C 1J8DA 2C96A 4XR9A 1M1YE 2IOYA 2OO7A 5KTMA 4GPAA 4HEA1 2HHCA 4EI2A 2J6BA 3D6VA 1TMKA 3ILHA 5AH0A 3T5BA 1XTBA 1YZLA 4F12A 5IDXA 5KKAA 1ADFA 1CE8B 1D2EA 2H08A 3N7TA 4WECA 2WY2D 2QRKA 4EY8A 1A2OA 5T8KC 3PBKA 2PAAA 3MLAA 4TX1A 3OI7A 2OKGA 5YASA 4DWWA 3IP3A 1DXHA 1DQRA 3LKVA 3KFXA 1MAHA 5AM1A 5DIZA 3GLFA 1TAQA 2CV0A 3V2IA 1DAMA 2PMCA 4HMOA 4JLMA 1CJUC 4OAPA 4ZZIA 4C1BA 3TSCA 4KOEC 1X7XA 5KQMA 5CH5A 2ETXA 3DZFA 3H8WA 4LJSA 1BGVA 4J4HA 4CKEB 8GPBA 1BW9B 5K3EA 5KCMA 4ENPA 2N47A 2EBHX 4N47A 4CU2A 1ANKA 1NYRA 2P30A 1G2QA 5AW7A 4NZ9A 4RKYA 3UUFA 4ZP1A 1BD4A 4MHTA 5FL3A 2WMYA 1NU8A 2AEMA 2BMJA 3CH7A 1W4AA 4K28A 4M0UA 4KXQA 3DLPX 5M34A 2JJ8A 4AY3A 4F2HA 2EGHA 4MS3A 4MJLA 2ZS8A 3ZWDA 1SCDA 2C5HA 1PEKE 1NM5A 2REOA 3GAZA 2VHUA 4RF2A 4WY5A 5FTWA 1RAFA 2XBLA 5IJ0A 3UXYA 1CU1A 3R5HA 1DO0A 2B4AA 2J67A 2ET6A 3JWGA 4G8DA 4GF5A 4OJNA 3IBSA 2Z8ZA 1XJ5A 3KLOA 1AKTA 4KQ1A 4HS4A 4ZEOA 3GLGB 2XVMA 1W5AA 2BGWA 4PG7A 3P9PA 1FK8A 1NP6A 1TF2A 2Y99A 3IMCA 2FETA 4G8JA 4J4BA 3R0VA 4N49A 4OSEA 5KHAA 3O3OB 4KLNA 3UA3A 5C4MA 4L3OA 3CEPB 3LJKA 4IBOA 4XR4A 3R7WA 3PZRA 4E09A 3GBVA 1DHRA 4YAFA 4KXXA 1M5UA 2DY0A 5J2TF 4RH3A 4YXWA 1WNTA 2EYUA 3KUUA 3QUTA 3W4IA 2IYAA 2JFHA 3KUCA 1P5HA 1L3CA 1SWVA 1T0PA 2D1RA 3WOHA 4FYWA 1UJNA 2C7RA 1DADA 4Q9NA 1KOGA 2VEDA 3PKJA 1HL3A 2ZI6A 4FMCB 4MYSA 4KW7A 4EW3A 4Z51A 1J1UA 4HX9A 3B7GA 2EKDA 4N40A 1ZVJA 3EXHB 1P4GA 4NYMQ 5K4GA 1T2FA 2RKOA 4FN4A 4KACA 1I7DA 2PKQO 4GMKA 1EP1B 3VU8A 2DTDA 3UAXA 2P2YA 2NTEA 3DP9A 4PXYA 1HE1C 2ZSUA 3GEPA 3V3KA 5KTSA 1FXUA 4NMWA 3K5HA 2WTBA 4OSPA 2CJWB 3ZH9B 3CYFA 1GNQA 1W85B 2R6GA 1LDEA 3AP1A 3CE9A 3L7MA 4EO7A 5HFJA 3EUWA 1QV9A 3NC1C 3LXMA 2G9NA 1B8UA 1ID8A 3FUTA 2PLRA 4ZK2A 4HQRA 3AMVA 1Y4AE 1BZYA 1O7JA 1PSWA 4OP3A 5IT4A 3OIUA 1UF9A 3KXPA 3NHLA 4FYYA 1H4VB 3RKUA 3SMVA 2AXEA 3HZHA 4YP5A 1L7DA 1RKUA 3HVIA 4A0GA 4MR8B 3WWYA 3KT3A 3R3SA 4TZ6A 3L77A 3FTQA 3U17A 2XAUA 5FBRB 2JAOA 3M5WA 3EZNA 3MGGA 4MZXA 3PL1A 1XBTA 1KVUA 3EEQA 3GROA 5HILA 4CDRA 5CT9A 4TYYA 1R0RE 4PWZA 3DQPA 2JBHA 4NJMB 5ALDA 3KXKA 2PWAA 1Z2AA 4RETA 4AC9A 1SCQA 4AN0A 1YJAA 2A0WA 2HR1A 3GJ5A 3FETA 1L1QA 3DOUA 3T9AA 3NBAA 3CVWA 1ONPA 4XLLA 3UKDA 5JY6A 5EEGA 2REQA 3ZX5A 3UJCA 4IIFA 4LC9A 2Q6OA 3MBKA 3ANYB 3RQSA 3PXCX 1OC4A 2GZ3A 9LDTA 5AJYA 1P62B 3ANXA 2O3UA 3LQFA 3FKQA 1KI4A 4HC4A 1T4MA 2F9FA 4RV4A 2XUJA 3HEAA 3RVPA 2Z6UA 2K4MA 2QTBA 4RIIA 2EFEB 3OEEA 3E84A 4HI0E 5HK8A 4CLOB 2IYZA 4JD5A 1JDBB 4BYGA 1AB6A 2Q8NA 3H6HA 3BIFA 3CBGA 5I7HA 3HH8A 5H9VA 2GK7A 2Q6VA 4EVSA 1NW4A 4WNCA 4C21A 3C14C 3CLTD 3GA5A 3SE7A 3DKRA 2IH2A 5AO9A 1IMOA 4Y6OA 3SSAA 3G2IA 3R6TA 3RTDA 3T41A 4DDMA 4FQ5A 4PYMA 3LGSA 4ZEWA 2ZUDA 3G5TA 2EIHA 4HBGA 3ITNA 2JFPA 2PBLA 3PUWA 2RHBA 4UHJA 1E1QA 3SQDA 2G0TA 1NYTA 2DAPA 5F98A 2VZ0A 1Y4UA 4UZSA 2UVPA 1SBTA 2NZ2A 4TRRA 4OQZA 1YT5A 3ND7A 2JFVA 4FFVA 2VNKA 5DASA 3ZI0A 4I9FA 1V7QA 1ZNZA 3ADCA 4IKPA 4DGQA 2FZ4A 2R60A 2Y6UA 3HWX1 3UGKA 5JECA 1E3WA 1N36B 3JU3A 2QR5A 1QGZA 5IARA 1G291 2JK0A 3Q40A 4WEOA 5KSZA 3W8DA 1YVPA 3LPMA 3Q11A 5LDGA 4TMVA 5AW9A 1JHRA 1HEIA 5EZSA 3SZMA 2ZR9A 2WKPA 2HDWA 4EOGA 2JAUA 2HF2A 2A2ZA 3HUDA 5AQEA 4XQ9A 3SC6A 5JS2A 2FG6C 2PPVA 2XKAA 1AXEA 1OYYA 4BAUA 5KVAA 1WNFA 1NF8A 1N8TA 4LXQA 1Y7IA 3B60A 3INNA 2W0SA 1KAEA 3F5DA 3KR0A 5THXA 3F8TA 2Z1DA 1O95D 3EEFA 2WYVA 4TKZA 1J0XO 2D0OB 3QPDA 4WTOA 2DPXA 3WGLA 1ZMTA 2IE8A 4I3HA 1M66A 4CIBA 5MN6A 2C29D 3C7AA 3T4XA 1YVRA 1IWOA 2X8WA 4LAFA 5G1NA 2O2YA 4D6PA 1RFGE 1QS0B 1ECFA 4D9KA 1OOEA 5FOQA 2FRXA 5ERGB 4R1NA 4OQFA 1T91A 1U3WA 5ARDA 4C5BA 4AJIA 5HRUA 1DZIA 3QYPA 4MWEA 3VU0A 2OLEA 5B57C 1TOAA 3LUHA 3T3HA 4DCPA 3EIUA 2Z5LA 1FP2A 1TI7A 3JD0A 3SM3A 3OOYA 4TUYF 3C5HA 1O4VA 1PZEA 3NOOA 3DZIA 2VQDA 3ZWNA 2KI5A 1BDJA 4AG5A 1R10A 3K2QA 4PZPA 2HTFA 2IUFA 3M3DA 3OC0A 1NW8A 4AKTA 4EQ6A 1IPFA 3OCZA 3ENVA 3OLQA 3RSCA 1EZ4A 2P9QA 4FMDF 3QOWA 4NABA 3O92A 2NUAA 2CUNA 4BKUA 4L7VA 2R85A 2BWJA 1T6NA 3AIIA 1GA4A 1N9KA 1RYZA 2GBPA 3ELDA 4NU8X 5DH9A 4XARA 7ADHA 1MEJA 4QOFA 1C7JA 1YV9A 3WNZA 4EJSB 3RS4A 2WAMA 1PGNA 3K7EA 4CNQA 4D92A 5GGXA 2WIKA 4DZTA 3JRWA 5DW3A 3C7KA 2ZTUA 4L07A 1CRZA 4N0MA 2H5JA 4TV9A 4KV7A 1LA2A 3WLQA 1CG6A 5ES3A 3ZNNA 2ECKA 1TNDA 1H2WA 1L1EA 3FCAA 1QTIA 4U3JB 3T7DA 4RKQA 3Q3GE 1L3BA 1EFTA 2DFLA 4R4JA 1O9BA 3WGHA 4JXXA 3HXQA 2JGIA 3NWEA 2RKBA 1YI8A 2K5UA 2O3JA 2YN0A 4G0OA 3BBPA 4UC0A 3ZE8A 2IPNA 3ZCVA 5FUMA 2ZYSA 4S3MA 5TS3A 3STWA 3OHMA 2NZVG 2FR8C 2DBYA 2F00A 4FKMA 3RNLA 2CVHA 4W5QA 4KB5A 4OYHA 3NV9A 3I8SA 2VTDA 5TPZD 3L0CA 4PHGA 5SYNA 3BXEA 4EGQA 2PH3A 2P0AA 5I3CA 1LBHA 3N8GA 3PC6A 4I50A 2QTGA 5IASA 3ETNA 4RGVA 1TADA 2P8JA 3JTEA 4HDMB 5DTQA 1BVYF 2JASA 2XCQA 1NJGA 2P6OA 4P4LA 4C4TA 4EY4A 2RGRA 1PQYA 1Y6JA 2GA9A 3HKCA 1Z9BA 3LUFA 3M1YA 3TJMA 2FI1A 2ZIGA 3P32A 2VPTA 1R18A 4PV7A 4RPHA 5SYAA 4M3NA 2GUGA 1CRQA 3T5PA 4GAEA 1GQ2A 2NU7B 5KNLA 5BNIA 5ALZA 3KK0A 2PAFA 2B4TO 3ORRA 3FLBA 2NADA 2PUWA 1FYEA 1O4WA 4UAGA 3UJNA 3LUAA 3UAYA 5LUAA 3HFSA 1QU2A 1NMSA 1VLJA 1ZIXA 2ACKA 2XVXA 3G02A 2PTGA 4BV8A 2HMUA 4ND8A 4X84A 2O3SA 4J2HA 2XIJA 4D9FA 3MGBA 1N2JA 3F9CA 4ARSA 3Q5DA 2JAHA 2B37A 3EUAA 4EB8A 2J9ZB 3ZD6A 1HETA 1VXOA 5CNKA 1P44A 3JPWA 3CM0A 5BORA 3AF6A 4EA6A 3EQ8A 1UZAA 2GJKA 3EVCA 2WT8A 3FPEA 3PLNA 4TXHA 2VRCA 3HXLA 4JOSA 3GLIE 1XZCA 2ZBRA 4EG4A 4LWOA 4R0VA 5LZ7A 3G0BA 3UQYS 4EKDA 4R8VA 4BLWA 1NF3A 1VBNA 3ZBPA 2FDRA 2YOHA 3CS3A 4DIDA 4IJUA 4TQ9A 1E6UA 4W5TA 3BWCA 4DLAA 4EVQA 3T7EA 3WWDA 1VJ1A 4OKIA 5JR3A 3AG5A 4ROSA 3T9EA 3LHFA 1K6IA 4TVSA 2OP1A 1RPAA 1XZEA 3WK4A 2ECPA 1W8DA 3C45A 4XVUA 2A9KA 2W2XA 3LLSA 3P7MA 2VJDA 3JSAA 5BWBA 3K1TA 5I9IA 4TKVB 1P17A 4W7HA 5BNFA 3T99A 5L8VA 1PJCA 2BJHA 1B73A 4AL4A 4LCJA 4NDZA 5EYPB 4F9TA 3P9IA 2XW6A 3TSOA 3QK7A 1G19A 1E61A 4GLJA 1TEXA 2FSUA 4A8HA 1KYWA 4ZJUA 2A0YA 3BE4A 1MO2A 1RP7A 2FPIB 3VC2A 1XJ0A 5ULLA 1ULSA 2RJ3A 5HF6A 4ND2A 1ZVQA 2PU7A 3H2IA 1UDRA 3JQAB 1LW7A 2W2LA 3PFNA 4XIJA 4F71A 1H1LB 2ONZA 2CYBA 3DMRA 1QFJA 4PFSA 2O07A 1LEHA 1B15A 3MTGA 1TQ6A 3IVAA 4NHEA 3KSAC 3R3JA 1D0SA 2GN2A 4FP9A 4BNXA 5CK4A 4R31A 1N8NA 1GTL1 1PDWA 1WXXA 4B2LA 3FVRA 2VPIA 1WRBA 1PFQA 4HWRA 4QLBA 4H1WA 2XJ9A 3JATA 3ZWMA 2F8LA 4D4GA 4E51A 2YR0A 1DVRA 1CZLA 1JZSA 3ILSA 4JJEA 5BV7A 4FFSA 4BO2A 3U9SA 1OWLA 5CUQA 5KUTA 1QAOA 4EG3A 5K8CA 4MJ7A 5I47A 5KQRA 4ZPXA 3ISVA 1Z18A 1FP6A 1OYOA 4CM8B 3KAPA 3ZDZB 2I80A 4E11A 2CBGA 1VI6A 5AIBA 2Q41A 4PZYA 1VYVA 1JEYA 1CKEA 1CZOA 1P2DA 2J9FA 4J4TA 5LP6A 1K08A 1JWLA 3WLFA 3PXGA 3HU2A 2BKUA 3LY7A 3WJ7A 1L4FA 3I5AA 4HSEA 2ZIVB 1EK5A 3ZJUA 4MICA 1DTWB 4X7BA 5ALYA 1W30A 2ON6A 5JYEA 4TWZA 5B3JC 2OD7A 2IZ6A 1C50A 3A1WA 1ZFNA 5EPEA 2VDJA 3ZXUB 1PL7A 2ATCA 1G4AE 4JQOA 4K0KB 3VSAA 2C77A 1JKFA 3WGYA 2RH9B 1CETA 1M0SA 1KBOA 1Q19A 3DTVD 3OZVA 3W5VA 3GGPA 4ZDKA 3CVVA 3GP3A 4X85A 3CW2A 2AOUB 5MN5A 3OPYB 1VCHA 3GDGA 3B3QA 3CKMA 3ED5A 5EIXA 1CUUA 3F0TA 3RVKA 4BP1A 4BV3A 4E5KA 4YR7A 4AKHA 4PE5B 3MSCA 4F72A 1D5WA 3SJAA 1NSYA 4NH4A 3PCRB 2EWVA 4L78A 2RKWA 5JSUA 3NNNA 1OBOA 3EXAA 3EDCA 4N5DA 5FF9A 3ZCRA 5FO0A 4PBTA 5KPJA 2D5IA 5ALWA 2CLOB 2TSYB 2GWRA 1NBOA 1LTHR 4JGBA 1FNBA 4MYCA 1OFUA 5AESA 4ZHQA 5IK2A 4UEQA 4CLDA 1BFKA 1ICEA 4HFMA 4RC9A 1UKCA 3FNQA 4OMUA 1AKNA 1PNTA 3J7AC 5JS1A 4HWGA 3RTGA 1WF3A 4NF2A 5K51A 4MGZR 4G5YA 4YN3A 1UMCB 2W6JA 1FSSA 3RSLA 2HYDA 4UARA 4DLPA 4Z1OA 5MF6A 3SEZA 4JROA 3RYHB 4LJ7A 3ZCXA 1A9XA 1CUAA 1ZNQO 2MINB 2Z8YA 4MPPA 2JH3A 4MRVA 1ZD9A 2P69A 3WGQA 1PSZA 1Y8QA 1XLWA 4G1UC 5CBPA 4HLQB 4RZIA 4XFJA 5F7ZA 5FUWA 3GLFB 2VJOA 4X8HA 3FSJX 5AVJA 1U3FA 2ZG6A 1XEAA 3A2LA 3GYGA 1G6Q1 1O96B 2HCRA 2Y9PB 3P8ZA 5EP4A 4DLLA 3WQHA 1FJXA 2BRUA 3G6WA 4G1MB 3I62A 1F0NA 1I5OA 2DQSA 5AVSA 1GKLA 2Q9BA 2O7NA 5GZ6A 3EF3A 4HLCA 4RY8A 3P2KA 4LOJA 1N0VC 1NQVA 5IAAA 3ENNA 1FRQA 4LJLA 3WO0A 1QH9A 2RBGA 4YQEA 1Z47A 2R68A 3TKLA 4A9AA 1BE8A 1BKDR 4M21A 3HVHA 3EZFA 1VECA 2D2IA 3K0BA 2IXAA 2QTVA 4Q03A 1JPJA 2BFDA 2ZATA 1AX9A 2Y1EA 3OU7A 1BNCA 521PA 4D98A 1PW5A 4B3SB 1N8KA 2DOKA 2AFIE 2YVUA 1JXQA 3GJ8A 4EJ2A 3M4XA 1Q83A 4MYDA 3PYMA 4BVKA 3I01M 1GGNA 4QELA 1BOFA 3AEKA 3GLIB 1OGIA 3W2EA 4S05A 5C8YB 2M2IA 3L1JA 4PNZA 4JEHA 1DJOA 2AGVA 2IHBA 3FH0A 4Q1FA 4AJ4A 4JJZA 3ONVA 3IS3A 1ZM2A 1XNGA 3QPAA 3U4QA 2V7UA 1Z5WA 3IVMA 1BVHA 1YZYA 3H9QA 2OFXA 4KPUB 1YFLA 3PV0A 1Z4LA 2HZ7A 4E5UA 2WRZA 4BVHA 4YK7A 1U5BA 4CMCA 3EZGA 3RI3A 3WSWA 3H65A 1A98A 2E6UX 3JQ6A 2VJQA 4L8WB 4QFCA 4S1NA 4YJGA 4YI5A 1Y6FA 4UHKA 1HFWA 3PNBA 4UVDA 1GG9A 1R00A 3ZQ4A 1VMEA 1OYVA 2AMVA 2KB0A 2VQSA 3GPDG 4LNUA 1KJ8A 2JLCA 2KM1A 4MMXB 5KOJA 1FUKA 1KYQA 5L45A 5KPDA 3TINA 1J5EB 2DSTA 5IC6A 4BS9A 3NG1A 2J8ZA 3BMCB 2NSHA 3C74A 3F96A 3I2HA 1X38A 2HQBA 2NGRA 7ABPA 1O0BA 3H0CA 2JHAA 1BN6A 4CMEA 2QT1A 3C98A 4YJFB 5A4FS 4U0JA 2IX3A 2WA1A 1LFDB 3KE9A 5EHGA 1C4XA 3Q72A 5CH8A 1BRTA 3W79A 4CEIA 1KDPA 5DTEA 4FEGA 2C61A 1S1MA 1W19A 5EGNA 2OG2A 3K0CA 3M81A 3TAUA 3W2IA 2QG6A 3AY3A 5MHTA 1MENA 2PT7A 4AZ3B 1LNZA 3L0BA 1CY0A 1OMOA 2YZMA 3C3AA 3TB6A 3RFCA 2AZ4A 1QFSA 2OM2A 4RDIA 4WLNA 3I3SR 4B83A 4E12A 2Q9UA 2ZRMA 1GNRA 3RHSA 4CN8A 5J4HA 2CE7A 1G7RA 3LVFO 3O84A 1UPBA 2JLZA 1M2FA 1TW3A 4NMXB 4KO3S 4ZO8A 3WRYA 1QQBA 1JHOA 4FYKA 3S1AB 4KH1A 2QPOA 5GTDA 4MMYB 2VYFA 2CK3D 2CBZA 3JAMA 2JCBA 2HA4A 1EFAA 1L4GA 1GAJA 1CP2A 1GKUB 3IPRA 2QV0A 4DNOA 3V4SA 3H7IA 1X2BA 821PA 1NOJA 1JFRA 4BWGA 2BJWA 2QLTA 2QZZA 2FRDA 1LTKA 5CB4A 4CV2A 4LJRA 1ISRA 2OXIA 2P3OA 3HLKA 4ZAWA 5F77A 4EBBA 3NEPX 4XXHA 4DEVA 2HLNA 4FK8A 1GZHB 1DU4A 1L5YA 3COVA 5CEFA 1ZR2A 3E6AA 1MEEA 3U4GA 1XQ9A 1LRKA 2B34A 1NP7A 1RXYA 2CJXA 2PZFA 3R7DA 3CXRA 5KYVA 1J70A 1U7XA 3JQCA 4XWGA 4M8IA 2BGRA 4C1NA 4P5EA 3V8NA 3AY7A 5ESXA 4OU5A 2FJ0A 5JQGB 3PFIA 5JAOA 1M5TA 2AZTA 2HXSA 3EPJA 4DUYB 3I04A 3BXPA 2BGTA 4ZQHA 1NAHA 1PQPA 1OXUA 3PRYA 4AJ1A 1NBHA 4Z2AA 2QN8A 3DQQA 2J32A 1L5OA 1KZ4A 3H1BA 3KTDA 1XA0A 1YAJA 4JJFA 4HQ6A 3R3XA 2G77B 1WXQA 1TL7C 1ZWLA 2I2DA 5KC8A 5DBEX 3EMKA 4OQNA 1F60A 3PLAE 1XEFA 3ZU4A 1NKTA 2Z43A 4PPQA 1KWGA 1G7TA 1PR2A 1Q22A 2MDTA 2C4WA 3PD1A 3EBPA 4HGZA 2RGDA 1I9GA 2Y8EA 5FADA 2VSYA 1JH8A 3PKZA 2FWMX 3GH1A 2QVYX 3MINA 1F6BA 3VSBA 3GJ0A 1PWHA 1W2HA 4E0BA 1CZNA 2FQXA 4ER5A 4ZYVA 2I3GA 1S96A 5FPQA 2P8SA 3PR2B 4J94A 4HAOA 5KIAA 1IC6A 3MXTA 4IIJB 1JJIA 4GLFA 1NVKA 4TL7A 1GGHA 3EDMA 1N33B 5FPYA 1NKSA 4YMSA 4FFBB 4EUEA 4PN3A 4AQYB 3WSTA 1P2VA 3RTAA 3RSSA 3IOMA 3Q98A 3UVEA 1DRKA 2FUG1 3ND6A 3OQIA 1AMUA 3SOZA 2J09A 4ZYTA 4FR0A 3F97A 3PE6A 2IPAB 3WLOA 4OFXA 3I4LA 3USZA 4D4IA 4B7CA 5IU6A 3SKXA 2GXUA 4UJ5A 3N75A 5F52A 5C1DA 4M53A 2GJSA 2AJBA 2XDAA 3F8WA 3UUGA 2QBYB 3O26A 1YB5A 5A0TA 4EPVA 2R7NA 2YMQA 3PIIA 4BRZA 3TX6A 5LMCA 3TDNA 2XRZA 1E9DA 1X86B 2ZRCA 3DFKA 3MGKA 3AJEA 4U8GA 1JQLB 2VPPA 2GCNA 3GDHA 3OCWA 1CUVA 2FWBA 1H9AA 2WUGA 4ZPJA 2OBMA 4V0RA 3F5MA 3QVWA 3I5MA 4D9GA 1NG1A 2B4QA 3ADOA 3QVLA 5K8LA 2R87A 4X5OA 3KE8A 5DDIP 2YVLA 3A05A 3MGCA 4IVPA 1XZLA 4Q1CA 121PA 2FUG6 3EZLA 1Z8HA 5KKNB 1YOVA 4J75A 5E1BA 1P5ZB 2BFBB 4JYZA 3BA1A 4BFXA 5LYJF 4AXXA 4GPIB 3V1UA 3WGNA 5CW2A 5D3KA 3FLEA 4HNTA 1CBUA 3ISTA 3MWLA 1OKKD 3VYSB 1PFWA 1XEWY 3PGXA 3DZJA 4MW5A 4KQGA 4MCAA 1F8UA 5EUMA 5IM4F 2FMKA 1OGJA 5DF1A 4K6MA 4PR0A 3KKZA 4LSWA 3WLIA 3AEQA 3NZEA 4BMCA 2BE7A 1C9NA 4WD3A 2I4MA 3GEHA 3KALA 3R5JA 2F1KA 2C31A 4LMPA 3SIRA 3NKVA 1IB0A 4YAWA 4LTDA 3UENA 1YXMA 1ZK1A 3VYVA 2P9YA 3CIOA 3FWPA 4QG7A 5AKHA 2CVQA 2P0YA 3TLYA 4K46A 4L4UA 5COAA 5MGBA 1W5BA 3A4MA 3K6RA 4CQNA 1V7ZA 1ZD3A 3HADA 4ZC1A 3T7RA 1GTRA 1F0YA 1WHSA 2NNWB 3HHPA 2QMEA 4URYR 1WR8A 3TRDA 1KI3A 2R6CA 3KL2A 2Q7OE 4ZYXA 3FOEC 3CCFA 4RPJA 2XLCA 3KUKA 2QR3A 4WY2A 2QDKA 1CLEA 2X0NA 4C4YA 1C30B 2OKCA 3L8YA 3N59A 1W8IA 1C3XA 1G3UA 2ABWA 2FN4A 3JARA 3LYLA 3KB6A 4LNAA 2AZMA 2FX3A 2C4KA 4E88A 5CAEA 2GN1A 1O95A 3EGWA 3JZMA 5L53A 2BTQA 5REQB 1K7YA 3U7GA 2ODTX 3GEMA 1XA4A 1XCMA 4ZALA 1CQZA 2ZWAA 3CZPA 4BIMA 4NEHB 2E9SA 4ITVA 4RZXA 1XZNA 4S35A 1OJ7A 4DDHA 4CV0A 1XKLA 2NVWA 4GKKB 5L40A 2G63A 1DWPA 1TU0A 3DZDA 5BVHB 4MV9A 4F2PA 1BFDA 4ZC8A 2Y66A 4M1KA 4B3RB 3RAJA 4B3FX 1RWVA 1PZXA 3MLBA 3R7LA 3RC1A 3AILA 3PXDA 2CHVA 1A9QA 1SMKA 4BB6A 4C0WA 1AGXA 1PW7A 2HRZA 4FYMA 5FNVF 3RM3A 3TOXA 1MQAA 1UZLA 3AF4A 4RVDA 2ZRNA 3SN6A 3LC0A 4KXFB 3MUEA 3LDGA 2CFIA 4JLWA 5BV8A 4UMVA 1XU7A 4YUXA 1LPOA 4QOGA 4GRAA 4PQYA 3BC1A 4X45A 5JSHA 2BP7B 3EH1A 1LJUA 2X8LA 1RABA 5KNBA 2I4NA 2CJPA 4BNMA 2I4IA 2NQ2C 1N2CA 1D6MA 1Q77A 1TIBA 2NSDA 1LDGA 2ZT7A 5EPUA 4E22A 1ACMA 1S1CA 3J7TA 3KEOA 4G1BA 2HMAA 1E59A 1PJ3A 1AK9A 3T94A 4KR3A 3BT7A 1US8B 2RGNA 2Z5GA 2A5JA 3UMJA 4KE6A 4II3A 3ZI4A 5IX8A 3DMDA 5F1YA 5HFNA 4BEBA 2XZDA 1EFRA 5IT0A 1TFRA 5BT9A 1BMTA 1GADO 5EIFA 4EJFA 4AWBA 2Q4BA 3A32A 3G8BA 2BZ1A 3CUTA 5TPWB 2C9OA 3PPIA 4G41A 4Y2RA 2V4MA 4R1OA 4H3SA 2ADMA 1UP7A 2YCBA 2JKYA 1QIDA 4Y6SA 5AHRA 5E1DA 1ISMA 2PUHA 2X1MA 1UBMS 3N2EA 1W48A 3CUVA 1QNFA 1YZGA 3CKYA 4I7EA 2FSVC 2ZYGA 1JQ3A 3FDXA 2ZYUX 4K9PA 4YRDA 1M7GA 1PEDA 2I3DA 3T06B 2BF4A 4DRYA 5CB4B 1E99A 1IHYA 1U9CA 4ZVQA 2IOHA 1Q20A 4C7OB 4YTEA 4BO5A 4COKA 2HLDD 4GPEA 2IU6A 1TQDA 4TMTA 5EXSA 2VTVA 3UM9A 2ZTMA 3VC1A 1MA0A 1IBKB 2FOLA 1FJ2A 1NLYA 3UB3A 4UUPA 1U1CA 1GYQA 3BFKA 5EZ5A 3FPKA 5TMDA 3QKSA 4DNPA 5JSZA 3PEWA 2HGSA 4PC2A 2EVWX 4C0SA 3ZHQA 4CKBB 4OHCA 1L1RA 4MR9B 5ALEA 2PCLA 2C9MA 2ZUVA 4PRKA 1IZ7A 3GEGA 1Y9ZA 5JSYA 1DJPA 1UPTA 2HT1A 2JA1A 5CM8B 5CFNA 1TM5E 1HYBA 5ENDA 2X0FA 1F2VA 5CA0B 1IZ9A 3EEIA 4DMMA 2PQ6A 4YCAA 1G3MA 4D9BA 1RXCA 3PJDA 1UDWA 5K3SA 1Z36A 5THQA 3VTAA 1P0CA 4ME6A 1KRWA 3BFXA 4RORA 2B21A 1Y8RB 3UAVA 1X7WA 1WU8A 1YR2A 4CR7A 3JQGA 1B6RA 4RFLA 3TRKA 1ZGZA 3JXEA 1P73A 3TZQA 621PA 1KEEA 3HCCA 1EX6A 1IAVA 2C94A 4KGZA 4WESA 4PLWA 3MTBA 2GDZA 5GM2A 1YR7A 3W5UA 1A8SA 2CHUA 1USWA 3IO5A 4DUGA 4GYYA 3EAQA 1RLUA 4MDEA 1XRMA 2OOKA 1HT3A 1TZJA 4EKEA 3U62A 3W7BA 1UFKA 3H4TA 3IIEA 1HE3A 1V8DA 4QGFA 3RUAA 2WA2A 2AI2A 3C8HA 1JQKA 2WOOA 3IPYA 2WT9A 1OAOC 4OB8A 4WXHA 5GV7A 1VB3A 1EAYA 2R6ZA 4M4SA 5BR7A 3EA0A 3OX3A 4Y0NA 2IYTA 3GLHB 4HP8A 1U4NA 1O3YA 2GN4A 2P5YA 2JFGA 2V65A 3P5SA 2PD6A 5DNDA 3RARA 2Q5OA 5DHPA 3Q6MA 1EPUA 2W43A 3QY9A 2ZKLA 1TM1E 5EJEA 2QQGA 3AKCA 1G20E 2PR2A 1RQGA 1RJGA 5F73A 3ZH2A 3U16A 4MLCA 1K8QA 2B8NA 4KXMA 4I5GA 3Q5EA 2JLUA 2NU6B 3DT6A 4C22A 3AG6A 1R9JA 2LWIA 3HCOA 5TV2A 3PJGA 3NC0C 3NQ41 3NALA 2IFTA 3H84A 1P60A 4M2LA 1EGAA 3NNSA 2F59A 2ZR0A 3TMYA 3M6UA 3B52X 3ITEA 4D57A 4O2BB 1YZTA 1M0EA 4ARIA 5GZ1A 1KFKB 2OO5C 2VDUE 5JCXA 1N9GA 3UV3A 4Y1FA 4D0SA 3K9WA 4WLOA 2OGZA 3L1HA 5JVDF 5EKDA 3TW6A 1SBCA 3PD0A 3VTKA 3GUYA 3MMPA 5B6JA 2FZ5A 3A36A 3BXXA 3SICE 1ULBA 1RAHA 2O48X 1X8JA 4LJKA 3ZLUA 4KXLA 2B2NA 4XUEA 5FOXA 4KQMA 4DSOA 1KPGA 4YFVA 5LQKA 2H0AA 1LLDA 3TK1A 3T1YB 3EPRA 4XPZA 3KZOA 3WYAA 3CNEA 1QM5A 5KJFA 1XCLA 4X90A 3COSA 1RTKA 3CLUD 3WZ2A 4ALLA 4OP1A 1OROA 1QU3A 5HGJA 2C9ZA 2YHSA 3DO6A 3G13A 1RXEA 4OHMA 1Z12A 3PHCA 3DEJA 1TO6A 1WDWB 2GRJA 2OBBA 1VKOA 2ZSIA 3LQKA 3EG9A 4A4DA 2XITA 5DOVA 2CW5A 1F17A 4O4HA 3FVQA 3O4GA 2G28A 1MKYA 1UMBA 3GDWA 2ZJYA 3RS2A 4CKZA 2ODPA 1ZRNA 5CTAA 3UAGA 5IAEA 1EEHA 2OHVA 2AOTB 1MXHA 1ZJYA 2KWIA 3BHMA 1L4NA 1YRAA 2GRAA 3HA5A 3GMTA 1OXXK 1U9YA 3KD2A 3QVSA 4F9FA 1T29A 5TQ2A 4BAZA 3NPMA 2AFHB 1JHVA 3TDKA 4RGQA 2PRJA 2PZJA 3GA7A 1XQXA 2XA2A 3I61A 1KJWA 1DX9A 5F4ZA 2IIQA 1SU8A 2RJNA 1MMFB 4OGKA 1XTJA 3L7JA 3DTVA 3DAGA 3AK4A 2NQTA 3WADA 3MRTA 1T4BA 1WCYA 1SD1A 3WL7A 1NMEA 5EFOA 5AVZA 1R0ZA 2OE2A 3WGGA 1O97C 1U0SY 2VPYA 2V97A 4YCNA 3NIBA 4JUAA 4RHTA 4BO9A 5CURA 4FU0A 2PL1A 1BX3A 1PDVA 1WWKA 4B9AA 3SFZA 4KITB 4H59A 4B3DA 2H51A 1U2GC 5IJAA 4AULA 2CXRA 1EAMA 1EXWA 1IHXA 2DMRA 2QPLA 2AG1A 2YZNA 3F2IA 3JRXA 4CWAA 4F8EA 3TXYA 4XOIA 2H52A 3EIHA 4YV0A 1LY1A 3BDIA 2YTZA 1Q14A 1YB4A 1MB4A 3H97A 4XGQA 4BCCA 2QLLA 2D2VA 4AP6A 2VDKB 3MUOA 4WADA 3JWPA 3DFUA 3RS7A 4DY6A 4CMKA 1X7XB 2IXFA 4OK5A 5JPIA 2G08A 4CIXA 1T9GR 2I22A 1B0PA 3OQ6A 1X19A 4IJWA 4D3DA 1TTTA 3BD8A 1M75A 2I5PO 4TS4A 3IQXA 4IQ8A 4FCCA 2GAFA 4I9HA 4LDNA 3D1LA 4HNQA 2CVPA 3EEYA 1EM6A 3NXSA 2N3ZA 1MOSA 4C7VA 4J91A 2YWJA 2H3HA 5IMSA 4DLWA 4MS3B 4MI1A 4ITUA 1VPLA 3BTUA 3EIFA 1ZUWA 2HMSA 4LGCA 4MYRA 3ENWA 3N8KA 1PNOA 3NVMB 3SYLA 4BNZA 1FLAA 4GGMX 4UNPA 3HJNA 5IJ0B 2YJZA 3UH0A 5AUQA 4I1SA 3JQDA 1JIJA 2JLAA 4M0PA 1U81A 6ABPA 2XIQA 3W5BA 3SNKA 2JEYA 3RJTA 3U26A 5CB0A 3AZQA 3G9XA 4W9NC 2VK2A 1V3VA 2EJUA 5CW1A 4GPZA 4QECA 2VBCA 4RDXA 3ICPA 2NPIA 5CCEA 2VXBA 1YRQA 2ZJ1A 2QRNA 1WW3A 2ZAGA 2W6PA 1CDEA 3GQVA 3IPCA 3R7WB 3UWSA 3EIQA 1KO8A 1VE6A 2IEGA 4G97A 4ZQFA 1P33A 2A7QA 3DS8A 3KOWA 3GJZA 4G56A 4U9HS 1SXIA 2F1RA 3AUSA 1SCNE 3TDMA 4C0HA 2CJFA 4RJKA 4BGUA 2GTIA 3TQCA 4MIYA 4NE7A 1XXHE 5ALNA 1HF3A 4NP6A 4IKOA 2B99A 2OQRA 3LCVB 3ONFA 2QRQA 1XROA 3NTLA 2FA9A 1LLFA 3V7WA 3Q7EA 2O4UX 3ITKA 1E77A 3D4BA 4JLSA 3ZW8A 3T3OA 4Z86A 1FNDA 1HZJA 2HK8A 3D64A 4B73A 4A8JC 2MYPA 5BW8A 3EXFA 3U5TA 2QTMA 5LXTA 1U0JA 1JG4A 1JNXX 2WZQA 4JT2A 5IXJA 4TTRA 4FB5A 4EHIA 2L69A 2LKDA 3DR3A 4YS6A 1VSUA 4BNKA 4UTXA 4HBZA 1S9DA 1B76A 4HVAA 3DV9A 2WT4A 1AS2A 1UJ4A 1BYIA 4KIJA 4W1SA 4ZYYA 5I4IA 4H31A 3TCNA 1TF5A 4X8OA 1Q74A 3QKWA 2FZKA 2Y0DA 3N7UA 2Q3LA 4V2IA 2E55A 4ZCRA 4RPGA 4EI9A 3OKPA 2ATXA 5C8DA 3ICEA 5EKXA 1CHDA 3V55A 2PM8A 1F06A 3UIEA 1FFXA 5L6LB 4MNTA 3CTPA 4HLUA 1KFBB 1Q2UA 3H2ZA 1MFZA 1Z5VA 3EHDA 3L4JA 3KZKA 1C4KA 1RM3A 3QFRA 3L6RA 5FUXA 5JFGA 3CZAA 3OQJA 3VPCA 5SZHB 4DYHA 2A4MA 3LMKA 1TD9A 3Q85A 4UE3S 4AAYA 3GMDA 1MJ5A 3I92A 4U6NA 4YYEA 4FBMA 3MJCA 5I8PA 3K2BA 4GX5A 3QOFA 4EY7A 2WQ7A 4QQFA 4CFSA 3I9JA 2GPJA 1ZPDA 2PRYA 2IP4A 4OBEA 5AOAA 3AGQA 2IYEA 2VHYA 1O9GA 5LWQA 2REQB 5H70A 2FSPA 4JBLA 4NEGA 4D0NA 4F56A 1R15A 1Q17A 2AG6A 2DUMA 3ECCA 3II6X 2IP2A 1OZAA 4I5DA 5DPMA 1UM8A 4JJAA 4ODIA 2C83A 2WIFA 1KYZA 3GHHA 4C4RA 4DQ0A 5I9TA 4LOKA 4MW4A 3NFYA 2DUJA 4P4SA 2B9VA 1FFGA 3KVYA 5LCXA 3TMAA 3MM4A 4J16A 3NUZA 4XLTA 2O5VA 2C2GA 1GO2A 4ML3A 5JJIA 2NP7A 1O1YA 3TVTA 4RE6A 3B7PA 3ASUA 3ON5A 4I8IA 4KH0A 3V9PA 3I9V1 4C03A 1RPJA 2QD4A 2H2IA 3OCJA 5I6DA 3WSVA 1XZDA 3IX7A 2CK3A 5CB8A 3VGPA 3ZC3A 2QX4A 1LDYA 4RADA 1KJ9A 2B8EA 4EB6A 4CEJA 3SXJA 1P45A 4OJTA 1AF7A 2CMGA 2PGAA 1N6RA 1ZD5A 3FGPA 2ZJ8A 1X7DA 3FMFA 4AUNA 2Y1CA 1A5AB 2HQ1A 3RRYA 3IIJA 4LJ8A 1PT7A 2W6MA 1IMJA 5AW5A 4AMVA 2D7JA 1DO2A 2G09A 2GNPA 5CVUA 3IODA 2UVPB 3EC1A 3VDMA 4EG0A 1J09A 2AJTA 1CT9A 2VRWA 3REOA 3TGPA 4OPMA 5EWLA 3IV9A 3O8CA 1YS2X 4BNWA 1E3WB 1XG5A 4HJXA 3RYFA 4ZK6A 3FKSD 3QEBZ 5IBCA 1V5EA 1YACA 4O2AF 4AZWA 5BN1A 2G82A 1G2PA 4H15A 1E32A 2HA7A 2FPWA 2XTJA 4P5PA 2B94A 1WD7A 2EIXA 1ONOA 4J3JA 2DUNA 4QO7A 4DWOA 1NQ5A 2YN4A 2H11A 2PYZA 3NRBA 4BFTA 4EUNA 1CVIA 3WDMA 3BRCA 2EGGA 2VJNA 4H7FA 1EHIA 4Y2JA 3O95A 2M6RA 1W0JD 4MVCA 3GYBA 1U9IA 2IYQA 5EHNA 4ROTA 5BVGA 5KDDA 3MJSA 1GV1A 1IQPA 2BDUA 3DHWC 3U49A 5JNLA 4YACA 3D3QA 3RFVA 2O59A 1P7ZA 2REBA 4GP6A 4S2UA 2GK4A 4HQ0A 1VCMA 3H17A 4ACBA 5IF3A 3A6DA 3IV6A 1S2MA 3CUSA 1SKMA 1FYVA 1RM4A 3E7PA 3COWA 3LXRA 4KO8A 1CUSA 1N5OX 1W0KD 2FMFA 2XNCA 1KEWA 4P3YA 5GAJA 2JLQA 3BL6A 3OOJA 2Z56A 4OQDA 1CRLA 3RW9A 4C88A 5BSGA 1VQ1A 3K0EA 2EFYA 3EVEA 1RMTA 3EEBA 4Q7LA 4FE7A 5BPHA 3SG0A 2RARA 1DAFA 2OO3A 4GOMD 4M9CA 1B26A 1YHZA 1CIJA 2CL5A 3EGOA 1POXA 3GCXA 4I4TA 4RVFA 5JLAA 2H4ZA 3UF0A 3WYDA 3IIIA 2R0QC 1V4BA 2DBRA 5BW5A 3DCNA 4WKGA 3KLBA 3JQQA 1S8NA 3PEVA 4ACAA 1U7DA 2VUHB 2X5NA 3GO4A 3L82B 1QP0A 1P2UA 3AHDA 4PEVA 3FF4A 3H5NA 4J1TA 5IT9A 2FFBA 4MUEA 4LDAA 3MMSA 2P6MA 3C3WA 2OD2A 2ZRAA 2ZFUA 1JR3E 4Y8VA 3RC7A 4L8GA 2H2FA 3HSKA 4MWGA 1U8AA 2NUAB 1IY1A 5THKA 1RU3A 4TWAA 5LQNA 1ENOA 2YHBA 1J0AA 2O2DA 4BKQA 5NLLA 4BBJA 3TW4A 1H2HA 3N0VA 4C2UA 1H93A 4NLLA 3UATA 4A0HA 4BYMA 1I5RA 1CEQA 1FB5A 3PFBA 5LKRA 4FR2A 1ZJWA 4KNYA 1U28A 2UV8A 2CUZA 3UHFA 3SPXA 5ED0A 4AJKA 5IJWA 2NZYA 2HQSA 3GP5A 1XJWA 4JFRA 4TV9B 4Y9SA 3QFSA 1OKKA 5ALUA 4KAJA 3WGKA 4RK4A 1SBYA 1PQ4A 1N6IA 4MR7A 4A6PA 3PXUA 1MX3A 4IV5A 5DNVA 2JGFA 3IP9A 5KKCA 1W34A 3TLGA 3B6IA 4YDQA 3Q3CA 4FZJA 4RK5A 2BOVA 5CGQB 4YAEA 3LXUX 4FD3A 3RHTA 4X1YA 2YOGA 5FUVA 5FTNA 2FUEA 5A4IS 2BM8A 2W70A 1OWMA 4QGHA 1QIHA 1QTRA 1Z5GA 1UBLS 1Y1KE 4BEJA 2AG8A 1CJVC 2GKOA 4I50B 3E8SA 2Q7DA 1C2TA 1QE0A 4U7HA 2XUDA 3OM0A 2EQBA 4LGYA 3HWWA 4EL0A 1LF5A 1AZSC 2W83A 2WAYA 3VV3A 1ZISA 4G4SP 1IN5A 1YVEI 4XW2A 5BMVF 4AP5A 2ISCA 4BBZA 2G8NA 5A03A 1Y3FE 2QROA 4UZEA 2ISQA 4F9EA 4QT4A 5LIPA 4O3MA 2Y1GA 3HY6A 3LPDA 4KRFA 1YZHA 5FLYA 4HAZA 3QUBA 1UZUA 2OILA 2BMEA 5AW2A 1A82A 1IPHA 1DBVO 2ORVA 1SUEA 2Y0EA 3AJDA 5LZ4A 4NXNB 3OMXA 3ZCQA 5CNMA 3QVXA 1V9SA 2DKNA 2FVYA 4MUJA 4ND8B 1KRXA 1JG1A 1HORA 2XF2A 3IJEB 2PANA 1IXRC 1U99A 4HCJA 2BH2A 5FA8A 2QM7A 4GUAA 5B58T 3WK8A 3DE2X 4EF5A 2X0DA 1XHLA 2EFGA 3CLRC 4F3KA 4TL6A 6LDHA 3DDHA 3NH6A 4QQRA 1K06A 1VSQA 4NE9A 4CM7A 1E1NA 4JHLA 3UTCA 5A6SA 5TJ9A 1KJIA 4OO3A 5F9MA 3DW1X 2CC2A 5CVTA 2Y0PA 2YJNA 1WB6A 4UE2A 3PLRA 1A50B 5KX5A 4KSBA 3VH3A 3DO8A 1A5ZA 2XMQA 3TVYA 1MOZA 4KTVE 2OCXA 1MNQA 2X2EA 4IXWA 1IHUA 1ESMA 1W2WB 5FOTA 3U13A 3QX3A 4BLUA 1QWOA 1LVHA 3ZY5A 3ETDA 2RHLA 3CO5A 2HM7A 1TMYA 2J5BA 5C46F 4RESA 3OQ1A 4CIDA 1HQYE 4YRLA 3WQQA 2F17A 2G1KA 4DCJA 1RIIA 1QO7A 2E4XA 4ZU3A 2GEKA 4ENSA 4X71A 1CJKC 1EVQA 3AW9A 1Z0FA 2IV3A 1QH1A 1HRDA 4TV8F 1DKNA 3DL4A 5JT1A 1UZNA 2HWXA 2WB4A 3THSA 3RU7A 2VOEA 1CHNA 4D74A 4WVFA 1BDMA 4NZMA 1DQPA 3C3EA 3M5CA 2OGTA 1NNSA 1Z45A 4UXHA 1E7MA 3C24A 3ZYZA 4G63A 4Z4HA 1X7ZA 1M2KA 2I54A 4K2AA 4O5OA 1OD6A 2HLDA 1T24A 5KWVA 2CLLB 4PIMA 3JATB 3LQYA 4IJKA 1RWOA 2C82A 4H1HA 4KCGA 5E6UA 4ZVTA 4XYBA 2GM4A 2JRLA 2FXVA 4XIYA 1QX3A 3OT1A 4BY9E 4M55A 1FFAA 3FRIA 2IV7A 4R9NA 2C2BA 3FW1A 1G4HA 4Z49A 1MJGA 5KWIA 4YAJA 2VYVD 5DK6A 4QPDA 5C53B 1K5HA 1GAXA 3EQ6A 2Q8PA 2XWBF 3DL2A 3IBGA 3ONWA 2Y68A 5AXDA 4RJTA 3GVPA 4FW9A 4OAOA 1XZGA 3Q15C 5LP6B 4YR9A 2WE8A 4OD0A 1HKUA 1KMHB 1HEYA 1HFKA 1P4SA 3QMVA 4NU0A 5CU7A 3RROA 2RC5A 3A9WA 1I6MA 4EYQA 5SZIA 2Q21A 4ARCA 3BL5A 3L84A 1QYWA 3GU3A 4L95C 5GMOA 4UZFA 1R6DA 3W9BA 1SOMA 3ZZNA 3DKVA 3KTAA 3SLKA 5FKJA 4UMDA 2XGMA 4B3JA 4ZGGA 3ZJ5A 3N2KA 4KR6A 1AKRA 2ZJ6A 4NFYA 1I3NA 5PNTA 5JUWA 4L0DA 1KZ9A 3HDGA 3KXDA 1OAAA 1QHXA 2WHPA 5ICEA 4P86A 4FIZA 3BF7A 4MINA 5I5GA 1Z88A 5C7OO 5IVKA 4M49A 2OGUA 1UWLA 3PENA 4D9JA 2CVZA 2O0JA 2HSZA 3DH0A 4CFYA 1J07A 1DT5A 2X40A 3EG5A 4FHGA 2VF2A 1H5UA 1QV6A 1V25A 1WXGA 1E7YA 2GJ4A 1ZD2P 3S29A 1N5LA 2RONA 4F2DA 1A8IA 3GN1A 4DTIA 4GI5A 5F64A 4U8HA 4M89A 4F1KA 4C4OA 5IN5A 3H5VA 1DIBA 1QRDA 1EB9A 1M2GA 3F5SA 3IT3A 1RQ2A 1ZLXA 1VPWA 1NUSA 1MZVA 1NUTA 1X1CA 1G8JA 3QFFA 4ZHQB 2WNSA 3CNOA 5HR5A 1UK7A 4Z4IA 4R05A 3EVDA 3DCJA 2X86A 1SA0A 1WL8A 4JSYA 4Q4AA 4AUEA 3H3JA 5K0JA 1PX0A 5LNK6 2MSNA 3PPWA 3N8NA 1ZGAA 3AYXB 1Y4DE 1A9XB 3COPA 3EB9A 1K8YB 1OIVA 3P20A 2QJTA 1LFAA 3N53A 3DULA 3BDVA 3NRCA 1G8YA 3LX5A 1K0FA 4KYVA 3SQLA 1RKXA 4B2PA 5JG7A 3MHTA 4E07A 3NATA 4RAQA 2FDCA 1EM8A 5LOVF 3LLUA 3ZDAA 4Q19A 5BNZA 1Y8QB 1MVLA 2PGNA 5JWRA 6CHYA 2FFHA 4HWOA 4JVLA 4NR0A 2G9RA 2WJVA 5ALHA 3WAKA 2G76A 1Y7TA 2WVGA 3JZIA 1M6VA 1C7FA 1ZM9A 4PYRA 3IQGX 3G2MA 2O54A 4IJMA 1Q7CA 5LMZA 3NHUA 4MDFA 5CXUA 1TF7A 1YL5A 5COBA 1H2AS 3TIFA 4GL4A 2KLHA 5KTKA 3PA8A 1IN6A 4C01A 2HXGA 3IV7A 2WAXA 1UKZA 1CR6A 1G55A 2PVSA 2R5WA 4XYGA 2DH5A 1SU6A 3W2GA 4EUHA 4MWBA 3DE7X 4MRSA 2YWXA 2HNAA 4ID9A 4QLAA 4V0OA 4EPXA 2GUWA 5GWXA 3F6EX 4HZIA 2FPPA 3DNMA 2WU1A 2Y71A 2BSQA 3G8YA 1Q0QA 1T3SA 2QTVB 4MYHA 3VDXA 1ZQ9A 2EHDA 2BFDB 5BN4A 1T5DX 3H5OA 2CFCA 4TPKA 2Q0SA 4BGDA 5HK9A 2PIAA 1U8YA 2YWGA 4MCIA 5ADWA 1XLVA 4CF5A 3FGNA 5BWMA 1ZSVA 1GDHA 4TXLA 2XNJA 5H80A 2ORED 1J56A 2I6GA 3KOMA 3TTXA 2C04A 3I12A 3AEKB 4NZZA 3TLAA 3N0XA 5JZMA 1NJFA 2QRMA 2GK6A