2OHVA

Structural basis for glutamate racemase inhibition
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
264
structure length
258
Chain Sequence
MDTRPIGFLDSGVGGLTVVCELIRQLPHEKIVYIGDSARAPKKQIKEYTWELVNFLLTQNVKMIVFACNTATAVAWEEVKAALDIPVLGVVLPGASAAIKSTTKGQVGVIGTPMTVASDIYRKKIQLLAPSIQVRSLACPKFVPIVESNEMCSSIAKKIVYDSLAPLVGKIDTLVLGCTHYPLLRPIIQNVMGPSVKLIDSGAECVRDISVLLNYFDINGNYHQAVEHRFFTTANPEIFQEIASIWLKQKINVEHVTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for glutamate racemase inhibition
pubmed doi rcsb
source organism Streptococcus pyogenes m1 gas
molecule tags Isomerase
molecule keywords Glutamate Racemase
total genus 92
structure length 258
sequence length 264
ec nomenclature ec 5.1.1.3: Glutamate racemase.
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ohvA02
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ohvA01
2GZMA 5EVCA 2JFNA 3HFRA 3UHFA 3OJCA 2OHOA 3ISVA 5IJWA 2JFYA 2JFZA 2JFQA 2DWUA 2JFOA 2JFXA 5ELLA 2DX7A 3ISTA 2VVTA 1ZUWA 2EQ5A 5HQTA 2OHGA 3UHPA 2OHVA 5HJ7A 2ZSKA 1B74A 2JFPA 4B1FA 3S7ZA 5ELMA 2W4IA 3UHOA 1JFLA 2DGDA 3S81A 5HRAA 3OUTA 5HRCA 1B73A 2JFWA 2JFVA 2JFUA 1IU9A
chains in the Genus database with same CATH superfamily
1TAUA 4BB0A 1KQOA 2BE9A 4MAFA 5LZ9A 4ANFA 1P0IA 4L7VA 1LW7A 4EWLA 5JH7B 3FPHA 4M0KA 1PDWA 4JENA 3RVDA 5AW5A 4ZCLA 4L73A 2I67A 1EHYA 1BD3A 3OWHA 2UDPA 3VVLA 4TMTA 1GUDA 2HRBA 4H7PA 3CUUA 4YP5A 5ALPA 3THSA 4YRLA 4C0AC 3FKSD 1UMBA 4Q9IA 5EJ6A 3THYA 5E6UB 1GVHA 5LUBA 2BLNA 4R51A 3FTFA 2VUSA 3OUZA 3TLAA 4ME6A 4JKYA 1K6JA 1IVNA 3NHLA 4B3HA 1E8DA 4NZZA 4XIIA 1LK0A 4IMRA 2IYQA 4P9NA 1XXHA 1C1DA 1QAQA 3Q3CA 1BIFA 3SEFA 4HTAA 5IJXA 4QWWA 4HDCA 2N9UA 1Z17A 1GKIA 1JLHA 1GLVA 2D2IA 2O7NA 4DMLA 1IUPA 2FSPA 1G8PA 2W6IA 4AQYB 2ZYAA 3BSSA 1DC5A 4MQ4A 2K87A 4PSVA 3RS5A 1IMJA 2CCGA 3DKKA 4FONA 1RZRA 1XA4A 3ERCA 3IAS6 1II8A 1YJQA 4W5OA 2EGGA 1QOZA 5CVEA 2FMIA 3O90A 4QXRA 4I1UA 5CITA 2CBZA 3RH0A 3V8NA 4KQ6A 4WY2A 3NETA 1DWQA 1S6YA 5J4KA 1AB6A 2JFBA 4LDJA 3KV3O 3D1LA 5MHTA 3EK2A 5DHQA 5B1EA 2HJSA 2I4NA 3H8VA 2J7KA 2P9HA 5BYKA 1T6NA 3G8YA 5AKIA 2FY8A 3S2EA 4F97A 1PZGA 4OJMX 5EZYA 1E59A 2ZBQA 2XMSA 2GUGA 4P53A 3U9LA 2RIPA 4IS3A 2CBGA 4OP3A 3PFKA 1B76A 1TF2A 4C5BA 2DLCX 3HGTA 5BR7A 3TJZA 1Q0UA 2JFOA 2WT9A 1RWQA 3EDQA 1TL7C 3UENA 4ZMRA 3LY7A 4M7WA 2XUDA 1Q83A 3UAXA 3DE1X 3BGWA 3HNRA 1RMQA 4BTLA 2VPQA 5LKRA 5EMKA 4XD7A 4X7PA 4CM5A 2OV8A 3HJGA 4PX5A 4CTOA 4ZRDA 4X1IB 3JQ6A 5IM4F 1C3EA 1U2DC 1YC2A 2PBRA 1ABFA 2GD1O 3D2AA 5I8ZA 2JNWA 4BMXA 5A0FA 3GJ7A 621PA 4JT2A 1G5PA 1U7XA 4EYKA 1QONA 1JWBB 1V7PC 3PS9A 3K4PA 3O84A 4UKDA 3H1FA 4GW3A 2YASA 1Q5PA 4BX3A 2JJ2D 4L0CA 3E48A 1M2OB 3HXOA 1CYDA 3TTTA 1EVKA 2YXEA 3C16C 2RGUA 4YIKA 4DRXB 4QULA 2I0FA 1YOVB 5MFPA 1E61A 1NNI1 1PT5A 4G4IA 2J0QA 4YRSA 1VJGA 1P2TA 2E9SA 4H2DA 2HA7A 4FCCA 1N3YA 3EZFA 3GT0A 3CLTC 4KMMA 3VAZA 3E7PA 4BNNA 3JD2A 4ROSA 4BMZA 3DE2X 3CX3A 5JXJA 3TECE 3DE4X 4HH0A 1NY6A 3C5HA 4YBRA 3IBGA 5CCDA 1LWOA 2I99A 3VZSA 3FSEA 1KEPA 2PAFA 4BFVA 4J1QA 5GV7A 2E1PA 1AS0A 2B7LA 3ZCVA 5ERXA 3LHSA 2C5GA 3W7BA 3LY9A 1ULSA 3OKFA 5BWMA 1AMUA 2CMHA 2HNKA 1GNVA 5IANA 2NSHA 3W5VA 1M2OA 1SA0B 3NBYC 1VRCA 2CB0A 2JI4A 4H6VA 4JVMA 4B79A 2YHUA 4FDLA 5CA1F 3ZK7A 5T64A 3MIIA 3TLJA 1YHNA 3L8MA 2ATCA 3B5IA 5D3MB 2IV2X 3UJNA 5DGDA 4OK3A 4HGRA 1WOYA 3RUDA 4EG7A 1X8KA 1XCJA 4K6CA 4K2AA 2JG3A 2H2GA 2QRZA 3VFDA 1D4OA 1FNBA 1M7GA 1P2DA 2FPMA 4CMIA 2XRYA 4EKDA 3TUJC 1EDEA 3KVVA 2B1GA 4J7CA 1L5NA 4C21A 1XTUA 3T5AA 3Q7RA 3IQZA 4I9GA 4Q34A 4BNLA 2QI9C 1Y6RA 5JRZA 5ER9A 4NCKA 2G9NA 1H94A 1N0WA 2L82A 1DQYA 4FINA 2WRZA 3O1JC 3A4LA 2IIBA 3PL1A 4L50A 5ELLA 1BX3A 3PZBA 5EP1A 2NU6B 4OLBA 2A5YB 1SXPA 2VK2A 3NIGB 3JR7A 1M6EX 1DIOB 3KYDB 2O59A 1FUEA 1S7GA 4RETA 4MV0A 3REOA 2JDIA 3KZVA 4G67A 4IDNA 3RQSA 2WT8A 4G0OA 4QRHA 3RVQA 3VSBA 4KR0A 1ZGJA 4OXNA 3IKMB 1JAXA 4YREA 4OI1A 3I9V6 3W5CA 3QEKA 3OVMA 3N2KB 5CT9A 4CF5A 3C3CA 1NN0A 2FFRA 3WFIA 4BGEA 3G5TA 3L04A 3TL2A 1S8NA 1SIBE 4G5QA 4KPUA 4RY9A 1RRGA 1ZOSA 4H16A 5IK2A 3LU1A 2I6QA 1VRVA 4H59A 2GT1A 5DLEA 1T4CB 2XNDA 1ULAA 3CM0A 3H3FA 1NJ1A 2QG4A 2NO7A 3X43A 3N76A 2HC9A 4ROTA 3SEAA 3IE2A 3FJ1A 1CQIA 3GLHE 5CCEA 1IDN1 2Z04A 2WSLA 4M98A 5C32A 3I37X 2CLSA 4I6JA 3WK4A 4M0MA 3RS4A 1XTVA 5LOVF 4DM4A 2V9CA 3HBLA 3JQAD 2QMOA 2WG1A 2ZU0C 4OHVA 1V7CA 3AEYA 5GINE 3IOBA 4JJFA 3ZJUA 3NVDA 1R6UA 5FOXA 4TYWA 1T4MA 3G0IA 1RXIA 1REQA 1GL7A 2D62A 1I2CA 2PSFA 3BD6A 4JLSA 4R1NA 3TXAA 1RJDA 1P2UA 5AQ1A 1I4WA 4RKYA 4B7CA 4BNXA 3DOEA 1GA1A 1MAVA 3IKJA 5CBKA 1K88A 6ADHA 4G4GA 2EF1A 2GRJA 3SU8A 1M0EA 3O73A 4ZT7A 3VPAA 2YBEA 3KQHA 2ZR8A 1QYIA 1X7XB 4HFRA 3B6KA 3LXRA 1WUYA 4LG1A 5FOVA 3W7AA 1ID1A 1OHHD 1SJ9A 2MSDB 2X77A 4KQCA 4LQDA 5E8JA 5T4BA 3HUTA 5IVHA 4A16A 1D0SA 1JPUA 1I3CA 4KFUA 4TTTS 4I4TB 1OD6A 3EW9A 3MCWA 4NF2A 1SCQA 2BBSA 5E9AA 4AECA 3VHXB 3QELB 3TQSA 2I7CA 2O0MA 3FPEA 4LRTB 2EC5A 3W2TA 5JANA 2ZSEA 3GJQA 2ID7A 1N33B 4AZVA 3MK31 2VNJA 1C2TA 4IDCA 3AL2A 1HV8A 5I48A 5D84A 4MJ3A 4XH9B 2V7WA 2G76A 1SC4A 1EFTA 2D5LA 2D7DA 2RGYA 1WVMA 4KVGA 4YP7A 1OLSB 3DD5A 4V02A 1F2UA 1TTHA 4L8FA 2WK1A 3U4DA 5J5VA 1SUFA 2Q8NA 3ELYA 3PSHA 4MQFA 4TSKA 3HCPA 2GXAA 3ONDA 4ER5A 1JVSA 5EKTA 3RV4A 1YAJA 2HIAA 1AQYA 2GN0A 1A95A 2I3ZA 2VDKB 4XWTA 5FA6A 2BONA 4WACA 3STTA 3MNFA 4LC9A 3I05A 3FCUB 5CYGA 5JDCA 4UQLA 4KOAA 4QBTA 1YB4A 3FPCA 3KUXA 3SHFA 1PR0A 1MDBA 4BGVA 4MR7A 1KO1A 3GEDA 1DKUA 3JRNA 1GZVA 1XC7A 1IUKA 2MINB 2ONJA 3JZIA 4TVSA 5AW6A 2BTEA 2W2NA 3C45A 4K9DA 1DWUA 3ZEAA 1G21A 3GJXC 3IP9A 5DYIA 4ZCTA 5IJ9A 1YJ5A 3ON5A 2XUKA 3RU7A 2JIRA 3H2IA 3HUFA 2OQRA 1ODLA 3B1JA 3KTOA 4GQAA 2BI7A 3WKBA 3DT8A 3FIUA 2NUBA 5JASA 3FYSA 2RGNC 5HE8A 2DR0A 4OQNA 2TMGA 3CX7A 3SICE 1PWHA 3AP2A 4EX7A 1BOFA 2FZEA 1ESCA 2JCGA 1UXHA 2FCAA 3DTTA 1YL7A 4LRYA 2IZ5A 1GVNB 4JKOA 1FDWA 5AM4A 4MVCA 4HBZA 1MMFB 4EJSB 1Z5VA 1DTWB 4G56A 1Z88A 3GJRA 2B94A 3TQFA 4GPD1 3NO4A 1LDYA 1ZKDA 2CHEA 4NOMA 1ZIPA 2FPKA 1PJQA 2QSZA 3MS4A 1PQUA 2VPYA 3WFJA 3G6KA 3L0YA 4EITA 4LOLA 1K7SN 1VPWA 2X0KA 2ORYA 3S0JA 3NHJA 1E9AA 3FWPA 5JAPA 4J7UA 4KUGA 1GGKA 1Z6YA 2C96A 3WWYA 5JOQA 1W1UA 3LBIA 3NTXA 4YCDA 2C00A 4D9CA 5HX7A 3LT5A 2GKOA 4XSHA 2G1PA 3R6WA 4UTOA 4CZ2A 4U4AA 1GGEA 2ZJZA 3E5RA 1EXVA 1N6HA 3NJRA 2YZGA 3JQ7B 2PMBA 3EIUA 3RTGA 1C8BA 3OD5A 3CVVA 1C1XA 4WZBE 5AYVA 4D8UA 3IEMA 1EGHA 5KNDD 4HG2A 3OIUA 3NV9A 3C14C 1KYVA 2HSEA 1G6HA 3TVYA 1X77A 5HRAA 5J23A 2TMYA 1CWUA 5LYJA 3CH4B 1AF7A 3UMGA 2MSLA 3DZIA 3LW7A 3HDGA 5EQFA 5CT8A 4OGKA 5CG1A 5KHLB 2ZUTA 4DIFA 2EFJA 3MWGA 2CWWA 4L28A 5DZSA 3F49S 3HB7A 5KYVA 1P4RA 3OJEA 3JSAA 2YTZA 3PQFA 3KXLA 4PGFA 4UAUA 4X54A 2I91A 3TQIA 3DL4A 2O8NA 3DUFA 3FMFA 1J0DA 2R3SA 3R3ZA 2IPNA 4NU6A 1IN1A 2BFDA 2VXBA 3BBLA 4FFPA 1EFPA 3DMHA 4RJIA 4KYUA 3TI7A 2MR5A 3O7WA 3FDZA 4DA8A 3ZBPA 1K9VF 4HAWA 4YMSA 1IBMB 3M9LA 2CNWA 3OEEA 1UP7A 1FFDA 1GL9B 2AHRA 2REQA 3PGKA 4HAYA 4Y6OA 4AW9A 2J3LA 5KJ6A 3P2IA 3REGA 3A6LA 1NBOA 2QRVB 3NNDA 1IOZA 2ZVJA 5EJMA 3WGQA 3I2KA 1E5LA 4M46A 4B46A 1Y4AE 3FH0A 4O0MA 2CF6A 3I9LA 2I3AA 4NYIR 2OENG 4OU5A 4INAA 4K9LA 4QRDA 3VBEA 1NBWB 1VYTA 2O8EB 4PBRA 1JR4A 1CW2B 4E2ZA 3GEGA 1NATA 4M8SA 2A0KA 2PRZA 2OV2A 1EFCA 2GPWA 4BB6A 1Z4MA 4D3FA 5C4IA 4NK4A 2HU5A 1QS0A 1Y80A 1Y5RA 1EB9A 3WB1A 4UCWA 4MA0A 3AOEC 4DANA 2BUAA 1RHUA 3E03A 3HRHA 3K0FA 4PTYA 4RHYA 1FDIA 3H6GA 2OCLA 4JLBA 4TKUA 4AJEA 1WSBA 1YS1X 4CT0A 4XCQA 1FBTA 5F4BA 3QE3A 1TJ3A 1ZD4A 4AZSA 3QSGA 1COWD 1Q1AA 1R50A 1CNFA 1OPXA 3G17A 2QSYA 3NCTA 3NHFA 3QVVA 2IUUA 2VP9A 1H9CA 1DC8A 1AZLA 5ITWA 3PDIB 2GO1A 1YIOA 3KQMA 3DHWC 2V6MA 3DR5A 1ZAKA 4LYJA 1PQWA 4BAUA 3AM5A 2H7YA 3QXGA 2ZSDA 3VNSA 4QVIA 3KQUA 2SHKA 4HR7A 1SOUA 1EXDA 4NJEA 1QC5B 5MN4A 1JDUA 4PE5B 2PKWA 3A7EA 3O4VA 1N57A 1W76A 1HBJA 2AFHE 3KKEA 1POWA 3QP9A 4GS5A 2NPOA 4UMEA 4EI7A 1SD5A 1SHJA 5GVRA 3SLGA 4EY5A 3ZXIA 1CJBA 2DECA 1XZBA 4PLZA 2XLBA 4GYWA 1RW4A 3ESCA 2HMTA 1AF4A 2Z4SA 3X1KA 1KK3A 4MQ5A 4XFKA 2ZWIA 1TAQA 3IIEA 4P4SB 4F7DA 4I3HA 2HMVA 1DO2A 3PLNA 3LKZA 2Q6KA 4IJVA 4ZJPA 3MFQA 5CB4A 1JQEA 3E2MA 4JI7B 1HFKA 2R2AA 3ZGOA 2Q5IA 3SIRA 1AHPA 1FSSA 1IHDA 3MINB 1GNLA 1L4GA 4TUYB 4BP9A 4BOYA 1Z73A 2AX4A 2NTVA 5B1IA 3MCVA 3VC2A 2V4MA 2OBNA 4Y6SA 3E7WA 2VKQA 3DE5X 3VR5H 1U0JA 3DWGA 2R6AA 2Y05A 3KPYA 4P3PA 2PA3A 1TQHA 2RG1A 1TYAE 3ZBQA 8AT1A 2Z8YA 4HNSA 5DHAA 5EMJA 2NTJA 4QJ4A 2DFTA 3G2HA 1Z2DA 2P9YA 4BRUA 1QIMA 3ILXA 3GLGE 4CTJA 2J9FA 5K1ZA 4AJOA 4W5NA 2AYZA 3KPUA 5DWDA 4IGKA 4RBNA 1I10A 3CE9A 1X7YA 1L4UA 2B37A 4PBSA 4Q7EA 5IF9A 2C29D 4C20A 3BWDD 4AB1A 1DFGA 3FOAA 1ODFA 1TM5E 3OE5A 2VK1A 3AKYA 5CVJA 4EPVA 2E5FA 2XCSB 3QEMA 4IG4A 1G5IA 2CFSA 2XOEA 3FJOA 3MRVA 5KWEA 4IHQA 3HUUA 4NCIA 3TUZC 2P5SA 1QK5A 3OUTA 4HTFB 3KVOA 4GC5A 4IOJA 5H7XA 1IOWA 4PG8A 1GNSA 1IU9A 4B7XA 2XJ9A 1LPNA 3SZMA 3Q1LA 4UDXX 2CD9A 1GPKA 2HIHA 2Q07A 2GNAA 3SM9A 4RXMA 4EYEA 3SAJA 1H93A 3ISTA 4OGWA 4GO1A 4KSBA 4W99A 4FD2A 1AO3A 2GN1A 3Q40A 1EFLA 4OYHA 1IZ7A 2BGWA 1GQ2A 2IXBA 3MTDA 1PUJA 2XUPA 5IAGA 3SHQA 3HR8A 4PWZA 4EM6A 4YV2A 4D5EA 5E0OA 4UATA 5TEVA 4M1YA 3C1UA 3RG8A 2R751 1S01A 2G82A 3H2BA 2ZXEA 2PRSA 3KJNA 3E5MA 5DXFA 3BK1A 4C07A 3O5AA 2WJ4A 3CRVA 3KLMX 1DINA 4OAPA 1I7SB 3SZOA 1M8GA 2C2OA 1QIIA 2Y9MB 2QTTA 5HIJA 3FCAA 3PDWA 2ZKLA 1EVJA 1B23P 4GUAA 2NU9A 3O92A 1U2ZA 2WJYA 2IYPA 3GK3A 3WLIA 3D8TA 1DAMA 5B1DA 2AEEA 2HF9A 3AU9A 1SVNA 1ECGA 2WJ3A 3C0KA 3TAUA 1EBFA 2M6SA 3PNVA 3E35A 4M53A 2IPMA 3SXJA 2UZ1A 3EXFB 1XZJA 1NFFA 1X7DA 3U48A 1RE0A 3RHZA 5JVDA 2W2XA 4K0RA 5AKXA 3AG6A 3EQ6A 4MWCA 3LJKA 3GP5A 4P82A 1GPJA 3GLQA 3EGVA 4LBZA 1G2IA 1UIRA 2AFHA 2ZJOA 3S1AB 3S8YA 5LC1A 4JUIA 2ZT5A 3PPYA 2P4QA 2I9KA 2AKEA 4JN6B 1XMXA 3F5DA 2QUAA 3I5YA 3JAWA 4S12A 2YZMA 5CDYA 3OQ1A 4NFSA 3ZTYA 3PA8A 5ITZB 1QFJA 3NALA 4O08A 4RMJA 5IDQA 1QRDA 1LUAA 6REQA 3L1HA 1XD2A 2REOA 4MVJH 5I5GA 4EHJA 3CGGA 2NPFA 2C9ZA 4DCGA 2Z83A 1J39A 2NZXA 4TS4A 3NDPA 5BUZA 2P9ZA 4ZO9A 2VATA 3UJCA 3W3AA 3L7JA 5EE1A 3SVTA 1ZR2A 3MF4A 1WF3A 1TU0A 3QUAA 5AHRA 3M0EA 1LC3A 1Z6GA 2B2NA 2CEKA 2Q50A 3ND6A 5AI6A 5F5XA 5JNUA 2BAGA 3N7TA 3CH5A 1AGRA 1EX9A 2GJAA 2FHSA 4PEVA 3IHWA 4IEIA 2WHPB 2OXEA 1JXMA 3AH8A 1CV2A 1JEDA 4Y67A 1CZKA 4UJ5A 1JQLB 2AMJA 1HT0A 1Z35A 3CT6A 4MIYA 3L7OA 2WKPA 1RRVA 3VO2A 1MB4A 7YASA 2G67A 1GZDA 2V65A 2F4VB 1WZEA 2CE2X 1WIWA 4BQFA 3U56A 2JHAA 3EPRA 4WKOA 1VKJA 4HK4A 2VAMA 3KTAB 1EA7A 2B4KA 5ALEA 2FV8A 1I14A 5DDIP 2VHWA 3V7WA 5I47A 4N8EA 1G8YA 2XIJA 2VUTA 4QICA 1PI3A 5FKJA 4J49A 5F9MA 2IFTA 1A76A 2YHIB 4WZZA 4I4LA 3OHPA 1WXDA 1IG0A 2FFHA 5F12A 3GYGA 4LMBA 5EZ5A 4ZXPA 4KNYA 4GOND 3GRRA 4URHA 1UC5B 1ZOPA 2I1WA 2I6TA 4GOOD 1FUIA 1G8SA 2RHGB 4P5EA 1KOFA 3OM8A 2J3EA 4MWGA 2DERA 1SZPA 2Y1FA 1L7BA 5I5EA 1COZA 1PWZA 4CN8A 2VOJA 1NI4B 2W11A 4ZO8A 4IDFA 3IMGA 1P31A 1FMLA 2G9VA 3AFGA 5FPQA 4ARZB 4KXMA 5HGJA 1E1YA 2G88A 2EP7A 3QKWA 3N86A 4N18A 1FK8A 3W06A 3WL7A 2I4RA 3GR6A 1EH5A 1EFRA 1CJVC 3WYCA 2RK6A 4W9RA 1FIUA 1RYNA 2FPWA 2OG1A 3AR2A 3D6TB 1RQRA 1OWLA 3IDAA 1ZH2A 4GWKA 4JQCA 1ZPDA 3EXHB 5DU2A 3SXUB 2WP0A 4EGCB 1P4HA 1QHHA 3TQQA 5EJ8A 1VL5A 1XTSA 1BHQ1 1OSNA 3AHIA 3EUEA 3KKMA 1QKJA 4TPKA 4LFCB 3AEQB 3X1MA 4XE5A 3OTQA 3QFCA 4MLPA 1KSGA 3ZCRA 4D0SA 1Q57A 1WW2A 2W2KA 3AUUA 3LL4A 4WN9A 5FO0A 4Q3KA 3MG9A 4FYXA 2FNAA 2JGRA 3TCXB 4O6VA 5LP6A 2X22A 4QDXA 2QORA 1SCKA 1UH5A 3ZLTA 3L6CA 2FF5A 4LC1A 3H86A 3PRHA 1BXKA 1L4FA 1W8IA 1V35A 1MC5A 4AG5A 5CB6A 5HP4A 1YFKA 3P9CA 3L77A 3B48A 1L4HA 2KM1A 2G28A 2JAHA 2PLRA 3WGLA 5FOQA 3GLFB 3I2YX 2JI7A 1SVLA 4O2RA 4Y9TA 2Z08A 2YKGA 3FMIA 4FFNA 3UN1A 4EZEA 4KDRA 3M5CA 3OZBA 4WBSA 3T5TA 3RW9A 5AKGA 3T99A 4EG6A 4KR7A 4DA9A 5THKA 3EXIA 4M83A 4AI6A 3AWDA 5AO9A 3PXXA 3M6AA 3CKYA 4PLTA 2GWHA 2H63A 3OQBA 3RHFA 3IAM6 3NBXX 1SIOA 4LZAA 1H22A 1Y8AA 4RGBA 4Y2RA 5T4EA 2IV7A 1B2RA 4G07A 4YXFA 1KDRA 2QU7A 3I64A 2H3EA 1J5EB 3DHYA 4UTZA 1O96A 4EI2A 4PR0A 1FP2A 1W9HA 3T9CA 2PZBA 5EZSA 4DIKA 1C3JA 1DAOA 3GEMA 5J43A 2K2WA 2EKZA 4OLFA 2W70A 1VCHA 4QTYA 2PLFA 4JI4B 1OR8A 2ISSD 4ND1A 2WYHA 5KDOA 4E15A 3PQCA 2KPOA 3KDPA 2R8YA 5B36A 4N7JA 3OF5A 4LQLA 3TRDA 3GFSA 3HFRA 4GBED 4BLUA 4GEGA 4M0EA 1BMTA 4UMDA 4YRDA 1EBUA 1E69A 1PTKA 3OECA 3K0CC 5IS2A 1NYLA 2A0YA 2WIFA 3PX7A 3M6LA 5ALNA 3O9MA 3V4ZA 1YO6A 2ZE5A 4LX8A 3O4JA 3PQ7A 1A8IA 1VDMA 3ZHUA 2D0IA 2X8BA 4JP1A 2FDCA 4Z54A 2WJ6A 3A8TA 4LGMA 4S1OA 3JQGA 3NORA 2C57A 1XB2A 2ODQA 2QP9X 2FUG1 1LDBA 3D7NA 2NAPA 2X19A 1E7QA 2X1MA 2RC5A 1GD1O 4A36A 2H8GA 2F59A 4M8IA 4R8VA 1PD0A 1M73E 2JC3A 2ZPUA 1QVRA 4KUEA 2J09A 4QDTA 2B9VA 1EUCB 3PT5A 1RBYA 1Z45A 3QMMA 4JIMA 4EOGA 3OG9A 4ENTA 2BF7A 4HGOA 2IYLD 3U1VA 1KS2A 3HFJA 4RHCA 4C06A 1TE2A 3M3DA 2XZLA 4GI3A 3TMYA 4MW4A 1YUMA 4EKIA 3ITDA 5J4LA 1GYPA 3AVOA 1NFRA 4ND4A 1D0IA 2QXYA 3VDMA 1TAHA 3PHIA 1RXVA 3INNA 1DZIA 3N3AC 1E3WB 4PG6A 4RACA 3UY4A 3GNTA 4E94A 3HXLA 2O5EA 1N6IA 1RKUA 2WJAA 2AQKA 1RWXA 3CEPB 1UXJA 1XKQA 4U2FA 5CX1B 2O7SA 2HPAA 3HN6A 4COOA 1KHTA 5JJIA 1TJYA 1N1DA 3INGA 3K0EA 2IOFA 1YGPA 1X0VA 2NYRA 4K46A 4UMFA 3U2QA 2V8OA 4LRXA 4CIXA 2QJOA 2QBYB 1ZNYA 2B3DA 4J9UE 1QJ4A 1QLHA 2NXEA 3F98A 2ZATA 4YRPA 4J3FA 5LQRA 2YZ2A 3EN0A 1RLTA 4MA4A 2Q9AA 2FEXA 4LBYA 3UT6A 1A2QA 4GMXA 5E3JA 5FCDA 5I4BA 2Q6IA 4TN1A 1W75A 1S1MA 2KE5A 4O4HF 3TX2A 3TLGA 1BVUA 3NJ4A 4MYSA 4NABA 4OO3A 4EYQA 5DNCA 1PN3A 1XZDA 2GEJA 2JJMA 4P98A 3DOJA 1ISPA 4PQRA 1J20A 3DR3A 2CJXA 1GGHA 1H6CA 1CBUA 3MD9A 4W5TA 1LLFA 2IIVA 2EP5A 3GVPA 3LFTA 3G9TA 1NLUA 1SXJB 1D7AA 3QNWA 2FSIA 2IP2A 1XMVA 4GR5A 3T38A 5BUSA 1RAHA 4R01A 3FNBA 3WSTA 3P0IA 3C7CB 4ZIRA 4HXFB 3AHCA 3D7MA 1AQUA 1BDMA 1RPAA 5FPSA 1GCUA 4Y2YA 1POXA 1OXXK 3DLHA 1YMQA 4IFBA 3WG9A 1ZI9A 2ZTMA 4LSWA 4MUGA 4P7GA 1XDUA 4ZVKA 5IM5A 5BMVA 2O2CA 1U1CA 3L7YA 2MR6A 3IQDB 3UKJA 4FX2A 3RC2A 1XX6A 2L18A 1GSIA 1Z25A 5BMVF 3ZKAA 3C85A 3FAKA 2ADFA 4KYTA 2D1FA 4CGYA 3IRVA 1E3IA 2KI5A 3DMGA 2XZDA 3FVVA 2WYWA 2QTMA 2I6FA 3DM5A 3G2QA 4LYFA 2VP6A 3ZGZA 1HYBA 1QJCA 2AMVA 3EPPA 5TGZA 4WBNA 3C7AA 1QP7A 1GTG1 4HWPA 3PSAA 2BGTA 2FSVA 3SNHA 4C4OA 4Z9YA 2O5VA 4LF4B 4I1IA 3DM9B 4UM9D 2XOKA 3ESDA 1N8TA 3KHKA 4NECA 1IN6A 3EA4A 1JDVA 4BQIA 2EX4A 4G84A 4C7XA 4XWKA 3UFXA 1NE7A 1C0EA 4C87A 3KWLA 2ZDHA 1JUDA 3KQVA 1NN5A 1S3SA 4RF3A 4Q4CA 4KLNA 2B7BA 3LWZA 1RI4A 4BDSA 1XJ0A 2P79A 2CLMB 3BEDA 2GETA 3MFYA 3V00A 5BRAA 3EARA 5LZ2A 1NMSA 2R7KA 3GYBA 2IHVA 2VZ8A 3TTVA 2QGZA 4L9RA 2JLQA 4ZYYA 5AD1A 3AKZA 2AFHB 1LSSA 5CT6A 5EIXA 4CR6A 1KH3A 1XXHB 2C84A 3OIFA 4PCAA 2CLFB 5DYYA 3RSQA 3S55A 3PL5A 4BAZA 4E6EA 2QNBA 2X7JA 4E4YA 1BQEA 1QPGA 2EL9A 3I39X 4LJ8A 4KK4A 4AJ4A 1TKAA 3MTIA 2GBLA 2VS1A 3QVTA 4P3XA 4ZP1A 1NUPA 4W5HA 5YASA 2DPXA 1GTVA 2VDJA 1X38A 3LYUA 5BWCA 2Y67A 2A9KA 1TGVA 2Q3HA 2BJVA 2I2BA 2ZTVA 1EUDA 2W2QA 3N75A 3TXYA 3S40A 3GF4A 2NU8B 3RGWS 2WJIA 1MV8A 5HM6A 4U6NA 1ZOLA 3WGYA 1A98A 3QPVA 4URVR 4UOZA 2CV2A 1I6MA 2BM8A 1LBQA 3ELBA 4PF1A 2O8CB 2BTOA 3VU1A 3CW8X 4RESA 3K6SA 1OFUX 2EWVA 1TB4A 1VE9A 4L8LA 3ND5A 3HA5A 2PO5A 3L8CA 4GM0A 2EERA 4BMNA 1WLSA 4B73A 1ZMXA 5HF9A 5E2AA 3RBXA 3OURA 3NIFB 3MOIA 1WHTB 2I8CA 2B5VA 4P08A 1Y6GA 4M9SA 5JJLA 4FVTA 1IYZA 1OW3B 1H6BA 1L5MA 2FP4B 2Q0XA 3MJ4A 3OP1A 4TUYF 2A88A 4HLDA 1BH6A 3NRBA 1JHRA 3WBKA 1E20A 2NW6A 2P5YA 3FFBA 3VV2A 5BV7A 2HQRA 1B8NA 4CWAA 4F8JA 2V9ZA 5DGHA 4BX8A 3SVLA 4ZQBA 4D45A 4IDEA 1F2DA 3ZZ1A 1IC6A 1YCGA 1CU1A 1YR3A 3C4QA 3MGKA 3PCTA 3K0KA 3PIDA 4JBWA 4M21A 1OZGA 5FB3A 4BWFB 5C81A 1G5TA 1ZL0A 4MW2A 5LQUA 1T0HB 2IH2A 2I2CA 3Q9LA 1ETUA 1U1EA 3EE6A 5I4CA 4EGSA 2HQOA 3EDMA 4AF8A 5TMBA 2R87A 1UDCA 1Y8QA 3RRZA 1TF7A 4POAA 1VLHA 1DAGA 1EZ4A 3AEUA 3LSYA 3MINA 3BGDA 2QGFA 1NR7A 4MYCA 2IIQA 1WRBA 3DL7A 4BO7A 3I32A 4EGQA 3W90A 4D25A 3D5TA 3EG5A 4EO4A 1XQ1A 1QQ7A 3DKRA 3SFZA 3OZCA 4QU8A 4MP6A 2WU0A 2MT9A 4M9CA 1BFDA 3JRXA 4RL6A 1OXMA 1WKVA 2CL0X 2FN7A 2QTWB 2QTCA 3DZFA 3CNLA 3B3QA 4TTPA 1D8TA 1CG6A 1V25A 1I2DA 2BFBB 2QLJA 4MTCA 2QT0A 2C04A 3WLPA 5CK4A 1YB6A 4QE3A 1XKXA 1C1YA 3KEQA 1ZWLA 1HT2E 4IIJF 2DFVA 4ZTUB 3VPFA 1T13A 1EDDA 2A2ZA 1PDVA 4RJ2A 3BF7A 3SHOA 1DXOA 3QSYA 3IEVA 4ID9A 4DRZA 4JBLA 3ZGYA 1GDTA 1A9OA 1PNVA 1P0CA 1Q3HA 3F2IA 2XE7A 3CLUD 2FKAA 4MGKR 1PJSA 2ZS7A 5JSZA 5ICMA 5FUQA 1XPJA 3JQQA 5K0BA 4R7ZA 4IGEA 1R4NB 2ZWOA 3IAXA 3QVMA 1KMMA 4TUYA 5JI3E 2O2GA 2AJLI 1SVSA 4I3GA 3UV6A 2UUAB 1TJNA 1TIBA 4FI3C 5DN6A 1SOVA 3RT1A 2B9EA 4NKRA 2K6GA 1R6BX 3ZLJA 5K0JA 1L7PA 1PSWA 1DKOA 1V5IA 1CY4A 4FKZA 4HWGA 1GZ6A 3BXOA 3H0EA 1P5RA 1V3QE 1XP5A 1XAHA 2XTNA 4HZGA 1P3Y1 2RB4A 3FLAA 3OE1A 5REQA 1G64A 1RYMA 5J40A 2OMEA 5LA6F 3I6YA 5KREA 3LC0A 4P7BA 4HRVA 4QX6A 5E6RB 3AYXB 1LNZA 2Q3DA 4UFNA 3AR3A 4FSDA 1UC9A 2RGXA 4MWBA 4RTMA 1IZYA 2BKLA 4AKEA 4Q93A 2AOUA 3D54D 1QE5A 2ZAIA 4FYHA 4HH1A 4BXOB 4BJ6A 1JVBA 3IDZA 4AO7A 3WKDA 1WQ3A 2PIAA 1U31A 4QPNA 3WO0A 3WQBA 1GYRA 3A9UA 1RZ3A 4LMAA 3HJAA 4P6VF 2VQFB 1XF9A 1SUWA 4YMHA 2IY9A 3DUWA 2ILVA 5JS1A 2XCTB 4F8EA 3HGQA 2B78A 5FWDA 1JEJA 3LMKA 1NRIA 3BD7A 3QE9Y 1N5MA 3WV5A 1RQGA 1FDVA 2AN4A 2RGGA 4V39A 3V2UA 5CDHA 4AKGA 1J06A 4WRRA 4Z2YA 3PRJA 1ULTA 3UCEA 4C14A 1J07A 3UXMA 4BLQA 2QVZX 3SJCA 4TV9B 4RPHA 3ZWYA 1WUHS 5KVCA 3PNMA 3R1IA 3B2EA 5I9TA 4BNVA 1Z5WA 2GM3A 1EVZA 2H0AA 2RKBA 2J3DA 3GT4A 3GL9A 1TQ4A 1KOJA 2ZIVB 1J6UA 1BYIA 1V6AA 3VDXA 2IGBA 4UW9A 2AE1A 4KKVA 3F2VA 1QH1A 4PBTA 4YT8A 4NEGA 4ML3A 1H2WA 3IOCA 2PEYA 4IJ5A 4MKGA 4Y2TA 5DGTA 5KYNA 3PZRA 1Z4LA 5LMNB 3H5WA 1J25A 4MYHA 1M1ZA 4LMPA 3WMFA 5LOVA 1QGUB 2EG9A 3HYCA 1LA2A 4WA8A 1LX7A 1KXZA 1I80A 3BE6A 3G02A 4R8LA 4XGRA 5ED4A 2QPOA 1VXRA 1EK1A 1VSUA 4Y18A 5JJBA 5BRNA 4Q3NA 2FW6A 3VOSA 4B8YA 1N32B 4YP6A 4BO6A 3RYCA 4OSOA 3FFAA 5F7OA 1T8UA 2J6CA 2DHEA 3MSXA 4ITUA 1IN5A 1VLMA 3CINA 4CODB 3UPTA 5ABPA 1E66A 5L9AA 1XRJA 5EE9A 4NU0A 3SSNA 4W1SA 4NZOA 3X2EA 5BSVA 3TBKA 2LTAA 1LQTA 3P45A 1U7PA 2QRJA 5GM1A 3TR6A 2D5BA 2IBMA 5CU7A 3GEHA 4ECAA 2CVQA 2BGIA 1J8VA 1Y8RA 1THZA 5B58T 4TSFA 4EBFA 3BGIA 3GUYA 1NZFA 3ITKA 1US8A 4HUQB 1CFJA 1TQ6A 1K4YA 1SH7A 3BIWA 4J9VA 4X24A 4E30A 4ENQA 4UM9B 3QU2A 1AZTA 4I4IA 4MS3B 4G24A 2FVXA 2BM1A 1A8QA 3JQ7A 5IZCC 3ABQB 1HC7A 1JHUA 4MR8A 3RO7A 4BKQA 2JLVA 1CE8B 2HJWA 4WL0A 4MKFA 5AOBA 3THXB 3TLMA 2XQVA 4GECA 2DPMA 4E1VA 1DLIA 4X7BA 1SUSA 3K5HA 4OK6A 4I99A 4XIYA 5A6SA 1DGQA 2FWJA 3Q3GE 1TTTA 3QVJA 1VRWA 2YH2A 3BWVA 4TL7A 1ZK0A 4Z0NA 5A4MS 2X5OA 2CUNA 1W35A 4MEBA 5EUCA 5HUQA 1YRAA 3W9SA 1KQ3A 3D4LA 3ZE7A 3GZJA 1X7WA 3ZVNA 2BY4A 4HSEA 1KQPA 4L3WA 2JJ1A 2P65A 5CA0A 4KXYA 4OB6A 1KPGA 3G89A 4YV1A 1KGDA 4JLOA 4WLUA 1LH0A 2R79A 3WLJA 1MEOA 1KMCA 3CYFA 3P9SA 4EHBA 2V6GA 4RY8A 1Q1ZA 3ADPA 10MHA 3R40A 2A58A 3A1WA 3EEOA 4ICIA 2ZZMA 4HJXA 4DV3B 3HSYA 4ZQCB 3DZ8A 3RAJA 5THXA 3NM4A 1E9FA 4NULA 3TBHA 4DIBA 3I01A 4KXLA 4RJTA 1R4AA 4QBGB 1PR9A 4Q12A 3HBJA 4WNCA 3O9ZA 3CEJA 2Y6VA 1SZJG 4WKCA 4EY8A 2BCGY 1AMNA 1Z8HA 4B6FA 3CUWA 3Q7QA 1W88A 4R2XA 5BN4B 3H8JA 3RKUA 5I7FA 2BYTA 3JQRA 5GOZA 2P35A 4BECA 3EDYA 2VXYA 5HZKA 3EDRA 5FF9A 2AB0A 3I1FA 3QFSA 2IF0A 2AL7A 3WK5A 5K0NA 4PN3A 1RIFA 9LDTA 4YEDA 5KMGB 1RC1A 1FXSA 1GL3A 2Q0SA 1E1RD 4TRJA 1YDMA 1NVEA 3NVAA 4MB2A 1DWOA 3OD1A 5K09A 5A9TA 1UKBA 4MWSA 3M5PA 4KV7A 1ADCA 4ZU3A 5K8TA 1BN6A 3B7WA 4OIFA 4JH0A 4ALIA 5ADUS 4D99A 1EFDN 3NLLA 2H4WA 3EB9A 2XD9A 3LVFO 2JDID 4MV3A 2PX5A 1ZEJA 4JUCA 3LQRA 5HF8A 2YCLA 3LXMA 2JAWA 4K6KA 4J3NA 1HNZB 3DKVA 1P7WA 4CKEA 1QDEA 2DUMA 4JBGA 3QPWA 5A5DA 3I2JA 1J8QA 1JQ3A 2JGMA 4R7GA 2ZI9A 1TRKA 3AEXA 3GIWA 4DARA 4US0R 4Y8VA 2O4CA 2WAYA 4AF7A 1K08A 1DIGA 4EVSA 3SSAA 4CM9D 3KQLA 4O2AA 4NU8X 3O3MB 3ESXA 3V1MA 1PV4A 4L5BA 1RU3A 4DJDC 3LPNA 1L4NA 1NW3A 1P9WA 1T2DA 1ZH0A 1UKAA 2GN4A 1W94A 4A5OA 1QO7A 5A7HA 4NFYA 1HSOA 2VHZA 1SOAA 2WV7A 3GC6A 2XCQA 1W52X 1ONBA 2HADA 4FQ8A 4KXFB 1I01A 2JCYA 3TOVA 5HILA 4OYLA 1S9DA 1YB2A 4Y7DA 3U7EB 5CB4F 1LVGA 4WLOA 2V3CC 1G3IA 5B2FA 5GQSA 1YRQA 4YJFA 2QD5A 1QGZA 1Z74A 3HFSA 2CFIA 3QVUA 3TQTA 2PUBA 2QT9A 3H11B 5T67A 2PH5A 1QDLB 1TCCA 3KDAA 2BFFA 4HWKA 2QXUA 4O4HA 1RI1A 3ZE6A 4BLWA 2GYUA 2ZJ3A 3UUEA 3A58B 3VGPA 2UZ0A 3DEIA 1C4KA 3FRHA 3OSUA 4NEHB 3UMYA 3JQBA 4EA6A 2KJQA 4HGZA 1OAKA 2XF2A 3EZNA 2BKEA 4D41A 3HKCA 4ZOBA 3R6DA 1FXUA 3HUDA 3GG2A 4QBHA 1E1CA 3OKAA 5KKCA 2Y9PB 3FNQA 3A1DA 3MXOA 4C88A 1EVEA 2RAUA 1K27A 3ISJA 4MKZA 2RC6A 1U4OA 1I24A 4GLLA 3T5PA 3N87A 3UV3A 1QYCA 3RSFA 1AJEA 1AX9A 2CB9A 2W2OA 1YZYA 2VSQA 3CSDA 1ND5A 1W93A 3UPUA 2GAJA 4G1FA 2JLBA 3C3BA 3IULA 2WHPA 5LLDA 5CYFA 4CYMA 1QHXA 2EIXA 1T8RA 2GPYA 2M9MA 4EAQA 1RIIA 3MGCA 3W9UA 1UINA 1J5XA 2OM2A 3ODPA 1KY5A 4CCAA 4RQAA 1C0IA 5EL0A 3WBJA 4WTOA 4FP9A 4X1OA 2VSOA 4NXNB 4IKOA 4O4HB 2D1SA 3U31A 3K7EA 2KW5A 2QL5A 4KLAA 4EFDA 1PIWA 4K9SA 1M74A 4JT9A 3MTBA 5CUQA 4DT1A 5HIIA 2PX2A 2FZ4A 3S7ZA 2I62A 4AP9A 2NYUA 3OY2A 2GEFA 1RYFA 3F6SA 3KWFA 4CM8B 4DIMA 2O8DA 4UOQA 5CM2Z 3GELA 3FVTA 1SKMA 2VA9A 1L9KA 1N4DA 1TCVA 2FR8A 3L05A 4X64B 2WFMA 4B75A 3BIOA 5CB4B 1KJ9A 1GNTA 4L95C 5JZVA 2CMFA 2X8JB 1YOVA 2BKUA 1HA3A 2J1LA 4MMZB 4ZI5A 1LGYA 1YVDA 3FUUA 1YJ8A 1SUBA 2FR0A 2JD0A 4PG5A 5AUQA 5JLJA 2GCPA 2QD3A 1FTQA 2PX0A 1ENPA 5HBGA 1GKLA 2P77A 4ZEOA 1QFMA 4EW6A 1ISRA 1P7PA 4Z9BA 4BNGA 4GPEA 4IYJA 2UVDA 4GMGA 3PC6A 4CMCA 1TCUA 2TECE 2WICA 4F0JA 3AHDA 2ZWMA 3DPUA 4KE7A 4GVPA 2WIAA 1ZI8A 3IUYA 1QGDA 4OHOA 3RD5A 4KPUB 4ZKDA 1UWKA 2WHQA 1WVIA 2XLCA 1Q92A 1I32A 1XVIA 2IXAA 2JFVA 3G0DA 4JBYA 4RDHA 4MB0A 5GVSA 5LYJF 5EXDA 1NQXA 1JLLA 3TBFA 4QSMA 3UGKA 4RMGA 1BH2A 2EKDA 3KYBA 3OA0A 4OBWA 4UEQA 3UM9A 1JJ7A 3ZG6A 4BVHA 3QLUC 1IK6A 5K9ZA 3BWEA 5ES3A 3TNFA 3RJZA 2V7TA 1ISMA 1TMYA 5EJIA 3GLHB 5H9VA 1QZUA 5CFQA 2W4QA 3LTNC 4II3A 2XGJA 3FN4A 1QB7A 3F3MA 2DHRA 1P91A 1P2SA 5EXPA 5B3JC 1U81A 1DS6A 1M2VA 4URYR 2A1UA 5BOSB 4JI0B 4GC9A 1UWCA 3IAAA 2O1EA 3PUXA 2AF4C 4TMFA 3ID6C 4WLVA 4CMJA 4FS3A 2PLWA 2PV0A 3KOWA 3IT3A 5EWJA 1P5HA 1CR2A 3O8QA 5H81A 2XMQA 3JS5A 1ZMRA 2ZIXA 3L6EA 2EAUA 4YXWA 3QLEA 1PZMA 1UDRA 3KOYA 1SCDA 4IVRA 3A06A 4RSGA 3AIOA 3KUUA 2EHDA 2GWRA 3HY6A 4UBJA 5IYZA 1ZGZA 4RU1A 5K3BA 1WMFA 4JQZA 1N5KA 2O23A 1U7ZA 2HTEA 4NZYA 3EVDA 1FW6A 1I6KA 1XK7A 2OCAA 3EIQA 4PLHA 4QYIB 4CR8A 4EPRA 4IHJB 4G1BA 4PRYA 3PQ3A 4WOCA 3RBAA 4DCUA 2B1JA 4LBWA 4A8JC 5KYWB 2OZEA 4GP6A 3JATA 4H4EA 4JXKA 4GZ5A 4N9QA 2BR5A 4OBXA 3EXEB 5IZ4A 2BEVB 1DRJA 4DHWA 1V47A 4Q9LA 3VXKA 4KE8A 3TLKA 3ADDA 2WZQA 4A1FA 4EH1A 2CHQA 1U2GC 1TZKA 3EMKA 1YHYA 4IJWA 2QTGA 3KZOA 5DSTA 4B7ZA 4L5YA 2RH5A 4Q00A 5K20A 4LXXA 2JCXA 1HQDA 2RCNA 2Z8XA 4BNIA 4ES6A 1QU2A 2ZIXB 1ZD1A 5BT9A 4NBUA 1VZ2A 3BN3A 3R7WA 3VR6A 2QUKA 3TSZA 5ADVA 1IPFA 5DW0A 1AQNA 1L4BA 1A27A 1V8OA 5IRCD 4MWTA 1G6KA 1JQJC 3ZGVA 2A4MA 4U7DA 1CT9A 1Z16A 3BS4A 3UTCA 1ZDMA 3IH5A 2GF9A 4QUDA 1ZUNB 3UFXB 3PNKA 3HVIA 1EVIA 4V24A 1FC0A 4BMDA 1YQWA 5BWLA 5EHZA 4DV5B 3T3OA 1DB3A 3L4JA 4L6CA 3CX8A 1I9GA 5JPDA 5IT5A 2JIZA 3AYZB 2XXAB 1EBBA 3AR4A 4C6TA 1MA0A 3IPYA 4YO8A 4OGLA 4G41A 4C0JA 2BGLA 3BF8A 5IC6A 3B1FA 4RA6B 3QMWA 4XFDA 1R0BA 1FP4A 1IULA 521PA 3F1LA 3MMSA 4FX5A 4FZJA 3SDBA 4K9RA 1RLJA 5H68A 3Q1KA 4WKNA 5DXJA 4TWBA 1VHJA 4NSNA 1D9XA 4Y2PA 2YWJA 4NBNA 4E32A 4OX9Y 1FTYA 2ZRLA 2OD2A 1GCIA 3VM6A 2WF5A 1E1QD 3L41A 2I71A 3UWMA 3RYHB 1TEXA 4HQFA 3GFQA 2VN8A 2CNKA 2O06A 4O02B 4QUEA 4ZC8A 3B85A 5CDFA 4EP1A 2B34A 5A3RA 2OXFA 2QTNA 3AW8A 5DCLA 2H2WA 4D9NA 4LZLA 2MWMA 2ZJ7A 4TM7A 4F45A 5LP6C 2QRKA 2B21A 1IZ9A 3L5OA 1R2QA 1J8FA 5CCBA 1O96B 4RK5A 2GZ3A 3V2GA 1MNQA 1Y6ZA 4HAOA 4R2LA 2IYEA 3E58A 4ER0A 2YFKA 1KSHA 1NGSA 1GLNA 4KSYA 4AP6A 1JG6A 1KF0A 3TAXA 1PYGA 2HA6A 4XJTA 3QEJA 1ZOIA 3VR4D 2HJGA 4DIEA 4BB5A 4IV8A 4NFLA 1UKCA 3JU3A 1G3MA 2QN9A 2XWBF 2CMKA 4G2NA 4ACBA 3OQOA 3HL4A 2WZBA 1OWMA 2XRMA 4G8BA 4PSUA 4KAFA 1GGVA 2X1HA 3IPAA 4ZCMA 4JZKA 4MJXA 2QLFA 4C78A 2Q5HA 2X0EA 3V97A 1Y89A 4CR7A 1WXIA 1NG1A 1XU7A 2VDOB 4KYIB 4YI5A 2WILA 3W5IA 2AQ8A 4RCVA 2I6UA 1Z62A 1Y6JA 2QV7A 1RVDA 4TRRA 3RFTA 4QD3A 4DLRA 1L5QA 4EF5A 5IWCA 4NAVA 2UUOA 1FFWA 2JFUA 3GCGA 2ZJ6A 4ZVRA 1FLNA 5CDTA 1I0LA 5KAPA 1FSZA 1DJQA 1Y8RB 1YQ9A 2QJTA 3A2KA 4XTRA 5JCXA 1G38A 2AMLA 4H6XA 1PFVA 1AUOA 3QJGA 3R7FA 1I3OA 1EFPB 1I5EA 1KJZA 2R00A 4HFNA 1Z4KA 4MDYA 1L6RA 4CLOB 3PICA 3ICWA 1CE8A 4Q4LA 5CURA 3FXAA 3HP4A 3H2JA 3UHJA 4BASA 3OFJA 2RK3A 1KS9A 3ER8A 3V8BA 5IZCA 1VJRA 1DWPA 1VKNA 4C2UA 2C5LA 2D1RA 2ANBA 2POCA 3PUJA 1FW8A 3LX5A 4LKOA 5ALZA 3ZWCA 5KOHA 1PG5A 3FTCA 3O21A 3X1XA 1L7MA 2IDMA 3MUEA 3RVPA 3LLVA 4IPTA 2F64A 3A9WA 4A2QA 1GGFA 1XCLA 1U4SA 1O94D 3EQ7A 5F64A 4RZXA 3I28A 4O4JB 1T43A 3ZD9A 4OP1A 1KP3A 5G0UA 2LRHA 5JAQA 3CEAA 3WLRA 3JAMA 1MGOA 4NZPA 3LIIA 3K9LA 4ENSA 1RBMA 1KBOA 2MOKA 3G0OA 4RLFA 2IOHA 3A1VA 4IICA 3DZBA 3I04M 4JV5B 3DAOA 4TTRA 4BKRA 2R4TA 5BV0A 4QA9A 1O0CA 3SDZA 5M34A 3LA8A 4AYWA 4CLDA 5H16A 1U4NA 1ZK2A 2AH5A 4YMTA 5I8WA 3UJAA 1HM5A 3E82A 3TLBA 1FYFA 4YUWA 4RGQA 1XTBA 4BN0A 3PGMA 2WWGA 3ICCA 2IYNA 2E4WA 2WMYA 1KDOA 3A1CA 4O2LA 3J7AC 1B00A 1NX9A 2O9JA 2WNIA 4IIUA 4OTZA 3AM3A 3GAFA 4DPKA 2HREA 4OYYA 4PZCA 5EXXA 2PG3A 2K4MA 2QD2A 2QTZA 3FVQA 5E8RA 1DCTA 2P8SA 1SUDA 2I22A 3AOGA 3DSRA 1UIMA 2XI4A 1IJFA 3IFSA 2FPUA 3VO9A 4BEWA 2OFWA 4TSRA 1XLTA 4BEVA 3UPDA 2G07A 2EJCA 4K2HA 4HEHA 4LA4A 4Q48A 4HDSA 4WXEA 5EIBC 4DG9A 2PL3A 2GLUA 4GZMA 2VPWA 2RBEA 2CFRA 2PXCA 1YS7A 4IH1A 4LYYA 4P3KA 1EG7A 2X42A 2DMRA 4XM0A 4GSYA 5EUMA 1R6VA 4PNZA 3U7JA 5G0SA 1I4DD 2Z2IA 1XTIA 5JAUA 3VR3A 3F3YA 5CIWA 3MPUA 2C61A 2JIOA 2I6SA 3PC4A 3DEFA 1CUUA 1DNPA 1TUEA 3JQBC 1PP4A 3R5FA 4WCVA 5ITZA 2JPDA 2NUPB 5LQCA 4GRDA 5BXQC 4RC9A 4DA6A 3PYXA 1GDDA 2CL5A 4C0HA 3RVBA 3E6AA 1W0KD 1T2CA 1EWKA 4IVNA 2IXTA 1NJ5A 1XCBA 2GJKA 2RBKA 3NBFA 4WY5A 4BMPB 2PKRA 3I30X 3VZQA 1L5KA 3GQBA 4EAAA 1UR5A 3CHYA 2FWNA 3WQRA 1M8KA 4HGQA 1CUAA 1RM3A 3EGXB 2TMDA 2QZPA 3PLAE 2FH5B 4EECA 4FOSA 4AUKA 4CMEA 4M1OA 4B48A 3INYA 4KDEA 5IHXA 5KTMA 2FEPA 2BMFA 3L6BA 1CCWA 1LI5A 2JHPA 1XQVA 4J43A 3GFRA 5CW1A 2XE6A 3PNSA 3LL7A 2ZIGA 4OH1A 5L6LB 5G1OA 4YMIA 2DBZA 1HUQA 3O38A 3ORQA 1GP2A 1AHIA 1FYXA 3NBUA 3PFIA 2NOAA 4MUKA 2RI1A 3V8QA 3G2PA 1I2AA 2F7SA 4DR1B 3RU9A 1OV4A 2DUWA 3CCCA 3M4YA 4NHOA 4X65B 3T9EA 2XYGA 4N5LA 4NHEA 1UBTS 1QQ5A 1U8ZA 4F86A 3MEQA 3K71B 4FLEA 4J4BA 1NU6A 5KTKA 1Z75A 3CLHA 1FQKA 1MCZA 4RIGA 3MRSA 1SBTA 5LQMA 5AW0A 3KJZA 5DN6D 1A5SB 1UC8A 3A9CA 3TLYA 4JHLA 2NPIA 2CJPA 4F93B 1RDFA 3GP8A 2JZCA 4KQMA 1P4SA 2X9VA 3VJLA 3RBZA 3NAQA 1QFXA 3B6EA 1MH9A 2OFPA 1K6XA 3LC1O 2RCYA 1KETA 1O0SA 3C3EA 5D5QA 4FMCB 4IRMA 2PR2A 3UICA 1I7QB 3KETA 4B3IA 3AILA 1VPDA 4XWWA 1GPDG 1QWOA 1FF9A 3M6XA 4G01B 2WYIA 2P75A 2FPOA 4YV0A 2EBUA 1U2EA 4X93A 4Y98A 3R8CA 1DBWA 5TRTA 3U7HB 1P7ZA 3F1KA 1U7WA 4GL4A 1E89A 2WWRA 1OBHA 2G40A 3DBRA 2DFLA 3TIVA 3WHLA 3FSGA 1JFFB 3CZMA 4DV6B 4PY2A 2BP7A 1W9MA 4MSUA 4PGMA 4PWYA 5L3QA 3S81A 2G4VA 2Z98A 3ZIUA 4ND3A 1M0TA 1LI7A 1JV2B 3I73A 4HZIA 5EJGA 1TNDA 4PYOA 4QELA 5FUWA 2OK7A 1I33A 5IJWA 9LDBA 4U39A 4DLBA 3MZ0A 4HNTA 2B3TA 5KMGA 3AR8A 3HEMA 3HPQA 2EZUA 4CLHA 4BFLA 2SNIE 5KJ1A 1H5NA 1NA5A 4YGXB 5F2EA 4EBBA 4BDTA 2AEMA 4BV3A 2Q7DA 2NSYA 3D3WB 2OBLA 3IQIX 3EVNA 4KXNA 2OB1A 3EXAA 5C4GB 4C4PA 3HVJA 3A9TA 1T9DA 3L79A 1EX7A 4UQPA 4H3HB 2V3WA 2VF5X 1SU7A 1WO8A 4YONB 2G5GX 4DZRA 5HQ3A 1ID8A 4X0EA 1V16A 2FPIA 3PQ5A 2C2HA 1BKYA 1E2IA 2M6RA 4JVNA 3S1AA 5BRJA 2EFDB 3AJEA 2OGWA 3AVQA 13PKA 2QK4A 3AERB 3DFUA 1KVTA 2W48A 3OZAA 3QEBZ 3AX6A 3WK7A 4CDGA 4DV7B 3QY0A 4HLNA 3G5MA 4AUNA 3GLFE 1NVVR 5AMXA 5BSFA 2NXJA 3N8DA 3PX2A 3RM3A 4KPFC 2YWCA 1T91A 3BBPA 4LBVA 4BUZA 1FJGB 4RIIA 3KJEA 3KKNA 3I9MA 4AULA 1U0LA 2H1RA 1JZQA 2JKVA 3ANXA 1DXYA 4JHXA 4LUCA 5TC4A 5IFLA 2GERA 3BD9A 3BQMB 4LHWA 3QXCA 3STWA 2OV6A 1VPLA 4F38A 4UCQA 4UUBA 3G85A 3TCKA 3ZNOA 3GLIE 4CT5A 1V3VA 3IQXA 3NNSA 3EHEA 4YXWD 1Z2CA 1PS9A 1VYHA 1JI0A 3A2NA 4ZAFA 1UADA 4OV6B 2CLDX 2ZIFA 4BNFA 3BL5A 3I4LA 5BORA 2QY6A 3I53A 2AR0A 3Q6MA 4FN5A 4TWAA 2MDTA 3H1BA 5JCPA 5F98A 1ZICA 2VF4X 4C01A 1XIVA 1R64A 2C82A 3LYAA 2YWDA 5A05A 3RROA 1ELOA 2CNDA 2Q8QA 4YS6A 4UD6A 4CQMB 1CF2O 3IBSA 2IY7A 2R8XA 4X1YB 2DLDA 3PEYA 4URFA 2E4VA 4L4UA 3JQEA 3WGVA 1NHWA 2FRDC 4K9MA 3IVCA 2J9ZB 4RADA 8MHTA 1RTKA 2PEZA 3ET5A 1DMSA 2XWQA 2XPCA 4GGMX 3BCSA 3E3MA 4M49A 4LY9A 1HYEA 3DO6A 2FOIA 2Z6QA 1AGPA 5EJ5A 4PLVA 4NBSA 2C7OA 3PP8A 2AE2A 3MSCA 4DMGA 3D0KA 3E9DA 5JXWA 1PTJC 4H1WA 2PYDA 4GSLA 1P7VA 2CKDA 1U8UA 2PWPA 3K96A 4LN1A 3VZDA 5A3VA 3OM1A 4DDUA 3HG7A 2WSMA 5I3CA 3CVXA 2WUDA 2RHBA 1D6JA 5D87A 4B0PA 4K6FA 4PHTA 4WCFA 1H1TA 4RTPA 1LS6A 2AOWA 2YS7A 5DBGA 2HI0A 4ZARA 1GPLA 1MO5A 4U3JA 2FI1A 2YZ7A 1RQXA 3ADOA 3G2IA 3VAAA 2B2CA 3EXHA 3KZ1E 4R84A 1GFZA 1C41A 3ETNA 2FSUA 3OQVA 5H8WA 5BYJA 2CDNA 5CD9A 5D5PA 4RVSA 3RC8A 2GJSA 2GR9A 3S27A 1JG1A 4GR4A 2ZJYA 4BUCA 3VSAA 5MF6A 4XB6B 1DRVA 4RTQA 1QHSA 2BOVA 4PGAA 5JO9A 1E2PA 2AC2A 4G1VA 5IUNC 2XZOA 1M1YA 5A4DA 1XHEA 1ARZA 4OQMA 1T1JA 3RK1A 1SXQA 5CGQB 3BDVA 1ZY2A 2GJ8A 4HVAA 1U28A 3O0TA 3BZWA 3AHEA 1HLFA 1XWFA 2QRHA 4JU9A 4X7RA 1GTMA 1K7YA 1NJ8A 1T2AA 2XGSA 4BPRA 1ND6A 1U6JA 3GLGA 3GJZA 2IE0A 4HO1X 4DT1B 5IMBA 4OFBA 2RE8A 1SVUA 4KU4A 4R68A 4R2MA 1Z0SA 3LC2O 2Q4TA 3GRKA 4Z3DA 4ERXA 1A9YA 4GNRA 1EDBA 2HM7A 1Q2XA 1DXQA 4RE5A 4WZAE 2DFKB 4G5FA 4C5CA 3KQKA 1U7OA 3OMWA 3I09A 1YRBA 3PC8C 1G41A 1WD7A 2C2KA 3ABOB 1QOQB 1L5FA 1OYYA 2VQSA 2WTXA 2NVUA 3M1AA 4IJUA 2D54A 5B58C 5EJEA 5KWSA 2QTAA 4XR4A 4XWGA 3HCNA 4ATNA 1HDCA 5GIPE 1K89A 5FADA 3B7PA 3ABRB 3IKVA 2MCFA 3K9HA 3LOQA 5CLFA 1K7XB 2UKDA 1U2PA 2W71A 3IUSA 1UBMS 4NIMA 4L07A 5KSZA 2ZVPX 3F96A 3WOHA 1KYQA 1ZJWA 3JASB 5C5EA 1ZN2A 4FW8A 2ATXA 4URWR 1YBVA 5B1HA 4IIJB 4WK0B 3V6LA 1BVHA 1KWGA 1M7BA 2ECQA 3P7MA 2J08A 4OXKA 4DSNA 2FFAA 4YUZA 2CHVA 2Z3VA 4XJSA 2IU3A 3VKUA 1RSZA 4NNPA 4TKVB 4AJKA 4JD5A 2ZI6A 2A6PA 4MQEA 2DQKA 3MMXA 5FRDA 2PL5A 4BVKA 5AOCA 5ICFA 3AC0A 3ZYZA 3VPHA 3WGZA 2J48A 4I1RA 4ESEA 4FEYA 2XAUA 2F1JA 5THQA 3L1VA 4UPEA 1VMIA 5F3DA 3U80A 1Q1EA 5DLPA 4S3MA 4MUYA 1J1UA 2DH5A 2A14A 3QV2A 4YI3A 3FOWA 3ORYA 2QRMA 3AVUA 4WUTA 3VZRA 2XMCA 4US1R 4BJ1A 4HZUB 1CZLA 1ZISA 3ZDDA 5KEIA 5C18A 2QTRA 3L0ZA 2QTFA 1VLJA 1PZFA 3TS1A 5FPTA 2ZTLA 3MAAC 3CZAA 5I7EA 4CEHB 3R74A 2I3GA 4AXBA 4EB6B 4IH4A 4XOIA 4WFIA 4R0VA 5FWYA 4B3XA 1VKRA 3LPCA 3MCAA 3N6XA 1G8JA 3QXJA 4IUCS 1SG6A 4J0EA 5G53C 3ROPA 4CV0A 3FF4A 1BJKA 2DRIA 1Z2NX 3TKYA 2ZKIA 2XF8A 1W25A 2R2GA 3CF6R 5JH7A 4CEIA 1XLWA 2VPIA 2QZZA 3OA2A 3N53A 2FLWA 3DUFB 4LZZA 2FGKA 3OZUA 4QHYA 5K6AC 4FGSA 3LK6A 3SGLA 2FE4A 3L7NA 2QX9A 4LI3X 1RYHA 5HZMA 2H1OA 2EFEB 4CV1A 3D8NA 4UAGA 4LYEA 4DFDA 5E0KB 3HM2A 4KNWA 1E79A 3OQIA 1FMJA 4J0CA 5HIMA 1Y3BE 2GH1A 2X5JO 3QBVA 1S2IA 3PWTA 3AEUB 1C3OA 1B0ZA 2HXSA 5C80A 1MO4A 5ALXA 1NMYA 1YNOA 2FK7A 3ASVA 4MS1A 2L0XA 2VPTA 2F1HA 4NL4H 5E4FA 4LGVA 2B4AA 5JZOA 4TTJA 1WCYA 1VIMA 4LXIA 3ITEA 1BMFD 1IY0A 1CZHA 1ECBA 4KX3A 2B6NA 4UHHA 4EENA 1IAQA 1EIWA 5DT2A 2ZG6A 3KCNA 1QF7A 1KAOA 1L5HB 3O31A 4PC2A 2WIKA 3PPXA 5EE3A 4MP3A 1HZZC 5KQRA 2XYRA 3DHVA 1H2XA 1HKUA 1G20E 3HY4A 3KD2A 4TXHA 5NLLA 5HTOA 3O26A 3GAAA 3H2KA 3RSGA 3RNLA 1FX1A 3ENVA 3LCCA 4Q1AA 5AWFC 1PNOA 3PXEA 1M2NA 2PT5A 3COYA 5BPFA 1L5GB 1L7VC 1GRCA 1CZUA 1G8MA 4IOMA 2OCGA 2QGNA 4OPMA 2UZ4A 3AQ4A 3R9KA 4OU4A 4I5FA 5L4SA 3E1KA 5BVHB 3RT7A 4JSTA 3K20A 3SN6A 4C7KA 3EEIA 2HO5A 3HHEA 3Q98A 4JNKA 1B6RA 4EMTA 5CP8A 5IKOA 1E2KA 1N2JA 4BGIA 4QLBA 2VTBB 3TDKA 1IDOA 1KHHA 3FTDA 5A6SB 5C1IA 4NBRA 3F71A 2PRJA 4CLRA 4UTNA 4AN0A 4UUQA 3TLEA 1P3DA 1KY3A 4JDPA 3OLXA 5IYZB 1I3KA 3BXPA 2CUKA 4M9QA 5FBRB 1UFRA 3DBHB 4UNSA 5L3RA 3I9FA 3HC7A 1UMCB 4QYSA 4Q9JA 1Y34E 1W59A 3DMTA 4GX1A 4CM4A 2QPLA 4LOKA 4JP2A 1KRHA 3OICA 1A9ZA 3RRFA 3VV3A 4BGDA 1GAXA 4G0YA 3VH4A 3SS7X 5BOSA 1TADA 1BWRA 4O4LB 5TX7A 1ZXBA 4MYDA 3RANA 3RYIA 5TEWA 2WHEA 4KACA 3UYKA 4K8RB 1E6KA 3AWIA 4N0QA 3UWSA 1ULBA 3C8ZA 1XNJA 1DX4A 2RAVA 5E4YA 2RKWA 4QGHA 4E21A 4NRDA 1FRNA 2BI4A 4PYLA 4I1PA 3LQKA 3JPWA 5G3YA 2GYWA 1VECA 1LU9A 4OG2A 1ZN9A 2X7HA 2BKAA 2HA2A 2I66A 2JI8A 2VCYA 2Q7OE 3VX4A 1E9DA 1YRYE 4BLPA 2B1IA 3OFKA 4RDCA 5A3QA 2BEJA 2DWUA 4G9EA 1Z6XA 2PSJA 3JQ8B 2GXUA 5CT4A 5AVOA 5KWJA 1VSTA 1JAZA 4D97A 2YMMA 821PA 5B6JA 1RKVA 4GF5A 1GA4A 3RIYA 1HLGA 3KKZA 3BULA 4IJMA 3TW8B 1OU0A 4JR2A 1YS9A 1VE5A 4JLWA 2H2IA 3F7MA 1UBKS 2XGOA 2C4VA 2Z2JA 4MCHA 1XWIA 3DONA 3ECCA 4JLAA 5DF1A 2V5VA 2Y68A 3K5WA 1DQPA 1TEZA 5FNVB 3IBCA 2R6R1 3P2YA 2KYRA 2X15A 4PPGA 5L95A 4YJ2A 1DJMA 1FP4B 1I6WA 5AI4A 2X0JA 3JAWB 1O95A 1RM0A 3FTEA 4Q4HB 1HDYA 3E1SA 2M6KA 3KKKA 3UUFA 5JSFA 2YYYA 5C2JB 1L7AA 4AY5A 5CFZA 9ABPA 5EP3A 4OA5A 3VYUB 3VSEA 3ZD7A 3SEQA 4LQCA 3VH3A 4X61A 2IQIA 3DQPA 4M8KA 2YUTA 2ZULA 3KD3A 4JJ6A 4ZC1A 3VR3D 1X1SA 4EG8A 3HWX1 5LQNA 2QVXX 3RUFA 4QC2A 4IDGA 1V1MA 2WWWA 1XZEA 3IKTA 4GKAA 5G1PA 4CMAA 3OZWA 2FEWB 5AKHA 5FHRA 3WMWA 4ADSG 4FWTA 5IP5A 2OD9A 3ZU4A 5DGXA 3W5HA 1NP3A 3WRYA 4BXOA 4KR2A 4X5OA 1T5LA 4YCNA 4LSZA 5K0ZA 3UH1A 4L4YA 5IULC 1HE1C 3NYWA 4NMWA 4QT0A 2CUZA 1M75A 6Q21A 1E32A 4RTJA 4FM9A 2IUTA 4H9GA 1MKYA 3QFRA 1SWVA 2JI9A 4DMHA 1WQ1R 3IESA 3LUGA 1CNEA 3AIMA 5E1DA 4EHDA 2FMHA 4EKNB 5IJZA 3B1XA 2GEKA 5ECYA 1IHXA 4DSOA 3I6MA 4MS3A 3HO8A 4KX5A 3DMFA 3ZN2A 1ZIYA 4RM3A 4UTPA 5FPKA 1JDPA 2I7VA 3ILHA 2C4MA 3KR0A 1D5CA 3H87A 5KSOA 4JBHA 1QQTA 2I7TA 5DK4A 4YWJA 3HJNA 3LVBA 1WULS 1Z29A 2X5XA 3OTWA 4EO9A 5SY9A 2H7VA 2FFQA 4UVIA 5FA5A 3ZVLA 2P5UA 3EODA 3T9AA 2PWYA 1B2LA 4W9NC 5I9IA 1EIZA 2FETA 4I4TA 4L08A 2JGDA 4I81A 3RYFA 4EJMA 5IAJA 1KZHA 3IPXA 3QE2A 1FMCA 4Z1OA 2WFAA 5DNUA 1PKXA 1E5TA 3M6IA 3C3KA 3ROKA 4I9NA 4QOHA 3NI2A 4OHPA 2YC2C 2D3WA 3FLMA 3IAUA 2X40A 1E63A 3B52X 1QVAA 4XJXA 3WL6A 1GPBA 4OUDA 4CUKA 4WCFC 4GGOA 2H00A 4NNOA 3F8SA 3MJVA 3MWLA 2HHCA 5D2CA 4IQ4A 3HI4A 5D1NA 1G19A 3LLCA 1A97A 2YHSA 3LRXA 2VBFA 4MNTA 5IEBA 2GZHA 4NXMB 3JXEA 2C9BA 2J9YB 5CDSA 1N2CB 3H3JA 1OI4A 4M86A 4CEJB 1Z6QA 3V7UA 1OXTA 3UFBA 5JALA 5M2QA 5TDHA 2DFDA 4EUFA 1CC1S 4KQJA 1Y48E 4G1CA 4N6GA 3O8OA 2CHGA 2K7ZA 1O6GA 1NFQA 2JS7A 3W2FA 4E5NA 2W6JD 3OBIA 1J42A 4KP7A 4LCBA 5ES4B 3EPJA 1BDIA 1ML3A 4OFXA 1QYRA 1ADJA 2FFJA 1RYDA 4BQQA 2FRDA 2KBEA 3IPLA 1XJ5A 3ISVA 2Q0HA 3K94A 2YFYA 5EKSA 2BFMA 2QLLA 4L4ZA 3DGEC 1PEAA 1JEQB 2MYNA 3EXEA 3MPOA 3R3XA 2XGMA 2ZJ5A 3D3JA 3PFCA 2I03A 3M70A 4FDAA 4KW7A 1LV7A 2YNMC 3QPUA 4AZTA 4E2FA 1Y8ZA 2HK9A 3N8HA 3C6QA 4N7RA 2R8RA 1BC5A 5L3ZA 5AVQA 2X76A 1AS2A 4FGZA 3NM6B 2IYFA 4V1CI 3KQSA 4P4TA 1EP1B 3U3JA 2JAQA 2HN9A 3U7IA 3FPJA 5AKKA 1KI2A 4C7JA 4KIWA 4ZVNA 2JLZA 1HG0A 2AVDA 1AGXA 1OYWA 2VRBA 4GOKA 5EZ6B 4JB2A 1MB3A 4KB5A 4S1TA 1NOJA 1ZU4A 3T5CA 3ZUGA 2P2ZA 2A5JA 1IATA 2MHCA 2R97A 1YH3A 4HNAA 3KUDA 1NJGA 4RTNA 4Q3AA 2F90A 2FQXA 3ANNA 5CPBA 4AC9A 1W19A 4KQ2A 1S2GA 4FB5A 3LIPA 1XZGA 4TMWA 4C89A 1T36A 4TN5A 2ZXUA 4I36A 2DWQA 3QXXA 1FFYA 4OEHA 1QMGA 4MV6A 5DWVA 3ZU5A 5IABA 3KZXA 4GOLD 2HT6A 1K6EA 4GBJA 2GFIA 4JEHA 2JIMA 2ZE6A 3HZZA 4LK3A 3QBDA 4RPJA 4M1KA 1TO6A 4WPGA 4ZJYA 3E9MA 2DQZA 3D7LA 4C7VA 2JLSA 2VYVD 2VHVA 4DWVA 3CW2A 4F60A 3I9OA 1EUQA 1Z7EA 4JYAB 4AS2A 2IS4A 4D42A 2IEGA 4A92A 1VGRA 4CCYA 3E53A 4MRSA 1R6XA 3CJTA 3E9ZA 1R12A 3OJ0A 1DBPA 2VWQA 4XASA 1IHYA 3T1NA 3O8NA 4UD2A 2L19A 3X1DA 2H17A 4YQYA 4F46A 4KHZA 3U39A 7GPBA 1E6EA 3AVPA 1NT4A 3AR9A 3OCWA 3UGQA 2QAGC 3HKCB 3PNOA 2O0LA 4Q03A 3TGWA 5LU9A 4FDMA 4XRRA 4K9PA 3FKSA 4XQGA 1YKFA 3BK2A 3PJDA 1Q6YA 1OOEA 4PGGA 1ULUA 2DF8A 4EHHA 5EWLA 1JMKC 2FB9A 3VUFA 3BORA 4F6RB 4WK4B 1M8PA 2QLNA 4WKGA 4MIKA 2CYAA 3IUNA 4Y6PA 4D44A 2C42A 5E95A 3U0VA 4URUR 4LEIA 5JZSA 1ORDA 1V26A 4W9NA 4DNQA 2R7LA 4Q4HA 1VLZA 3DAYA 3BJMA 2NZ2A 4M7OA 4PONA 4E03A 1CJCA 2QRVA 2VDLB 1F2TB 4E08A 4N76A 4KR3A 3C70A 1XMOB 2VH1A 1QRTA 2MSCB 4TKVA 3DEZA 3TVTA 5CK5A 2C5BA 1QQ6A 1H2YA 1TXGA 2C5AA 2L69A 4JQYA 4LHVA 5SY6A 2R85A 4RIFA 5L4LA 3V4RA 3L9WA 1VMAA 2CNWD 3OEED 4O2AB 1NP6A 2FQQA 3BGOS 3GFVA 2ZQYA 1C3XA 4QDJA 1RI5A 2YQ4A 3QELA 1YI8A 4H7DA 2SBTA 3HEAA 5CDUA 5IKXA 4UE3S 3IQFA 5JRJA 1ZJYA 3V1KA 1RC0A 2WU8A 2AYYA 3S2IA 4OHMA 4QOEA 5GZ1A 2UAGA 2JW5A 2H9AA 4UHCA 5K0CA 3J81A 4A2CA 1SBIA 3MTQA 1OXUA 3INRA 1GPWB 2DPYA 1CLUA 1H3FA 2IUEA 1ZVQA 2Q5LA 3LBAA 1QKIA 1RCUA 3FYUC 1A71A 2O7QA 1MIOA 5SZKB 4KITB 2GCOA 4O2BA 1JKJB 1KO7A 3CO5A 5LKAA 2WY2D 2D4HA 2I76A 4AU1A 4GT1A 3FGNA 5JBNA 1Z7GA 1W4ZA 5SZIA 2J59A 1ADYA 4WZAA 3S29A 3AEKA 2OO5A 1VP9A 1NWHA 2AUMA 3N5KA 3PQEA 2XHEA 3T54A 1T2VA 1H42A 3SVZA 1R9MA 1PFQA 2OCBA 4HFMA 3CXUA 4TL6A 5D8DA 1OLOA 1M5TA 4MR7B 1S1CA 3NGMA 1CUGA 1EGMB 4FD3A 2IDZA 1YR7A 4FFBB 4PYMA 4YRKA 3U3MA 4OMFG 2WIBA 3RU3A 2WNHA 3C6XA 4QM7A 4GXTA 2HHJA 2NYVA 2ODPA 1ZMOA 3P2OA 2BELA 5JNTA 5EXEA 4LRSB 1J1ZA 4Y6RA 3HJCA 3PT9A 3T9BA 3ZQJA 5K0FA 2YWXA 3LH5A 3V7FA 4DS3A 2FEAA 3QQPA 4BC1A 4LRQA 2ZUFA 2WWHA 2W5UA 5FD8A 1UJ6A 3H1AA 2Z43A 4Q6BA 1JFFA 3FHCB 4QOGA 1WJGA 2ODAA 3QEOA 4FNOA 3QRWA 3U7RA 2BI8A 2DM6A 5KNCH 1XFDA 4CIAA 1A8HA 3RJ9A 1FNNA 3D2LA 3ACCA 4Z2AA 4C1NA 1TLFA 1T3TA 3A1FA 3WLEA 2OKCA 4BGUA 1FSGA 1R66A 2P0YA 1DHRA 3ME5A 3PF9A 4CM8A 5DV9A 1E58A 3ZIAD 3EPHA 4N5MA 4ZO4A 5DW3A 4BC0A 4F4CA 2C88A 4OHCA 3QBEA 5CVCA 1NBHA 2ZIUB 4AURA 4NYMR 5IM4A 4L8GA 3ZDRA 1GUBA 1ZJZA 1ORRA 1Y5LA 2V7QA 2Z1NA 3LUFA 4GDFA 4KREA 5H70A 1V48A 2C5HA 3FJYA 3FGZA 4OAOA 4ZVVA 3UIEA 4CQJA 3SWWA 1D2RA 3SBEA 3DHEA 3N2ZB 4JBIA 1ZRHA 1J09A 3NTQA 4IRUB 3GFTA 4ESOA 5E6SA 3I3OA 4QQKA 3DE0X 3DBIA 4INZA 2CEAA 4FWIB 5EY5B 2XNKA 4KQXA 5DLYA 3RAGA 3HVUA 2O50A 4DUYB 1M2KA 1NW4A 1RZVA 4AJ2A 1SEVA 5K8JB 3FVRA 3A4IA 7MDHA 1G60A 2LWIA 4A8HA 1Y3HA 1OFUA 3QUSA 1IBLB 1W85A 1XD9A 2OPBA 1VCMA 2AK3A 2MIIA 3GPCA 1LF5A 1AGYA 1UAGA 2H11A 2BFDB 2GI4A 2OCIA 1GG2A 3IUPA 4X20A 5DKFA 3WGGA 3CVJA 2F67A 4JELA 3L7AA 2B20A 1W6RA 3H75A 3JWHA 2FX2A 1V11A 1ZSYA 3FAZA 4P7FA 4PRZA 4Q21A 4X3CA 3ZX5A 2BHNA 4C6TB 1ODIA 1JQKA 4OQZA 3EGCA 4ZGWA 5KINB 1KFBB 2FDXA 4DLAA 1ACMA 1ODTC 2HBQA 1YQGA 4IUYA 4L72A 4XD2A 3UUWA 3OZVA 4QYWA 2DOKA 1OWPA 2R7MA 2XMDA 2YJTD 3AGPA 3STYA 4O8CA 3PNQA 3A9SA 5AW4A 3JALB 2HYIC 4FFVA 2HEIA 3LX8A 1JDTA 4WXHA 1PAUA 4JJ4A 4CRWB 1CDZA 4ON9A 3EC7A 4FMBB 4N12A 2XMZA 1Q20A 3ZCXA 4L8YA 3GLVA 4H3KB 4NBLA 1WXQA 4XDZA 3F73A 3MJTA 3JQAA 3Q3JB 1XEXA 2VEOA 2PQ6A 4PXSA 1CERA 1LRJA 1NLFA 4YPOA 4IILA 3P4UA 1BU5A 2OQVA 2FMFA 2JGNA 3A6EA 3HR4A 5L53A 1CUEA 2ACWA 3ESAA 4J3JA 4Y9DA 3QWBA 1VMKA 4D4GA 1OZHA 4P1ZA 3DULA 1HZJA 2X2PA 3DDSA 2YYSA 5NULA 4BRZA 3I9KA 4LGYA 3W7VA 1NVMB 1Q0TA 1IH8A 5K8UA 2OFOA 3PFNA 3FZNA 3CBGA 4MUIA 1N3BA 2GUWA 3I1JA 1L2TA 1MT0A 5JNWA 5TPZA 4JSYA 3R0QA 2D74A 3LDHA 4BNWA 3T3PB 1TEHA 3ZLVA 4ZZ0A 5FNVF 4LF7B 3A2MA 1HE3A 2I2XB 1RD4A 2A4KA 2Z2XA 4MYUA 1DFHA 3K70D 2QX8A 2FPPB 3E0QA 2YICA 2VPZA 2ZRNA 1X1BA 3RFXA 2YW9A 7AT1A 4GRAA 4MLCA 5EIAA 4TZKA 1AK2A 1O03A 2BUCA 3DFKA 5DCYA 3EZ2A 4KIJA 1CUVA 5JFGA 2Q6OA 1EYZA 1UM9A 2Z2KA 4RTLA 3NYQA 1M2WA 1YR6A 2HY7A 3FOZA 2WKWA 3GRCA 1QAMA 5LFAA 3UAVA 5KO2A 2BMJA 3SMQA 1G98A 3CGWA 3EC2A 3FNGA 1O5IA 1N2BA 1WKBA 4V38A 4HY3A 1D03A 4BVGA 4IX1A 3L46A 4C3VA 2ZBGA 1G20B 3N2IA 5FH9A 3TPFA 3PWZA 3BRWA 2XOKD 4LJYA 1OXBB 3WNCA 3HLYA 3CE6A 3UAYA 1X42A 4OKNA 1MHPA 3RU2A 3ETEA 3PPIA 3PTLA 1NSTA 4GKBA 4TVKA 4EI9A 1Z4QA 3EIFA 4KYVA 3ZDFA 3BIXA 3BSFA 1X8LA 5COQA 4R6WA 3M83A 4LNUA 2HU8A 4DWOA 5D1HA 2BDEA 3VPGA 3QUBA 4S1VA 1LWNA 4B9EA 3RIMA 5JTTA 1AKEA 4KWHA 4IHAA 1W4BA 2KBFA 4HV4A 2O1SA 4CUJA 2C54A 4JYZA 1URPA 4JUDX 1LVUA 1UJ2A 3FYHA 3MJEA 4N0DA 1SBZA 2AKYA 4L6IA 5T3UA 4QZVA 2CLLB 4G85A 3WIUA 3A0RB 2IU4A 4PZ0A 5KNCA 4U0KA 2CVFA 1F20A 3W5AA 4Z8YA 2PZEA 4PO1A 3GWGA 3IDOA 5JMOA 1NC1A 5JY1A 1G7SA 1UPCA 3ETHA 4HDKA 3RSOA 4B6EA 3KO8A 2PH1A 5H02A 1UBFA 3LWDA 4DM7A 4YUYA 4I6EA 4B40A 3NTLA 4RO0A 1L4KA 3QKRA 4HGPA 2EEPA 5CVVA 3T0GA 1DQSA 2IJGX 4LOAA 4QTZA 1NXSA 1ORWA 5FI0B 3CVYA 3CXRA 3OMXA 4FZ5A 2C4WA 2NO9A 2HWYA 5GIOE 2R44A 4RZIA 7REQA 1LKZA 1OTXA 3M1LA 4FYWA 1U6IA 3OQMA 2O3QA 1N5JA 1WUKS 1JQ5A 1R4NA 3KM0A 4ILEA 4L9SA 1OU4A 3QIAA 3MWDB 4GX0A 4Q18A 4LDRA 4DQ0A 1BWSA 2WHRA 2IHTA 3B3FA 5CA1A 1J7JA 2D8AA 1JLMA 4KAXA 4RTOA 2W7TA 2VNIA 3AKCA 3QU7A 4IXTA 4NMMA 5B30A 1CVRA 1MC8A 2NAFA 3PC8A 5C3UA 3ROTA 3CPSA 2F3QA 2WWYA 1GTL1 2VLIA 2J7PD 1M10A 1W47A 2VDMB 3ZOZA 2AOTA 5GMOA 4WUVA 4M2LA 3TRJA 3EIXA 4XLTA 1NXQA 4Z7QB 1T15A 4AP5A 1P39A 3T35A 4YMWA 2EX1A 5U9CA 4HL6A 4V0LA 2FG6C 4CIWA 4UNQA 3VR1A 1TO2E 5A5FA 4PLPA 3JTEA 3DLAA 3C6MA 2X1LA 3FB1A 1PGPA 4PLGA 1M67A 1NSYA 4R8MA 1IXRC 2D1TA 1CY6A 2FE1A 1WPXA 2VJMA 1WPQA 4YALA 4CTMA 1SKBA 2OWEA 1I7PA 1HURA 1PSZA 3H65A 4HUQA 4FSXA 1WA5A 4U7HA 4UCFA 1O94A 3KKOA 3VZBA 4KRFA 1H6AA 2ZUBA 5AJUA 1D07A 3T3HA 2DR3A 1E99A 1NMEA 1DIAA 1E77A 1L3BA 1X2BA 2PRYA 2KLHA 2OZKA 1K7EB 3F7NA 4Q9HA 4YDRA 4M89A 4ZGBA 2Q9CA 2WM8A 2X6TA 2YRFA 3L0SA 1W46A 3IP8A 3BJZA 4IXDA 4DUPA 3R7WB 3PYMA 4I2VA 3PDJA 5IH7A 4YLEA 4WERA 3VU8A 5A1TA 3O03A 2C5SA 3F5MA 5AJWA 3QVWA 1HX7A 1U8TA 2OESA 2YOGA 3C41J 5LA6B 3UHPA 3NKVA 5HKOA 4KSCA 3NHSA 5EEGA 4D5GA 2C2WA 1EFAA 2DFNA 2XVYA 3T1QA 4ZDJA 2ET6A 2QMUA 1OZ0A 3ZH9B 3EFHA 2VSXA 1AC5A 4TYMA 4Z4EA 1XHLA 1WXEA 3L7IA 4UDOA 5BR1A 1OC2A 1VL6A 5CHYA 2Y8EA 3V34A 1SQGA 2ZFUA 3RE1A 2IOYA 1PT6A 3MGAA 1V8BA 3P0EA 4LDPA 2AJBA 4XQ0A 2VWPA 5DRTA 3Q8LA 2DKFA 4MPJA 5AR1A 3AR5A 3KSDO 1LQ2A 4DV2B 3R5HA 4Y9UA 5LXTF 3AK4A 1WU8A 1X7HA 3DFZA 2IE8A 3QITA 1OXSC 1U7DA 4F04A 1YU6A 4CF6A 1N8SA 1P1HA 5AFSA 4WDRA 3IMEA 1Y3DE 4JVLA 5AI8A 3RG2A 1Q6ZA 4B6RA 1UBUS 1JXQA 2XADA 1G4UR 2XB4A 3BFPA 3D1VA 1MJHA 1MOPA 4EYGA 5JS6A 4O1HA 1JFLA 4S1NA 2DWPA 1UKVY 3I3SR 1K9SA 2VYQA 3NU1A 4I7EA 4BL5A 1C30B 2VZ9A 2QAGA 2XUJA 3RJTA 1SO8A 2GCIA 1I0ZA 3ED1A 1XHFA 4XVHA 1UDBA 5DMXA 4Y0NA 4ER6A 2RHOA 4IV5A 1I36A 1M9NA 4WESA 5C8YF 5KOJA 5KNDA 3OX1A 4LF9B 5ARDA 1E2LA 2E55A 3A6KA 2ZTSA 2AZTA 2OAQ1 1G3UA 1GR1A 1HZZA 3WRWA 4UQOA 2Q4RA 2PN1A 1SELA 3C3AA