2OHWA

Crystal structure of the yuei protein from bacillus subtilis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
128
structure length
128
Chain Sequence
b'EDKMDLYLQQGMYGPLETKPDERHLFLGSLRERVVLALTKGQVLRSKPYKEAEHELKNSHNVTLLINGELQYQSYSSYIQMASRYGVPFKIVSDLQFHTPLGIVIAADIAVNRELIYIQDDIYNRSVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YueI protein
molecule tags Structural genomics, unknown function
source organism Bacillus subtilis
publication title Crystal structure of the YueI protein from Bacillus subtilis
rcsb
total genus 37
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07997 DUF1694 Protein of unknown function (DUF1694)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2ohwA00
2OZBA 3G4SF 2QI2A 1W3EX 3OBWA 5FJ4C 3I55F 1JJ2F 5G4VC 2KTUA 3CCQF 3HAXD 3PLAC 1Q81H 2LBXA 2ALEA 1NMUB 3G6EF 1KD1H 1GZ0A 3J7AR 2QA4F 4BY9D 2WALA 3NMUC 3CC4F 3V7QA 2HVYD 1S72F 1Q86H 2VGNA 1YITF 1GO0A 5GIPC 2OTLF 2JNBA 4X3MA 3LWQC 3PAFA 3JAMM 1YJNF 3ON1A 3HJWC 3CMEF 2FC3A 3LWPC 5GANK 1YIJF 1VQ5F 1RLGA 3J80M 3CD6F 1RA4A 3J81M 3FFMA 3VI6A 3WXMB 1X7PA 2OHWA 5EO3A 3CG6A 3CC2F 1VQ7F 2QEXF 1VQLF 1VQ6F 5A2QM 3CCLF 2AIFA 1H7MA 3CC7F 3CCSF 3CCRF 3CCMF 3CCUF 1Q7YH 4C4WC 3N4YA 1VQ4F 2CZWA 1M90H 3CCEF 1VQOF 1VQ9F 1QVFF 3G71F 1K9MH 3E20B 3CXCF 1VQ8F 1CN7A 3LWRC 3NK6A 4NUTA 1PXWA 3CCJF 1W41A 1IPAA 1W42A 3E1YA 3I56F 3V7EA 3CPQA 1KQSF 1T0KB 3N4ZA 5G4UC 5DCVA 3SIVA 5GIOC 1M1KH 1X52A 1W2BF 3CPWF 2OTJF 3GYQA 2BO1A 3LFOA 3OBYA 1VQNF 1VQKF 5IT9M 3VMFB 1KC8H 3NK7A 3IR9A 1Q82H 3NVIB 1QVGF 1DT9A 2I6DA 3RA6A 1SDSA 5GINC 1YHQF 3CCVF 2VGMA 1CK2A 1K73H 2KTVA 1X7OA 2KG4A 3LWOC 1N8RH 1W40A 3O85A 1NJIH 5EWRA 3AGKA 1YJWF 1YI2F 5GAPK 1ZWZA 1VQPF 3CMAF 1GO1A 3JCMM 4TZZA 2LBWA 3RA5A 3LWVC 1E7KA 4LCKA 1XBIA 1K8AH 3MCAB 3OW2F 3NVKE 1VQMF 1YJ9F 4X3LA 4BW0B 5FLXM 3SIUA
chains in the Genus database with same CATH superfamily
3VCZA 4NWOB 2AIZP 5LOVB 3OBWA 4LNUA 5CB4A 2KTUA 4B46A 2GZLA 4KWEA 4O2BA 4U3JB 3S03A 5C8YB 3E22B 2WALA 3CC4F 3D00A 2I6RA 4DRXA 4RHAA 2Q1XA 4G4VA 3UT5A 5GIPC 3V3TA 3K0TA 4X3MA 1CLIA 4O4LB 3JAMM 1W581 3KJKA 5GONB 4ZI7B 3HKDA 3WJRA 3LWPC 2R6R1 1VQ5F 2Z1FA 2HQSC 1IV2A 5MN5A 4O4IA 3GTZA 3HKEA 1X7PA 4ZHWA 4TV9B 5EO3A 4ZOLA 3WGJA 5EAZA 4DXDA 2BTUA 5CA0A 5A2QM 2GVIA 5EZYB 3TD3A 5BMVB 3CCRF 5JVDB 3CCSF 5JCOC 3JARA 5MN6A 4BT2A 3CCMF 5EIBC 4C4WC 5LXTB 1VQ4F 1M90H 5EYPB 1YGYA 3I7TA 1VQ8F 3TD4A 1CN7A 1H47A 3FD5A 3CCJF 1PXWA 2VAPA 3KJJA 1PF5A 4G4ZA 2H8CA 5MN4A 1W5AA 3E1YA 3N2GA 3FPIA 3N4ZA 2VXYA 3SIVA 4X1IB 1X52A 1Z5VA 4TUYA 1H48A 3VIUA 1ODEA 2V9YA 4LNUB 3C9UA 3RYIB 2ZOVA 2IAFA 3CCVF 3MBMA 2VGMA 4RQOA 2RHJA 2BTQB 4R40B 2KTVA 4I55B 4O4HB 1COMA 5J2UA 3M84A 3O85A 2FGYA 3LMEA 2UZHA 1FSZA 5J2TA 1VQPF 5ITZA 1GO1A 2HS0A 3HWUA 1RLUA 1W5FA 3JATB 3LWVC 4LCKA 5IYZB 2CVLA 4G88A 3HKDB 3F0DA 3K14A 1VQMF 4X3LA 3GHZA 3SIUA 2HRUA 5CA1B 1UFYA 2RHOA 3RYCB 1JJ2F 3CCQF 4EI9A 3F0FA 2Z1UA 3PLAC 2YXZA 2LBXA 2ALEA 3G6EF 3C9TA 1KD1H 1GZ0A 5AVMA 3NMUC 2Z1EA 4O4HA 5KX5B 2HVYD 4X1YB 1YITF 5JQGB 2BTOA 2JNBA 2HP0B 3LWQC 3PAFA 4X20A 3DC2A 3JATA 3CMEF 3CYQA 4BVQA 5LP6A 3D54A 5GANK 3HKCB 3J80M 1W5BA 3VOAA 3J81M 3N2GB 3FFMA 4F6RA 4G4XA 3CG6A 5HY4A 1VQ7F 2K1SA 5LYJA 4I50A 2QEXF 3ZOPA 4BVTA 1VQ6F 4U3JA 3CC7F 2HS3A 4C8GA 1SA0B 3P4EA 3E22A 3JAWA 4EB6A 5IJ9A 2RB9A 1JFFB 3KHNA 2PHNA 4BT6A 1ONIA 3JAKB 5IJ0A 3TD5A 4IHJB 4X20B 3D01A 2OTJF 3C8LA 2R751 3LWRC 4NUTA 4XCQA 3MQWA 2KGWA 3Q8HA 4HNAA 5ITZB 1YQNA 3JVHA 3HKCA 1OAPA 4I4TB 4X1KA 3S0HA 4C8IA 4O4IB 3N2KA 3V7EA 3CPQA 1W5EA 3HKEB 1KQSF 4NQ3A 4YJ3B 5DCVA 2HS4A 5GIOC 1TVKA 3ERNA 3GYQA 2BO1A 3HKBA 2DYYA 5IT9M 3VMFB 2QTPA 3QHDA 3F0EA 1QU9A 2ZODA 1SDSA 3IEQA 3JALB 5FNVB 1CK2A 3RYFB 5HY0A 3FD6A 1W40A 3RYHB 4YJ2A 4IHJA 1TUBB 1NJIH 2CHTA 2LBTA 1YJWF 5JQGA 1IV4A 3CYPB 5HY1A 4TZZA 2GLZA 4O4LA 3RA5A 4I4TA 4X1KB 3KIZA 4ZHYB 5LP6B 3OW2F 1VH8A 3S0WA 2RHLA 2OZBA 4IIJA 2QI2A 4M8IA 3BYQA 3QTYA 5FJ4C 3I55F 4O2AA 5G4VC 5CA0B 5FNVA 1Q81H 1U43A 1SA0A 4BY9D 2H8EA 2YYEA 3V7QA 5BMVA 3RYHA 1RQ7A 1S72F 4YJ2B 3JARB 1W55A 2VGNA 3ZP7A 1U3PA 3K12A 5J2TB 2OTLF 3IMPA 3JAKA 1QAHA 3WGLA 5LP6C 3ON1A 2DT4A 5IYZA 2CHSA 2LCAA 1J7HA 1RLGA 1RA4A 3EORA 4O4JB 2AMTA 4B5CA 1JD1A 2G9IA 2OHWA 4ERHA 5EB0A 1Q8RA 3CC2F 4X1IA 1TVKB 3S06A 2UYKA 1XHOA 4TUYB 4O2AB 2HRYA 3VTIC 3S02A 2AIFA 4TV8B 2ZAUA 4FFBB 1T0AA 4DRXB 5LA6A 1GX1A 1SZQA 1W59A 1Q7YH 3P0ZA 3ZO8A 3N4YA 4I55A 1W57A 2HP0A 3CCEF 1VQOF 1VQ9F 1QVFF 3K2XA 2H6LA 3G71F 1JY8A 3E20B 3CXCF 1K9MH 5HY2A 3NK6A 4BT7A 1R1MA 3IKFA 2UYJA 1IPAA 2OTMA 4F6RB 1T0KB 2MQEA 5G4UC 3WGNA 1VHAA 5HWEA 1W2BF 3M4SA 3LFOA 3RE3A 5EB1B 2L26A 1FFXA 3NK7A 5LOVA 3F6MA 1VQVA 4C81A 1DT9A 2I6DA 3RA6A 5EZYA 5GINC 5JVDA 4O2BB 3LYBA 3IKEA 2ZF8A 1K73H 1FNJA 1X7OA 2KG4A 3LWOC 1N8RH 3ZP4A 5KX5A 5EYPA 2VAMA 4BVSA 1YI2F 2F9ZC 3UT5B 3R0PA 4HNAB 3KE1A 3F0GA 3M1XA 1KNKA 3VOBA 1E7KA 4BVRA 5HXZA 4ZI7A 3NVKE 1YJ9F 4YJ3A 2CSLA 5FLXM 4O4JA 5JCOA 1RQ2A 2ZVYA 3G4SF 4ZHQA 3T80A 1W3EX 3VYUC 4G4WA 4ZOLB 2IQQA 2Z01A 5LYJB 1QD9A 3RYIA 2HP3A 3CB2A 3HAXD 3ELCA 4E6EA 1NMUB 4TV8A 4FFBA 3J7AR 2QA4F 5J2UB 4BT3A 3VO8A 5LA6B 1Q86H 1TUBA 1XV2A 1XRGA 1GO0A 2B33A 3WGKA 1U40A 3ESJA 3VYSC 4C8EA 2HX0A 3QUWA 1YJNF 3HJWC 2FC3A 2W8BC 1YIJF 2ZVZA 3CD6F 2UYNB 3OONA 2NMUA 3N2KB 3VI6A 3WXMB 1DBFA 1Z5WA 2EWCA 3RYCA 3HTNA 3HKBB 1VQLF 3V4DA 1VK3A 3CCLF 3MCQA 3C9SA 1H7MA 1FFXB 5C8YA 3FBAA 2UYPA 3JALA 4X1YA 3WJQA 3RYFA 3CCUF 1NQ3A 2CZWA 2P6YA 4WBNB 5KMGB 4U39A 2CWJA 3B6NA 1JN1A 3JASA 3WPWA 2VAWA 5JH7B 2N48A 4BT4A 2PMPA 4BT5A 5GONA 5HP7A 4ZHVA 1W41A 5EIBD 2UYNA 3WPXA 1W42A 2Z1TA 3I56F 1U3LA 4TV9A 3WGMA 4C82A 5B8FA 1M1KH 3CPWF 1OFUA 3C9RA 3L7QA 4I50B 4IIJB 3I3FA 3U0OA 5CA1A 1UI9A 3OBYA 4EI7A 4ZHQB 1VQKF 1VQNF 3WJPA 4B45A 1KC8H 3IR9A 1Q82H 3S0YA 3NVIB 1QVGF 3JAWB 4EB6B 5CB4B 1YHQF 5IJ9B 1JFFA 2CW4A 4PWTA 3MDOA 5LXTA 4ZK7A 3P10A 1X25A 4B62A 4WBNA 5IJ0B 5KMGA 1FNKA 1IV3A 3JASB 3DDNA 5JH7A 5EWRA 4EI8A 3AGKA 5HP8A 5GAPK 2IG8A 1ZWZA 3IEWA 1IV1A 1KNJA 2RHHA 3CMAF 4G4YA 3JCMM 2LBWA 3VYTC 2Q1YA 1XBIA 3LDTA 1K8AH 3MCAB 4BW0B 5HXUA
chains in the Genus database with same CATH topology
2OZBA 3G4SF 2QI2A 1W3EX 3OBWA 5FJ4C 3I55F 1JJ2F 5G4VC 2KTUA 4EI9A 3CCQF 3HAXD 3PLAC 1Q81H 2LBXA 2ALEA 1NMUB 3G6EF 1KD1H 1GZ0A 3J7AR 2QA4F 4BY9D 2WALA 3NMUC 3CC4F 3V7QA 3D00A 2HVYD 1S72F 1Q86H 2VGNA 1YITF 1GO0A 5GIPC 2OTLF 2JNBA 3V3TA 4X3MA 3LWQC 3PAFA 3JAMM 1YJNF 3ON1A 3HJWC 3CMEF 2FC3A 4BVQA 3LWPC 5GANK 1YIJF 1VQ5F 1RLGA 3J80M 3CD6F 1RA4A 3J81M 3FFMA 3VI6A 3WXMB 1X7PA 2OHWA 5EO3A 3CG6A 3CC2F 5HY4A 1VQ7F 2QEXF 4BVTA 1VQLF 5A2QM 1VQ6F 3CCLF 2AIFA 1H7MA 3CC7F 3CCSF 3CCRF 3CCMF 3CCUF 1Q7YH 4C4WC 3N4YA 1VQ4F 2CZWA 1M90H 3CCEF 1VQOF 1VQ9F 1QVFF 3G71F 1K9MH 3E20B 3CXCF 1VQ8F 1CN7A 3LWRC 5HY2A 3NK6A 4NUTA 1PXWA 4XCQA 3CCJF 1W41A 1IPAA 1W42A 3E1YA 3I56F 3V7EA 3CPQA 1KQSF 1T0KB 4NQ3A 3N4ZA 5G4UC 5HWEA 5DCVA 3SIVA 5GIOC 1M1KH 1X52A 1W2BF 3CPWF 2OTJF 3GYQA 2BO1A 3LFOA 3OBYA 4EI7A 1VQKF 1VQNF 3VMFB 5IT9M 1KC8H 3NK7A 3IR9A 1Q82H 3NVIB 1QVGF 1DT9A 2I6DA 3RA6A 1SDSA 5GINC 1YHQF 3CCVF 2VGMA 1CK2A 5HY0A 1K73H 2KTVA 1X7OA 2KG4A 3LWOC 1N8RH 1W40A 3O85A 4BVSA 2FGYA 1NJIH 5EWRA 4EI8A 3AGKA 1YJWF 1YI2F 2F9ZC 5GAPK 1ZWZA 1VQPF 5HY1A 3CMAF 1GO1A 3JCMM 4TZZA 2LBWA 2GLZA 3RA5A 3LWVC 1E7KA 4LCKA 1XBIA 4BVRA 1K8AH 5HXZA 3MCAB 3OW2F 3NVKE 1VQMF 1YJ9F 4X3LA 4BW0B 5FLXM 3SIUA 5HXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OZB A;  3G4S F;  2QI2 A;  1W3E X;  3OBW A;  5FJ4 C;  3I55 F;  1JJ2 F;  5G4V C;  2KTU A;  3CCQ F;  3HAX D;  3PLA C;  1Q81 H;  2LBX A;  2ALE A;  1NMU B;  3G6E F;  1KD1 H;  1GZ0 A;  3J7A R;  2QA4 F;  4BY9 D;  2WAL A;  3NMU C;  3CC4 F;  3V7Q A;  2HVY D;  1S72 F;  1Q86 H;  2VGN A;  1YIT F;  1GO0 A;  5GIP C;  2OTL F;  2JNB A;  4X3M A;  3LWQ C;  3PAF A;  3JAM M;  1YJN F;  3ON1 A;  3HJW C;  3CME F;  2FC3 A;  3LWP C;  5GAN K;  1YIJ F;  1VQ5 F;  1RLG A;  3J80 M;  3CD6 F;  1RA4 A;  3J81 M;  3FFM A;  3VI6 A;  3WXM B;  1X7P A;  2OHW A;  5EO3 A;  3CG6 A;  3CC2 F;  1VQ7 F;  2QEX F;  1VQL F;  1VQ6 F;  5A2Q M;  3CCL F;  2AIF A;  1H7M A;  3CC7 F;  3CCS F;  3CCR F;  3CCM F;  3CCU F;  1Q7Y H;  4C4W C;  3N4Y A;  1VQ4 F;  2CZW A;  1M90 H;  3CCE F;  1VQO F;  1VQ9 F;  1QVF F;  3G71 F;  1K9M H;  3E20 B;  3CXC F;  1VQ8 F;  1CN7 A;  3LWR C;  3NK6 A;  4NUT A;  1PXW A;  3CCJ F;  1W41 A;  1IPA A;  1W42 A;  3E1Y A;  3I56 F;  3V7E A;  3CPQ A;  1KQS F;  1T0K B;  3N4Z A;  5G4U C;  5DCV A;  3SIV A;  5GIO C;  1M1K H;  1X52 A;  1W2B F;  3CPW F;  2OTJ F;  3GYQ A;  2BO1 A;  3LFO A;  3OBY A;  1VQN F;  1VQK F;  5IT9 M;  3VMF B;  1KC8 H;  3NK7 A;  3IR9 A;  1Q82 H;  3NVI B;  1QVG F;  1DT9 A;  2I6D A;  3RA6 A;  1SDS A;  5GIN C;  1YHQ F;  3CCV F;  2VGM A;  1CK2 A;  1K73 H;  2KTV A;  1X7O A;  2KG4 A;  3LWO C;  1N8R H;  1W40 A;  3O85 A;  1NJI H;  5EWR A;  3AGK A;  1YJW F;  1YI2 F;  5GAP K;  1ZWZ A;  1VQP F;  3CMA F;  1GO1 A;  3JCM M;  4TZZ A;  2LBW A;  3RA5 A;  3LWV C;  1E7K A;  4LCK A;  1XBI A;  1K8A H;  3MCA B;  3OW2 F;  3NVK E;  1VQM F;  1YJ9 F;  4X3L A;  4BW0 B;  5FLX M;  3SIU A; 
#chains in the Genus database with same CATH topology
 3VCZ A;  4NWO B;  2AIZ P;  5LOV B;  3OBW A;  4LNU A;  5CB4 A;  2KTU A;  4B46 A;  2GZL A;  4KWE A;  4O2B A;  4U3J B;  3S03 A;  5C8Y B;  3E22 B;  2WAL A;  3CC4 F;  3D00 A;  2I6R A;  4DRX A;  4RHA A;  2Q1X A;  4G4V A;  3UT5 A;  5GIP C;  3V3T A;  3K0T A;  4X3M A;  1CLI A;  4O4L B;  3JAM M;  1W58 1;  3KJK A;  5GON B;  4ZI7 B;  3HKD A;  3WJR A;  3LWP C;  2R6R 1;  1VQ5 F;  2Z1F A;  2HQS C;  1IV2 A;  5MN5 A;  4O4I A;  3GTZ A;  3HKE A;  1X7P A;  4ZHW A;  4TV9 B;  5EO3 A;  4ZOL A;  3WGJ A;  5EAZ A;  4DXD A;  2BTU A;  5CA0 A;  5A2Q M;  2GVI A;  5EZY B;  3TD3 A;  5BMV B;  3CCR F;  5JVD B;  3CCS F;  5JCO C;  3JAR A;  5MN6 A;  4BT2 A;  3CCM F;  5EIB C;  4C4W C;  5LXT B;  1VQ4 F;  1M90 H;  5EYP B;  1YGY A;  3I7T A;  1VQ8 F;  3TD4 A;  1CN7 A;  1H47 A;  3FD5 A;  3CCJ F;  1PXW A;  2VAP A;  3KJJ A;  1PF5 A;  4G4Z A;  2H8C A;  5MN4 A;  1W5A A;  3E1Y A;  3N2G A;  3FPI A;  3N4Z A;  2VXY A;  3SIV A;  4X1I B;  1X52 A;  1Z5V A;  4TUY A;  1H48 A;  3VIU A;  1ODE A;  2V9Y A;  4LNU B;  3C9U A;  3RYI B;  2ZOV A;  2IAF A;  3CCV F;  3MBM A;  2VGM A;  4RQO A;  2RHJ A;  2BTQ B;  4R40 B;  2KTV A;  4I55 B;  4O4H B;  1COM A;  5J2U A;  3M84 A;  3O85 A;  2FGY A;  3LME A;  2UZH A;  1FSZ A;  5J2T A;  1VQP F;  5ITZ A;  1GO1 A;  2HS0 A;  3HWU A;  1RLU A;  1W5F A;  3JAT B;  3LWV C;  4LCK A;  5IYZ B;  2CVL A;  4G88 A;  3HKD B;  3F0D A;  3K14 A;  1VQM F;  4X3L A;  3GHZ A;  3SIU A;  2HRU A;  5CA1 B;  1UFY A;  2RHO A;  3RYC B;  1JJ2 F;  3CCQ F;  4EI9 A;  3F0F A;  2Z1U A;  3PLA C;  2YXZ A;  2LBX A;  2ALE A;  3G6E F;  3C9T A;  1KD1 H;  1GZ0 A;  5AVM A;  3NMU C;  2Z1E A;  4O4H A;  5KX5 B;  2HVY D;  4X1Y B;  1YIT F;  5JQG B;  2BTO A;  2JNB A;  2HP0 B;  3LWQ C;  3PAF A;  4X20 A;  3DC2 A;  3JAT A;  3CME F;  3CYQ A;  4BVQ A;  5LP6 A;  3D54 A;  5GAN K;  3HKC B;  3J80 M;  1W5B A;  3VOA A;  3J81 M;  3N2G B;  3FFM A;  4F6R A;  4G4X A;  3CG6 A;  5HY4 A;  1VQ7 F;  2K1S A;  5LYJ A;  4I50 A;  2QEX F;  3ZOP A;  4BVT A;  1VQ6 F;  4U3J A;  3CC7 F;  2HS3 A;  4C8G A;  1SA0 B;  3P4E A;  3E22 A;  3JAW A;  4EB6 A;  5IJ9 A;  2RB9 A;  1JFF B;  3KHN A;  2PHN A;  4BT6 A;  1ONI A;  3JAK B;  5IJ0 A;  3TD5 A;  4IHJ B;  4X20 B;  3D01 A;  2OTJ F;  3C8L A;  2R75 1;  3LWR C;  4NUT A;  4XCQ A;  3MQW A;  2KGW A;  3Q8H A;  4HNA A;  5ITZ B;  1YQN A;  3JVH A;  3HKC A;  1OAP A;  4I4T B;  4X1K A;  3S0H A;  4C8I A;  4O4I B;  3N2K A;  3V7E A;  3CPQ A;  1W5E A;  3HKE B;  1KQS F;  4NQ3 A;  4YJ3 B;  5DCV A;  2HS4 A;  5GIO C;  1TVK A;  3ERN A;  3GYQ A;  2BO1 A;  3HKB A;  2DYY A;  5IT9 M;  3VMF B;  2QTP A;  3QHD A;  3F0E A;  1QU9 A;  2ZOD A;  1SDS A;  3IEQ A;  3JAL B;  5FNV B;  1CK2 A;  3RYF B;  5HY0 A;  3FD6 A;  1W40 A;  3RYH B;  4YJ2 A;  4IHJ A;  1TUB B;  1NJI H;  2CHT A;  2LBT A;  1YJW F;  5JQG A;  1IV4 A;  3CYP B;  5HY1 A;  4TZZ A;  2GLZ A;  4O4L A;  3RA5 A;  4I4T A;  4X1K B;  3KIZ A;  4ZHY B;  5LP6 B;  3OW2 F;  1VH8 A;  3S0W A;  2RHL A;  2OZB A;  4IIJ A;  2QI2 A;  4M8I A;  3BYQ A;  3QTY A;  5FJ4 C;  3I55 F;  4O2A A;  5G4V C;  5CA0 B;  5FNV A;  1Q81 H;  1U43 A;  1SA0 A;  4BY9 D;  2H8E A;  2YYE A;  3V7Q A;  5BMV A;  3RYH A;  1RQ7 A;  1S72 F;  4YJ2 B;  3JAR B;  1W55 A;  2VGN A;  3ZP7 A;  1U3P A;  3K12 A;  5J2T B;  2OTL F;  3IMP A;  3JAK A;  1QAH A;  3WGL A;  5LP6 C;  3ON1 A;  2DT4 A;  5IYZ A;  2CHS A;  2LCA A;  1J7H A;  1RLG A;  1RA4 A;  3EOR A;  4O4J B;  2AMT A;  4B5C A;  1JD1 A;  2G9I A;  2OHW A;  4ERH A;  5EB0 A;  1Q8R A;  3CC2 F;  4X1I A;  1TVK B;  3S06 A;  2UYK A;  1XHO A;  4TUY B;  4O2A B;  2HRY A;  3VTI C;  3S02 A;  2AIF A;  4TV8 B;  2ZAU A;  4FFB B;  1T0A A;  4DRX B;  5LA6 A;  1GX1 A;  1SZQ A;  1W59 A;  1Q7Y H;  3P0Z A;  3ZO8 A;  3N4Y A;  4I55 A;  1W57 A;  2HP0 A;  3CCE F;  1VQO F;  1VQ9 F;  1QVF F;  3K2X A;  2H6L A;  3G71 F;  1JY8 A;  3E20 B;  3CXC F;  1K9M H;  5HY2 A;  3NK6 A;  4BT7 A;  1R1M A;  3IKF A;  2UYJ A;  1IPA A;  2OTM A;  4F6R B;  1T0K B;  2MQE A;  5G4U C;  3WGN A;  1VHA A;  5HWE A;  1W2B F;  3M4S A;  3LFO A;  3RE3 A;  5EB1 B;  2L26 A;  1FFX A;  3NK7 A;  5LOV A;  3F6M A;  1VQV A;  4C81 A;  1DT9 A;  2I6D A;  3RA6 A;  5EZY A;  5GIN C;  5JVD A;  4O2B B;  3LYB A;  3IKE A;  2ZF8 A;  1K73 H;  1FNJ A;  1X7O A;  2KG4 A;  3LWO C;  1N8R H;  3ZP4 A;  5KX5 A;  5EYP A;  2VAM A;  4BVS A;  1YI2 F;  2F9Z C;  3UT5 B;  3R0P A;  4HNA B;  3KE1 A;  3F0G A;  3M1X A;  1KNK A;  3VOB A;  1E7K A;  4BVR A;  5HXZ A;  4ZI7 A;  3NVK E;  1YJ9 F;  4YJ3 A;  2CSL A;  5FLX M;  4O4J A;  5JCO A;  1RQ2 A;  2ZVY A;  3G4S F;  4ZHQ A;  3T80 A;  1W3E X;  3VYU C;  4G4W A;  4ZOL B;  2IQQ A;  2Z01 A;  5LYJ B;  1QD9 A;  3RYI A;  2HP3 A;  3CB2 A;  3HAX D;  3ELC A;  4E6E A;  1NMU B;  4TV8 A;  4FFB A;  3J7A R;  2QA4 F;  5J2U B;  4BT3 A;  3VO8 A;  5LA6 B;  1Q86 H;  1TUB A;  1XV2 A;  1XRG A;  1GO0 A;  2B33 A;  3WGK A;  1U40 A;  3ESJ A;  3VYS C;  4C8E A;  2HX0 A;  3QUW A;  1YJN F;  3HJW C;  2FC3 A;  2W8B C;  1YIJ F;  2ZVZ A;  3CD6 F;  2UYN B;  3OON A;  2NMU A;  3N2K B;  3VI6 A;  3WXM B;  1DBF A;  1Z5W A;  2EWC A;  3RYC A;  3HTN A;  3HKB B;  1VQL F;  3V4D A;  1VK3 A;  3CCL F;  3MCQ A;  3C9S A;  1H7M A;  1FFX B;  5C8Y A;  3FBA A;  2UYP A;  3JAL A;  4X1Y A;  3WJQ A;  3RYF A;  3CCU F;  1NQ3 A;  2CZW A;  2P6Y A;  4WBN B;  5KMG B;  4U39 A;  2CWJ A;  3B6N A;  1JN1 A;  3JAS A;  3WPW A;  2VAW A;  5JH7 B;  2N48 A;  4BT4 A;  2PMP A;  4BT5 A;  5GON A;  5HP7 A;  4ZHV A;  1W41 A;  5EIB D;  2UYN A;  3WPX A;  1W42 A;  2Z1T A;  3I56 F;  1U3L A;  4TV9 A;  3WGM A;  4C82 A;  5B8F A;  1M1K H;  3CPW F;  1OFU A;  3C9R A;  3L7Q A;  4I50 B;  4IIJ B;  3I3F A;  3U0O A;  5CA1 A;  1UI9 A;  3OBY A;  4EI7 A;  4ZHQ B;  1VQK F;  1VQN F;  3WJP A;  4B45 A;  1KC8 H;  3IR9 A;  1Q82 H;  3S0Y A;  3NVI B;  1QVG F;  3JAW B;  4EB6 B;  5CB4 B;  1YHQ F;  5IJ9 B;  1JFF A;  2CW4 A;  4PWT A;  3MDO A;  5LXT A;  4ZK7 A;  3P10 A;  1X25 A;  4B62 A;  4WBN A;  5IJ0 B;  5KMG A;  1FNK A;  1IV3 A;  3JAS B;  3DDN A;  5JH7 A;  5EWR A;  4EI8 A;  3AGK A;  5HP8 A;  5GAP K;  2IG8 A;  1ZWZ A;  3IEW A;  1IV1 A;  1KNJ A;  2RHH A;  3CMA F;  4G4Y A;  3JCM M;  2LBW A;  3VYT C;  2Q1Y A;  1XBI A;  3LDT A;  1K8A H;  3MCA B;  4BW0 B;  5HXU A; 
#chains in the Genus database with same CATH homology
 2OZB A;  3G4S F;  2QI2 A;  1W3E X;  3OBW A;  5FJ4 C;  3I55 F;  1JJ2 F;  5G4V C;  2KTU A;  4EI9 A;  3CCQ F;  3HAX D;  3PLA C;  1Q81 H;  2LBX A;  2ALE A;  1NMU B;  3G6E F;  1KD1 H;  1GZ0 A;  3J7A R;  2QA4 F;  4BY9 D;  2WAL A;  3NMU C;  3CC4 F;  3V7Q A;  3D00 A;  2HVY D;  1S72 F;  1Q86 H;  2VGN A;  1YIT F;  1GO0 A;  5GIP C;  2OTL F;  2JNB A;  3V3T A;  4X3M A;  3LWQ C;  3PAF A;  3JAM M;  1YJN F;  3ON1 A;  3HJW C;  3CME F;  2FC3 A;  4BVQ A;  3LWP C;  5GAN K;  1YIJ F;  1VQ5 F;  1RLG A;  3J80 M;  3CD6 F;  1RA4 A;  3J81 M;  3FFM A;  3VI6 A;  3WXM B;  1X7P A;  2OHW A;  5EO3 A;  3CG6 A;  3CC2 F;  5HY4 A;  1VQ7 F;  2QEX F;  4BVT A;  1VQL F;  5A2Q M;  1VQ6 F;  3CCL F;  2AIF A;  1H7M A;  3CC7 F;  3CCS F;  3CCR F;  3CCM F;  3CCU F;  1Q7Y H;  4C4W C;  3N4Y A;  1VQ4 F;  2CZW A;  1M90 H;  3CCE F;  1VQO F;  1VQ9 F;  1QVF F;  3G71 F;  1K9M H;  3E20 B;  3CXC F;  1VQ8 F;  1CN7 A;  3LWR C;  5HY2 A;  3NK6 A;  4NUT A;  1PXW A;  4XCQ A;  3CCJ F;  1W41 A;  1IPA A;  1W42 A;  3E1Y A;  3I56 F;  3V7E A;  3CPQ A;  1KQS F;  1T0K B;  4NQ3 A;  3N4Z A;  5G4U C;  5HWE A;  5DCV A;  3SIV A;  5GIO C;  1M1K H;  1X52 A;  1W2B F;  3CPW F;  2OTJ F;  3GYQ A;  2BO1 A;  3LFO A;  3OBY A;  4EI7 A;  1VQK F;  1VQN F;  3VMF B;  5IT9 M;  1KC8 H;  3NK7 A;  3IR9 A;  1Q82 H;  3NVI B;  1QVG F;  1DT9 A;  2I6D A;  3RA6 A;  1SDS A;  5GIN C;  1YHQ F;  3CCV F;  2VGM A;  1CK2 A;  5HY0 A;  1K73 H;  2KTV A;  1X7O A;  2KG4 A;  3LWO C;  1N8R H;  1W40 A;  3O85 A;  4BVS A;  2FGY A;  1NJI H;  5EWR A;  4EI8 A;  3AGK A;  1YJW F;  1YI2 F;  2F9Z C;  5GAP K;  1ZWZ A;  1VQP F;  5HY1 A;  3CMA F;  1GO1 A;  3JCM M;  4TZZ A;  2LBW A;  2GLZ A;  3RA5 A;  3LWV C;  1E7K A;  4LCK A;  1XBI A;  4BVR A;  1K8A H;  5HXZ A;  3MCA B;  3OW2 F;  3NVK E;  1VQM F;  1YJ9 F;  4X3L A;  4BW0 B;  5FLX M;  3SIU A;  5HXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...