2OHWA

Crystal structure of the yuei protein from bacillus subtilis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
128
structure length
128
Chain Sequence
EDKMDLYLQQGMYGPLETKPDERHLFLGSLRERVVLALTKGQVLRSKPYKEAEHELKNSHNVTLLINGELQYQSYSSYIQMASRYGVPFKIVSDLQFHTPLGIVIAADIAVNRELIYIQDDIYNRSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YueI protein
publication title Crystal structure of the YueI protein from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 37
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07997 DUF1694 Protein of unknown function (DUF1694)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2ohwA00
1KD1H 1H7MA 2OHWA 3MCAB 1VQOF 2CZWA 2I6DA 3LWPC 1XBIA 1W42A 5GANK 2OZBA 1YITF 5G4UC 3RA5A 3J80M 1VQLF 1E7KA 1SDSA 1NJIH 1DT9A 2JNBA 1W2BF 4X3LA 1KQSF 2VGMA 1QVGF 3E1YA 3CCMF 5IT9M 3LFOA 4C4WC 1VQ9F 3G4SF 3CC2F 3WXMB 1VQKF 2VGNA 3IR9A 5GIPC 3OBYA 5FJ4C 4X3MA 4NUTA 5GINC 3NK7A 1X52A 3CCLF 1K73H 1VQNF 3N4YA 2KTVA 1YJWF 4BY9D 3OW2F 3O85A 3CCQF 3PAFA 2BO1A 1GO1A 3CCUF 1W41A 3AGKA 3J7AR 3CPWF 1VQ4F 3GYQA 2OTLF 1CK2A 3G71F 5EO3A 3HJWC 3FFMA 1NMUB 1VQPF 1QVFF 5A2QM 3I56F 3LWRC 1K8AH 2QI2A 1YJNF 1PXWA 3I55F 3JCMM 3CCRF 3CMAF 3CCSF 1M1KH 3CPQA 5FLXM 1RA4A 2LBWA 1VQ8F 3LWOC 1YI2F 1Q82H 1Q86H 1YHQF 3HAXD 3N4ZA 5GAPK 3JAMM 1Q81H 1VQ7F 5GIOC 2QA4F 1M90H 1RLGA 3VI6A 3NK6A 2KTUA 1T0KB 5G4VC 3NVKE 1Q7YH 1X7OA 2QEXF 3LWVC 3CCJF 2OTJF 4BW0B 1GO0A 1CN7A 3CCEF 3VMFB 3G6EF 3NMUC 1KC8H 2ALEA 3V7QA 1YIJF 5DCVA 3OBWA 2AIFA 2FC3A 1VQ5F 1X7PA 4TZZA 1VQMF 1K9MH 3LWQC 2HVYD 1N8RH 3CD6F 3CG6A 3SIVA 2LBXA 2KG4A 3J81M 3RA6A 1W40A 3PLAC 4LCKA 1S72F 3CC7F 3CXCF 3V7EA 1YJ9F 3CCVF 1W3EX 3E20B 1JJ2F 1VQ6F 2WALA 3ON1A 1GZ0A 3SIUA 3NVIB 3CMEF 3CC4F 1ZWZA 5EWRA 1IPAA
chains in the Genus database with same CATH superfamily
3ZOPA 3MCAB 3LWPC 3WJQA 1XBIA 4NQ3A 5GANK 1PF5A 1YITF 5EYPB 1QAHA 3N2GB 2R6R1 4U3JA 1SDSA 2QTPA 3M1XA 4EB6A 3U0OA 4X3LA 3HKCA 2ZOVA 1QVGF 3P10A 3CC2F 3RYHB 4ZHYB 1U3LA 2Z1FA 4NWOB 3TD4A 4NUTA 4TV9A 4G4VA 2RHHA 3NK7A 4BT4A 2VAWA 1SZQA 5J2TB 3OW2F 3CCQF 3PAFA 3P4EA 4IHJB 4HNAB 2ZODA 3AGKA 3IEWA 3CPWF 2UYNB 2Q1XA 1H47A 1QU9A 3GYQA 3K12A 3K2XA 3G71F 3HKEB 4O2BB 3LYBA 3FFMA 3C8LA 3Q8HA 4O2AA 1W5FA 1VQPF 3LWRC 1K8AH 5LXTB 3ERNA 5IJ0B 3RE3A 1RLUA 4FFBA 2CVLA 5LP6A 4G4XA 2LBWA 3LWOC 5KX5A 1Q86H 4RHAA 2R751 3LMEA 1Q81H 2GZLA 3KJJA 2LBTA 3FBAA 3JAKB 5CB4A 3VOBA 3VI6A 4O4LA 5MN4A 2IQQA 2Z1TA 2KGWA 3S0HA 1Q7YH 2VXYA 4EI7A 2QEXF 3WGJA 3WGKA 5JQGA 3JAWB 1CN7A 2V9YA 3G6EF 3NMUC 5JH7B 3VO8A 5HXZA 2W8BC 3OBWA 2AIFA 1VQ5F 3BYQA 4ZOLA 4TZZA 1JN1A 2VAPA 3HKDA 3CD6F 3LDTA 3RA6A 5LYJB 2UYJA 5KMGB 3JASB 2ZF8A 5JVDA 4WBNA 5HP8A 1Q8RA 4O4IB 1JJ2F 4I4TA 2WALA 2VAMA 3ON1A 4YJ2A 1GZ0A 3MBMA 5EZYA 3NVIB 5EIBD 5EWRA 5J2UA 2ZVZA 1ONIA 2UYKA 4DRXA 1H7MA 1ODEA 3VCZA 1TVKA 3D54A 4R40B 5GONA 1RQ7A 1W42A 4YJ3A 3VYUC 3RYCB 2B33A 3RA5A 3CB2A 1JFFB 3C9RA 3VYTC 1VQLF 1E7KA 1DT9A 2JNBA 1W2BF 5LOVA 4TV8B 1VQVA 3WJPA 2VGMA 4C8EA 5IT9M 5IJ9B 4X1KB 1VQKF 3VIUA 3IR9A 3HKBA 4G4WA 5FJ4C 1FNJA 4X20B 1U43A 5CA1B 1OFUA 5CA0A 2UZHA 5GINC 5LA6B 5MN6A 4C81A 2KTVA 1YJWF 4BY9D 4ZHVA 4O4JB 3O85A 3CYPB 2MQEA 3CCUF 1VH8A 1H48A 1TVKB 3T80A 4I55A 1CK2A 4KWEA 3WGNA 3FPIA 5EO3A 1SA0B 4X1IB 4E6EA 1TUBA 5ITZB 5BMVB 3HJWC 1QD9A 3I56F 2QI2A 3E22B 1OAPA 2HRUA 3JALA 3I55F 2PMPA 1GX1A 4X1YB 3M4SA 3CMAF 2K1SA 1CLIA 1RA4A 2HS0A 1YI2F 1YHQF 2H8CA 3HAXD 3KHNA 5AVMA 3JAMM 4PWTA 1RLGA 3NK6A 5C8YA 3NVKE 4U3JB 2OTMA 1IV1A 5HY0A 4EB6B 3LWVC 4G4ZA 3HKCB 3FD6A 5IYZA 5EB0A 1W5AA 3MQWA 4M8IA 4O4HA 4ZK7A 2HP0A 3WPWA 3KE1A 4TV9B 5DCVA 3HWUA 2FC3A 4TUYA 4ZHQA 3LWQC 2HVYD 4F6RA 1YQNA 3CG6A 4LNUA 2ZVYA 2LBXA 3IKEA 1W40A 5JCOA 3RYIA 4LCKA 1FFXA 3MCQA 3V7EA 1YJ9F 3GHZA 4B45A 1W3EX 4IIJA 4ZI7A 3S0WA 4O2AB 4C82A 2BTQB 2HQSC 2OHWA 4I50A 1VQOF 3ELCA 4FFBB 5LP6B 3VOAA 2LCAA 2OZBA 4BT2A 3MDOA 5KX5B 1IV3A 2Q1YA 3N2KA 2IAFA 2RB9A 2GVIA 1KQSF 3WJRA 5CB4B 3LFOA 1UI9A 1YGYA 4O4LB 5EIBC 3RYIB 3G4SF 1FFXB 1VQ9F 3WXMB 3QUWA 3OBYA 3UT5A 3C9TA 1K73H 3CCLF 1VQNF 3JARA 5JQGB 2PHNA 5HWEA 1W5EA 3RYFA 3M84A 3JATA 3FD5A 2CWJA 3JVHA 5FNVA 3D01A 2CW4A 4ZOLB 2BTUA 5HY4A 4B5CA 3HKDB 1W57A 1NMUB 1QVFF 5A2QM 3F6MA 1Z5VA 5JVDB 3V3TA 4WBNB 1PXWA 1J7HA 5JCOC 3DDNA 3JCMM 3CCRF 3CCSF 1M1KH 3CPQA 5FLXM 3WGLA 4I4TB 1VHAA 4YJ2B 5EZYB 5EYPA 3V4DA 3N2GA 5J2UB 4DRXB 1KNJA 4BVTA 5GONB 5GIOC 4YJ3B 2KTUA 1W59A 2HX0A 5G4VC 3RYHA 3R0PA 2P6YA 3EORA 3S03A 2CHSA 3VYSC 5LOVB 3CCJF 1JD1A 3F0FA 1GO0A 5B8FA 2ZAUA 3IKFA 3S02A 5J2TA 4IHJA 3VMFB 3HKBB 4HNAA 1U3PA 2ALEA 3V7QA 3KIZA 3IMPA 3VTIC 1XHOA 1YIJF 2UYNA 4C8GA 5CA0B 1X7PA 5HXUA 3HKEA 2Z1UA 1UFYA 3ZP7A 4O2BA 3SIVA 1FSZA 1IV2A 2KG4A 4RQOA 3J81M 2AIZP 4B62A 3ZO8A 2GLZA 5LXTA 3CC7F 3CXCF 4I55B 5IJ0A 4EI9A 3CCVF 1TUBB 4U39A 2G9IA 3OONA 1COMA 3CC4F 1ZWZA 2HP3A 3TD3A 1NQ3A 1X25A 2Z1EA 1XV2A 4BVRA 1KD1H 3JALB 3I7TA 3JAKA 4ZHWA 2CZWA 2I6DA 4BT5A 3B6NA 3C9UA 2HS4A 5G4UC 3KJKA 3J80M 2RHJA 1NJIH 2F9ZC 1XRGA 1W55A 3K14A 4ERHA 3E1YA 3CCMF 4C4WC 3JAWA 5C8YB 2VGNA 1RQ2A 3F0EA 3TD5A 5JH7A 5GIPC 4X3MA 5HY2A 5HY1A 3ESJA 4BT6A 1X52A 3D00A 3F0DA 3I3FA 3N4YA 5IYZB 2RHLA 3CYQA 2CSLA 2BO1A 4O4HB 3WPXA 1GO1A 1W41A 2HP0B 3S0YA 5LYJA 3J7AR 1VK3A 5KMGA 1VQ4F 4BT7A 3JASA 2EWCA 4TUYB 1FNKA 2OTLF 2RHOA 2Z01A 3P0ZA 2L26A 4ZHQB 4O4IA 1U40A 4F6RB 2HS3A 4LNUB 4XCQA 2IG8A 3QHDA 4DXDA 2AMTA 3F0GA 1YJNF 4C8IA 1IV4A 2UYPA 3L7QA 3K0TA 4IIJB 4BVSA 4ZI7B 1VQ8F 1Q82H 3RYCA 4BVQA 3N4ZA 5GAPK 1JFFA 2CHTA 1VQ7F 5MN5A 4I50B 4TV8A 4EI8A 4G88A 2QA4F 3HTNA 1M90H 5IJ9A 4X1KA 1IPAA 1R1MA 1T0KB 5EB1B 3N2KB 1KNKA 2DT4A 1Z5WA 4X20A 3GTZA 1X7OA 2H8EA 5CA1A 2YXZA 5LA6A 2OTJF 4BW0B 1JY8A 2H6LA 2YYEA 3CCEF 4O4JA 4BT3A 1T0AA 1KC8H 3UT5B 5EAZA 3C9SA 1VQMF 1W581 3JARB 1SA0A 4X1IA 5LP6C 3ZP4A 5ITZA 5BMVA 3RYFB 1N8RH 1K9MH 1W5BA 2FGYA 3JATB 4B46A 1DBFA 3PLAC 2BTOA 3S06A 5FNVB 1S72F 3E22A 3DC2A 4G4YA 3QTYA 4X1YA 3E20B 1VQ6F 5HP7A 2HRYA 2DYYA 3SIUA 3IEQA 3CMEF 3WGMA 2I6RA 2N48A 2NMUA
chains in the Genus database with same CATH topology
4BVRA 1KD1H 1H7MA 2OHWA 3MCAB 1VQOF 2CZWA 2I6DA 3LWPC 1XBIA 4NQ3A 1W42A 5GANK 2OZBA 1YITF 5G4UC 3RA5A 3J80M 1VQLF 1E7KA 1SDSA 1NJIH 1DT9A 2JNBA 1W2BF 4X3LA 1KQSF 2F9ZC 2VGMA 1QVGF 3E1YA 3CCMF 5IT9M 3LFOA 4C4WC 1VQ9F 3G4SF 3CC2F 3WXMB 1VQKF 2VGNA 3IR9A 5GIPC 3OBYA 5FJ4C 4X3MA 5HY2A 5HY1A 4NUTA 5GINC 3NK7A 1X52A 3D00A 3CCLF 1K73H 1VQNF 3N4YA 2KTVA 1YJWF 5HWEA 4BY9D 3OW2F 3O85A 3CCQF 3PAFA 2BO1A 1GO1A 3CCUF 1W41A 3AGKA 3J7AR 3CPWF 1VQ4F 5HY4A 3GYQA 2OTLF 1CK2A 3G71F 5EO3A 3HJWC 3FFMA 4XCQA 1NMUB 1VQPF 1QVFF 5A2QM 3I56F 3LWRC 1K8AH 2QI2A 3V3TA 1YJNF 1PXWA 3I55F 3JCMM 3CCRF 3CMAF 3CCSF 1M1KH 3CPQA 4BVSA 5FLXM 1RA4A 2LBWA 1VQ8F 3LWOC 1YI2F 1Q82H 1Q86H 1YHQF 3HAXD 4BVQA 3N4ZA 5GAPK 3JAMM 1Q81H 4BVTA 1VQ7F 4EI8A 5GIOC 2QA4F 1M90H 1RLGA 3VI6A 3NK6A 2KTUA 1T0KB 5G4VC 3NVKE 1Q7YH 5HY0A 1X7OA 4EI7A 2QEXF 3LWVC 3CCJF 2OTJF 4BW0B 1GO0A 1CN7A 3CCEF 3VMFB 3G6EF 3NMUC 1KC8H 2ALEA 3V7QA 5HXZA 1YIJF 5DCVA 3OBWA 2AIFA 2FC3A 1VQ5F 1X7PA 4TZZA 1VQMF 5HXUA 1K9MH 3LWQC 2HVYD 1N8RH 3CD6F 3CG6A 3SIVA 2FGYA 2LBXA 2KG4A 3J81M 3RA6A 1W40A 3PLAC 4LCKA 2GLZA 1S72F 3CC7F 3CXCF 3V7EA 1YJ9F 4EI9A 3CCVF 1W3EX 3E20B 1JJ2F 1VQ6F 2WALA 3ON1A 1GZ0A 3SIUA 3NVIB 3CMEF 3CC4F 1ZWZA 5EWRA 1IPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KD1 H;  1H7M A;  2OHW A;  3MCA B;  1VQO F;  2CZW A;  2I6D A;  3LWP C;  1XBI A;  1W42 A;  5GAN K;  2OZB A;  1YIT F;  5G4U C;  3RA5 A;  3J80 M;  1VQL F;  1E7K A;  1SDS A;  1NJI H;  1DT9 A;  2JNB A;  1W2B F;  4X3L A;  1KQS F;  2VGM A;  1QVG F;  3E1Y A;  3CCM F;  5IT9 M;  3LFO A;  4C4W C;  1VQ9 F;  3G4S F;  3CC2 F;  3WXM B;  1VQK F;  2VGN A;  3IR9 A;  5GIP C;  3OBY A;  5FJ4 C;  4X3M A;  4NUT A;  5GIN C;  3NK7 A;  1X52 A;  3CCL F;  1K73 H;  1VQN F;  3N4Y A;  2KTV A;  1YJW F;  4BY9 D;  3OW2 F;  3O85 A;  3CCQ F;  3PAF A;  2BO1 A;  1GO1 A;  3CCU F;  1W41 A;  3AGK A;  3J7A R;  3CPW F;  1VQ4 F;  3GYQ A;  2OTL F;  1CK2 A;  3G71 F;  5EO3 A;  3HJW C;  3FFM A;  1NMU B;  1VQP F;  1QVF F;  5A2Q M;  3I56 F;  3LWR C;  1K8A H;  2QI2 A;  1YJN F;  1PXW A;  3I55 F;  3JCM M;  3CCR F;  3CMA F;  3CCS F;  1M1K H;  3CPQ A;  5FLX M;  1RA4 A;  2LBW A;  1VQ8 F;  3LWO C;  1YI2 F;  1Q82 H;  1Q86 H;  1YHQ F;  3HAX D;  3N4Z A;  5GAP K;  3JAM M;  1Q81 H;  1VQ7 F;  5GIO C;  2QA4 F;  1M90 H;  1RLG A;  3VI6 A;  3NK6 A;  2KTU A;  1T0K B;  5G4V C;  3NVK E;  1Q7Y H;  1X7O A;  2QEX F;  3LWV C;  3CCJ F;  2OTJ F;  4BW0 B;  1GO0 A;  1CN7 A;  3CCE F;  3VMF B;  3G6E F;  3NMU C;  1KC8 H;  2ALE A;  3V7Q A;  1YIJ F;  5DCV A;  3OBW A;  2AIF A;  2FC3 A;  1VQ5 F;  1X7P A;  4TZZ A;  1VQM F;  1K9M H;  3LWQ C;  2HVY D;  1N8R H;  3CD6 F;  3CG6 A;  3SIV A;  2LBX A;  2KG4 A;  3J81 M;  3RA6 A;  1W40 A;  3PLA C;  4LCK A;  1S72 F;  3CC7 F;  3CXC F;  3V7E A;  1YJ9 F;  3CCV F;  1W3E X;  3E20 B;  1JJ2 F;  1VQ6 F;  2WAL A;  3ON1 A;  1GZ0 A;  3SIU A;  3NVI B;  3CME F;  3CC4 F;  1ZWZ A;  5EWR A;  1IPA A; 
#chains in the Genus database with same CATH topology
 3ZOP A;  3MCA B;  3LWP C;  3WJQ A;  1XBI A;  4NQ3 A;  5GAN K;  1PF5 A;  1YIT F;  5EYP B;  1QAH A;  3N2G B;  2R6R 1;  4U3J A;  1SDS A;  2QTP A;  3M1X A;  4EB6 A;  3U0O A;  4X3L A;  3HKC A;  2ZOV A;  1QVG F;  3P10 A;  3CC2 F;  3RYH B;  4ZHY B;  1U3L A;  2Z1F A;  4NWO B;  3TD4 A;  4NUT A;  4TV9 A;  4G4V A;  2RHH A;  3NK7 A;  4BT4 A;  2VAW A;  1SZQ A;  5J2T B;  3OW2 F;  3CCQ F;  3PAF A;  3P4E A;  4IHJ B;  4HNA B;  2ZOD A;  3AGK A;  3IEW A;  3CPW F;  2UYN B;  2Q1X A;  1H47 A;  1QU9 A;  3GYQ A;  3K12 A;  3K2X A;  3G71 F;  3HKE B;  4O2B B;  3LYB A;  3FFM A;  3C8L A;  3Q8H A;  4O2A A;  1W5F A;  1VQP F;  3LWR C;  1K8A H;  5LXT B;  3ERN A;  5IJ0 B;  3RE3 A;  1RLU A;  4FFB A;  2CVL A;  5LP6 A;  4G4X A;  2LBW A;  3LWO C;  5KX5 A;  1Q86 H;  4RHA A;  2R75 1;  3LME A;  1Q81 H;  2GZL A;  3KJJ A;  2LBT A;  3FBA A;  3JAK B;  5CB4 A;  3VOB A;  3VI6 A;  4O4L A;  5MN4 A;  2IQQ A;  2Z1T A;  2KGW A;  3S0H A;  1Q7Y H;  2VXY A;  4EI7 A;  2QEX F;  3WGJ A;  3WGK A;  5JQG A;  3JAW B;  1CN7 A;  2V9Y A;  3G6E F;  3NMU C;  5JH7 B;  3VO8 A;  5HXZ A;  2W8B C;  3OBW A;  2AIF A;  1VQ5 F;  3BYQ A;  4ZOL A;  4TZZ A;  1JN1 A;  2VAP A;  3HKD A;  3CD6 F;  3LDT A;  3RA6 A;  5LYJ B;  2UYJ A;  5KMG B;  3JAS B;  2ZF8 A;  5JVD A;  4WBN A;  5HP8 A;  1Q8R A;  4O4I B;  1JJ2 F;  4I4T A;  2WAL A;  2VAM A;  3ON1 A;  4YJ2 A;  1GZ0 A;  3MBM A;  5EZY A;  3NVI B;  5EIB D;  5EWR A;  5J2U A;  2ZVZ A;  1ONI A;  2UYK A;  4DRX A;  1H7M A;  1ODE A;  3VCZ A;  1TVK A;  3D54 A;  4R40 B;  5GON A;  1RQ7 A;  1W42 A;  4YJ3 A;  3VYU C;  3RYC B;  2B33 A;  3RA5 A;  3CB2 A;  1JFF B;  3C9R A;  3VYT C;  1VQL F;  1E7K A;  1DT9 A;  2JNB A;  1W2B F;  5LOV A;  4TV8 B;  1VQV A;  3WJP A;  2VGM A;  4C8E A;  5IT9 M;  5IJ9 B;  4X1K B;  1VQK F;  3VIU A;  3IR9 A;  3HKB A;  4G4W A;  5FJ4 C;  1FNJ A;  4X20 B;  1U43 A;  5CA1 B;  1OFU A;  5CA0 A;  2UZH A;  5GIN C;  5LA6 B;  5MN6 A;  4C81 A;  2KTV A;  1YJW F;  4BY9 D;  4ZHV A;  4O4J B;  3O85 A;  3CYP B;  2MQE A;  3CCU F;  1VH8 A;  1H48 A;  1TVK B;  3T80 A;  4I55 A;  1CK2 A;  4KWE A;  3WGN A;  3FPI A;  5EO3 A;  1SA0 B;  4X1I B;  4E6E A;  1TUB A;  5ITZ B;  5BMV B;  3HJW C;  1QD9 A;  3I56 F;  2QI2 A;  3E22 B;  1OAP A;  2HRU A;  3JAL A;  3I55 F;  2PMP A;  1GX1 A;  4X1Y B;  3M4S A;  3CMA F;  2K1S A;  1CLI A;  1RA4 A;  2HS0 A;  1YI2 F;  1YHQ F;  2H8C A;  3HAX D;  3KHN A;  5AVM A;  3JAM M;  4PWT A;  1RLG A;  3NK6 A;  5C8Y A;  3NVK E;  4U3J B;  2OTM A;  1IV1 A;  5HY0 A;  4EB6 B;  3LWV C;  4G4Z A;  3HKC B;  3FD6 A;  5IYZ A;  5EB0 A;  1W5A A;  3MQW A;  4M8I A;  4O4H A;  4ZK7 A;  2HP0 A;  3WPW A;  3KE1 A;  4TV9 B;  5DCV A;  3HWU A;  2FC3 A;  4TUY A;  4ZHQ A;  3LWQ C;  2HVY D;  4F6R A;  1YQN A;  3CG6 A;  4LNU A;  2ZVY A;  2LBX A;  3IKE A;  1W40 A;  5JCO A;  3RYI A;  4LCK A;  1FFX A;  3MCQ A;  3V7E A;  1YJ9 F;  3GHZ A;  4B45 A;  1W3E X;  4IIJ A;  4ZI7 A;  3S0W A;  4O2A B;  4C82 A;  2BTQ B;  2HQS C;  2OHW A;  4I50 A;  1VQO F;  3ELC A;  4FFB B;  5LP6 B;  3VOA A;  2LCA A;  2OZB A;  4BT2 A;  3MDO A;  5KX5 B;  1IV3 A;  2Q1Y A;  3N2K A;  2IAF A;  2RB9 A;  2GVI A;  1KQS F;  3WJR A;  5CB4 B;  3LFO A;  1UI9 A;  1YGY A;  4O4L B;  5EIB C;  3RYI B;  3G4S F;  1FFX B;  1VQ9 F;  3WXM B;  3QUW A;  3OBY A;  3UT5 A;  3C9T A;  1K73 H;  3CCL F;  1VQN F;  3JAR A;  5JQG B;  2PHN A;  5HWE A;  1W5E A;  3RYF A;  3M84 A;  3JAT A;  3FD5 A;  2CWJ A;  3JVH A;  5FNV A;  3D01 A;  2CW4 A;  4ZOL B;  2BTU A;  5HY4 A;  4B5C A;  3HKD B;  1W57 A;  1NMU B;  1QVF F;  5A2Q M;  3F6M A;  1Z5V A;  5JVD B;  3V3T A;  4WBN B;  1PXW A;  1J7H A;  5JCO C;  3DDN A;  3JCM M;  3CCR F;  3CCS F;  1M1K H;  3CPQ A;  5FLX M;  3WGL A;  4I4T B;  1VHA A;  4YJ2 B;  5EZY B;  5EYP A;  3V4D A;  3N2G A;  5J2U B;  4DRX B;  1KNJ A;  4BVT A;  5GON B;  5GIO C;  4YJ3 B;  2KTU A;  1W59 A;  2HX0 A;  5G4V C;  3RYH A;  3R0P A;  2P6Y A;  3EOR A;  3S03 A;  2CHS A;  3VYS C;  5LOV B;  3CCJ F;  1JD1 A;  3F0F A;  1GO0 A;  5B8F A;  2ZAU A;  3IKF A;  3S02 A;  5J2T A;  4IHJ A;  3VMF B;  3HKB B;  4HNA A;  1U3P A;  2ALE A;  3V7Q A;  3KIZ A;  3IMP A;  3VTI C;  1XHO A;  1YIJ F;  2UYN A;  4C8G A;  5CA0 B;  1X7P A;  5HXU A;  3HKE A;  2Z1U A;  1UFY A;  3ZP7 A;  4O2B A;  3SIV A;  1FSZ A;  1IV2 A;  2KG4 A;  4RQO A;  3J81 M;  2AIZ P;  4B62 A;  3ZO8 A;  2GLZ A;  5LXT A;  3CC7 F;  3CXC F;  4I55 B;  5IJ0 A;  4EI9 A;  3CCV F;  1TUB B;  4U39 A;  2G9I A;  3OON A;  1COM A;  3CC4 F;  1ZWZ A;  2HP3 A;  3TD3 A;  1NQ3 A;  1X25 A;  2Z1E A;  1XV2 A;  4BVR A;  1KD1 H;  3JAL B;  3I7T A;  3JAK A;  4ZHW A;  2CZW A;  2I6D A;  4BT5 A;  3B6N A;  3C9U A;  2HS4 A;  5G4U C;  3KJK A;  3J80 M;  2RHJ A;  1NJI H;  2F9Z C;  1XRG A;  1W55 A;  3K14 A;  4ERH A;  3E1Y A;  3CCM F;  4C4W C;  3JAW A;  5C8Y B;  2VGN A;  1RQ2 A;  3F0E A;  3TD5 A;  5JH7 A;  5GIP C;  4X3M A;  5HY2 A;  5HY1 A;  3ESJ A;  4BT6 A;  1X52 A;  3D00 A;  3F0D A;  3I3F A;  3N4Y A;  5IYZ B;  2RHL A;  3CYQ A;  2CSL A;  2BO1 A;  4O4H B;  3WPX A;  1GO1 A;  1W41 A;  2HP0 B;  3S0Y A;  5LYJ A;  3J7A R;  1VK3 A;  5KMG A;  1VQ4 F;  4BT7 A;  3JAS A;  2EWC A;  4TUY B;  1FNK A;  2OTL F;  2RHO A;  2Z01 A;  3P0Z A;  2L26 A;  4ZHQ B;  4O4I A;  1U40 A;  4F6R B;  2HS3 A;  4LNU B;  4XCQ A;  2IG8 A;  3QHD A;  4DXD A;  2AMT A;  3F0G A;  1YJN F;  4C8I A;  1IV4 A;  2UYP A;  3L7Q A;  3K0T A;  4IIJ B;  4BVS A;  4ZI7 B;  1VQ8 F;  1Q82 H;  3RYC A;  4BVQ A;  3N4Z A;  5GAP K;  1JFF A;  2CHT A;  1VQ7 F;  5MN5 A;  4I50 B;  4TV8 A;  4EI8 A;  4G88 A;  2QA4 F;  3HTN A;  1M90 H;  5IJ9 A;  4X1K A;  1IPA A;  1R1M A;  1T0K B;  5EB1 B;  3N2K B;  1KNK A;  2DT4 A;  1Z5W A;  4X20 A;  3GTZ A;  1X7O A;  2H8E A;  5CA1 A;  2YXZ A;  5LA6 A;  2OTJ F;  4BW0 B;  1JY8 A;  2H6L A;  2YYE A;  3CCE F;  4O4J A;  4BT3 A;  1T0A A;  1KC8 H;  3UT5 B;  5EAZ A;  3C9S A;  1VQM F;  1W58 1;  3JAR B;  1SA0 A;  4X1I A;  5LP6 C;  3ZP4 A;  5ITZ A;  5BMV A;  3RYF B;  1N8R H;  1K9M H;  1W5B A;  2FGY A;  3JAT B;  4B46 A;  1DBF A;  3PLA C;  2BTO A;  3S06 A;  5FNV B;  1S72 F;  3E22 A;  3DC2 A;  4G4Y A;  3QTY A;  4X1Y A;  3E20 B;  1VQ6 F;  5HP7 A;  2HRY A;  2DYY A;  3SIU A;  3IEQ A;  3CME F;  3WGM A;  2I6R A;  2N48 A;  2NMU A; 
#chains in the Genus database with same CATH homology
 4BVR A;  1KD1 H;  1H7M A;  2OHW A;  3MCA B;  1VQO F;  2CZW A;  2I6D A;  3LWP C;  1XBI A;  4NQ3 A;  1W42 A;  5GAN K;  2OZB A;  1YIT F;  5G4U C;  3RA5 A;  3J80 M;  1VQL F;  1E7K A;  1SDS A;  1NJI H;  1DT9 A;  2JNB A;  1W2B F;  4X3L A;  1KQS F;  2F9Z C;  2VGM A;  1QVG F;  3E1Y A;  3CCM F;  5IT9 M;  3LFO A;  4C4W C;  1VQ9 F;  3G4S F;  3CC2 F;  3WXM B;  1VQK F;  2VGN A;  3IR9 A;  5GIP C;  3OBY A;  5FJ4 C;  4X3M A;  5HY2 A;  5HY1 A;  4NUT A;  5GIN C;  3NK7 A;  1X52 A;  3D00 A;  3CCL F;  1K73 H;  1VQN F;  3N4Y A;  2KTV A;  1YJW F;  5HWE A;  4BY9 D;  3OW2 F;  3O85 A;  3CCQ F;  3PAF A;  2BO1 A;  1GO1 A;  3CCU F;  1W41 A;  3AGK A;  3J7A R;  3CPW F;  1VQ4 F;  5HY4 A;  3GYQ A;  2OTL F;  1CK2 A;  3G71 F;  5EO3 A;  3HJW C;  3FFM A;  4XCQ A;  1NMU B;  1VQP F;  1QVF F;  5A2Q M;  3I56 F;  3LWR C;  1K8A H;  2QI2 A;  3V3T A;  1YJN F;  1PXW A;  3I55 F;  3JCM M;  3CCR F;  3CMA F;  3CCS F;  1M1K H;  3CPQ A;  4BVS A;  5FLX M;  1RA4 A;  2LBW A;  1VQ8 F;  3LWO C;  1YI2 F;  1Q82 H;  1Q86 H;  1YHQ F;  3HAX D;  4BVQ A;  3N4Z A;  5GAP K;  3JAM M;  1Q81 H;  4BVT A;  1VQ7 F;  4EI8 A;  5GIO C;  2QA4 F;  1M90 H;  1RLG A;  3VI6 A;  3NK6 A;  2KTU A;  1T0K B;  5G4V C;  3NVK E;  1Q7Y H;  5HY0 A;  1X7O A;  4EI7 A;  2QEX F;  3LWV C;  3CCJ F;  2OTJ F;  4BW0 B;  1GO0 A;  1CN7 A;  3CCE F;  3VMF B;  3G6E F;  3NMU C;  1KC8 H;  2ALE A;  3V7Q A;  5HXZ A;  1YIJ F;  5DCV A;  3OBW A;  2AIF A;  2FC3 A;  1VQ5 F;  1X7P A;  4TZZ A;  1VQM F;  5HXU A;  1K9M H;  3LWQ C;  2HVY D;  1N8R H;  3CD6 F;  3CG6 A;  3SIV A;  2FGY A;  2LBX A;  2KG4 A;  3J81 M;  3RA6 A;  1W40 A;  3PLA C;  4LCK A;  2GLZ A;  1S72 F;  3CC7 F;  3CXC F;  3V7E A;  1YJ9 F;  4EI9 A;  3CCV F;  1W3E X;  3E20 B;  1JJ2 F;  1VQ6 F;  2WAL A;  3ON1 A;  1GZ0 A;  3SIU A;  3NVI B;  3CME F;  3CC4 F;  1ZWZ A;  5EWR A;  1IPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...