2OHWA

Crystal structure of the yuei protein from bacillus subtilis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
128
structure length
128
Chain Sequence
EDKMDLYLQQGMYGPLETKPDERHLFLGSLRERVVLALTKGQVLRSKPYKEAEHELKNSHNVTLLINGELQYQSYSSYIQMASRYGVPFKIVSDLQFHTPLGIVIAADIAVNRELIYIQDDIYNRSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the YueI protein from Bacillus subtilis
rcsb
molecule keywords YueI protein
molecule tags Structural genomics, unknown function
source organism Bacillus subtilis
total genus 37
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07997 DUF1694 Protein of unknown function (DUF1694)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2ohwA00
1W2BF 1RA4A 1CN7A 1GZ0A 2VGNA 2KTVA 5GANK 3NVIB 3NVKE 1ZWZA 2HVYD 4X3MA 3LFOA 3NK7A 3JCMM 1QVFF 3CCJF 3OBWA 3CCSF 2LBXA 3OW2F 1NJIH 1VQ8F 1YJ9F 1VQNF 5G4UC 1PXWA 3CCUF 3PLAC 3V7EA 1YJNF 1K9MH 3CPWF 3RA6A 1Q82H 3CG6A 4TZZA 3LWRC 3CCEF 1XBIA 1KC8H 2CZWA 1Q81H 3G71F 3CD6F 5DCVA 3LWQC 1W42A 2KG4A 2WALA 4X3LA 3G6EF 1YITF 1K73H 3CC4F 3NMUC 5EO3A 1VQOF 3E1YA 5FJ4C 1VQ9F 5G4VC 1VQ4F 1YJWF 2QA4F 3CMEF 2OTLF 4BW0B 3CCRF 1VQKF 2JNBA 2OHWA 1M1KH 3CCQF 4BY9D 1S72F 1VQ7F 1K8AH 1M90H 1VQLF 1QVGF 5A2QM 3SIUA 5GIOC 1W41A 5FLXM 5GAPK 3SIVA 3N4ZA 3VI6A 1X7OA 1W3EX 1T0KB 1Q86H 3LWOC 3LWPC 2KTUA 3J81M 3MCAB 1X52A 1CK2A 3GYQA 3V7QA 4LCKA 5IT9M 2FC3A 2BO1A 3I56F 3RA5A 5GINC 1YIJF 3OBYA 1GO1A 1JJ2F 1GO0A 3HJWC 2I6DA 2OZBA 3HAXD 3N4YA 1NMUB 1W40A 5GIPC 3AGKA 3O85A 3VMFB 3PAFA 2LBWA 1VQMF 3WXMB 3G4SF 3FFMA 1H7MA 1SDSA 1VQPF 1RLGA 1E7KA 1X7PA 3CC2F 3LWVC 2OTJF 3ON1A 3CMAF 1YHQF 4C4WC 2QI2A 3J7AR 1VQ5F 3CXCF 3CCLF 1KQSF 2QEXF 3CCVF 1N8RH 3J80M 1IPAA 4NUTA 3IR9A 1DT9A 1VQ6F 3I55F 1Q7YH 3E20B 5EWRA 3NK6A 2VGMA 3JAMM 3CPQA 1KD1H 3CCMF 1YI2F 2ALEA 2AIFA 3CC7F
chains in the Genus database with same CATH superfamily
1SZQA 4F6RB 5GANK 5CA0A 3GTZA 4DXDA 4X3MA 4U3JA 3OW2F 1H48A 4HNAB 1VQNF 3JAWA 3F0FA 2HRYA 3CPWF 3JARB 3N2KB 4TV9A 4TZZA 3IMPA 3VYUC 1KC8H 5FNVB 2DT4A 3HKEB 4RQOA 4ZK7A 1ODEA 1Q81H 4NWOB 2W8BC 3LWQC 5EIBD 5KMGB 1JD1A 1K73H 3MQWA 2NMUA 1IV1A 3TD3A 5EO3A 5LA6A 5FJ4C 1VQ9F 3C9RA 3K0TA 5G4VC 3E22A 4ZHYB 2OTLF 2EWCA 4X1YB 2HS0A 2RHHA 3CYPB 1M1KH 2G9IA 1W5AA 4ZOLA 5JH7B 1K8AH 3K12A 1W59A 4C8IA 1X25A 3JATB 4O4JB 5JVDB 2BTOA 5EYPB 3RYHA 4BT2A 5BMVB 3DDNA 4FFBA 3ZP4A 4ZI7A 4IIJB 4EB6A 1W3EX 5GONA 1Q86H 3LWOC 5EB0A 3CB2A 3LWPC 3J81M 3GYQA 5IT9M 3HKCB 4BT5A 5LXTA 3QHDA 5ITZB 1U3LA 4HNAA 3D54A 1YQNA 1GO1A 2PMPA 5CA1A 2PHNA 3N4YA 4EI8A 5LOVB 2LCAA 3LMEA 5GIPC 1XHOA 1U40A 2Z01A 2ZF8A 2HS3A 3F0GA 3G4SF 1H7MA 1FNJA 4I50B 2HS4A 4YJ3A 3FD5A 5C8YB 3I3FA 3LWVC 3N2GB 3CMAF 1YHQF 3J7AR 2UZHA 3CXCF 3RYFA 2AIZP 3CCVF 4M8IA 4NUTA 3D00A 3IR9A 5JH7A 3ZP7A 5CB4A 1IV4A 3E20B 4G4VA 3ELCA 2UYJA 4B62A 4U39A 4E6EA 3ZOPA 4I55A 3CC7F 4B46A 5JQGA 2CHSA 1QVFF 4NQ3A 3OBWA 2B33A 4TV8A 4YJ2A 1SA0B 1VQ8F 3VOBA 3WPXA 4O2AA 4O4LA 3D01A 3RA6A 2H6LA 4ZHQB 1XBIA 3RYIA 2UYNB 2CZWA 2F9ZC 3G71F 3L7QA 1W57A 2CVLA 2WALA 1YITF 3G6EF 4DRXB 3U0OA 1RQ2A 3E1YA 4X1KA 1DBFA 1NQ3A 5MN4A 1YGYA 3MDOA 5EZYA 3N2GA 3HKBB 3UT5A 5HY2A 3CCRF 2CW4A 3K14A 3VCZA 4O4HB 2CHTA 3CCQF 1ONIA 4BY9D 3HTNA 2I6RA 5KX5B 1IV2A 1W5FA 1PF5A 5IJ9B 1VQLF 2H8EA 3F0DA 3HKDB 3RYCB 1TUBA 2HRUA 4BVQA 2MQEA 3SIVA 5IJ0B 4WBNB 2V9YA 3VO8A 3MCAB 3V7QA 1CK2A 4BT7A 4LCKA 2FC3A 1FFXA 1U43A 2RHJA 3S02A 2BTQB 3RA5A 2Q1XA 2VAMA 5LYJB 5HXUA 3OBYA 2BTUA 5IYZA 3KHNA 3ZO8A 1JJ2F 2HP0A 1JFFB 2UYNA 1NMUB 3F0EA 2DYYA 4EI9A 3DC2A 3QUWA 3AGKA 3JALB 4R40B 3TD5A 2L26A 3WGNA 2LBWA 3Q8HA 1CLIA 4TUYB 1SDSA 2YYEA 5J2UB 1RLGA 5JCOC 4F6RA 1E7KA 2N48A 3ON1A 3KJKA 4XCQA 2R6R1 2IAFA 1VQ5F 1KQSF 3VIUA 3C8LA 2IQQA 2Z1UA 1N8RH 3J80M 4IHJB 5MN6A 5JCOA 5J2TB 1DT9A 3I55F 2Z1FA 3JARA 3N2KA 4G4WA 3HKDA 1VHAA 5FNVA 3NK6A 3HKEA 3RYCA 4O2BB 5HP7A 5HXZA 5KMGA 3CCMF 2ALEA 5G4UC 3WGMA 3NVIB 3P10A 4I4TB 3T80A 4X1YA 3CCJF 1QAHA 3CCSF 2LBXA 1NJIH 3WPWA 3CCUF 3V7EA 5HY0A 1K9MH 3P4EA 4X1IB 4ZHVA 3JVHA 1JY8A 3CCEF 3JATA 4O4JA 5JVDA 5EIBC 5DCVA 5EYPA 3JASB 3VOAA 4C81A 5BMVA 1W42A 2KG4A 1W5BA 3EORA 4IIJA 3MCQA 3BYQA 4G4YA 4BVSA 3WJRA 5CA0B 1YJWF 1VQ4F 4C82A 2QA4F 3KIZA 3CMEF 1KNJA 2ZVYA 4BW0B 3HKCA 4C8EA 4U3JB 3WJQA 1FSZA 5ITZA 4LNUB 1Z5WA 2JNBA 2OHWA 1W581 1VQKF 1QU9A 2K1SA 3S0WA 1QD9A 3JAWB 1FNKA 1VQ7F 1XRGA 4TV9B 5A2QM 3SIUA 1W41A 5LOVA 3IEQA 2FGYA 3N4ZA 4O4IB 5LA6B 2QTPA 4I50A 2KTUA 3E22B 1X52A 5C8YA 3TD4A 1U3PA 4I4TA 1OAPA 4B45A 1UFYA 3FD6A 3OONA 5GINC 2GZLA 3VTIC 1YIJF 2HQSC 4ZOLB 3S06A 3S0YA 3JAKB 4B5CA 3RYHB 3HAXD 3JASA 4FFBB 4PWTA 3O85A 2VAPA 4ZI7B 4EB6B 1VQMF 5GONB 3M4SA 3VYTC 5LXTB 1TVKB 1X7PA 2UYKA 3WGKA 5EAZA 2R751 4C4WC 4LNUA 4EI7A 5B8FA 3CCLF 1R1MA 1SA0A 4C8GA 1W5EA 1IPAA 1VH8A 4BT6A 5CA1B 3S03A 1VQ6F 2Z1EA 2Z1TA 3VYSC 1Q7YH 4ZHQA 1GX1A 5EWRA 2RHOA 3CPQA 4BVTA 4O4IA 4DRXA 2AIFA 1H47A 2ZODA 1RA4A 4YJ3B 1W2BF 3IEWA 1CN7A 1GZ0A 2VGNA 2KTVA 1T0AA 3NVKE 1ZWZA 1KNKA 2HVYD 3HKBA 3LFOA 3NK7A 3JCMM 3V4DA 3RYFB 4O4HA 4X20B 1YJ9F 2Q1YA 1PXWA 5HY1A 3IKFA 3PLAC 2HP3A 3WGJA 1YJNF 3JAKA 5KX5A 5CB4B 1Q82H 3B6NA 3CG6A 3LDTA 4G88A 5IJ9A 1J7HA 3LWRC 3FPIA 1W55A 3C9UA 3C9TA 4G4XA 3KE1A 3CD6F 5HP8A 4X3LA 5LP6B 3KJJA 3M84A 4I55B 3RE3A 5IJ0A 3CC4F 4WBNA 4RHAA 3NMUC 1VQOF 3WGLA 1COMA 2LBTA 3WJPA 5MN5A 1TVKA 3ESJA 5JQGB 4TV8B 4YJ2B 1VK3A 4BT4A 4ZHWA 3MBMA 1S72F 5LYJA 3C9SA 4O2AB 4O4LB 2OTMA 2VAWA 1M90H 1UI9A 1QVGF 1JFFA 2KGWA 3LYBA 3RYIB 2GLZA 5GIOC 1RLUA 5FLXM 5GAPK 2UYPA 3K2XA 1RQ7A 3JALA 3VI6A 1X7OA 1T0KB 1XV2A 4X1KB 5AVMA 4TUYA 3P0ZA 5EZYB 1Q8RA 5J2UA 3UT5B 3S0HA 2BO1A 1VQVA 3I56F 5EB1B 3M1XA 3IKEA 3V3TA 4X20A 4BT3A 5LP6C 1Z5VA 4IHJA 1GO0A 5J2TA 2H8CA 3HJWC 2P6YA 2I6DA 2OZBA 3I7TA 2AMTA 1W40A 1TUBB 4ERHA 2GVIA 5LP6A 4O2BA 3FBAA 3PAFA 5HY4A 3VMFB 2HX0A 3WXMB 3FFMA 2CWJA 4G4ZA 1VQPF 5HWEA 3CC2F 1FFXB 2YXZA 3GHZA 2OTJF 3ERNA 1OFUA 2QI2A 5IYZB 2QEXF 3F6MA 2IG8A 2CSLA 2HP0B 3QTYA 4BVRA 4X1IA 1IV3A 2VXYA 2RB9A 2ZAUA 3HWUA 3R0PA 2VGMA 3CYQA 4KWEA 3JAMM 2ZOVA 2ZVZA 2RHLA 1KD1H 1YI2F 1JN1A
chains in the Genus database with same CATH topology
1W2BF 1RA4A 1CN7A 1GZ0A 2VGNA 2KTVA 5GANK 3NVIB 3NVKE 1ZWZA 2HVYD 4X3MA 3LFOA 3NK7A 3JCMM 1QVFF 3CCJF 4NQ3A 3OBWA 3CCSF 2LBXA 3OW2F 1NJIH 1VQ8F 1YJ9F 1VQNF 5G4UC 1PXWA 5HY1A 3CCUF 3PLAC 3V7EA 5HY0A 1YJNF 1K9MH 3CPWF 3RA6A 1Q82H 3CG6A 4TZZA 3LWRC 3CCEF 1XBIA 1KC8H 2CZWA 2F9ZC 3G71F 1Q81H 3CD6F 5DCVA 3LWQC 1W42A 2KG4A 2WALA 4X3LA 3G6EF 1YITF 1K73H 3CC4F 3NMUC 5EO3A 1VQOF 3E1YA 5FJ4C 1VQ9F 5G4VC 4BVSA 1VQ4F 1YJWF 2QA4F 3CMEF 2OTLF 4BW0B 5HY2A 3CCRF 1VQKF 2JNBA 2OHWA 1M1KH 3CCQF 4BY9D 1S72F 1VQ7F 1K8AH 1M90H 1VQLF 1QVGF 5A2QM 3SIUA 2GLZA 5GIOC 1W41A 5FLXM 5GAPK 2FGYA 4BVQA 3SIVA 3N4ZA 3VI6A 1X7OA 1W3EX 1T0KB 1Q86H 3LWOC 3LWPC 2KTUA 3J81M 3MCAB 1X52A 1CK2A 3GYQA 3V7QA 4LCKA 5IT9M 2FC3A 2BO1A 3I56F 3RA5A 5GINC 3V3TA 1YIJF 5HXUA 3OBYA 1GO1A 1JJ2F 1GO0A 3HJWC 2I6DA 2OZBA 3HAXD 4EI8A 3N4YA 1NMUB 1W40A 4EI9A 5GIPC 3AGKA 3O85A 5HY4A 3PAFA 2LBWA 3VMFB 1VQMF 3WXMB 3G4SF 3FFMA 1H7MA 1SDSA 1VQPF 1RLGA 5HWEA 1E7KA 1X7PA 3CC2F 3LWVC 2OTJF 3ON1A 3CMAF 4XCQA 1YHQF 4C4WC 2QI2A 3J7AR 1VQ5F 3CXCF 4EI7A 3CCLF 1KQSF 2QEXF 3CCVF 1N8RH 3J80M 1IPAA 3D00A 4NUTA 3IR9A 1DT9A 1VQ6F 4BVRA 3I55F 1Q7YH 3E20B 5EWRA 3NK6A 2VGMA 3JAMM 3CPQA 5HXZA 4BVTA 1KD1H 3CCMF 1YI2F 2ALEA 2AIFA 3CC7F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B F;  1RA4 A;  1CN7 A;  1GZ0 A;  2VGN A;  2KTV A;  5GAN K;  3NVI B;  3NVK E;  1ZWZ A;  2HVY D;  4X3M A;  3LFO A;  3NK7 A;  3JCM M;  1QVF F;  3CCJ F;  3OBW A;  3CCS F;  2LBX A;  3OW2 F;  1NJI H;  1VQ8 F;  1YJ9 F;  1VQN F;  5G4U C;  1PXW A;  3CCU F;  3PLA C;  3V7E A;  1YJN F;  1K9M H;  3CPW F;  3RA6 A;  1Q82 H;  3CG6 A;  4TZZ A;  3LWR C;  3CCE F;  1XBI A;  1KC8 H;  2CZW A;  1Q81 H;  3G71 F;  3CD6 F;  5DCV A;  3LWQ C;  1W42 A;  2KG4 A;  2WAL A;  4X3L A;  3G6E F;  1YIT F;  1K73 H;  3CC4 F;  3NMU C;  5EO3 A;  1VQO F;  3E1Y A;  5FJ4 C;  1VQ9 F;  5G4V C;  1VQ4 F;  1YJW F;  2QA4 F;  3CME F;  2OTL F;  4BW0 B;  3CCR F;  1VQK F;  2JNB A;  2OHW A;  1M1K H;  3CCQ F;  4BY9 D;  1S72 F;  1VQ7 F;  1K8A H;  1M90 H;  1VQL F;  1QVG F;  5A2Q M;  3SIU A;  5GIO C;  1W41 A;  5FLX M;  5GAP K;  3SIV A;  3N4Z A;  3VI6 A;  1X7O A;  1W3E X;  1T0K B;  1Q86 H;  3LWO C;  3LWP C;  2KTU A;  3J81 M;  3MCA B;  1X52 A;  1CK2 A;  3GYQ A;  3V7Q A;  4LCK A;  5IT9 M;  2FC3 A;  2BO1 A;  3I56 F;  3RA5 A;  5GIN C;  1YIJ F;  3OBY A;  1GO1 A;  1JJ2 F;  1GO0 A;  3HJW C;  2I6D A;  2OZB A;  3HAX D;  3N4Y A;  1NMU B;  1W40 A;  5GIP C;  3AGK A;  3O85 A;  3VMF B;  3PAF A;  2LBW A;  1VQM F;  3WXM B;  3G4S F;  3FFM A;  1H7M A;  1SDS A;  1VQP F;  1RLG A;  1E7K A;  1X7P A;  3CC2 F;  3LWV C;  2OTJ F;  3ON1 A;  3CMA F;  1YHQ F;  4C4W C;  2QI2 A;  3J7A R;  1VQ5 F;  3CXC F;  3CCL F;  1KQS F;  2QEX F;  3CCV F;  1N8R H;  3J80 M;  1IPA A;  4NUT A;  3IR9 A;  1DT9 A;  1VQ6 F;  3I55 F;  1Q7Y H;  3E20 B;  5EWR A;  3NK6 A;  2VGM A;  3JAM M;  3CPQ A;  1KD1 H;  3CCM F;  1YI2 F;  2ALE A;  2AIF A;  3CC7 F; 
#chains in the Genus database with same CATH topology
 1SZQ A;  4F6R B;  5GAN K;  5CA0 A;  3GTZ A;  4DXD A;  4X3M A;  4U3J A;  3OW2 F;  1H48 A;  4HNA B;  1VQN F;  3JAW A;  3F0F A;  2HRY A;  3CPW F;  3JAR B;  3N2K B;  4TV9 A;  4TZZ A;  3IMP A;  3VYU C;  1KC8 H;  5FNV B;  2DT4 A;  3HKE B;  4RQO A;  4ZK7 A;  1ODE A;  1Q81 H;  4NWO B;  2W8B C;  3LWQ C;  5EIB D;  5KMG B;  1JD1 A;  1K73 H;  3MQW A;  2NMU A;  1IV1 A;  3TD3 A;  5EO3 A;  5LA6 A;  5FJ4 C;  1VQ9 F;  3C9R A;  3K0T A;  5G4V C;  3E22 A;  4ZHY B;  2OTL F;  2EWC A;  4X1Y B;  2HS0 A;  2RHH A;  3CYP B;  1M1K H;  2G9I A;  1W5A A;  4ZOL A;  5JH7 B;  1K8A H;  3K12 A;  1W59 A;  4C8I A;  1X25 A;  3JAT B;  4O4J B;  5JVD B;  2BTO A;  5EYP B;  3RYH A;  4BT2 A;  5BMV B;  3DDN A;  4FFB A;  3ZP4 A;  4ZI7 A;  4IIJ B;  4EB6 A;  1W3E X;  5GON A;  1Q86 H;  3LWO C;  5EB0 A;  3CB2 A;  3LWP C;  3J81 M;  3GYQ A;  5IT9 M;  3HKC B;  4BT5 A;  5LXT A;  3QHD A;  5ITZ B;  1U3L A;  4HNA A;  3D54 A;  1YQN A;  1GO1 A;  2PMP A;  5CA1 A;  2PHN A;  3N4Y A;  4EI8 A;  5LOV B;  2LCA A;  3LME A;  5GIP C;  1XHO A;  1U40 A;  2Z01 A;  2ZF8 A;  2HS3 A;  3F0G A;  3G4S F;  1H7M A;  1FNJ A;  4I50 B;  2HS4 A;  4YJ3 A;  3FD5 A;  5C8Y B;  3I3F A;  3LWV C;  3N2G B;  3CMA F;  1YHQ F;  3J7A R;  2UZH A;  3CXC F;  3RYF A;  2AIZ P;  3CCV F;  4M8I A;  4NUT A;  3D00 A;  3IR9 A;  5JH7 A;  3ZP7 A;  5CB4 A;  1IV4 A;  3E20 B;  4G4V A;  3ELC A;  2UYJ A;  4B62 A;  4U39 A;  4E6E A;  3ZOP A;  4I55 A;  3CC7 F;  4B46 A;  5JQG A;  2CHS A;  1QVF F;  4NQ3 A;  3OBW A;  2B33 A;  4TV8 A;  4YJ2 A;  1SA0 B;  1VQ8 F;  3VOB A;  3WPX A;  4O2A A;  4O4L A;  3D01 A;  3RA6 A;  2H6L A;  4ZHQ B;  1XBI A;  3RYI A;  2UYN B;  2CZW A;  2F9Z C;  3G71 F;  3L7Q A;  1W57 A;  2CVL A;  2WAL A;  1YIT F;  3G6E F;  4DRX B;  3U0O A;  1RQ2 A;  3E1Y A;  4X1K A;  1DBF A;  1NQ3 A;  5MN4 A;  1YGY A;  3MDO A;  5EZY A;  3N2G A;  3HKB B;  3UT5 A;  5HY2 A;  3CCR F;  2CW4 A;  3K14 A;  3VCZ A;  4O4H B;  2CHT A;  3CCQ F;  1ONI A;  4BY9 D;  3HTN A;  2I6R A;  5KX5 B;  1IV2 A;  1W5F A;  1PF5 A;  5IJ9 B;  1VQL F;  2H8E A;  3F0D A;  3HKD B;  3RYC B;  1TUB A;  2HRU A;  4BVQ A;  2MQE A;  3SIV A;  5IJ0 B;  4WBN B;  2V9Y A;  3VO8 A;  3MCA B;  3V7Q A;  1CK2 A;  4BT7 A;  4LCK A;  2FC3 A;  1FFX A;  1U43 A;  2RHJ A;  3S02 A;  2BTQ B;  3RA5 A;  2Q1X A;  2VAM A;  5LYJ B;  5HXU A;  3OBY A;  2BTU A;  5IYZ A;  3KHN A;  3ZO8 A;  1JJ2 F;  2HP0 A;  1JFF B;  2UYN A;  1NMU B;  3F0E A;  2DYY A;  4EI9 A;  3DC2 A;  3QUW A;  3AGK A;  3JAL B;  4R40 B;  3TD5 A;  2L26 A;  3WGN A;  2LBW A;  3Q8H A;  1CLI A;  4TUY B;  1SDS A;  2YYE A;  5J2U B;  1RLG A;  5JCO C;  4F6R A;  1E7K A;  2N48 A;  3ON1 A;  3KJK A;  4XCQ A;  2R6R 1;  2IAF A;  1VQ5 F;  1KQS F;  3VIU A;  3C8L A;  2IQQ A;  2Z1U A;  1N8R H;  3J80 M;  4IHJ B;  5MN6 A;  5JCO A;  5J2T B;  1DT9 A;  3I55 F;  2Z1F A;  3JAR A;  3N2K A;  4G4W A;  3HKD A;  1VHA A;  5FNV A;  3NK6 A;  3HKE A;  3RYC A;  4O2B B;  5HP7 A;  5HXZ A;  5KMG A;  3CCM F;  2ALE A;  5G4U C;  3WGM A;  3NVI B;  3P10 A;  4I4T B;  3T80 A;  4X1Y A;  3CCJ F;  1QAH A;  3CCS F;  2LBX A;  1NJI H;  3WPW A;  3CCU F;  3V7E A;  5HY0 A;  1K9M H;  3P4E A;  4X1I B;  4ZHV A;  3JVH A;  1JY8 A;  3CCE F;  3JAT A;  4O4J A;  5JVD A;  5EIB C;  5DCV A;  5EYP A;  3JAS B;  3VOA A;  4C81 A;  5BMV A;  1W42 A;  2KG4 A;  1W5B A;  3EOR A;  4IIJ A;  3MCQ A;  3BYQ A;  4G4Y A;  4BVS A;  3WJR A;  5CA0 B;  1YJW F;  1VQ4 F;  4C82 A;  2QA4 F;  3KIZ A;  3CME F;  1KNJ A;  2ZVY A;  4BW0 B;  3HKC A;  4C8E A;  4U3J B;  3WJQ A;  1FSZ A;  5ITZ A;  4LNU B;  1Z5W A;  2JNB A;  2OHW A;  1W58 1;  1VQK F;  1QU9 A;  2K1S A;  3S0W A;  1QD9 A;  3JAW B;  1FNK A;  1VQ7 F;  1XRG A;  4TV9 B;  5A2Q M;  3SIU A;  1W41 A;  5LOV A;  3IEQ A;  2FGY A;  3N4Z A;  4O4I B;  5LA6 B;  2QTP A;  4I50 A;  2KTU A;  3E22 B;  1X52 A;  5C8Y A;  3TD4 A;  1U3P A;  4I4T A;  1OAP A;  4B45 A;  1UFY A;  3FD6 A;  3OON A;  5GIN C;  2GZL A;  3VTI C;  1YIJ F;  2HQS C;  4ZOL B;  3S06 A;  3S0Y A;  3JAK B;  4B5C A;  3RYH B;  3HAX D;  3JAS A;  4FFB B;  4PWT A;  3O85 A;  2VAP A;  4ZI7 B;  4EB6 B;  1VQM F;  5GON B;  3M4S A;  3VYT C;  5LXT B;  1TVK B;  1X7P A;  2UYK A;  3WGK A;  5EAZ A;  2R75 1;  4C4W C;  4LNU A;  4EI7 A;  5B8F A;  3CCL F;  1R1M A;  1SA0 A;  4C8G A;  1W5E A;  1IPA A;  1VH8 A;  4BT6 A;  5CA1 B;  3S03 A;  1VQ6 F;  2Z1E A;  2Z1T A;  3VYS C;  1Q7Y H;  4ZHQ A;  1GX1 A;  5EWR A;  2RHO A;  3CPQ A;  4BVT A;  4O4I A;  4DRX A;  2AIF A;  1H47 A;  2ZOD A;  1RA4 A;  4YJ3 B;  1W2B F;  3IEW A;  1CN7 A;  1GZ0 A;  2VGN A;  2KTV A;  1T0A A;  3NVK E;  1ZWZ A;  1KNK A;  2HVY D;  3HKB A;  3LFO A;  3NK7 A;  3JCM M;  3V4D A;  3RYF B;  4O4H A;  4X20 B;  1YJ9 F;  2Q1Y A;  1PXW A;  5HY1 A;  3IKF A;  3PLA C;  2HP3 A;  3WGJ A;  1YJN F;  3JAK A;  5KX5 A;  5CB4 B;  1Q82 H;  3B6N A;  3CG6 A;  3LDT A;  4G88 A;  5IJ9 A;  1J7H A;  3LWR C;  3FPI A;  1W55 A;  3C9U A;  3C9T A;  4G4X A;  3KE1 A;  3CD6 F;  5HP8 A;  4X3L A;  5LP6 B;  3KJJ A;  3M84 A;  4I55 B;  3RE3 A;  5IJ0 A;  3CC4 F;  4WBN A;  4RHA A;  3NMU C;  1VQO F;  3WGL A;  1COM A;  2LBT A;  3WJP A;  5MN5 A;  1TVK A;  3ESJ A;  5JQG B;  4TV8 B;  4YJ2 B;  1VK3 A;  4BT4 A;  4ZHW A;  3MBM A;  1S72 F;  5LYJ A;  3C9S A;  4O2A B;  4O4L B;  2OTM A;  2VAW A;  1M90 H;  1UI9 A;  1QVG F;  1JFF A;  2KGW A;  3LYB A;  3RYI B;  2GLZ A;  5GIO C;  1RLU A;  5FLX M;  5GAP K;  2UYP A;  3K2X A;  1RQ7 A;  3JAL A;  3VI6 A;  1X7O A;  1T0K B;  1XV2 A;  4X1K B;  5AVM A;  4TUY A;  3P0Z A;  5EZY B;  1Q8R A;  5J2U A;  3UT5 B;  3S0H A;  2BO1 A;  1VQV A;  3I56 F;  5EB1 B;  3M1X A;  3IKE A;  3V3T A;  4X20 A;  4BT3 A;  5LP6 C;  1Z5V A;  4IHJ A;  1GO0 A;  5J2T A;  2H8C A;  3HJW C;  2P6Y A;  2I6D A;  2OZB A;  3I7T A;  2AMT A;  1W40 A;  1TUB B;  4ERH A;  2GVI A;  5LP6 A;  4O2B A;  3FBA A;  3PAF A;  5HY4 A;  3VMF B;  2HX0 A;  3WXM B;  3FFM A;  2CWJ A;  4G4Z A;  1VQP F;  5HWE A;  3CC2 F;  1FFX B;  2YXZ A;  3GHZ A;  2OTJ F;  3ERN A;  1OFU A;  2QI2 A;  5IYZ B;  2QEX F;  3F6M A;  2IG8 A;  2CSL A;  2HP0 B;  3QTY A;  4BVR A;  4X1I A;  1IV3 A;  2VXY A;  2RB9 A;  2ZAU A;  3HWU A;  3R0P A;  2VGM A;  3CYQ A;  4KWE A;  3JAM M;  2ZOV A;  2ZVZ A;  2RHL A;  1KD1 H;  1YI2 F;  1JN1 A; 
#chains in the Genus database with same CATH homology
 1W2B F;  1RA4 A;  1CN7 A;  1GZ0 A;  2VGN A;  2KTV A;  5GAN K;  3NVI B;  3NVK E;  1ZWZ A;  2HVY D;  4X3M A;  3LFO A;  3NK7 A;  3JCM M;  1QVF F;  3CCJ F;  4NQ3 A;  3OBW A;  3CCS F;  2LBX A;  3OW2 F;  1NJI H;  1VQ8 F;  1YJ9 F;  1VQN F;  5G4U C;  1PXW A;  5HY1 A;  3CCU F;  3PLA C;  3V7E A;  5HY0 A;  1YJN F;  1K9M H;  3CPW F;  3RA6 A;  1Q82 H;  3CG6 A;  4TZZ A;  3LWR C;  3CCE F;  1XBI A;  1KC8 H;  2CZW A;  2F9Z C;  3G71 F;  1Q81 H;  3CD6 F;  5DCV A;  3LWQ C;  1W42 A;  2KG4 A;  2WAL A;  4X3L A;  3G6E F;  1YIT F;  1K73 H;  3CC4 F;  3NMU C;  5EO3 A;  1VQO F;  3E1Y A;  5FJ4 C;  1VQ9 F;  5G4V C;  4BVS A;  1VQ4 F;  1YJW F;  2QA4 F;  3CME F;  2OTL F;  4BW0 B;  5HY2 A;  3CCR F;  1VQK F;  2JNB A;  2OHW A;  1M1K H;  3CCQ F;  4BY9 D;  1S72 F;  1VQ7 F;  1K8A H;  1M90 H;  1VQL F;  1QVG F;  5A2Q M;  3SIU A;  2GLZ A;  5GIO C;  1W41 A;  5FLX M;  5GAP K;  2FGY A;  4BVQ A;  3SIV A;  3N4Z A;  3VI6 A;  1X7O A;  1W3E X;  1T0K B;  1Q86 H;  3LWO C;  3LWP C;  2KTU A;  3J81 M;  3MCA B;  1X52 A;  1CK2 A;  3GYQ A;  3V7Q A;  4LCK A;  5IT9 M;  2FC3 A;  2BO1 A;  3I56 F;  3RA5 A;  5GIN C;  3V3T A;  1YIJ F;  5HXU A;  3OBY A;  1GO1 A;  1JJ2 F;  1GO0 A;  3HJW C;  2I6D A;  2OZB A;  3HAX D;  4EI8 A;  3N4Y A;  1NMU B;  1W40 A;  4EI9 A;  5GIP C;  3AGK A;  3O85 A;  5HY4 A;  3PAF A;  2LBW A;  3VMF B;  1VQM F;  3WXM B;  3G4S F;  3FFM A;  1H7M A;  1SDS A;  1VQP F;  1RLG A;  5HWE A;  1E7K A;  1X7P A;  3CC2 F;  3LWV C;  2OTJ F;  3ON1 A;  3CMA F;  4XCQ A;  1YHQ F;  4C4W C;  2QI2 A;  3J7A R;  1VQ5 F;  3CXC F;  4EI7 A;  3CCL F;  1KQS F;  2QEX F;  3CCV F;  1N8R H;  3J80 M;  1IPA A;  3D00 A;  4NUT A;  3IR9 A;  1DT9 A;  1VQ6 F;  4BVR A;  3I55 F;  1Q7Y H;  3E20 B;  5EWR A;  3NK6 A;  2VGM A;  3JAM M;  3CPQ A;  5HXZ A;  4BVT A;  1KD1 H;  3CCM F;  1YI2 F;  2ALE A;  2AIF A;  3CC7 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...