2OHWA

Crystal structure of the yuei protein from bacillus subtilis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
128
structure length
128
Chain Sequence
EDKMDLYLQQGMYGPLETKPDERHLFLGSLRERVVLALTKGQVLRSKPYKEAEHELKNSHNVTLLINGELQYQSYSSYIQMASRYGVPFKIVSDLQFHTPLGIVIAADIAVNRELIYIQDDIYNRSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YueI protein
publication title Crystal structure of the YueI protein from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 37
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07997 DUF1694 Protein of unknown function (DUF1694)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 2ohwA00
3CG6A 3I55F 1VQNF 1GO1A 2QA4F 1NMUB 3O85A 2OTJF 3J80M 3CCQF 1CK2A 1KC8H 4BY9D 1VQOF 1VQ6F 5GAPK 1VQ4F 3LFOA 1N8RH 1KQSF 3J81M 3GYQA 2QI2A 5EWRA 2KTVA 3J7AR 1VQ8F 3FFMA 2HVYD 4BW0B 3CPWF 3CCVF 3VI6A 5A2QM 3NK7A 3V7EA 4X3MA 1VQLF 3SIUA 5DCVA 3LWPC 3CCLF 1VQPF 1RA4A 3LWQC 1QVFF 1W2BF 3WXMB 3IR9A 3CMEF 1YITF 1Q82H 3OBYA 1M90H 2OHWA 1YI2F 3OBWA 1Q86H 1H7MA 3CCEF 5G4VC 3RA5A 3SIVA 1X7OA 3NK6A 3NVKE 2VGNA 3LWOC 1T0KB 1VQ9F 2KTUA 5GIOC 5GINC 4NUTA 3CPQA 3N4YA 2OTLF 1XBIA 3AGKA 3PAFA 5EO3A 1W40A 3CCSF 1SDSA 3E1YA 1ZWZA 3JCMM 3G4SF 1CN7A 5IT9M 1W41A 1PXWA 3G6EF 1X7PA 5FJ4C 1KD1H 5G4UC 3CCJF 3G71F 4C4WC 2OZBA 3RA6A 3JAMM 2LBXA 3OW2F 1GZ0A 1QVGF 1YHQF 3I56F 1K8AH 5GIPC 3CC2F 5FLXM 3ON1A 5GANK 2BO1A 1YIJF 4TZZA 1JJ2F 3V7QA 1VQ7F 1W3EX 3CCRF 3HAXD 2VGMA 1S72F 4LCKA 1DT9A 3CCUF 3CC7F 2WALA 3CXCF 3CD6F 3NVIB 3PLAC 1W42A 2I6DA 3HJWC 3CC4F 1K9MH 3LWRC 2LBWA 1GO0A 3CMAF 3E20B 1K73H 1YJNF 1VQ5F 3CCMF 1Q7YH 2QEXF 3VMFB 1X52A 1IPAA 3NMUC 3N4ZA 3LWVC 1YJWF 3MCAB 2ALEA 1E7KA 1VQKF 2CZWA 2JNBA 1NJIH 1M1KH 1RLGA 1YJ9F 2AIFA 2FC3A 1Q81H 2KG4A 1VQMF 4X3LA
chains in the Genus database with same CATH superfamily
5EIBC 2ZF8A 1VQNF 2NMUA 1NMUB 4HNAA 1GX1A 3MDOA 1CK2A 4TV8A 1KC8H 3B6NA 1N8RH 1KQSF 2QI2A 3TD3A 1VQVA 2BTQB 2I6RA 3JVHA 2HVYD 1RQ2A 3CPWF 2CSLA 3IKEA 4X20B 3N2KB 4X3MA 1VQLF 3SIUA 1VQPF 5KX5A 3EORA 1R1MA 2VXYA 3RYFB 3WXMB 4X1YA 3UT5B 3K0TA 3M1XA 2IQQA 3ERNA 3RA5A 4BT5A 3NVKE 1PF5A 3S06A 4U3JB 4B62A 2HS4A 4ZHVA 3VO8A 3L7QA 1JD1A 5GINC 2UYNB 3CB2A 2K1SA 1JN1A 3WJRA 1XBIA 1W5FA 3AGKA 3JASB 3ZP7A 4ZI7B 4C8EA 1COMA 3KIZA 5GONA 3PAFA 1SDSA 5LA6A 1J7HA 3JATA 4YJ2A 3D54A 5J2UA 2GZLA 5IJ9A 5JCOC 1PXWA 3C9UA 4O4LB 2F9ZC 1X25A 3JAMM 3HKDA 5C8YB 3RYCB 3I56F 2R751 5GIPC 1JFFB 4DRXA 5GANK 4ZHQB 3VOBA 1TVKA 4B45A 4B46A 1OFUA 4HNAB 1W3EX 3CCRF 4TV8B 1W5AA 3CCUF 2HRYA 1XHOA 2ZODA 3CD6F 2ZVZA 3K12A 4I4TA 3C9TA 4O2BA 5MN5A 4C81A 2HP3A 2LBWA 4I55A 3VTIC 4BVTA 1YJNF 4G4XA 1UI9A 2Z1UA 4C82A 5KX5B 2RHHA 2DYYA 2QEXF 1JY8A 4ZK7A 1VK3A 3LWVC 4X1YB 2PHNA 2UYKA 3P10A 3K2XA 1E7KA 4O4JA 1M1KH 4R40B 3JAKA 1U3LA 3V3TA 4I50A 2RHOA 4NQ3A 3MCQA 4PWTA 3FPIA 2KGWA 4EI9A 1QD9A 1W55A 3WGJA 1ODEA 2BTOA 3CG6A 3I55F 1Q8RA 3VYTC 3GHZA 4EI7A 2H8EA 1UFYA 2R6R1 3N2GA 4M8IA 3WGNA 3WJQA 1VQOF 1VQ6F 5GAPK 1VQ4F 5B8FA 3HKCA 5GONB 5EWRA 1VQ8F 5LA6B 3FFMA 3JATB 4BW0B 5J2UB 5IJ9B 4XCQA 5ITZA 5A2QM 3V7EA 1VH8A 5DCVA 2GLZA 3CCLF 2P6YA 3TD4A 3HKDB 3LWQC 5HP7A 1SA0A 5JVDA 1W2BF 2CHTA 1YITF 3JARA 1Q82H 4BT6A 4TV9A 4DRXB 1TVKB 4BVQA 3HWUA 1H7MA 3CCEF 5G4VC 5JQGA 3NK6A 4X1IA 1VQ9F 3F0DA 5GIOC 5HXUA 4I4TB 4O2BB 1FFXA 3JAWA 5KMGA 2IAFA 3QHDA 1FNKA 3HKBA 4I55B 1W40A 2G9IA 2LCAA 3WGLA 3GTZA 3JCMM 4F6RA 4G4VA 3C9SA 5EZYA 2UYJA 3JALA 3G71F 4C4WC 3E22A 4O4JB 1IV2A 2Z01A 5HP8A 4EI8A 3JAKB 1W5EA 2AMTA 1YHQF 4I50B 1K8AH 1U3PA 3RYIA 3CC2F 5EIBD 1YIJF 2BO1A 5IYZA 3V7QA 2RHLA 3QUWA 3N2GB 4ZOLA 1S72F 4LCKA 1U43A 3ZP4A 3CC7F 2Z1FA 3K14A 3DDNA 3HKCB 2CWJA 2UYPA 4EB6A 5ITZB 5LP6A 1T0AA 3CMAF 1VQ5F 5LXTA 3CCMF 1Q7YH 4O4HA 1SA0B 5JVDB 5HY1A 3WPWA 3JARB 3NMUC 2V9YA 4TV9B 4YJ3A 2ALEA 1VQKF 2CZWA 2JNBA 3S0YA 3KJKA 1NJIH 1XRGA 5CA0A 2FGYA 3D00A 1YJ9F 5JQGB 1Z5VA 2L26A 2HS3A 4X1IB 1VQMF 1GO1A 2GVIA 2QA4F 1IV3A 1DBFA 3I7TA 2EWCA 3C8LA 1FFXB 3JAWB 3CCQF 5KMGB 1YQNA 4BY9D 1VHAA 3HKBB 3LFOA 3OONA 3J81M 3GYQA 5JH7B 2B33A 3J7AR 3KJJA 2Q1XA 4F6RB 5HY0A 3CCVF 2HS0A 4X1KA 3NK7A 5EZYB 2Q1YA 1QAHA 4BT7A 3JALB 3VCZA 3VOAA 3VIUA 5MN6A 3E22B 3LWPC 4O4IA 4C8IA 1RA4A 1QVFF 2ZVYA 4G4YA 3KE1A 3CMEF 3RYIB 1KNJA 1FNJA 1M90H 5IYZB 3S03A 2W8BC 3OBWA 5EYPA 3SIVA 1X7OA 3LYBA 2PMPA 2VGNA 4ZOLB 3LWOC 2RHJA 2KTUA 3QTYA 1FSZA 1RQ7A 4KWEA 3IMPA 2HQSC 2VAWA 4NUTA 3N4YA 2RB9A 1W57A 4EB6B 2MQEA 5CB4A 3C9RA 5J2TA 5LP6B 5EO3A 3CCSF 4G88A 5LXTB 1ZWZA 2ZOVA 3S0HA 3KHNA 1CN7A 3HTNA 4O4HB 5IJ0A 1W41A 3WPXA 1TUBA 5HWEA 3M84A 3RE3A 3CCJF 1RLUA 4YJ3B 1H48A 3F6MA 1KNKA 2HP0A 4U39A 1SZQA 3OW2F 5EB0A 5CA0B 1GZ0A 1QVGF 3S02A 3U0OA 3ON1A 4RQOA 2VAPA 1JJ2F 2YXZA 4IIJA 3ZOPA 2VGMA 4WBNA 1H47A 5HXZA 1XV2A 1DT9A 2YYEA 5JH7A 2WALA 3VYSC 3NVIB 4C8GA 5LOVA 1W42A 4BT3A 3CC4F 4X1KB 3LDTA 2QTPA 4DXDA 3LMEA 2H8CA 4O4IB 3VMFB 1W5BA 1IPAA 3N4ZA 5BMVA 2IG8A 2ZAUA 2CVLA 3FBAA 4BVRA 2Z1EA 1RLGA 4LNUA 2HRUA 5EAZA 5EYPB 3D01A 4FFBA 5EB1B 2FC3A 2Z1TA 2VAMA 1IV4A 1Z5WA 3O85A 2OTJF 3J80M 4TUYA 4O2AA 3WGMA 1YGYA 5CB4B 5J2TB 3F0FA 3ZO8A 2KTVA 2LBTA 4IHJA 5AVMA 3S0WA 3VI6A 5IJ0B 1QU9A 1TUBB 3MBMA 3WJPA 4BVSA 5FNVA 3HKEA 4NWOB 2HP0B 2H6LA 3I3FA 4G4WA 2N48A 5MN4A 5LYJA 2AIZP 3IR9A 3RYHA 3OBYA 4ERHA 2DT4A 5CA1A 2OHWA 1YI2F 1Q86H 3R0PA 1ONIA 3P4EA 4IIJB 3VYUC 4WBNB 1T0KB 3MQWA 1W59A 1U40A 3FD6A 2UZHA 1IV1A 3CPQA 1NQ3A 5LOVB 4ZHYB 2HX0A 2OTLF 3BYQA 3E1YA 4X20A 3G4SF 5IT9M 3G6EF 3CYPB 1X7PA 5FJ4C 1KD1H 5G4UC 3N2KA 5HY4A 3V4DA 5BMVB 2OZBA 3RA6A 3DC2A 2LBXA 3T80A 4BT2A 4LNUB 2OTMA 3IEWA 4RHAA 3RYFA 3IEQA 3UT5A 4FFBB 5FLXM 2BTUA 4BT4A 4TZZA 1VQ7F 3Q8HA 5HY2A 1OAPA 3ELCA 3HAXD 4TUYB 3ESJA 4O2AB 3WGKA 4U3JA 4B5CA 3CXCF 2UYNA 5LP6C 2CW4A 4IHJB 3PLAC 3JASA 2I6DA 4ZI7A 3TD5A 3HJWC 1K9MH 3LWRC 1GO0A 3FD5A 1K73H 3E20B 3CYQA 5FNVB 5JCOA 4G4ZA 3HKEB 2CHSA 1X52A 4YJ2B 1W581 4O4LA 3F0GA 5LYJB 3RYHB 3P0ZA 1YJWF 3MCAB 3IKFA 5CA1B 3M4SA 5C8YA 3RYCA 1CLIA 2AIFA 3F0EA 4ZHWA 1Q81H 2KG4A 1JFFA 4ZHQA 4E6EA 4X3LA
chains in the Genus database with same CATH topology
3CG6A 3I55F 1VQNF 1GO1A 2QA4F 1NMUB 3O85A 2OTJF 3J80M 4EI7A 3CCQF 1CK2A 1KC8H 4BY9D 1VQOF 1VQ6F 5GAPK 1VQ4F 3LFOA 1N8RH 1KQSF 3J81M 3GYQA 2QI2A 5EWRA 2KTVA 3J7AR 1VQ8F 3FFMA 2HVYD 4BW0B 5HY0A 3CPWF 3CCVF 4XCQA 3VI6A 5A2QM 3NK7A 3V7EA 4BVSA 4X3MA 1VQLF 3SIUA 5DCVA 2GLZA 3LWPC 3CCLF 1VQPF 1RA4A 3LWQC 1QVFF 1W2BF 3WXMB 3IR9A 3CMEF 1YITF 1Q82H 3OBYA 1M90H 2OHWA 1YI2F 4BVQA 3OBWA 1Q86H 1H7MA 3CCEF 5G4VC 3RA5A 3SIVA 1X7OA 3NK6A 3NVKE 2VGNA 3LWOC 1T0KB 1VQ9F 2KTUA 5GIOC 5HXUA 5GINC 4NUTA 3CPQA 3N4YA 2OTLF 1XBIA 3AGKA 3PAFA 5EO3A 1W40A 3CCSF 1SDSA 3E1YA 1ZWZA 3JCMM 3G4SF 1CN7A 5IT9M 1W41A 1PXWA 3G6EF 1X7PA 5FJ4C 1KD1H 5HWEA 5G4UC 3CCJF 3G71F 5HY4A 2F9ZC 4C4WC 2OZBA 3RA6A 3JAMM 2LBXA 4EI8A 3OW2F 1GZ0A 1QVGF 1YHQF 3I56F 1K8AH 5GIPC 3CC2F 5FLXM 3ON1A 5GANK 2BO1A 1YIJF 4TZZA 1JJ2F 3V7QA 1VQ7F 5HY2A 1W3EX 3CCRF 3HAXD 2VGMA 5HXZA 1S72F 4LCKA 1DT9A 3CCUF 3CC7F 2WALA 3CXCF 3CD6F 3NVIB 3PLAC 1W42A 2I6DA 3HJWC 3CC4F 1K9MH 3LWRC 2LBWA 1GO0A 3CMAF 3E20B 4BVTA 1YJNF 1K73H 1VQ5F 3CCMF 1Q7YH 2QEXF 3VMFB 1X52A 5HY1A 1IPAA 3NMUC 3N4ZA 3LWVC 1YJWF 3MCAB 2ALEA 1E7KA 1VQKF 2CZWA 2JNBA 4BVRA 1NJIH 1M1KH 1RLGA 2FGYA 3D00A 1YJ9F 3V3TA 4NQ3A 2AIFA 4EI9A 2FC3A 1Q81H 2KG4A 1VQMF 4X3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CG6 A;  3I55 F;  1VQN F;  1GO1 A;  2QA4 F;  1NMU B;  3O85 A;  2OTJ F;  3J80 M;  3CCQ F;  1CK2 A;  1KC8 H;  4BY9 D;  1VQO F;  1VQ6 F;  5GAP K;  1VQ4 F;  3LFO A;  1N8R H;  1KQS F;  3J81 M;  3GYQ A;  2QI2 A;  5EWR A;  2KTV A;  3J7A R;  1VQ8 F;  3FFM A;  2HVY D;  4BW0 B;  3CPW F;  3CCV F;  3VI6 A;  5A2Q M;  3NK7 A;  3V7E A;  4X3M A;  1VQL F;  3SIU A;  5DCV A;  3LWP C;  3CCL F;  1VQP F;  1RA4 A;  3LWQ C;  1QVF F;  1W2B F;  3WXM B;  3IR9 A;  3CME F;  1YIT F;  1Q82 H;  3OBY A;  1M90 H;  2OHW A;  1YI2 F;  3OBW A;  1Q86 H;  1H7M A;  3CCE F;  5G4V C;  3RA5 A;  3SIV A;  1X7O A;  3NK6 A;  3NVK E;  2VGN A;  3LWO C;  1T0K B;  1VQ9 F;  2KTU A;  5GIO C;  5GIN C;  4NUT A;  3CPQ A;  3N4Y A;  2OTL F;  1XBI A;  3AGK A;  3PAF A;  5EO3 A;  1W40 A;  3CCS F;  1SDS A;  3E1Y A;  1ZWZ A;  3JCM M;  3G4S F;  1CN7 A;  5IT9 M;  1W41 A;  1PXW A;  3G6E F;  1X7P A;  5FJ4 C;  1KD1 H;  5G4U C;  3CCJ F;  3G71 F;  4C4W C;  2OZB A;  3RA6 A;  3JAM M;  2LBX A;  3OW2 F;  1GZ0 A;  1QVG F;  1YHQ F;  3I56 F;  1K8A H;  5GIP C;  3CC2 F;  5FLX M;  3ON1 A;  5GAN K;  2BO1 A;  1YIJ F;  4TZZ A;  1JJ2 F;  3V7Q A;  1VQ7 F;  1W3E X;  3CCR F;  3HAX D;  2VGM A;  1S72 F;  4LCK A;  1DT9 A;  3CCU F;  3CC7 F;  2WAL A;  3CXC F;  3CD6 F;  3NVI B;  3PLA C;  1W42 A;  2I6D A;  3HJW C;  3CC4 F;  1K9M H;  3LWR C;  2LBW A;  1GO0 A;  3CMA F;  3E20 B;  1K73 H;  1YJN F;  1VQ5 F;  3CCM F;  1Q7Y H;  2QEX F;  3VMF B;  1X52 A;  1IPA A;  3NMU C;  3N4Z A;  3LWV C;  1YJW F;  3MCA B;  2ALE A;  1E7K A;  1VQK F;  2CZW A;  2JNB A;  1NJI H;  1M1K H;  1RLG A;  1YJ9 F;  2AIF A;  2FC3 A;  1Q81 H;  2KG4 A;  1VQM F;  4X3L A; 
#chains in the Genus database with same CATH topology
 5EIB C;  2ZF8 A;  1VQN F;  2NMU A;  1NMU B;  4HNA A;  1GX1 A;  3MDO A;  1CK2 A;  4TV8 A;  1KC8 H;  3B6N A;  1N8R H;  1KQS F;  2QI2 A;  3TD3 A;  1VQV A;  2BTQ B;  2I6R A;  3JVH A;  2HVY D;  1RQ2 A;  3CPW F;  2CSL A;  3IKE A;  4X20 B;  3N2K B;  4X3M A;  1VQL F;  3SIU A;  1VQP F;  5KX5 A;  3EOR A;  1R1M A;  2VXY A;  3RYF B;  3WXM B;  4X1Y A;  3UT5 B;  3K0T A;  3M1X A;  2IQQ A;  3ERN A;  3RA5 A;  4BT5 A;  3NVK E;  1PF5 A;  3S06 A;  4U3J B;  4B62 A;  2HS4 A;  4ZHV A;  3VO8 A;  3L7Q A;  1JD1 A;  5GIN C;  2UYN B;  3CB2 A;  2K1S A;  1JN1 A;  3WJR A;  1XBI A;  1W5F A;  3AGK A;  3JAS B;  3ZP7 A;  4ZI7 B;  4C8E A;  1COM A;  3KIZ A;  5GON A;  3PAF A;  1SDS A;  5LA6 A;  1J7H A;  3JAT A;  4YJ2 A;  3D54 A;  5J2U A;  2GZL A;  5IJ9 A;  5JCO C;  1PXW A;  3C9U A;  4O4L B;  2F9Z C;  1X25 A;  3JAM M;  3HKD A;  5C8Y B;  3RYC B;  3I56 F;  2R75 1;  5GIP C;  1JFF B;  4DRX A;  5GAN K;  4ZHQ B;  3VOB A;  1TVK A;  4B45 A;  4B46 A;  1OFU A;  4HNA B;  1W3E X;  3CCR F;  4TV8 B;  1W5A A;  3CCU F;  2HRY A;  1XHO A;  2ZOD A;  3CD6 F;  2ZVZ A;  3K12 A;  4I4T A;  3C9T A;  4O2B A;  5MN5 A;  4C81 A;  2HP3 A;  2LBW A;  4I55 A;  3VTI C;  4BVT A;  1YJN F;  4G4X A;  1UI9 A;  2Z1U A;  4C82 A;  5KX5 B;  2RHH A;  2DYY A;  2QEX F;  1JY8 A;  4ZK7 A;  1VK3 A;  3LWV C;  4X1Y B;  2PHN A;  2UYK A;  3P10 A;  3K2X A;  1E7K A;  4O4J A;  1M1K H;  4R40 B;  3JAK A;  1U3L A;  3V3T A;  4I50 A;  2RHO A;  4NQ3 A;  3MCQ A;  4PWT A;  3FPI A;  2KGW A;  4EI9 A;  1QD9 A;  1W55 A;  3WGJ A;  1ODE A;  2BTO A;  3CG6 A;  3I55 F;  1Q8R A;  3VYT C;  3GHZ A;  4EI7 A;  2H8E A;  1UFY A;  2R6R 1;  3N2G A;  4M8I A;  3WGN A;  3WJQ A;  1VQO F;  1VQ6 F;  5GAP K;  1VQ4 F;  5B8F A;  3HKC A;  5GON B;  5EWR A;  1VQ8 F;  5LA6 B;  3FFM A;  3JAT B;  4BW0 B;  5J2U B;  5IJ9 B;  4XCQ A;  5ITZ A;  5A2Q M;  3V7E A;  1VH8 A;  5DCV A;  2GLZ A;  3CCL F;  2P6Y A;  3TD4 A;  3HKD B;  3LWQ C;  5HP7 A;  1SA0 A;  5JVD A;  1W2B F;  2CHT A;  1YIT F;  3JAR A;  1Q82 H;  4BT6 A;  4TV9 A;  4DRX B;  1TVK B;  4BVQ A;  3HWU A;  1H7M A;  3CCE F;  5G4V C;  5JQG A;  3NK6 A;  4X1I A;  1VQ9 F;  3F0D A;  5GIO C;  5HXU A;  4I4T B;  4O2B B;  1FFX A;  3JAW A;  5KMG A;  2IAF A;  3QHD A;  1FNK A;  3HKB A;  4I55 B;  1W40 A;  2G9I A;  2LCA A;  3WGL A;  3GTZ A;  3JCM M;  4F6R A;  4G4V A;  3C9S A;  5EZY A;  2UYJ A;  3JAL A;  3G71 F;  4C4W C;  3E22 A;  4O4J B;  1IV2 A;  2Z01 A;  5HP8 A;  4EI8 A;  3JAK B;  1W5E A;  2AMT A;  1YHQ F;  4I50 B;  1K8A H;  1U3P A;  3RYI A;  3CC2 F;  5EIB D;  1YIJ F;  2BO1 A;  5IYZ A;  3V7Q A;  2RHL A;  3QUW A;  3N2G B;  4ZOL A;  1S72 F;  4LCK A;  1U43 A;  3ZP4 A;  3CC7 F;  2Z1F A;  3K14 A;  3DDN A;  3HKC B;  2CWJ A;  2UYP A;  4EB6 A;  5ITZ B;  5LP6 A;  1T0A A;  3CMA F;  1VQ5 F;  5LXT A;  3CCM F;  1Q7Y H;  4O4H A;  1SA0 B;  5JVD B;  5HY1 A;  3WPW A;  3JAR B;  3NMU C;  2V9Y A;  4TV9 B;  4YJ3 A;  2ALE A;  1VQK F;  2CZW A;  2JNB A;  3S0Y A;  3KJK A;  1NJI H;  1XRG A;  5CA0 A;  2FGY A;  3D00 A;  1YJ9 F;  5JQG B;  1Z5V A;  2L26 A;  2HS3 A;  4X1I B;  1VQM F;  1GO1 A;  2GVI A;  2QA4 F;  1IV3 A;  1DBF A;  3I7T A;  2EWC A;  3C8L A;  1FFX B;  3JAW B;  3CCQ F;  5KMG B;  1YQN A;  4BY9 D;  1VHA A;  3HKB B;  3LFO A;  3OON A;  3J81 M;  3GYQ A;  5JH7 B;  2B33 A;  3J7A R;  3KJJ A;  2Q1X A;  4F6R B;  5HY0 A;  3CCV F;  2HS0 A;  4X1K A;  3NK7 A;  5EZY B;  2Q1Y A;  1QAH A;  4BT7 A;  3JAL B;  3VCZ A;  3VOA A;  3VIU A;  5MN6 A;  3E22 B;  3LWP C;  4O4I A;  4C8I A;  1RA4 A;  1QVF F;  2ZVY A;  4G4Y A;  3KE1 A;  3CME F;  3RYI B;  1KNJ A;  1FNJ A;  1M90 H;  5IYZ B;  3S03 A;  2W8B C;  3OBW A;  5EYP A;  3SIV A;  1X7O A;  3LYB A;  2PMP A;  2VGN A;  4ZOL B;  3LWO C;  2RHJ A;  2KTU A;  3QTY A;  1FSZ A;  1RQ7 A;  4KWE A;  3IMP A;  2HQS C;  2VAW A;  4NUT A;  3N4Y A;  2RB9 A;  1W57 A;  4EB6 B;  2MQE A;  5CB4 A;  3C9R A;  5J2T A;  5LP6 B;  5EO3 A;  3CCS F;  4G88 A;  5LXT B;  1ZWZ A;  2ZOV A;  3S0H A;  3KHN A;  1CN7 A;  3HTN A;  4O4H B;  5IJ0 A;  1W41 A;  3WPX A;  1TUB A;  5HWE A;  3M84 A;  3RE3 A;  3CCJ F;  1RLU A;  4YJ3 B;  1H48 A;  3F6M A;  1KNK A;  2HP0 A;  4U39 A;  1SZQ A;  3OW2 F;  5EB0 A;  5CA0 B;  1GZ0 A;  1QVG F;  3S02 A;  3U0O A;  3ON1 A;  4RQO A;  2VAP A;  1JJ2 F;  2YXZ A;  4IIJ A;  3ZOP A;  2VGM A;  4WBN A;  1H47 A;  5HXZ A;  1XV2 A;  1DT9 A;  2YYE A;  5JH7 A;  2WAL A;  3VYS C;  3NVI B;  4C8G A;  5LOV A;  1W42 A;  4BT3 A;  3CC4 F;  4X1K B;  3LDT A;  2QTP A;  4DXD A;  3LME A;  2H8C A;  4O4I B;  3VMF B;  1W5B A;  1IPA A;  3N4Z A;  5BMV A;  2IG8 A;  2ZAU A;  2CVL A;  3FBA A;  4BVR A;  2Z1E A;  1RLG A;  4LNU A;  2HRU A;  5EAZ A;  5EYP B;  3D01 A;  4FFB A;  5EB1 B;  2FC3 A;  2Z1T A;  2VAM A;  1IV4 A;  1Z5W A;  3O85 A;  2OTJ F;  3J80 M;  4TUY A;  4O2A A;  3WGM A;  1YGY A;  5CB4 B;  5J2T B;  3F0F A;  3ZO8 A;  2KTV A;  2LBT A;  4IHJ A;  5AVM A;  3S0W A;  3VI6 A;  5IJ0 B;  1QU9 A;  1TUB B;  3MBM A;  3WJP A;  4BVS A;  5FNV A;  3HKE A;  4NWO B;  2HP0 B;  2H6L A;  3I3F A;  4G4W A;  2N48 A;  5MN4 A;  5LYJ A;  2AIZ P;  3IR9 A;  3RYH A;  3OBY A;  4ERH A;  2DT4 A;  5CA1 A;  2OHW A;  1YI2 F;  1Q86 H;  3R0P A;  1ONI A;  3P4E A;  4IIJ B;  3VYU C;  4WBN B;  1T0K B;  3MQW A;  1W59 A;  1U40 A;  3FD6 A;  2UZH A;  1IV1 A;  3CPQ A;  1NQ3 A;  5LOV B;  4ZHY B;  2HX0 A;  2OTL F;  3BYQ A;  3E1Y A;  4X20 A;  3G4S F;  5IT9 M;  3G6E F;  3CYP B;  1X7P A;  5FJ4 C;  1KD1 H;  5G4U C;  3N2K A;  5HY4 A;  3V4D A;  5BMV B;  2OZB A;  3RA6 A;  3DC2 A;  2LBX A;  3T80 A;  4BT2 A;  4LNU B;  2OTM A;  3IEW A;  4RHA A;  3RYF A;  3IEQ A;  3UT5 A;  4FFB B;  5FLX M;  2BTU A;  4BT4 A;  4TZZ A;  1VQ7 F;  3Q8H A;  5HY2 A;  1OAP A;  3ELC A;  3HAX D;  4TUY B;  3ESJ A;  4O2A B;  3WGK A;  4U3J A;  4B5C A;  3CXC F;  2UYN A;  5LP6 C;  2CW4 A;  4IHJ B;  3PLA C;  3JAS A;  2I6D A;  4ZI7 A;  3TD5 A;  3HJW C;  1K9M H;  3LWR C;  1GO0 A;  3FD5 A;  1K73 H;  3E20 B;  3CYQ A;  5FNV B;  5JCO A;  4G4Z A;  3HKE B;  2CHS A;  1X52 A;  4YJ2 B;  1W58 1;  4O4L A;  3F0G A;  5LYJ B;  3RYH B;  3P0Z A;  1YJW F;  3MCA B;  3IKF A;  5CA1 B;  3M4S A;  5C8Y A;  3RYC A;  1CLI A;  2AIF A;  3F0E A;  4ZHW A;  1Q81 H;  2KG4 A;  1JFF A;  4ZHQ A;  4E6E A;  4X3L A; 
#chains in the Genus database with same CATH homology
 3CG6 A;  3I55 F;  1VQN F;  1GO1 A;  2QA4 F;  1NMU B;  3O85 A;  2OTJ F;  3J80 M;  4EI7 A;  3CCQ F;  1CK2 A;  1KC8 H;  4BY9 D;  1VQO F;  1VQ6 F;  5GAP K;  1VQ4 F;  3LFO A;  1N8R H;  1KQS F;  3J81 M;  3GYQ A;  2QI2 A;  5EWR A;  2KTV A;  3J7A R;  1VQ8 F;  3FFM A;  2HVY D;  4BW0 B;  5HY0 A;  3CPW F;  3CCV F;  4XCQ A;  3VI6 A;  5A2Q M;  3NK7 A;  3V7E A;  4BVS A;  4X3M A;  1VQL F;  3SIU A;  5DCV A;  2GLZ A;  3LWP C;  3CCL F;  1VQP F;  1RA4 A;  3LWQ C;  1QVF F;  1W2B F;  3WXM B;  3IR9 A;  3CME F;  1YIT F;  1Q82 H;  3OBY A;  1M90 H;  2OHW A;  1YI2 F;  4BVQ A;  3OBW A;  1Q86 H;  1H7M A;  3CCE F;  5G4V C;  3RA5 A;  3SIV A;  1X7O A;  3NK6 A;  3NVK E;  2VGN A;  3LWO C;  1T0K B;  1VQ9 F;  2KTU A;  5GIO C;  5HXU A;  5GIN C;  4NUT A;  3CPQ A;  3N4Y A;  2OTL F;  1XBI A;  3AGK A;  3PAF A;  5EO3 A;  1W40 A;  3CCS F;  1SDS A;  3E1Y A;  1ZWZ A;  3JCM M;  3G4S F;  1CN7 A;  5IT9 M;  1W41 A;  1PXW A;  3G6E F;  1X7P A;  5FJ4 C;  1KD1 H;  5HWE A;  5G4U C;  3CCJ F;  3G71 F;  5HY4 A;  2F9Z C;  4C4W C;  2OZB A;  3RA6 A;  3JAM M;  2LBX A;  4EI8 A;  3OW2 F;  1GZ0 A;  1QVG F;  1YHQ F;  3I56 F;  1K8A H;  5GIP C;  3CC2 F;  5FLX M;  3ON1 A;  5GAN K;  2BO1 A;  1YIJ F;  4TZZ A;  1JJ2 F;  3V7Q A;  1VQ7 F;  5HY2 A;  1W3E X;  3CCR F;  3HAX D;  2VGM A;  5HXZ A;  1S72 F;  4LCK A;  1DT9 A;  3CCU F;  3CC7 F;  2WAL A;  3CXC F;  3CD6 F;  3NVI B;  3PLA C;  1W42 A;  2I6D A;  3HJW C;  3CC4 F;  1K9M H;  3LWR C;  2LBW A;  1GO0 A;  3CMA F;  3E20 B;  4BVT A;  1YJN F;  1K73 H;  1VQ5 F;  3CCM F;  1Q7Y H;  2QEX F;  3VMF B;  1X52 A;  5HY1 A;  1IPA A;  3NMU C;  3N4Z A;  3LWV C;  1YJW F;  3MCA B;  2ALE A;  1E7K A;  1VQK F;  2CZW A;  2JNB A;  4BVR A;  1NJI H;  1M1K H;  1RLG A;  2FGY A;  3D00 A;  1YJ9 F;  3V3T A;  4NQ3 A;  2AIF A;  4EI9 A;  2FC3 A;  1Q81 H;  2KG4 A;  1VQM F;  4X3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...