2OI8A

Crystal structure of putative regulatory protein sco4313
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
209
structure length
203
Chain Sequence
TPRERYRTQVRAEIKDHAWEQIATAGASALSLNAIAKRMGMSGPALYRYFDGRDELITELIRDAYRSQADSLRAAAASGADLAGLAHALRAWALDDPQRYFLIFGTPVPGYRAPDDITEIAAETMAVIVDACAAGTDGAFDAHLDTHRQWADRPAPSSALHRALSFWSRLHGVLSLELAGQFTGMGFDSALLFEAELKDLLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of tetR family protein SCO4313
rcsb
molecule keywords Putative regulatory protein SCO4313
molecule tags Transcription
source organism Streptomyces coelicolor
total genus 65
structure length 203
sequence length 209
ec nomenclature
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF13305 TetR_C_33 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2oi8A00
2I10A 3G1MA 5FKOA 1BJZA 3CWRA 1QVUA 4W1UA 1RKWA 3PASA 3BR2A 2V57A 2HYJA 5FMPA 1QVTA 3KNWA 3G1OA 3Q3SA 4AUXA 2QWTA 4UDSA 4D5CA 5F08A 2G3BA 3ZQGA 4ABZA 3BR0A 4I76A 3GZIA 3HIMA 5IOZA 3BRUA 3WHCA 1UI5A 3HGYA 5H9TA 5GPAA 4GCTA 2RASA 2REKA 2UXUA 1SGMA 4G12A 3VUQA 2QOPA 2OERA 1JUSA 3V6GA 4MXMA 4PXIA 1JUMA 3KKDA 2F07A 2FBQA 4AC6A 5CXGA 3CRJA 3BQYA 3LSJA 5FKLA 2O7TA 4MK6A 3BR1A 4NN1A 3ZQFA 4W97A 3HE0A 3NPIA 2XGEA 3B6AA 4B1RA 2QCOA 2DG7A 3ON2A 4D7NA 2UXIA 3VOKA 2NS8A 3FK7A 3Q0UA 3F1BA 3IH2A 3RD3A 4DW6A 2NX4A 1Z0XA 4HKUA 2TCTA 4M3EA 2ZCNA 5HSZA 2NP5A 3DCFA 3P9TA 2VPRA 2XPUA 5CXIA 2TRTA 4D7MA 3EUPA 5FKNA 2UXHA 5EZHA 4AF5A 3FK6A 2XB5A 3JSJA 3AQSA 2ID3A 5J1RA 5EYRA 5F1JA 5K7HA 3G7RA 3O8GA 3CDLA 2IBDA 3BJBA 5GP9A 2UXPA 3GEUA 3NNRA 2GUHA 4JNNA 5FKKA 1A6IA 2UXOA 2XPVA 3V78A 3BTIA 2IU5A 5AQCA 2QKOA 4V2FA 3HTIA 2HXIA 5CW8A 1JTYA 5FGLA 3C07A 3LSRA 3WHBA 3NI7A 3BR5A 1ORKA 4M3BA 3ZQHA 3NRGA 3BTCA 2JJ7A 3VOXA 3RH2A 3BTLA 3NXCA 5IPAA 2XRLA 5DAJA 3FRQA 2WV1A 4X1EA 3DPJA 2Q24A 2X6OA 3SDGA 3QPSA 2Y2ZA 3S5RA 2XGDA 2IEKA 3E7QA 5F0FA 5HAWA 2OI8A 3LSPA 3AQTA 1JT6A 4ACIA 1T33A 2FJ1A 4M3DA 5EZGA 5K58A 3SFIA 4V2GA 2HKUA 4M3GA 3G56A 3Q0VA 2VKEA 2WUIA 3HGGA 3VVZA 3C2BA 3CCYA 2G7GA 5FKMA 3PPBA 2ZOYA 4YZEA 3VW2A 3QBMA 2PZ9A 3IH4A 4XK4A 3F0CA 4GFLA 1U9OA 5D18A 1Z77A 3QKXA 2OF7A 5J1YA 3B81A 4GCKA 1JT0A 2HQ5A 5J1UA 4GCLA 3EGQA 2FD5A 3B6CA 3FIWA 3IUVA 2DG8A 2G7LA 2O7OA 2XPWA 3TP3A 2JK3A 1U9NA 2HYTA 5F04A 3BTJA 1ZKGA 3Q0WA 2YVEA 4L62A 2PBXA 3BQZA 3BHQA 3LHQA 3VVXA 4B3AA 3G1LA 1VI0A 4KWAA 3QQAA 5C4YA 2GBYA 5D1RA 2Y31A 3ON4A 3HTJA 5K7ZA 3BT9A 4JYKA 4JKZA 3KZ9A 4M3FA 4I6ZA 2QTQA 5F0HA 3HTAA 5K7FA 2Y30A 2ID6A 2FQ4A 2GENA 1JUPA 2YVHA 2ZB9A 3LWJA 5HBUA 1T56A 3VW0A 5F27A 1UI6A 2XGCA 2ZOZA 1QPIA 2XDNA 2G0EA 2VKVA 3HTHA 3ANPA 3VP5A 5FHPA 2ZCXA 4NELA 1JTXA 5IOYA 2OPTA 4JL3A 3ZQLA 3ZQIA 2NS7A 3BR3A 2W53A 2RAEA 5F0CA 3MNLA 3MVPA 3VIBA 3QPLA 5EFYA 2NP3A 3VPRA 4AC0A 2GFNA 3TP0A 3BCGA 3T6NA 2X9DA 2D6YA 3BR6A 3VVYA 5GPCA 4MO7A 4ME9A 5J3LA 3COLA 3CJDA 3O60A 2HXOA 4D5FA 3O8HA 2RHAA 3LOCA 1ZK8A 2IAIA 2DTZA 5IP6A 2ZCMA 4GFKA 3PM1A 5D19A 3LJLA 1RPWA 2QIBA 1RKTA 2EH3A 3KKCA 4CGRA 2FX0A 3DEWA 3VW1A 2WGBA 3IH3A 3BNIA 4ICHA 3ANGA 2G7SA
chains in the Genus database with same CATH superfamily
2I10A 3G1MA 5FKOA 1BJZA 3CWRA 1QVUA 4W1UA 1RKWA 3PASA 3BR2A 2V57A 2HYJA 5FMPA 1QVTA 3KNWA 3G1OA 3Q3SA 4AUXA 2QWTA 4UDSA 4D5CA 5F08A 2G3BA 3ZQGA 4ABZA 3BR0A 4I76A 3GZIA 3HIMA 5IOZA 3BRUA 3WHCA 1UI5A 3HGYA 5H9TA 5GPAA 4GCTA 2RASA 2REKA 2UXUA 1SGMA 4G12A 3VUQA 2QOPA 2OERA 1JUSA 3V6GA 4MXMA 2B3WA 4PXIA 1JUMA 3KKDA 2F07A 2FBQA 2PFVA 2R7SA 4AC6A 5CXGA 3CRJA 3BQYA 3LSJA 5FKLA 2O7TA 4MK6A 3BR1A 4NN1A 3ZQFA 4W97A 3HE0A 5CQGA 3NPIA 2XGEA 3B6AA 4B1RA 2QCOA 2DG7A 3ON2A 4D7NA 4IRVA 2UXIA 3VOKA 2NS8A 3FK7A 3Q0UA 3F1BA 3IH2A 3RD3A 4DW6A 4WIBA 2NX4A 1Z0XA 4HKUA 2TCTA 2B1EA 4M3EA 3KYLA 2ZCNA 5HSZA 2NP5A 3DCFA 3P9TA 2VPRA 2XPUA 5CXIA 2TRTA 4D7MA 3EUPA 5FKNA 2UXHA 5EZHA 4AF5A 3FK6A 2XB5A 3JSJA 3AQSA 2ID3A 5J1RA 5EYRA 5F1JA 5K7HA 3G7RA 3O8GA 3CDLA 2IBDA 3BJBA 5GP9A 2UXPA 2R7TA 3GEUA 3NNRA 2GUHA 4JNNA 5FKKA 1A6IA 2UXOA 2XPVA 3V78A 3BTIA 2IU5A 3DU6A 5AQCA 2QKOA 4V2FA 3HTIA 2HXIA 5CW8A 1JTYA 5FGLA 3C07A 3LSRA 3WHBA 3NI7A 3BR5A 2FJI1 1ORKA 4M3BA 3ZQHA 3NRGA 3BTCA 2JJ7A 3VOXA 3RH2A 3BTLA 4C2MA 3NXCA 5IPAA 2XRLA 5DAJA 3FRQA 2WV1A 4X1EA 3DPJA 4U9LA 3K8PC 2Q24A 2X6OA 3SDGA 3QPSA 2Y2ZA 3S5RA 2XGDA 2IEKA 3E7QA 5F0FA 5HAWA 2OI8A 3LSPA 2R7WA 3AQTA 1JT6A 4ACIA 1T33A 2FJ1A 2YVXA 4M3DA 5EZGA 5K58A 3SFIA 4V2GA 2HKUA 4M3GA 3G56A 3Q0VA 2VKEA 2WUIA 3HGGA 3VTIA 3FHNA 3VVZA 3C2BA 3CCYA 2G7GA 5FKMA 2R7XA 3PPBA 2ZOYA 4YZEA 3VW2A 3QBMA 2PZ9A 3IH4A 4XK4A 3F0CA 4GFLA 1U9OA 5D18A 1Z77A 3QKXA 2OF7A 5J1YA 3B81A 4GCKA 1JT0A 2HQ5A 5J1UA 4GCLA 3EGQA 2FD5A 3B6CA 3FIWA 3IUVA 2DG8A 2G7LA 2O7OA 2XPWA 3TP3A 2JK3A 1U9NA 2HYTA 5F04A 3BTJA 1ZKGA 3Q0WA 2YVEA 2R7OA 4L62A 2PBXA 3BQZA 3BHQA 3LHQA 3VVXA 4B3AA 3G1LA 1VI0A 4KWAA 3QQAA 5C4YA 2GBYA 2ZY9A 5D1RA 2Y31A 3ON4A 4OD5A 3HTJA 5K7ZA 3BT9A 4JYKA 4JKZA 3KZ9A 4M3FA 4I6ZA 2QTQA 5F0HA 3HTAA 5K7FA 2Y30A 2ID6A 4DVYP 2FQ4A 2GENA 1JUPA 2YVHA 2ZB9A 2A2FX 3LWJA 3SWHA 1T56A 5HBUA 3VW0A 5F27A 1UI6A 2R7VA 2XGCA 2ZOZA 1QPIA 2XDNA 2G0EA 2VKVA 3HTHA 3ANPA 3VP5A 5FHPA 2ZCXA 4NELA 1JTXA 5IOYA 2OPTA 4JL3A 3ZQLA 3DU5A 3ZQIA 2NS7A 3BR3A 2W53A 2RAEA 5F0CA 3MNLA 3MVPA 3VIBA 3QPLA 5EFYA 2NP3A 3VPRA 4AC0A 2GFNA 3TP0A 3BCGA 3T6NA 2X9DA 2D6YA 2R7RA 3BR6A 3VVYA 5GPCA 4MO7A 4ME9A 5J3LA 3COLA 3CJDA 3O60A 2HXOA 4D5FA 3O8HA 2RHAA 3LOCA 1ZK8A 2IAIA 2DTZA 5IP6A 3NS4A 2ZCMA 4GFKA 2R7QA 3PM1A 5D19A 3LJLA 1RPWA 2QIBA 4OD4A 1RKTA 2EH3A 3KKCA 4CGRA 2FX0A 3DEWA 3VW1A 2WGBA 3IH3A 2R7UA 3BNIA 4ICHA 3ANGA 2G7SA 4U9NA
chains in the Genus database with same CATH topology
2I10A 3G1MA 5FKOA 1BJZA 3CWRA 1QVUA 4W1UA 1RKWA 3PASA 3BR2A 2V57A 2HYJA 5FMPA 1QVTA 3KNWA 3G1OA 3Q3SA 4AUXA 2QWTA 4UDSA 4D5CA 5F08A 2G3BA 3ZQGA 4ABZA 3BR0A 4I76A 3GZIA 3HIMA 5IOZA 3BRUA 3WHCA 1UI5A 3HGYA 5H9TA 5GPAA 4GCTA 2RASA 2REKA 2UXUA 1SGMA 4G12A 3VUQA 2QOPA 2OERA 1JUSA 3V6GA 4MXMA 4PXIA 1JUMA 3KKDA 2F07A 2FBQA 4AC6A 5CXGA 3CRJA 3BQYA 3LSJA 5FKLA 2O7TA 4MK6A 3BR1A 4NN1A 3ZQFA 4W97A 3HE0A 3NPIA 2XGEA 3B6AA 4B1RA 2QCOA 2DG7A 3ON2A 4D7NA 2UXIA 3VOKA 2NS8A 3FK7A 3Q0UA 3F1BA 3IH2A 3RD3A 4DW6A 2NX4A 1Z0XA 4HKUA 2TCTA 4M3EA 2ZCNA 5HSZA 2NP5A 3DCFA 3P9TA 2VPRA 2XPUA 5CXIA 2TRTA 4D7MA 3EUPA 5FKNA 2UXHA 5EZHA 4AF5A 3FK6A 2XB5A 3JSJA 3AQSA 2ID3A 5J1RA 5EYRA 5F1JA 5K7HA 3G7RA 3O8GA 3CDLA 2IBDA 3BJBA 5GP9A 2UXPA 3GEUA 3NNRA 2GUHA 4JNNA 5FKKA 1A6IA 2UXOA 2XPVA 3V78A 3BTIA 2IU5A 5AQCA 2QKOA 4V2FA 3HTIA 2HXIA 5CW8A 1JTYA 5FGLA 3C07A 3LSRA 3WHBA 3NI7A 3BR5A 1ORKA 4M3BA 3ZQHA 3NRGA 3BTCA 2JJ7A 3VOXA 3RH2A 3BTLA 3NXCA 5IPAA 2XRLA 5DAJA 3FRQA 2WV1A 4X1EA 3DPJA 2Q24A 2X6OA 3SDGA 3QPSA 2Y2ZA 3S5RA 2XGDA 2IEKA 3E7QA 5F0FA 5HAWA 2OI8A 3LSPA 3AQTA 1JT6A 4ACIA 1T33A 2FJ1A 4M3DA 5EZGA 5K58A 3SFIA 4V2GA 2HKUA 4M3GA 3G56A 3Q0VA 2VKEA 2WUIA 3HGGA 3VVZA 3C2BA 3CCYA 2G7GA 5FKMA 3PPBA 2ZOYA 4YZEA 3VW2A 3QBMA 2PZ9A 3IH4A 4XK4A 3F0CA 4GFLA 1U9OA 5D18A 1Z77A 3QKXA 2OF7A 5J1YA 3B81A 4GCKA 1JT0A 2HQ5A 5J1UA 4GCLA 3EGQA 2FD5A 3B6CA 3FIWA 3IUVA 2DG8A 2G7LA 2O7OA 2XPWA 3TP3A 2JK3A 1U9NA 2HYTA 5F04A 3BTJA 1ZKGA 3Q0WA 2YVEA 4L62A 2PBXA 3BQZA 3BHQA 3LHQA 3VVXA 4B3AA 3G1LA 1VI0A 4KWAA 3QQAA 5C4YA 2GBYA 5D1RA 2Y31A 3ON4A 3HTJA 5K7ZA 3BT9A 4JYKA 4JKZA 3KZ9A 4M3FA 4I6ZA 2QTQA 5F0HA 3HTAA 5K7FA 2Y30A 2ID6A 2FQ4A 2GENA 1JUPA 2YVHA 2ZB9A 3LWJA 5HBUA 1T56A 3VW0A 5F27A 1UI6A 2XGCA 2ZOZA 1QPIA 2XDNA 2G0EA 2VKVA 3HTHA 3ANPA 3VP5A 5FHPA 2ZCXA 4NELA 1JTXA 5IOYA 2OPTA 4JL3A 3ZQLA 3ZQIA 2NS7A 3BR3A 2W53A 2RAEA 5F0CA 3MNLA 3MVPA 3VIBA 3QPLA 5EFYA 2NP3A 3VPRA 4AC0A 2GFNA 3TP0A 3BCGA 3T6NA 2X9DA 2D6YA 3BR6A 3VVYA 5GPCA 4MO7A 4ME9A 5J3LA 3COLA 3CJDA 3O60A 2HXOA 4D5FA 3O8HA 2RHAA 3LOCA 1ZK8A 2IAIA 2DTZA 5IP6A 2ZCMA 4GFKA 3PM1A 5D19A 3LJLA 1RPWA 2QIBA 1RKTA 2EH3A 3KKCA 4CGRA 2FX0A 3DEWA 3VW1A 2WGBA 3IH3A 3BNIA 4ICHA 3ANGA 2G7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I10 A;  3G1M A;  5FKO A;  1BJZ A;  3CWR A;  1QVU A;  4W1U A;  1RKW A;  3PAS A;  3BR2 A;  2V57 A;  2HYJ A;  5FMP A;  1QVT A;  3KNW A;  3G1O A;  3Q3S A;  4AUX A;  2QWT A;  4UDS A;  4D5C A;  5F08 A;  2G3B A;  3ZQG A;  4ABZ A;  3BR0 A;  4I76 A;  3GZI A;  3HIM A;  5IOZ A;  3BRU A;  3WHC A;  1UI5 A;  3HGY A;  5H9T A;  5GPA A;  4GCT A;  2RAS A;  2REK A;  2UXU A;  1SGM A;  4G12 A;  3VUQ A;  2QOP A;  2OER A;  1JUS A;  3V6G A;  4MXM A;  4PXI A;  1JUM A;  3KKD A;  2F07 A;  2FBQ A;  4AC6 A;  5CXG A;  3CRJ A;  3BQY A;  3LSJ A;  5FKL A;  2O7T A;  4MK6 A;  3BR1 A;  4NN1 A;  3ZQF A;  4W97 A;  3HE0 A;  3NPI A;  2XGE A;  3B6A A;  4B1R A;  2QCO A;  2DG7 A;  3ON2 A;  4D7N A;  2UXI A;  3VOK A;  2NS8 A;  3FK7 A;  3Q0U A;  3F1B A;  3IH2 A;  3RD3 A;  4DW6 A;  2NX4 A;  1Z0X A;  4HKU A;  2TCT A;  4M3E A;  2ZCN A;  5HSZ A;  2NP5 A;  3DCF A;  3P9T A;  2VPR A;  2XPU A;  5CXI A;  2TRT A;  4D7M A;  3EUP A;  5FKN A;  2UXH A;  5EZH A;  4AF5 A;  3FK6 A;  2XB5 A;  3JSJ A;  3AQS A;  2ID3 A;  5J1R A;  5EYR A;  5F1J A;  5K7H A;  3G7R A;  3O8G A;  3CDL A;  2IBD A;  3BJB A;  5GP9 A;  2UXP A;  3GEU A;  3NNR A;  2GUH A;  4JNN A;  5FKK A;  1A6I A;  2UXO A;  2XPV A;  3V78 A;  3BTI A;  2IU5 A;  5AQC A;  2QKO A;  4V2F A;  3HTI A;  2HXI A;  5CW8 A;  1JTY A;  5FGL A;  3C07 A;  3LSR A;  3WHB A;  3NI7 A;  3BR5 A;  1ORK A;  4M3B A;  3ZQH A;  3NRG A;  3BTC A;  2JJ7 A;  3VOX A;  3RH2 A;  3BTL A;  3NXC A;  5IPA A;  2XRL A;  5DAJ A;  3FRQ A;  2WV1 A;  4X1E A;  3DPJ A;  2Q24 A;  2X6O A;  3SDG A;  3QPS A;  2Y2Z A;  3S5R A;  2XGD A;  2IEK A;  3E7Q A;  5F0F A;  5HAW A;  2OI8 A;  3LSP A;  3AQT A;  1JT6 A;  4ACI A;  1T33 A;  2FJ1 A;  4M3D A;  5EZG A;  5K58 A;  3SFI A;  4V2G A;  2HKU A;  4M3G A;  3G56 A;  3Q0V A;  2VKE A;  2WUI A;  3HGG A;  3VVZ A;  3C2B A;  3CCY A;  2G7G A;  5FKM A;  3PPB A;  2ZOY A;  4YZE A;  3VW2 A;  3QBM A;  2PZ9 A;  3IH4 A;  4XK4 A;  3F0C A;  4GFL A;  1U9O A;  5D18 A;  1Z77 A;  3QKX A;  2OF7 A;  5J1Y A;  3B81 A;  4GCK A;  1JT0 A;  2HQ5 A;  5J1U A;  4GCL A;  3EGQ A;  2FD5 A;  3B6C A;  3FIW A;  3IUV A;  2DG8 A;  2G7L A;  2O7O A;  2XPW A;  3TP3 A;  2JK3 A;  1U9N A;  2HYT A;  5F04 A;  3BTJ A;  1ZKG A;  3Q0W A;  2YVE A;  4L62 A;  2PBX A;  3BQZ A;  3BHQ A;  3LHQ A;  3VVX A;  4B3A A;  3G1L A;  1VI0 A;  4KWA A;  3QQA A;  5C4Y A;  2GBY A;  5D1R A;  2Y31 A;  3ON4 A;  3HTJ A;  5K7Z A;  3BT9 A;  4JYK A;  4JKZ A;  3KZ9 A;  4M3F A;  4I6Z A;  2QTQ A;  5F0H A;  3HTA A;  5K7F A;  2Y30 A;  2ID6 A;  2FQ4 A;  2GEN A;  1JUP A;  2YVH A;  2ZB9 A;  3LWJ A;  5HBU A;  1T56 A;  3VW0 A;  5F27 A;  1UI6 A;  2XGC A;  2ZOZ A;  1QPI A;  2XDN A;  2G0E A;  2VKV A;  3HTH A;  3ANP A;  3VP5 A;  5FHP A;  2ZCX A;  4NEL A;  1JTX A;  5IOY A;  2OPT A;  4JL3 A;  3ZQL A;  3ZQI A;  2NS7 A;  3BR3 A;  2W53 A;  2RAE A;  5F0C A;  3MNL A;  3MVP A;  3VIB A;  3QPL A;  5EFY A;  2NP3 A;  3VPR A;  4AC0 A;  2GFN A;  3TP0 A;  3BCG A;  3T6N A;  2X9D A;  2D6Y A;  3BR6 A;  3VVY A;  5GPC A;  4MO7 A;  4ME9 A;  5J3L A;  3COL A;  3CJD A;  3O60 A;  2HXO A;  4D5F A;  3O8H A;  2RHA A;  3LOC A;  1ZK8 A;  2IAI A;  2DTZ A;  5IP6 A;  2ZCM A;  4GFK A;  3PM1 A;  5D19 A;  3LJL A;  1RPW A;  2QIB A;  1RKT A;  2EH3 A;  3KKC A;  4CGR A;  2FX0 A;  3DEW A;  3VW1 A;  2WGB A;  3IH3 A;  3BNI A;  4ICH A;  3ANG A;  2G7S A; 
#chains in the Genus database with same CATH topology
 2I10 A;  3G1M A;  5FKO A;  1BJZ A;  3CWR A;  1QVU A;  4W1U A;  1RKW A;  3PAS A;  3BR2 A;  2V57 A;  2HYJ A;  5FMP A;  1QVT A;  3KNW A;  3G1O A;  3Q3S A;  4AUX A;  2QWT A;  4UDS A;  4D5C A;  5F08 A;  2G3B A;  3ZQG A;  4ABZ A;  3BR0 A;  4I76 A;  3GZI A;  3HIM A;  5IOZ A;  3BRU A;  3WHC A;  1UI5 A;  3HGY A;  5H9T A;  5GPA A;  4GCT A;  2RAS A;  2REK A;  2UXU A;  1SGM A;  4G12 A;  3VUQ A;  2QOP A;  2OER A;  1JUS A;  3V6G A;  4MXM A;  2B3W A;  4PXI A;  1JUM A;  3KKD A;  2F07 A;  2FBQ A;  2PFV A;  2R7S A;  4AC6 A;  5CXG A;  3CRJ A;  3BQY A;  3LSJ A;  5FKL A;  2O7T A;  4MK6 A;  3BR1 A;  4NN1 A;  3ZQF A;  4W97 A;  3HE0 A;  5CQG A;  3NPI A;  2XGE A;  3B6A A;  4B1R A;  2QCO A;  2DG7 A;  3ON2 A;  4D7N A;  4IRV A;  2UXI A;  3VOK A;  2NS8 A;  3FK7 A;  3Q0U A;  3F1B A;  3IH2 A;  3RD3 A;  4DW6 A;  4WIB A;  2NX4 A;  1Z0X A;  4HKU A;  2TCT A;  2B1E A;  4M3E A;  3KYL A;  2ZCN A;  5HSZ A;  2NP5 A;  3DCF A;  3P9T A;  2VPR A;  2XPU A;  5CXI A;  2TRT A;  4D7M A;  3EUP A;  5FKN A;  2UXH A;  5EZH A;  4AF5 A;  3FK6 A;  2XB5 A;  3JSJ A;  3AQS A;  2ID3 A;  5J1R A;  5EYR A;  5F1J A;  5K7H A;  3G7R A;  3O8G A;  3CDL A;  2IBD A;  3BJB A;  5GP9 A;  2UXP A;  2R7T A;  3GEU A;  3NNR A;  2GUH A;  4JNN A;  5FKK A;  1A6I A;  2UXO A;  2XPV A;  3V78 A;  3BTI A;  2IU5 A;  3DU6 A;  5AQC A;  2QKO A;  4V2F A;  3HTI A;  2HXI A;  5CW8 A;  1JTY A;  5FGL A;  3C07 A;  3LSR A;  3WHB A;  3NI7 A;  3BR5 A;  2FJI 1;  1ORK A;  4M3B A;  3ZQH A;  3NRG A;  3BTC A;  2JJ7 A;  3VOX A;  3RH2 A;  3BTL A;  4C2M A;  3NXC A;  5IPA A;  2XRL A;  5DAJ A;  3FRQ A;  2WV1 A;  4X1E A;  3DPJ A;  4U9L A;  3K8P C;  2Q24 A;  2X6O A;  3SDG A;  3QPS A;  2Y2Z A;  3S5R A;  2XGD A;  2IEK A;  3E7Q A;  5F0F A;  5HAW A;  2OI8 A;  3LSP A;  2R7W A;  3AQT A;  1JT6 A;  4ACI A;  1T33 A;  2FJ1 A;  2YVX A;  4M3D A;  5EZG A;  5K58 A;  3SFI A;  4V2G A;  2HKU A;  4M3G A;  3G56 A;  3Q0V A;  2VKE A;  2WUI A;  3HGG A;  3VTI A;  3FHN A;  3VVZ A;  3C2B A;  3CCY A;  2G7G A;  5FKM A;  2R7X A;  3PPB A;  2ZOY A;  4YZE A;  3VW2 A;  3QBM A;  2PZ9 A;  3IH4 A;  4XK4 A;  3F0C A;  4GFL A;  1U9O A;  5D18 A;  1Z77 A;  3QKX A;  2OF7 A;  5J1Y A;  3B81 A;  4GCK A;  1JT0 A;  2HQ5 A;  5J1U A;  4GCL A;  3EGQ A;  2FD5 A;  3B6C A;  3FIW A;  3IUV A;  2DG8 A;  2G7L A;  2O7O A;  2XPW A;  3TP3 A;  2JK3 A;  1U9N A;  2HYT A;  5F04 A;  3BTJ A;  1ZKG A;  3Q0W A;  2YVE A;  2R7O A;  4L62 A;  2PBX A;  3BQZ A;  3BHQ A;  3LHQ A;  3VVX A;  4B3A A;  3G1L A;  1VI0 A;  4KWA A;  3QQA A;  5C4Y A;  2GBY A;  2ZY9 A;  5D1R A;  2Y31 A;  3ON4 A;  4OD5 A;  3HTJ A;  5K7Z A;  3BT9 A;  4JYK A;  4JKZ A;  3KZ9 A;  4M3F A;  4I6Z A;  2QTQ A;  5F0H A;  3HTA A;  5K7F A;  2Y30 A;  2ID6 A;  4DVY P;  2FQ4 A;  2GEN A;  1JUP A;  2YVH A;  2ZB9 A;  2A2F X;  3LWJ A;  3SWH A;  1T56 A;  5HBU A;  3VW0 A;  5F27 A;  1UI6 A;  2R7V A;  2XGC A;  2ZOZ A;  1QPI A;  2XDN A;  2G0E A;  2VKV A;  3HTH A;  3ANP A;  3VP5 A;  5FHP A;  2ZCX A;  4NEL A;  1JTX A;  5IOY A;  2OPT A;  4JL3 A;  3ZQL A;  3DU5 A;  3ZQI A;  2NS7 A;  3BR3 A;  2W53 A;  2RAE A;  5F0C A;  3MNL A;  3MVP A;  3VIB A;  3QPL A;  5EFY A;  2NP3 A;  3VPR A;  4AC0 A;  2GFN A;  3TP0 A;  3BCG A;  3T6N A;  2X9D A;  2D6Y A;  2R7R A;  3BR6 A;  3VVY A;  5GPC A;  4MO7 A;  4ME9 A;  5J3L A;  3COL A;  3CJD A;  3O60 A;  2HXO A;  4D5F A;  3O8H A;  2RHA A;  3LOC A;  1ZK8 A;  2IAI A;  2DTZ A;  5IP6 A;  3NS4 A;  2ZCM A;  4GFK A;  2R7Q A;  3PM1 A;  5D19 A;  3LJL A;  1RPW A;  2QIB A;  4OD4 A;  1RKT A;  2EH3 A;  3KKC A;  4CGR A;  2FX0 A;  3DEW A;  3VW1 A;  2WGB A;  3IH3 A;  2R7U A;  3BNI A;  4ICH A;  3ANG A;  2G7S A;  4U9N A; 
#chains in the Genus database with same CATH homology
 2I10 A;  3G1M A;  5FKO A;  1BJZ A;  3CWR A;  1QVU A;  4W1U A;  1RKW A;  3PAS A;  3BR2 A;  2V57 A;  2HYJ A;  5FMP A;  1QVT A;  3KNW A;  3G1O A;  3Q3S A;  4AUX A;  2QWT A;  4UDS A;  4D5C A;  5F08 A;  2G3B A;  3ZQG A;  4ABZ A;  3BR0 A;  4I76 A;  3GZI A;  3HIM A;  5IOZ A;  3BRU A;  3WHC A;  1UI5 A;  3HGY A;  5H9T A;  5GPA A;  4GCT A;  2RAS A;  2REK A;  2UXU A;  1SGM A;  4G12 A;  3VUQ A;  2QOP A;  2OER A;  1JUS A;  3V6G A;  4MXM A;  4PXI A;  1JUM A;  3KKD A;  2F07 A;  2FBQ A;  4AC6 A;  5CXG A;  3CRJ A;  3BQY A;  3LSJ A;  5FKL A;  2O7T A;  4MK6 A;  3BR1 A;  4NN1 A;  3ZQF A;  4W97 A;  3HE0 A;  3NPI A;  2XGE A;  3B6A A;  4B1R A;  2QCO A;  2DG7 A;  3ON2 A;  4D7N A;  2UXI A;  3VOK A;  2NS8 A;  3FK7 A;  3Q0U A;  3F1B A;  3IH2 A;  3RD3 A;  4DW6 A;  2NX4 A;  1Z0X A;  4HKU A;  2TCT A;  4M3E A;  2ZCN A;  5HSZ A;  2NP5 A;  3DCF A;  3P9T A;  2VPR A;  2XPU A;  5CXI A;  2TRT A;  4D7M A;  3EUP A;  5FKN A;  2UXH A;  5EZH A;  4AF5 A;  3FK6 A;  2XB5 A;  3JSJ A;  3AQS A;  2ID3 A;  5J1R A;  5EYR A;  5F1J A;  5K7H A;  3G7R A;  3O8G A;  3CDL A;  2IBD A;  3BJB A;  5GP9 A;  2UXP A;  3GEU A;  3NNR A;  2GUH A;  4JNN A;  5FKK A;  1A6I A;  2UXO A;  2XPV A;  3V78 A;  3BTI A;  2IU5 A;  5AQC A;  2QKO A;  4V2F A;  3HTI A;  2HXI A;  5CW8 A;  1JTY A;  5FGL A;  3C07 A;  3LSR A;  3WHB A;  3NI7 A;  3BR5 A;  1ORK A;  4M3B A;  3ZQH A;  3NRG A;  3BTC A;  2JJ7 A;  3VOX A;  3RH2 A;  3BTL A;  3NXC A;  5IPA A;  2XRL A;  5DAJ A;  3FRQ A;  2WV1 A;  4X1E A;  3DPJ A;  2Q24 A;  2X6O A;  3SDG A;  3QPS A;  2Y2Z A;  3S5R A;  2XGD A;  2IEK A;  3E7Q A;  5F0F A;  5HAW A;  2OI8 A;  3LSP A;  3AQT A;  1JT6 A;  4ACI A;  1T33 A;  2FJ1 A;  4M3D A;  5EZG A;  5K58 A;  3SFI A;  4V2G A;  2HKU A;  4M3G A;  3G56 A;  3Q0V A;  2VKE A;  2WUI A;  3HGG A;  3VVZ A;  3C2B A;  3CCY A;  2G7G A;  5FKM A;  3PPB A;  2ZOY A;  4YZE A;  3VW2 A;  3QBM A;  2PZ9 A;  3IH4 A;  4XK4 A;  3F0C A;  4GFL A;  1U9O A;  5D18 A;  1Z77 A;  3QKX A;  2OF7 A;  5J1Y A;  3B81 A;  4GCK A;  1JT0 A;  2HQ5 A;  5J1U A;  4GCL A;  3EGQ A;  2FD5 A;  3B6C A;  3FIW A;  3IUV A;  2DG8 A;  2G7L A;  2O7O A;  2XPW A;  3TP3 A;  2JK3 A;  1U9N A;  2HYT A;  5F04 A;  3BTJ A;  1ZKG A;  3Q0W A;  2YVE A;  4L62 A;  2PBX A;  3BQZ A;  3BHQ A;  3LHQ A;  3VVX A;  4B3A A;  3G1L A;  1VI0 A;  4KWA A;  3QQA A;  5C4Y A;  2GBY A;  5D1R A;  2Y31 A;  3ON4 A;  3HTJ A;  5K7Z A;  3BT9 A;  4JYK A;  4JKZ A;  3KZ9 A;  4M3F A;  4I6Z A;  2QTQ A;  5F0H A;  3HTA A;  5K7F A;  2Y30 A;  2ID6 A;  2FQ4 A;  2GEN A;  1JUP A;  2YVH A;  2ZB9 A;  3LWJ A;  5HBU A;  1T56 A;  3VW0 A;  5F27 A;  1UI6 A;  2XGC A;  2ZOZ A;  1QPI A;  2XDN A;  2G0E A;  2VKV A;  3HTH A;  3ANP A;  3VP5 A;  5FHP A;  2ZCX A;  4NEL A;  1JTX A;  5IOY A;  2OPT A;  4JL3 A;  3ZQL A;  3ZQI A;  2NS7 A;  3BR3 A;  2W53 A;  2RAE A;  5F0C A;  3MNL A;  3MVP A;  3VIB A;  3QPL A;  5EFY A;  2NP3 A;  3VPR A;  4AC0 A;  2GFN A;  3TP0 A;  3BCG A;  3T6N A;  2X9D A;  2D6Y A;  3BR6 A;  3VVY A;  5GPC A;  4MO7 A;  4ME9 A;  5J3L A;  3COL A;  3CJD A;  3O60 A;  2HXO A;  4D5F A;  3O8H A;  2RHA A;  3LOC A;  1ZK8 A;  2IAI A;  2DTZ A;  5IP6 A;  2ZCM A;  4GFK A;  3PM1 A;  5D19 A;  3LJL A;  1RPW A;  2QIB A;  1RKT A;  2EH3 A;  3KKC A;  4CGR A;  2FX0 A;  3DEW A;  3VW1 A;  2WGB A;  3IH3 A;  3BNI A;  4ICH A;  3ANG A;  2G7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...