2OI8A

Crystal structure of putative regulatory protein sco4313
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
209
structure length
203
Chain Sequence
b'TPRERYRTQVRAEIKDHAWEQIATAGASALSLNAIAKRMGMSGPALYRYFDGRDELITELIRDAYRSQADSLRAAAASGADLAGLAHALRAWALDDPQRYFLIFGTPVPGYRAPDDITEIAAETMAVIVDACAAGTDGAFDAHLDTHRQWADRPAPSSALHRALSFWSRLHGVLSLELAGQFTGMGFDSALLFEAELKDLLGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative regulatory protein SCO4313
publication title Crystal structure of tetR family protein SCO4313
rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 65
structure length 203
sequence length 209
ec nomenclature
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF13305 TetR_C_33 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2oi8A00
1RKTA 2GFNA 3ANGA 5EFYA 3BT9A 2QCOA 2IAIA 3DEWA 3VVXA 2XPVA 2RHAA 3IH3A 4UDSA 3PASA 2ZB9A 3BHQA 5F0CA 3CRJA 3GEUA 3VPRA 3HE0A 4M3FA 3BR2A 2Y31A 3FK6A 3HGGA 5HSZA 3G7RA 5FKLA 3E7QA 4MK6A 4M3GA 5C4YA 3VUQA 3LWJA 5FKMA 2XRLA 3G1LA 1T56A 3VW2A 3O8HA 5D1RA 4JNNA 5IOZA 2TCTA 3BQYA 2XGDA 3CJDA 4B1RA 3AQTA 2JJ7A 1RPWA 5FMPA 5J1YA 1QVTA 1Z0XA 5DAJA 2DTZA 4NELA 2FBQA 2PZ9A 2ID3A 3P9TA 4D5FA 5AQCA 2OERA 3KKCA 5K7ZA 3PM1A 4MO7A 3TP3A 5CXGA 2X6OA 3F1BA 4NN1A 3TP0A 3FIWA 3VOKA 3Q0WA 1RKWA 3BJBA 3C07A 2ZCXA 2REKA 4ABZA 2UXUA 1U9OA 4GFLA 3VP5A 3Q0UA 5CXIA 2D6YA 2ZOYA 2HKUA 4GCLA 5IOYA 2HXIA 3HTHA 3CWRA 3BTJA 1JT6A 2UXPA 5CW8A 3VVYA 2QTQA 2WUIA 3NI7A 3EGQA 2Y30A 2G7GA 3Q3SA 3LSPA 2ZOZA 2IU5A 3F0CA 2G0EA 2TRTA 3HTAA 2XGEA 3BTCA 5FHPA 3KKDA 1JUMA 2F07A 5K7FA 3G1MA 2Y2ZA 4D5CA 4MXMA 3QPSA 2QKOA 3HGYA 2GUHA 2HXOA 1BJZA 5F08A 3HTJA 1VI0A 2HYTA 2DG7A 4X1EA 3V6GA 5F0FA 3BTLA 3AQSA 3SDGA 4HKUA 3G56A 4M3BA 3DCFA 2G3BA 3IH4A 2ZCMA 2RASA 3G1OA 3ON2A 3FK7A 3VVZA 3V78A 4D7MA 4JKZA 3GZIA 3SFIA 1UI6A 2NS7A 4D7NA 3ZQFA 3IH2A 5FKOA 5FKNA 4V2FA 5IP6A 1T33A 2PBXA 5F0HA 5IPAA 4AC0A 5D18A 3CDLA 1JUPA 5K7HA 2IEKA 4CGRA 3NRGA 1ZK8A 4PXIA 4GFKA 5F27A 2WGBA 2GBYA 2YVHA 1QVUA 2YVEA 3ZQLA 2DG8A 2NS8A 4W1UA 3HIMA 4JL3A 1SGMA 2XPUA 3ANPA 3JSJA 2O7TA 2GENA 1ZKGA 3FRQA 3LSJA 3O8GA 3VW0A 2NP5A 5K58A 2OPTA 2UXIA 2OF7A 2IBDA 3COLA 3LHQA 4W97A 2NX4A 2XPWA 3WHCA 3RD3A 3NXCA 3BRUA 2VPRA 1Z77A 1JTYA 2X9DA 2UXHA 3LOCA 3WHBA 3QPLA 5HAWA 3C2BA 4I6ZA 4AC6A 2VKEA 2FX0A 3B6AA 3EUPA 3NNRA 2G7SA 2G7LA 3T6NA 2XGCA 3O60A 3BR1A 4V2GA 3BR5A 2QIBA 4M3EA 4ME9A 4GCTA 4DW6A 3KNWA 4GCKA 3LSRA 5J3LA 3RH2A 3QQAA 3B6CA 4AF5A 3BR3A 3VW1A 5EZHA 2XDNA 1U9NA 5HBUA 5FGLA 3NPIA 2ID6A 3HTIA 2WV1A 4JYKA 3BCGA 5J1UA 2O7OA 2JK3A 4L62A 2QOPA 2FD5A 4B3AA 3S5RA 5F04A 3MNLA 1QPIA 4ICHA 3CCYA 3ON4A 2OI8A 1JTXA 5GP9A 2FQ4A 5FKKA 3Q0VA 2Q24A 2RAEA 3ZQGA 3PPBA 3BTIA 1A6IA 3BR6A 4G12A 5EYRA 2HYJA 3ZQIA 2FJ1A 2QWTA 2HQ5A 5F1JA 2I10A 2W53A 3KZ9A 4AUXA 5J1RA 4XK4A 3B81A 2UXOA 4YZEA 3VIBA 4M3DA 2ZCNA 2NP3A 1JT0A 3BNIA 3DPJA 1ORKA 3LJLA 4KWAA 5EZGA 3BQZA 5H9TA 2VKVA 3VOXA 1JUSA 3QKXA 5GPCA 4I76A 4ACIA 1UI5A 5GPAA 3IUVA 3ZQHA 5D19A 3QBMA 2XB5A 2EH3A 3MVPA 3BR0A 2V57A
chains in the Genus database with same CATH superfamily
1RKTA 2GFNA 3ANGA 5EFYA 3BT9A 2QCOA 2IAIA 2R7UA 3DEWA 3VVXA 2XPVA 2RHAA 3IH3A 4UDSA 3PASA 2ZB9A 3BHQA 5F0CA 3CRJA 3GEUA 3VPRA 3HE0A 4M3FA 3BR2A 2A2FX 2Y31A 3FK6A 3HGGA 5HSZA 3G7RA 5FKLA 3E7QA 4MK6A 4M3GA 5C4YA 3VUQA 3LWJA 5FKMA 2XRLA 3G1LA 1T56A 3VW2A 3O8HA 3NS4A 5D1RA 4JNNA 5IOZA 2TCTA 3BQYA 2XGDA 3CJDA 4B1RA 3AQTA 2JJ7A 1RPWA 5FMPA 5J1YA 1QVTA 1Z0XA 5DAJA 2DTZA 4NELA 2B3WA 2FBQA 2ID3A 2PZ9A 3P9TA 4D5FA 5AQCA 4WIBA 2OERA 3KKCA 5K7ZA 3PM1A 4MO7A 3TP3A 5CXGA 2X6OA 3F1BA 4NN1A 3TP0A 3FIWA 3VOKA 3Q0WA 1RKWA 3BJBA 3C07A 2ZCXA 2REKA 4ABZA 4U9NA 2UXUA 1U9OA 4GFLA 3VP5A 3Q0UA 5CXIA 2D6YA 2R7OA 2ZOYA 4DVYP 2HKUA 4GCLA 5IOYA 2HXIA 3HTHA 3CWRA 3BTJA 1JT6A 2UXPA 5CW8A 3VVYA 3VTIA 2YVXA 2QTQA 4OD5A 2WUIA 3NI7A 3EGQA 2Y30A 2G7GA 2FJI1 3Q3SA 3LSPA 2ZOZA 2IU5A 3F0CA 2G0EA 2TRTA 3HTAA 2XGEA 3BTCA 5FHPA 2R7RA 3KKDA 1JUMA 2F07A 2R7SA 5K7FA 3G1MA 2Y2ZA 4D5CA 4MXMA 3QPSA 2QKOA 3HGYA 2GUHA 2HXOA 1BJZA 5F08A 3HTJA 1VI0A 2HYTA 2DG7A 4X1EA 3V6GA 5F0FA 3BTLA 3AQSA 3SDGA 3FHNA 4HKUA 3G56A 4M3BA 3DCFA 2G3BA 3IH4A 2ZCMA 2RASA 3G1OA 3ON2A 3FK7A 3VVZA 2R7XA 3V78A 4D7MA 4JKZA 3GZIA 3SFIA 2R7VA 2B1EA 1UI6A 2NS7A 4D7NA 3ZQFA 3IH2A 5FKOA 5FKNA 4V2FA 5IP6A 1T33A 2PBXA 5F0HA 5IPAA 4AC0A 5D18A 2PFVA 4C2MA 3CDLA 1JUPA 5K7HA 2IEKA 4CGRA 3NRGA 1ZK8A 4PXIA 4GFKA 5F27A 2WGBA 2GBYA 2YVHA 1QVUA 2YVEA 3ZQLA 2DG8A 2NS8A 3DU5A 4W1UA 3HIMA 2R7QA 1SGMA 2XPUA 4JL3A 3ANPA 3JSJA 2O7TA 2GENA 3DU6A 1ZKGA 3FRQA 3LSJA 3O8GA 3VW0A 2NP5A 5K58A 2OPTA 2UXIA 2OF7A 2IBDA 3COLA 3LHQA 3K8PC 4W97A 2NX4A 2XPWA 3WHCA 3RD3A 2R7TA 3NXCA 3BRUA 2VPRA 1Z77A 1JTYA 2X9DA 2UXHA 3LOCA 3WHBA 3QPLA 5HAWA 3C2BA 4I6ZA 4AC6A 2VKEA 2FX0A 3B6AA 3EUPA 3NNRA 2G7SA 2G7LA 3T6NA 2XGCA 3O60A 3BR1A 4V2GA 3BR5A 2QIBA 4M3EA 4ME9A 4GCTA 4DW6A 3KNWA 4GCKA 3LSRA 5J3LA 3KYLA 3RH2A 3QQAA 3B6CA 4AF5A 3BR3A 4OD4A 3VW1A 5EZHA 2XDNA 1U9NA 5HBUA 5FGLA 3NPIA 2ID6A 3HTIA 2WV1A 4JYKA 3BCGA 5J1UA 2O7OA 2JK3A 2R7WA 4L62A 2QOPA 2FD5A 4B3AA 3S5RA 5F04A 3MNLA 1QPIA 4ICHA 3CCYA 3ON4A 2OI8A 1JTXA 5GP9A 2FQ4A 5FKKA 3Q0VA 2Q24A 2RAEA 3ZQGA 3PPBA 2ZY9A 3BTIA 1A6IA 3BR6A 4G12A 5EYRA 2HYJA 3ZQIA 4U9LA 2FJ1A 2QWTA 2HQ5A 5F1JA 2I10A 2W53A 3KZ9A 4AUXA 5J1RA 4XK4A 3B81A 2UXOA 4IRVA 4YZEA 3VIBA 4M3DA 2ZCNA 3SWHA 2NP3A 1JT0A 3BNIA 3DPJA 1ORKA 3LJLA 4KWAA 5EZGA 3BQZA 5H9TA 2VKVA 3VOXA 1JUSA 3QKXA 5CQGA 5GPCA 4I76A 4ACIA 1UI5A 5GPAA 3IUVA 3ZQHA 5D19A 3QBMA 2XB5A 2EH3A 3MVPA 3BR0A 2V57A
chains in the Genus database with same CATH topology
1RKTA 2GFNA 3ANGA 5EFYA 3BT9A 2QCOA 2IAIA 3DEWA 3VVXA 2XPVA 2RHAA 3IH3A 4UDSA 3PASA 2ZB9A 3BHQA 5F0CA 3CRJA 3GEUA 3VPRA 3HE0A 4M3FA 3BR2A 2Y31A 3FK6A 3HGGA 5HSZA 3G7RA 5FKLA 3E7QA 4MK6A 4M3GA 5C4YA 3VUQA 3LWJA 5FKMA 2XRLA 3G1LA 1T56A 3VW2A 3O8HA 5D1RA 4JNNA 5IOZA 2TCTA 3BQYA 2XGDA 3CJDA 4B1RA 3AQTA 2JJ7A 1RPWA 5FMPA 5J1YA 1QVTA 1Z0XA 5DAJA 2DTZA 4NELA 2FBQA 2PZ9A 2ID3A 3P9TA 4D5FA 5AQCA 2OERA 3KKCA 5K7ZA 3PM1A 4MO7A 3TP3A 5CXGA 2X6OA 3F1BA 4NN1A 3TP0A 3FIWA 3VOKA 3Q0WA 1RKWA 3BJBA 3C07A 2ZCXA 2REKA 4ABZA 2UXUA 1U9OA 4GFLA 3VP5A 3Q0UA 5CXIA 2D6YA 2ZOYA 2HKUA 4GCLA 5IOYA 2HXIA 3HTHA 3CWRA 3BTJA 1JT6A 2UXPA 5CW8A 3VVYA 2QTQA 2WUIA 3NI7A 3EGQA 2Y30A 2G7GA 3Q3SA 3LSPA 2ZOZA 2IU5A 3F0CA 2G0EA 2TRTA 3HTAA 2XGEA 3BTCA 5FHPA 3KKDA 1JUMA 2F07A 5K7FA 3G1MA 2Y2ZA 4D5CA 4MXMA 3QPSA 2QKOA 3HGYA 2GUHA 2HXOA 1BJZA 5F08A 3HTJA 1VI0A 2HYTA 2DG7A 4X1EA 3V6GA 5F0FA 3BTLA 3AQSA 3SDGA 4HKUA 3G56A 4M3BA 3DCFA 2G3BA 3IH4A 2ZCMA 2RASA 3G1OA 3ON2A 3FK7A 3VVZA 3V78A 4D7MA 4JKZA 3GZIA 3SFIA 1UI6A 2NS7A 4D7NA 3ZQFA 3IH2A 5FKOA 5FKNA 4V2FA 5IP6A 1T33A 2PBXA 5F0HA 5IPAA 4AC0A 5D18A 3CDLA 1JUPA 5K7HA 2IEKA 4CGRA 3NRGA 1ZK8A 4PXIA 4GFKA 5F27A 2WGBA 2GBYA 2YVHA 1QVUA 2YVEA 3ZQLA 2DG8A 2NS8A 4W1UA 3HIMA 4JL3A 1SGMA 2XPUA 3ANPA 3JSJA 2O7TA 2GENA 1ZKGA 3FRQA 3LSJA 3O8GA 3VW0A 2NP5A 5K58A 2OPTA 2UXIA 2OF7A 2IBDA 3COLA 3LHQA 4W97A 2NX4A 2XPWA 3WHCA 3RD3A 3NXCA 3BRUA 2VPRA 1Z77A 1JTYA 2X9DA 2UXHA 3LOCA 3WHBA 3QPLA 5HAWA 3C2BA 4I6ZA 4AC6A 2VKEA 2FX0A 3B6AA 3EUPA 3NNRA 2G7SA 2G7LA 3T6NA 2XGCA 3O60A 3BR1A 4V2GA 3BR5A 2QIBA 4M3EA 4ME9A 4GCTA 4DW6A 3KNWA 4GCKA 3LSRA 5J3LA 3RH2A 3QQAA 3B6CA 4AF5A 3BR3A 3VW1A 5EZHA 2XDNA 1U9NA 5HBUA 5FGLA 3NPIA 2ID6A 3HTIA 2WV1A 4JYKA 3BCGA 5J1UA 2O7OA 2JK3A 4L62A 2QOPA 2FD5A 4B3AA 3S5RA 5F04A 3MNLA 1QPIA 4ICHA 3CCYA 3ON4A 2OI8A 1JTXA 5GP9A 2FQ4A 5FKKA 3Q0VA 2Q24A 2RAEA 3ZQGA 3PPBA 3BTIA 1A6IA 3BR6A 4G12A 5EYRA 2HYJA 3ZQIA 2FJ1A 2QWTA 2HQ5A 5F1JA 2I10A 2W53A 3KZ9A 4AUXA 5J1RA 4XK4A 3B81A 2UXOA 4YZEA 3VIBA 4M3DA 2ZCNA 2NP3A 1JT0A 3BNIA 3DPJA 1ORKA 3LJLA 4KWAA 5EZGA 3BQZA 5H9TA 2VKVA 3VOXA 1JUSA 3QKXA 5GPCA 4I76A 4ACIA 1UI5A 5GPAA 3IUVA 3ZQHA 5D19A 3QBMA 2XB5A 2EH3A 3MVPA 3BR0A 2V57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RKT A;  2GFN A;  3ANG A;  5EFY A;  3BT9 A;  2QCO A;  2IAI A;  3DEW A;  3VVX A;  2XPV A;  2RHA A;  3IH3 A;  4UDS A;  3PAS A;  2ZB9 A;  3BHQ A;  5F0C A;  3CRJ A;  3GEU A;  3VPR A;  3HE0 A;  4M3F A;  3BR2 A;  2Y31 A;  3FK6 A;  3HGG A;  5HSZ A;  3G7R A;  5FKL A;  3E7Q A;  4MK6 A;  4M3G A;  5C4Y A;  3VUQ A;  3LWJ A;  5FKM A;  2XRL A;  3G1L A;  1T56 A;  3VW2 A;  3O8H A;  5D1R A;  4JNN A;  5IOZ A;  2TCT A;  3BQY A;  2XGD A;  3CJD A;  4B1R A;  3AQT A;  2JJ7 A;  1RPW A;  5FMP A;  5J1Y A;  1QVT A;  1Z0X A;  5DAJ A;  2DTZ A;  4NEL A;  2FBQ A;  2PZ9 A;  2ID3 A;  3P9T A;  4D5F A;  5AQC A;  2OER A;  3KKC A;  5K7Z A;  3PM1 A;  4MO7 A;  3TP3 A;  5CXG A;  2X6O A;  3F1B A;  4NN1 A;  3TP0 A;  3FIW A;  3VOK A;  3Q0W A;  1RKW A;  3BJB A;  3C07 A;  2ZCX A;  2REK A;  4ABZ A;  2UXU A;  1U9O A;  4GFL A;  3VP5 A;  3Q0U A;  5CXI A;  2D6Y A;  2ZOY A;  2HKU A;  4GCL A;  5IOY A;  2HXI A;  3HTH A;  3CWR A;  3BTJ A;  1JT6 A;  2UXP A;  5CW8 A;  3VVY A;  2QTQ A;  2WUI A;  3NI7 A;  3EGQ A;  2Y30 A;  2G7G A;  3Q3S A;  3LSP A;  2ZOZ A;  2IU5 A;  3F0C A;  2G0E A;  2TRT A;  3HTA A;  2XGE A;  3BTC A;  5FHP A;  3KKD A;  1JUM A;  2F07 A;  5K7F A;  3G1M A;  2Y2Z A;  4D5C A;  4MXM A;  3QPS A;  2QKO A;  3HGY A;  2GUH A;  2HXO A;  1BJZ A;  5F08 A;  3HTJ A;  1VI0 A;  2HYT A;  2DG7 A;  4X1E A;  3V6G A;  5F0F A;  3BTL A;  3AQS A;  3SDG A;  4HKU A;  3G56 A;  4M3B A;  3DCF A;  2G3B A;  3IH4 A;  2ZCM A;  2RAS A;  3G1O A;  3ON2 A;  3FK7 A;  3VVZ A;  3V78 A;  4D7M A;  4JKZ A;  3GZI A;  3SFI A;  1UI6 A;  2NS7 A;  4D7N A;  3ZQF A;  3IH2 A;  5FKO A;  5FKN A;  4V2F A;  5IP6 A;  1T33 A;  2PBX A;  5F0H A;  5IPA A;  4AC0 A;  5D18 A;  3CDL A;  1JUP A;  5K7H A;  2IEK A;  4CGR A;  3NRG A;  1ZK8 A;  4PXI A;  4GFK A;  5F27 A;  2WGB A;  2GBY A;  2YVH A;  1QVU A;  2YVE A;  3ZQL A;  2DG8 A;  2NS8 A;  4W1U A;  3HIM A;  4JL3 A;  1SGM A;  2XPU A;  3ANP A;  3JSJ A;  2O7T A;  2GEN A;  1ZKG A;  3FRQ A;  3LSJ A;  3O8G A;  3VW0 A;  2NP5 A;  5K58 A;  2OPT A;  2UXI A;  2OF7 A;  2IBD A;  3COL A;  3LHQ A;  4W97 A;  2NX4 A;  2XPW A;  3WHC A;  3RD3 A;  3NXC A;  3BRU A;  2VPR A;  1Z77 A;  1JTY A;  2X9D A;  2UXH A;  3LOC A;  3WHB A;  3QPL A;  5HAW A;  3C2B A;  4I6Z A;  4AC6 A;  2VKE A;  2FX0 A;  3B6A A;  3EUP A;  3NNR A;  2G7S A;  2G7L A;  3T6N A;  2XGC A;  3O60 A;  3BR1 A;  4V2G A;  3BR5 A;  2QIB A;  4M3E A;  4ME9 A;  4GCT A;  4DW6 A;  3KNW A;  4GCK A;  3LSR A;  5J3L A;  3RH2 A;  3QQA A;  3B6C A;  4AF5 A;  3BR3 A;  3VW1 A;  5EZH A;  2XDN A;  1U9N A;  5HBU A;  5FGL A;  3NPI A;  2ID6 A;  3HTI A;  2WV1 A;  4JYK A;  3BCG A;  5J1U A;  2O7O A;  2JK3 A;  4L62 A;  2QOP A;  2FD5 A;  4B3A A;  3S5R A;  5F04 A;  3MNL A;  1QPI A;  4ICH A;  3CCY A;  3ON4 A;  2OI8 A;  1JTX A;  5GP9 A;  2FQ4 A;  5FKK A;  3Q0V A;  2Q24 A;  2RAE A;  3ZQG A;  3PPB A;  3BTI A;  1A6I A;  3BR6 A;  4G12 A;  5EYR A;  2HYJ A;  3ZQI A;  2FJ1 A;  2QWT A;  2HQ5 A;  5F1J A;  2I10 A;  2W53 A;  3KZ9 A;  4AUX A;  5J1R A;  4XK4 A;  3B81 A;  2UXO A;  4YZE A;  3VIB A;  4M3D A;  2ZCN A;  2NP3 A;  1JT0 A;  3BNI A;  3DPJ A;  1ORK A;  3LJL A;  4KWA A;  5EZG A;  3BQZ A;  5H9T A;  2VKV A;  3VOX A;  1JUS A;  3QKX A;  5GPC A;  4I76 A;  4ACI A;  1UI5 A;  5GPA A;  3IUV A;  3ZQH A;  5D19 A;  3QBM A;  2XB5 A;  2EH3 A;  3MVP A;  3BR0 A;  2V57 A; 
#chains in the Genus database with same CATH topology
 1RKT A;  2GFN A;  3ANG A;  5EFY A;  3BT9 A;  2QCO A;  2IAI A;  2R7U A;  3DEW A;  3VVX A;  2XPV A;  2RHA A;  3IH3 A;  4UDS A;  3PAS A;  2ZB9 A;  3BHQ A;  5F0C A;  3CRJ A;  3GEU A;  3VPR A;  3HE0 A;  4M3F A;  3BR2 A;  2A2F X;  2Y31 A;  3FK6 A;  3HGG A;  5HSZ A;  3G7R A;  5FKL A;  3E7Q A;  4MK6 A;  4M3G A;  5C4Y A;  3VUQ A;  3LWJ A;  5FKM A;  2XRL A;  3G1L A;  1T56 A;  3VW2 A;  3O8H A;  3NS4 A;  5D1R A;  4JNN A;  5IOZ A;  2TCT A;  3BQY A;  2XGD A;  3CJD A;  4B1R A;  3AQT A;  2JJ7 A;  1RPW A;  5FMP A;  5J1Y A;  1QVT A;  1Z0X A;  5DAJ A;  2DTZ A;  4NEL A;  2B3W A;  2FBQ A;  2ID3 A;  2PZ9 A;  3P9T A;  4D5F A;  5AQC A;  4WIB A;  2OER A;  3KKC A;  5K7Z A;  3PM1 A;  4MO7 A;  3TP3 A;  5CXG A;  2X6O A;  3F1B A;  4NN1 A;  3TP0 A;  3FIW A;  3VOK A;  3Q0W A;  1RKW A;  3BJB A;  3C07 A;  2ZCX A;  2REK A;  4ABZ A;  4U9N A;  2UXU A;  1U9O A;  4GFL A;  3VP5 A;  3Q0U A;  5CXI A;  2D6Y A;  2R7O A;  2ZOY A;  4DVY P;  2HKU A;  4GCL A;  5IOY A;  2HXI A;  3HTH A;  3CWR A;  3BTJ A;  1JT6 A;  2UXP A;  5CW8 A;  3VVY A;  3VTI A;  2YVX A;  2QTQ A;  4OD5 A;  2WUI A;  3NI7 A;  3EGQ A;  2Y30 A;  2G7G A;  2FJI 1;  3Q3S A;  3LSP A;  2ZOZ A;  2IU5 A;  3F0C A;  2G0E A;  2TRT A;  3HTA A;  2XGE A;  3BTC A;  5FHP A;  2R7R A;  3KKD A;  1JUM A;  2F07 A;  2R7S A;  5K7F A;  3G1M A;  2Y2Z A;  4D5C A;  4MXM A;  3QPS A;  2QKO A;  3HGY A;  2GUH A;  2HXO A;  1BJZ A;  5F08 A;  3HTJ A;  1VI0 A;  2HYT A;  2DG7 A;  4X1E A;  3V6G A;  5F0F A;  3BTL A;  3AQS A;  3SDG A;  3FHN A;  4HKU A;  3G56 A;  4M3B A;  3DCF A;  2G3B A;  3IH4 A;  2ZCM A;  2RAS A;  3G1O A;  3ON2 A;  3FK7 A;  3VVZ A;  2R7X A;  3V78 A;  4D7M A;  4JKZ A;  3GZI A;  3SFI A;  2R7V A;  2B1E A;  1UI6 A;  2NS7 A;  4D7N A;  3ZQF A;  3IH2 A;  5FKO A;  5FKN A;  4V2F A;  5IP6 A;  1T33 A;  2PBX A;  5F0H A;  5IPA A;  4AC0 A;  5D18 A;  2PFV A;  4C2M A;  3CDL A;  1JUP A;  5K7H A;  2IEK A;  4CGR A;  3NRG A;  1ZK8 A;  4PXI A;  4GFK A;  5F27 A;  2WGB A;  2GBY A;  2YVH A;  1QVU A;  2YVE A;  3ZQL A;  2DG8 A;  2NS8 A;  3DU5 A;  4W1U A;  3HIM A;  2R7Q A;  1SGM A;  2XPU A;  4JL3 A;  3ANP A;  3JSJ A;  2O7T A;  2GEN A;  3DU6 A;  1ZKG A;  3FRQ A;  3LSJ A;  3O8G A;  3VW0 A;  2NP5 A;  5K58 A;  2OPT A;  2UXI A;  2OF7 A;  2IBD A;  3COL A;  3LHQ A;  3K8P C;  4W97 A;  2NX4 A;  2XPW A;  3WHC A;  3RD3 A;  2R7T A;  3NXC A;  3BRU A;  2VPR A;  1Z77 A;  1JTY A;  2X9D A;  2UXH A;  3LOC A;  3WHB A;  3QPL A;  5HAW A;  3C2B A;  4I6Z A;  4AC6 A;  2VKE A;  2FX0 A;  3B6A A;  3EUP A;  3NNR A;  2G7S A;  2G7L A;  3T6N A;  2XGC A;  3O60 A;  3BR1 A;  4V2G A;  3BR5 A;  2QIB A;  4M3E A;  4ME9 A;  4GCT A;  4DW6 A;  3KNW A;  4GCK A;  3LSR A;  5J3L A;  3KYL A;  3RH2 A;  3QQA A;  3B6C A;  4AF5 A;  3BR3 A;  4OD4 A;  3VW1 A;  5EZH A;  2XDN A;  1U9N A;  5HBU A;  5FGL A;  3NPI A;  2ID6 A;  3HTI A;  2WV1 A;  4JYK A;  3BCG A;  5J1U A;  2O7O A;  2JK3 A;  2R7W A;  4L62 A;  2QOP A;  2FD5 A;  4B3A A;  3S5R A;  5F04 A;  3MNL A;  1QPI A;  4ICH A;  3CCY A;  3ON4 A;  2OI8 A;  1JTX A;  5GP9 A;  2FQ4 A;  5FKK A;  3Q0V A;  2Q24 A;  2RAE A;  3ZQG A;  3PPB A;  2ZY9 A;  3BTI A;  1A6I A;  3BR6 A;  4G12 A;  5EYR A;  2HYJ A;  3ZQI A;  4U9L A;  2FJ1 A;  2QWT A;  2HQ5 A;  5F1J A;  2I10 A;  2W53 A;  3KZ9 A;  4AUX A;  5J1R A;  4XK4 A;  3B81 A;  2UXO A;  4IRV A;  4YZE A;  3VIB A;  4M3D A;  2ZCN A;  3SWH A;  2NP3 A;  1JT0 A;  3BNI A;  3DPJ A;  1ORK A;  3LJL A;  4KWA A;  5EZG A;  3BQZ A;  5H9T A;  2VKV A;  3VOX A;  1JUS A;  3QKX A;  5CQG A;  5GPC A;  4I76 A;  4ACI A;  1UI5 A;  5GPA A;  3IUV A;  3ZQH A;  5D19 A;  3QBM A;  2XB5 A;  2EH3 A;  3MVP A;  3BR0 A;  2V57 A; 
#chains in the Genus database with same CATH homology
 1RKT A;  2GFN A;  3ANG A;  5EFY A;  3BT9 A;  2QCO A;  2IAI A;  3DEW A;  3VVX A;  2XPV A;  2RHA A;  3IH3 A;  4UDS A;  3PAS A;  2ZB9 A;  3BHQ A;  5F0C A;  3CRJ A;  3GEU A;  3VPR A;  3HE0 A;  4M3F A;  3BR2 A;  2Y31 A;  3FK6 A;  3HGG A;  5HSZ A;  3G7R A;  5FKL A;  3E7Q A;  4MK6 A;  4M3G A;  5C4Y A;  3VUQ A;  3LWJ A;  5FKM A;  2XRL A;  3G1L A;  1T56 A;  3VW2 A;  3O8H A;  5D1R A;  4JNN A;  5IOZ A;  2TCT A;  3BQY A;  2XGD A;  3CJD A;  4B1R A;  3AQT A;  2JJ7 A;  1RPW A;  5FMP A;  5J1Y A;  1QVT A;  1Z0X A;  5DAJ A;  2DTZ A;  4NEL A;  2FBQ A;  2PZ9 A;  2ID3 A;  3P9T A;  4D5F A;  5AQC A;  2OER A;  3KKC A;  5K7Z A;  3PM1 A;  4MO7 A;  3TP3 A;  5CXG A;  2X6O A;  3F1B A;  4NN1 A;  3TP0 A;  3FIW A;  3VOK A;  3Q0W A;  1RKW A;  3BJB A;  3C07 A;  2ZCX A;  2REK A;  4ABZ A;  2UXU A;  1U9O A;  4GFL A;  3VP5 A;  3Q0U A;  5CXI A;  2D6Y A;  2ZOY A;  2HKU A;  4GCL A;  5IOY A;  2HXI A;  3HTH A;  3CWR A;  3BTJ A;  1JT6 A;  2UXP A;  5CW8 A;  3VVY A;  2QTQ A;  2WUI A;  3NI7 A;  3EGQ A;  2Y30 A;  2G7G A;  3Q3S A;  3LSP A;  2ZOZ A;  2IU5 A;  3F0C A;  2G0E A;  2TRT A;  3HTA A;  2XGE A;  3BTC A;  5FHP A;  3KKD A;  1JUM A;  2F07 A;  5K7F A;  3G1M A;  2Y2Z A;  4D5C A;  4MXM A;  3QPS A;  2QKO A;  3HGY A;  2GUH A;  2HXO A;  1BJZ A;  5F08 A;  3HTJ A;  1VI0 A;  2HYT A;  2DG7 A;  4X1E A;  3V6G A;  5F0F A;  3BTL A;  3AQS A;  3SDG A;  4HKU A;  3G56 A;  4M3B A;  3DCF A;  2G3B A;  3IH4 A;  2ZCM A;  2RAS A;  3G1O A;  3ON2 A;  3FK7 A;  3VVZ A;  3V78 A;  4D7M A;  4JKZ A;  3GZI A;  3SFI A;  1UI6 A;  2NS7 A;  4D7N A;  3ZQF A;  3IH2 A;  5FKO A;  5FKN A;  4V2F A;  5IP6 A;  1T33 A;  2PBX A;  5F0H A;  5IPA A;  4AC0 A;  5D18 A;  3CDL A;  1JUP A;  5K7H A;  2IEK A;  4CGR A;  3NRG A;  1ZK8 A;  4PXI A;  4GFK A;  5F27 A;  2WGB A;  2GBY A;  2YVH A;  1QVU A;  2YVE A;  3ZQL A;  2DG8 A;  2NS8 A;  4W1U A;  3HIM A;  4JL3 A;  1SGM A;  2XPU A;  3ANP A;  3JSJ A;  2O7T A;  2GEN A;  1ZKG A;  3FRQ A;  3LSJ A;  3O8G A;  3VW0 A;  2NP5 A;  5K58 A;  2OPT A;  2UXI A;  2OF7 A;  2IBD A;  3COL A;  3LHQ A;  4W97 A;  2NX4 A;  2XPW A;  3WHC A;  3RD3 A;  3NXC A;  3BRU A;  2VPR A;  1Z77 A;  1JTY A;  2X9D A;  2UXH A;  3LOC A;  3WHB A;  3QPL A;  5HAW A;  3C2B A;  4I6Z A;  4AC6 A;  2VKE A;  2FX0 A;  3B6A A;  3EUP A;  3NNR A;  2G7S A;  2G7L A;  3T6N A;  2XGC A;  3O60 A;  3BR1 A;  4V2G A;  3BR5 A;  2QIB A;  4M3E A;  4ME9 A;  4GCT A;  4DW6 A;  3KNW A;  4GCK A;  3LSR A;  5J3L A;  3RH2 A;  3QQA A;  3B6C A;  4AF5 A;  3BR3 A;  3VW1 A;  5EZH A;  2XDN A;  1U9N A;  5HBU A;  5FGL A;  3NPI A;  2ID6 A;  3HTI A;  2WV1 A;  4JYK A;  3BCG A;  5J1U A;  2O7O A;  2JK3 A;  4L62 A;  2QOP A;  2FD5 A;  4B3A A;  3S5R A;  5F04 A;  3MNL A;  1QPI A;  4ICH A;  3CCY A;  3ON4 A;  2OI8 A;  1JTX A;  5GP9 A;  2FQ4 A;  5FKK A;  3Q0V A;  2Q24 A;  2RAE A;  3ZQG A;  3PPB A;  3BTI A;  1A6I A;  3BR6 A;  4G12 A;  5EYR A;  2HYJ A;  3ZQI A;  2FJ1 A;  2QWT A;  2HQ5 A;  5F1J A;  2I10 A;  2W53 A;  3KZ9 A;  4AUX A;  5J1R A;  4XK4 A;  3B81 A;  2UXO A;  4YZE A;  3VIB A;  4M3D A;  2ZCN A;  2NP3 A;  1JT0 A;  3BNI A;  3DPJ A;  1ORK A;  3LJL A;  4KWA A;  5EZG A;  3BQZ A;  5H9T A;  2VKV A;  3VOX A;  1JUS A;  3QKX A;  5GPC A;  4I76 A;  4ACI A;  1UI5 A;  5GPA A;  3IUV A;  3ZQH A;  5D19 A;  3QBM A;  2XB5 A;  2EH3 A;  3MVP A;  3BR0 A;  2V57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...