2OI8A

Crystal structure of putative regulatory protein sco4313
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
209
structure length
203
Chain Sequence
TPRERYRTQVRAEIKDHAWEQIATAGASALSLNAIAKRMGMSGPALYRYFDGRDELITELIRDAYRSQADSLRAAAASGADLAGLAHALRAWALDDPQRYFLIFGTPVPGYRAPDDITEIAAETMAVIVDACAAGTDGAFDAHLDTHRQWADRPAPSSALHRALSFWSRLHGVLSLELAGQFTGMGFDSALLFEAELKDLLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of tetR family protein SCO4313
rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
molecule keywords Putative regulatory protein SCO4313
total genus 65
structure length 203
sequence length 209
ec nomenclature
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF13305 TetR_C_33 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2oi8A00
4I76A 2O7TA 3ON4A 2NP3A 2Y31A 3GEUA 3Q0WA 3MNLA 5IPAA 4AF5A 2Y30A 3WHCA 2ZB9A 5F08A 2XPWA 3HIMA 3G1OA 2YVEA 4M3GA 3PM1A 2PZ9A 2XDNA 3ZQFA 3MVPA 3VOXA 3NNRA 3WHBA 1ORKA 2QOPA 2XPVA 4X1EA 3ON2A 2DTZA 3BR0A 4JKZA 3DCFA 4W1UA 2G7SA 2ID3A 3BR1A 4MO7A 4HKUA 3BTCA 2G3BA 4NELA 3VOKA 2G7GA 5K7ZA 4ICHA 1SGMA 2QTQA 5K7FA 2ZOYA 3VIBA 3Q0VA 3HTJA 2QWTA 1BJZA 3VW1A 3LOCA 4B1RA 4B3AA 1T56A 2G0EA 4M3FA 1JUMA 2QCOA 5K7HA 2D6YA 2X9DA 1ZKGA 3CWRA 3O8GA 2FD5A 2WUIA 4PXIA 4MK6A 5FMPA 3C07A 3BQZA 3HGGA 5HAWA 1JTYA 2XB5A 2HKUA 3T6NA 4GFLA 1U9NA 1UI5A 3BR3A 4D5FA 3C2BA 2ID6A 3QQAA 2HXIA 3QBMA 2UXUA 4M3BA 2WV1A 4AC6A 3TP3A 3HTIA 3KNWA 1U9OA 2HXOA 3BTLA 3LSRA 2RASA 4DW6A 4GFKA 1JT6A 3BR6A 2UXHA 2Y2ZA 2ZCNA 3VPRA 3QPSA 3SDGA 2PBXA 2HYTA 3RH2A 4AUXA 3Q0UA 2GUHA 3CDLA 3KKDA 1JTXA 2OF7A 3NPIA 5F0HA 3FIWA 2I10A 2OERA 5EFYA 2ZOZA 3VUQA 4AC0A 2VKEA 1RKTA 5C4YA 4M3DA 5FKMA 3KZ9A 3BJBA 3PPBA 4I6ZA 5CXGA 1RPWA 5CW8A 2JJ7A 2RHAA 2TCTA 3AQTA 1QVUA 2XGDA 3PASA 3RD3A 3CCYA 3CJDA 3ANPA 3E7QA 3VW2A 3V6GA 5EYRA 5F0FA 3B6AA 2NP5A 2XGEA 3QPLA 2XRLA 1QVTA 3IH4A 3B6CA 2HQ5A 3HE0A 3P9TA 1QPIA 5GP9A 4XK4A 2QIBA 3BRUA 3O8HA 2FQ4A 3BT9A 5F0CA 2IAIA 5FGLA 4UDSA 3HTHA 4M3EA 2REKA 5HBUA 3LJLA 3NXCA 4MXMA 3BR5A 3LWJA 2FBQA 2TRTA 5FHPA 4CGRA 2V57A 3FRQA 4JYKA 5EZHA 1JUPA 3HTAA 5F1JA 3VVYA 2VKVA 4W97A 4L62A 3LSJA 3FK6A 4ME9A 2G7LA 3S5RA 1JT0A 4ABZA 3HGYA 2JK3A 2DG8A 2IBDA 2VPRA 5D19A 3IH3A 2IEKA 2NS8A 2YVHA 1VI0A 3ANGA 5FKLA 5D1RA 3BNIA 3ZQLA 3Q3SA 1Z77A 2NS7A 3BQYA 3AQSA 5D18A 5F27A 4JL3A 3V78A 3ZQHA 3VVXA 3DEWA 5IOZA 2UXPA 1UI6A 4V2FA 3TP0A 4V2GA 5HSZA 3G7RA 3G56A 3VVZA 3KKCA 2FX0A 3SFIA 2FJ1A 5DAJA 2EH3A 4G12A 3G1LA 2NX4A 3BTIA 4D7NA 2XPUA 5FKNA 3IUVA 2ZCXA 5H9TA 2OPTA 3GZIA 4ACIA 3ZQGA 3COLA 1A6IA 2XGCA 2DG7A 2F07A 3BR2A 1Z0XA 4GCLA 5IP6A 5K58A 3ZQIA 5F04A 2GBYA 5CXIA 2O7OA 3BCGA 4JNNA 5FKKA 5GPCA 3NRGA 2RAEA 3LSPA 1T33A 5J1YA 2GFNA 2IU5A 3QKXA 3DPJA 2Q24A 2W53A 5AQCA 3F0CA 2QKOA 2UXOA 3EGQA 4YZEA 4D7MA 3O60A 2HYJA 5J1UA 3VP5A 3G1MA 1JUSA 4NN1A 5J3LA 5J1RA 5GPAA 4KWAA 2GENA 3EUPA 5EZGA 3FK7A 1RKWA 1ZK8A 3IH2A 3BTJA 4GCTA 5IOYA 3JSJA 2X6OA 4GCKA 4D5CA 3NI7A 2OI8A 2ZCMA 3F1BA 2UXIA 3B81A 5FKOA 3CRJA 3BHQA 3LHQA 2WGBA 3VW0A
chains in the Genus database with same CATH superfamily
4I76A 2O7TA 3ON4A 2NP3A 2Y31A 3GEUA 3Q0WA 3MNLA 5IPAA 4AF5A 2Y30A 3WHCA 2ZB9A 5F08A 2XPWA 3HIMA 3G1OA 2YVEA 4M3GA 3PM1A 2PZ9A 2XDNA 3ZQFA 3MVPA 3VOXA 3NNRA 3WHBA 1ORKA 2QOPA 2XPVA 4X1EA 3ON2A 2DTZA 3BR0A 4JKZA 3DCFA 4W1UA 2G7SA 2ID3A 3BR1A 4MO7A 4HKUA 3BTCA 2G3BA 4NELA 2FJI1 3VOKA 2G7GA 5K7ZA 4ICHA 1SGMA 2QTQA 5K7FA 2ZOYA 3VIBA 3Q0VA 3HTJA 3FHNA 2QWTA 1BJZA 3VW1A 3LOCA 4B1RA 4B3AA 1T56A 2G0EA 2YVXA 4M3FA 1JUMA 2QCOA 4C2MA 5K7HA 2D6YA 2X9DA 2R7SA 1ZKGA 3CWRA 3O8GA 2FD5A 2WUIA 4PXIA 4MK6A 5FMPA 3C07A 3BQZA 3HGGA 5HAWA 1JTYA 2XB5A 2HKUA 3T6NA 4GFLA 1U9NA 1UI5A 3BR3A 4D5FA 3C2BA 2ID6A 3QQAA 2HXIA 3QBMA 2UXUA 4M3BA 2WV1A 4AC6A 3TP3A 3HTIA 3KNWA 1U9OA 2HXOA 3BTLA 3LSRA 2RASA 4DW6A 4GFKA 1JT6A 3BR6A 2UXHA 2Y2ZA 2ZCNA 2R7UA 3VPRA 3QPSA 3SDGA 2PBXA 2HYTA 3RH2A 4AUXA 3Q0UA 2GUHA 3CDLA 3KYLA 3KKDA 1JTXA 2OF7A 2R7QA 3NPIA 5F0HA 3FIWA 2I10A 2OERA 5EFYA 2ZOZA 3VUQA 4AC0A 2VKEA 1RKTA 5C4YA 4M3DA 5FKMA 3KZ9A 3BJBA 3PPBA 4I6ZA 5CXGA 1RPWA 5CW8A 2JJ7A 2RHAA 2TCTA 3AQTA 1QVUA 2XGDA 3PASA 3RD3A 3SWHA 3CCYA 3CJDA 3ANPA 3DU5A 3E7QA 3VW2A 3V6GA 5EYRA 5F0FA 3B6AA 2NP5A 2XGEA 3QPLA 2XRLA 1QVTA 3IH4A 3B6CA 2HQ5A 3HE0A 3P9TA 2R7RA 1QPIA 5CQGA 5GP9A 4XK4A 2QIBA 3BRUA 3O8HA 2FQ4A 3BT9A 5F0CA 2IAIA 5FGLA 4U9LA 4UDSA 3HTHA 4M3EA 2REKA 5HBUA 3LJLA 3NXCA 4MXMA 3BR5A 3LWJA 2FBQA 4OD4A 2TRTA 5FHPA 4CGRA 3DU6A 2V57A 3FRQA 3NS4A 4JYKA 5EZHA 1JUPA 3HTAA 5F1JA 3VVYA 2VKVA 4W97A 2R7WA 4L62A 3LSJA 3FK6A 4ME9A 4U9NA 2G7LA 3S5RA 1JT0A 4ABZA 3HGYA 2JK3A 2DG8A 2IBDA 2VPRA 5D19A 3IH3A 4DVYP 2IEKA 2NS8A 2YVHA 1VI0A 2R7XA 3ANGA 3K8PC 5FKLA 5D1RA 3BNIA 3ZQLA 3Q3SA 1Z77A 2NS7A 3VTIA 3BQYA 3AQSA 5D18A 5F27A 4JL3A 3V78A 3ZQHA 3VVXA 3DEWA 5IOZA 2ZY9A 2UXPA 1UI6A 4V2FA 3TP0A 4V2GA 5HSZA 2PFVA 3G7RA 3G56A 3VVZA 3KKCA 2FX0A 3SFIA 2FJ1A 5DAJA 2EH3A 4G12A 3G1LA 2NX4A 3BTIA 4D7NA 2XPUA 5FKNA 3IUVA 2ZCXA 5H9TA 2A2FX 2OPTA 3GZIA 2B3WA 4ACIA 3ZQGA 3COLA 1A6IA 2R7TA 2XGCA 2DG7A 2F07A 3BR2A 1Z0XA 4GCLA 5IP6A 5K58A 3ZQIA 5F04A 2GBYA 5CXIA 4OD5A 2O7OA 3BCGA 4JNNA 5FKKA 5GPCA 3NRGA 2RAEA 3LSPA 1T33A 5J1YA 2GFNA 2IU5A 3QKXA 4IRVA 3DPJA 2Q24A 2W53A 2R7OA 5AQCA 3F0CA 2B1EA 2QKOA 2UXOA 3EGQA 4YZEA 4D7MA 3O60A 2HYJA 5J1UA 3VP5A 3G1MA 1JUSA 4NN1A 5J3LA 5J1RA 5GPAA 4KWAA 2GENA 3EUPA 5EZGA 3FK7A 1RKWA 1ZK8A 3IH2A 3BTJA 4GCTA 5IOYA 3JSJA 2X6OA 4WIBA 4GCKA 4D5CA 3NI7A 2OI8A 2ZCMA 3F1BA 2UXIA 3B81A 5FKOA 3CRJA 3BHQA 3LHQA 2WGBA 2R7VA 3VW0A
chains in the Genus database with same CATH topology
4I76A 2O7TA 3ON4A 2NP3A 2Y31A 3GEUA 3Q0WA 3MNLA 5IPAA 4AF5A 2Y30A 3WHCA 2ZB9A 5F08A 2XPWA 3HIMA 3G1OA 2YVEA 4M3GA 3PM1A 2PZ9A 2XDNA 3ZQFA 3MVPA 3VOXA 3NNRA 3WHBA 1ORKA 2QOPA 2XPVA 4X1EA 3ON2A 2DTZA 3BR0A 4JKZA 3DCFA 4W1UA 2G7SA 2ID3A 3BR1A 4MO7A 4HKUA 3BTCA 2G3BA 4NELA 3VOKA 2G7GA 5K7ZA 4ICHA 1SGMA 2QTQA 5K7FA 2ZOYA 3VIBA 3Q0VA 3HTJA 2QWTA 1BJZA 3VW1A 3LOCA 4B1RA 4B3AA 1T56A 2G0EA 4M3FA 1JUMA 2QCOA 5K7HA 2D6YA 2X9DA 1ZKGA 3CWRA 3O8GA 2FD5A 2WUIA 4PXIA 4MK6A 5FMPA 3C07A 3BQZA 3HGGA 5HAWA 1JTYA 2XB5A 2HKUA 3T6NA 4GFLA 1U9NA 1UI5A 3BR3A 4D5FA 3C2BA 2ID6A 3QQAA 2HXIA 3QBMA 2UXUA 4M3BA 2WV1A 4AC6A 3TP3A 3HTIA 3KNWA 1U9OA 2HXOA 3BTLA 3LSRA 2RASA 4DW6A 4GFKA 1JT6A 3BR6A 2UXHA 2Y2ZA 2ZCNA 3VPRA 3QPSA 3SDGA 2PBXA 2HYTA 3RH2A 4AUXA 3Q0UA 2GUHA 3CDLA 3KKDA 1JTXA 2OF7A 3NPIA 5F0HA 3FIWA 2I10A 2OERA 5EFYA 2ZOZA 3VUQA 4AC0A 2VKEA 1RKTA 5C4YA 4M3DA 5FKMA 3KZ9A 3BJBA 3PPBA 4I6ZA 5CXGA 1RPWA 5CW8A 2JJ7A 2RHAA 2TCTA 3AQTA 1QVUA 2XGDA 3PASA 3RD3A 3CCYA 3CJDA 3ANPA 3E7QA 3VW2A 3V6GA 5EYRA 5F0FA 3B6AA 2NP5A 2XGEA 3QPLA 2XRLA 1QVTA 3IH4A 3B6CA 2HQ5A 3HE0A 3P9TA 1QPIA 5GP9A 4XK4A 2QIBA 3BRUA 3O8HA 2FQ4A 3BT9A 5F0CA 2IAIA 5FGLA 4UDSA 3HTHA 4M3EA 2REKA 5HBUA 3LJLA 3NXCA 4MXMA 3BR5A 3LWJA 2FBQA 2TRTA 5FHPA 4CGRA 2V57A 3FRQA 4JYKA 5EZHA 1JUPA 3HTAA 5F1JA 3VVYA 2VKVA 4W97A 4L62A 3LSJA 3FK6A 4ME9A 2G7LA 3S5RA 1JT0A 4ABZA 3HGYA 2JK3A 2DG8A 2IBDA 2VPRA 5D19A 3IH3A 2IEKA 2NS8A 2YVHA 1VI0A 3ANGA 5FKLA 5D1RA 3BNIA 3ZQLA 3Q3SA 1Z77A 2NS7A 3BQYA 3AQSA 5D18A 5F27A 4JL3A 3V78A 3ZQHA 3VVXA 3DEWA 5IOZA 2UXPA 1UI6A 4V2FA 3TP0A 4V2GA 5HSZA 3G7RA 3G56A 3VVZA 3KKCA 2FX0A 3SFIA 2FJ1A 5DAJA 2EH3A 4G12A 3G1LA 2NX4A 3BTIA 4D7NA 2XPUA 5FKNA 3IUVA 2ZCXA 5H9TA 2OPTA 3GZIA 4ACIA 3ZQGA 3COLA 1A6IA 2XGCA 2DG7A 2F07A 3BR2A 1Z0XA 4GCLA 5IP6A 5K58A 3ZQIA 5F04A 2GBYA 5CXIA 2O7OA 3BCGA 4JNNA 5FKKA 5GPCA 3NRGA 2RAEA 3LSPA 1T33A 5J1YA 2GFNA 2IU5A 3QKXA 3DPJA 2Q24A 2W53A 5AQCA 3F0CA 2QKOA 2UXOA 3EGQA 4YZEA 4D7MA 3O60A 2HYJA 5J1UA 3VP5A 3G1MA 1JUSA 4NN1A 5J3LA 5J1RA 5GPAA 4KWAA 2GENA 3EUPA 5EZGA 3FK7A 1RKWA 1ZK8A 3IH2A 3BTJA 4GCTA 5IOYA 3JSJA 2X6OA 4GCKA 4D5CA 3NI7A 2OI8A 2ZCMA 3F1BA 2UXIA 3B81A 5FKOA 3CRJA 3BHQA 3LHQA 2WGBA 3VW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I76 A;  2O7T A;  3ON4 A;  2NP3 A;  2Y31 A;  3GEU A;  3Q0W A;  3MNL A;  5IPA A;  4AF5 A;  2Y30 A;  3WHC A;  2ZB9 A;  5F08 A;  2XPW A;  3HIM A;  3G1O A;  2YVE A;  4M3G A;  3PM1 A;  2PZ9 A;  2XDN A;  3ZQF A;  3MVP A;  3VOX A;  3NNR A;  3WHB A;  1ORK A;  2QOP A;  2XPV A;  4X1E A;  3ON2 A;  2DTZ A;  3BR0 A;  4JKZ A;  3DCF A;  4W1U A;  2G7S A;  2ID3 A;  3BR1 A;  4MO7 A;  4HKU A;  3BTC A;  2G3B A;  4NEL A;  3VOK A;  2G7G A;  5K7Z A;  4ICH A;  1SGM A;  2QTQ A;  5K7F A;  2ZOY A;  3VIB A;  3Q0V A;  3HTJ A;  2QWT A;  1BJZ A;  3VW1 A;  3LOC A;  4B1R A;  4B3A A;  1T56 A;  2G0E A;  4M3F A;  1JUM A;  2QCO A;  5K7H A;  2D6Y A;  2X9D A;  1ZKG A;  3CWR A;  3O8G A;  2FD5 A;  2WUI A;  4PXI A;  4MK6 A;  5FMP A;  3C07 A;  3BQZ A;  3HGG A;  5HAW A;  1JTY A;  2XB5 A;  2HKU A;  3T6N A;  4GFL A;  1U9N A;  1UI5 A;  3BR3 A;  4D5F A;  3C2B A;  2ID6 A;  3QQA A;  2HXI A;  3QBM A;  2UXU A;  4M3B A;  2WV1 A;  4AC6 A;  3TP3 A;  3HTI A;  3KNW A;  1U9O A;  2HXO A;  3BTL A;  3LSR A;  2RAS A;  4DW6 A;  4GFK A;  1JT6 A;  3BR6 A;  2UXH A;  2Y2Z A;  2ZCN A;  3VPR A;  3QPS A;  3SDG A;  2PBX A;  2HYT A;  3RH2 A;  4AUX A;  3Q0U A;  2GUH A;  3CDL A;  3KKD A;  1JTX A;  2OF7 A;  3NPI A;  5F0H A;  3FIW A;  2I10 A;  2OER A;  5EFY A;  2ZOZ A;  3VUQ A;  4AC0 A;  2VKE A;  1RKT A;  5C4Y A;  4M3D A;  5FKM A;  3KZ9 A;  3BJB A;  3PPB A;  4I6Z A;  5CXG A;  1RPW A;  5CW8 A;  2JJ7 A;  2RHA A;  2TCT A;  3AQT A;  1QVU A;  2XGD A;  3PAS A;  3RD3 A;  3CCY A;  3CJD A;  3ANP A;  3E7Q A;  3VW2 A;  3V6G A;  5EYR A;  5F0F A;  3B6A A;  2NP5 A;  2XGE A;  3QPL A;  2XRL A;  1QVT A;  3IH4 A;  3B6C A;  2HQ5 A;  3HE0 A;  3P9T A;  1QPI A;  5GP9 A;  4XK4 A;  2QIB A;  3BRU A;  3O8H A;  2FQ4 A;  3BT9 A;  5F0C A;  2IAI A;  5FGL A;  4UDS A;  3HTH A;  4M3E A;  2REK A;  5HBU A;  3LJL A;  3NXC A;  4MXM A;  3BR5 A;  3LWJ A;  2FBQ A;  2TRT A;  5FHP A;  4CGR A;  2V57 A;  3FRQ A;  4JYK A;  5EZH A;  1JUP A;  3HTA A;  5F1J A;  3VVY A;  2VKV A;  4W97 A;  4L62 A;  3LSJ A;  3FK6 A;  4ME9 A;  2G7L A;  3S5R A;  1JT0 A;  4ABZ A;  3HGY A;  2JK3 A;  2DG8 A;  2IBD A;  2VPR A;  5D19 A;  3IH3 A;  2IEK A;  2NS8 A;  2YVH A;  1VI0 A;  3ANG A;  5FKL A;  5D1R A;  3BNI A;  3ZQL A;  3Q3S A;  1Z77 A;  2NS7 A;  3BQY A;  3AQS A;  5D18 A;  5F27 A;  4JL3 A;  3V78 A;  3ZQH A;  3VVX A;  3DEW A;  5IOZ A;  2UXP A;  1UI6 A;  4V2F A;  3TP0 A;  4V2G A;  5HSZ A;  3G7R A;  3G56 A;  3VVZ A;  3KKC A;  2FX0 A;  3SFI A;  2FJ1 A;  5DAJ A;  2EH3 A;  4G12 A;  3G1L A;  2NX4 A;  3BTI A;  4D7N A;  2XPU A;  5FKN A;  3IUV A;  2ZCX A;  5H9T A;  2OPT A;  3GZI A;  4ACI A;  3ZQG A;  3COL A;  1A6I A;  2XGC A;  2DG7 A;  2F07 A;  3BR2 A;  1Z0X A;  4GCL A;  5IP6 A;  5K58 A;  3ZQI A;  5F04 A;  2GBY A;  5CXI A;  2O7O A;  3BCG A;  4JNN A;  5FKK A;  5GPC A;  3NRG A;  2RAE A;  3LSP A;  1T33 A;  5J1Y A;  2GFN A;  2IU5 A;  3QKX A;  3DPJ A;  2Q24 A;  2W53 A;  5AQC A;  3F0C A;  2QKO A;  2UXO A;  3EGQ A;  4YZE A;  4D7M A;  3O60 A;  2HYJ A;  5J1U A;  3VP5 A;  3G1M A;  1JUS A;  4NN1 A;  5J3L A;  5J1R A;  5GPA A;  4KWA A;  2GEN A;  3EUP A;  5EZG A;  3FK7 A;  1RKW A;  1ZK8 A;  3IH2 A;  3BTJ A;  4GCT A;  5IOY A;  3JSJ A;  2X6O A;  4GCK A;  4D5C A;  3NI7 A;  2OI8 A;  2ZCM A;  3F1B A;  2UXI A;  3B81 A;  5FKO A;  3CRJ A;  3BHQ A;  3LHQ A;  2WGB A;  3VW0 A; 
#chains in the Genus database with same CATH topology
 4I76 A;  2O7T A;  3ON4 A;  2NP3 A;  2Y31 A;  3GEU A;  3Q0W A;  3MNL A;  5IPA A;  4AF5 A;  2Y30 A;  3WHC A;  2ZB9 A;  5F08 A;  2XPW A;  3HIM A;  3G1O A;  2YVE A;  4M3G A;  3PM1 A;  2PZ9 A;  2XDN A;  3ZQF A;  3MVP A;  3VOX A;  3NNR A;  3WHB A;  1ORK A;  2QOP A;  2XPV A;  4X1E A;  3ON2 A;  2DTZ A;  3BR0 A;  4JKZ A;  3DCF A;  4W1U A;  2G7S A;  2ID3 A;  3BR1 A;  4MO7 A;  4HKU A;  3BTC A;  2G3B A;  4NEL A;  2FJI 1;  3VOK A;  2G7G A;  5K7Z A;  4ICH A;  1SGM A;  2QTQ A;  5K7F A;  2ZOY A;  3VIB A;  3Q0V A;  3HTJ A;  3FHN A;  2QWT A;  1BJZ A;  3VW1 A;  3LOC A;  4B1R A;  4B3A A;  1T56 A;  2G0E A;  2YVX A;  4M3F A;  1JUM A;  2QCO A;  4C2M A;  5K7H A;  2D6Y A;  2X9D A;  2R7S A;  1ZKG A;  3CWR A;  3O8G A;  2FD5 A;  2WUI A;  4PXI A;  4MK6 A;  5FMP A;  3C07 A;  3BQZ A;  3HGG A;  5HAW A;  1JTY A;  2XB5 A;  2HKU A;  3T6N A;  4GFL A;  1U9N A;  1UI5 A;  3BR3 A;  4D5F A;  3C2B A;  2ID6 A;  3QQA A;  2HXI A;  3QBM A;  2UXU A;  4M3B A;  2WV1 A;  4AC6 A;  3TP3 A;  3HTI A;  3KNW A;  1U9O A;  2HXO A;  3BTL A;  3LSR A;  2RAS A;  4DW6 A;  4GFK A;  1JT6 A;  3BR6 A;  2UXH A;  2Y2Z A;  2ZCN A;  2R7U A;  3VPR A;  3QPS A;  3SDG A;  2PBX A;  2HYT A;  3RH2 A;  4AUX A;  3Q0U A;  2GUH A;  3CDL A;  3KYL A;  3KKD A;  1JTX A;  2OF7 A;  2R7Q A;  3NPI A;  5F0H A;  3FIW A;  2I10 A;  2OER A;  5EFY A;  2ZOZ A;  3VUQ A;  4AC0 A;  2VKE A;  1RKT A;  5C4Y A;  4M3D A;  5FKM A;  3KZ9 A;  3BJB A;  3PPB A;  4I6Z A;  5CXG A;  1RPW A;  5CW8 A;  2JJ7 A;  2RHA A;  2TCT A;  3AQT A;  1QVU A;  2XGD A;  3PAS A;  3RD3 A;  3SWH A;  3CCY A;  3CJD A;  3ANP A;  3DU5 A;  3E7Q A;  3VW2 A;  3V6G A;  5EYR A;  5F0F A;  3B6A A;  2NP5 A;  2XGE A;  3QPL A;  2XRL A;  1QVT A;  3IH4 A;  3B6C A;  2HQ5 A;  3HE0 A;  3P9T A;  2R7R A;  1QPI A;  5CQG A;  5GP9 A;  4XK4 A;  2QIB A;  3BRU A;  3O8H A;  2FQ4 A;  3BT9 A;  5F0C A;  2IAI A;  5FGL A;  4U9L A;  4UDS A;  3HTH A;  4M3E A;  2REK A;  5HBU A;  3LJL A;  3NXC A;  4MXM A;  3BR5 A;  3LWJ A;  2FBQ A;  4OD4 A;  2TRT A;  5FHP A;  4CGR A;  3DU6 A;  2V57 A;  3FRQ A;  3NS4 A;  4JYK A;  5EZH A;  1JUP A;  3HTA A;  5F1J A;  3VVY A;  2VKV A;  4W97 A;  2R7W A;  4L62 A;  3LSJ A;  3FK6 A;  4ME9 A;  4U9N A;  2G7L A;  3S5R A;  1JT0 A;  4ABZ A;  3HGY A;  2JK3 A;  2DG8 A;  2IBD A;  2VPR A;  5D19 A;  3IH3 A;  4DVY P;  2IEK A;  2NS8 A;  2YVH A;  1VI0 A;  2R7X A;  3ANG A;  3K8P C;  5FKL A;  5D1R A;  3BNI A;  3ZQL A;  3Q3S A;  1Z77 A;  2NS7 A;  3VTI A;  3BQY A;  3AQS A;  5D18 A;  5F27 A;  4JL3 A;  3V78 A;  3ZQH A;  3VVX A;  3DEW A;  5IOZ A;  2ZY9 A;  2UXP A;  1UI6 A;  4V2F A;  3TP0 A;  4V2G A;  5HSZ A;  2PFV A;  3G7R A;  3G56 A;  3VVZ A;  3KKC A;  2FX0 A;  3SFI A;  2FJ1 A;  5DAJ A;  2EH3 A;  4G12 A;  3G1L A;  2NX4 A;  3BTI A;  4D7N A;  2XPU A;  5FKN A;  3IUV A;  2ZCX A;  5H9T A;  2A2F X;  2OPT A;  3GZI A;  2B3W A;  4ACI A;  3ZQG A;  3COL A;  1A6I A;  2R7T A;  2XGC A;  2DG7 A;  2F07 A;  3BR2 A;  1Z0X A;  4GCL A;  5IP6 A;  5K58 A;  3ZQI A;  5F04 A;  2GBY A;  5CXI A;  4OD5 A;  2O7O A;  3BCG A;  4JNN A;  5FKK A;  5GPC A;  3NRG A;  2RAE A;  3LSP A;  1T33 A;  5J1Y A;  2GFN A;  2IU5 A;  3QKX A;  4IRV A;  3DPJ A;  2Q24 A;  2W53 A;  2R7O A;  5AQC A;  3F0C A;  2B1E A;  2QKO A;  2UXO A;  3EGQ A;  4YZE A;  4D7M A;  3O60 A;  2HYJ A;  5J1U A;  3VP5 A;  3G1M A;  1JUS A;  4NN1 A;  5J3L A;  5J1R A;  5GPA A;  4KWA A;  2GEN A;  3EUP A;  5EZG A;  3FK7 A;  1RKW A;  1ZK8 A;  3IH2 A;  3BTJ A;  4GCT A;  5IOY A;  3JSJ A;  2X6O A;  4WIB A;  4GCK A;  4D5C A;  3NI7 A;  2OI8 A;  2ZCM A;  3F1B A;  2UXI A;  3B81 A;  5FKO A;  3CRJ A;  3BHQ A;  3LHQ A;  2WGB A;  2R7V A;  3VW0 A; 
#chains in the Genus database with same CATH homology
 4I76 A;  2O7T A;  3ON4 A;  2NP3 A;  2Y31 A;  3GEU A;  3Q0W A;  3MNL A;  5IPA A;  4AF5 A;  2Y30 A;  3WHC A;  2ZB9 A;  5F08 A;  2XPW A;  3HIM A;  3G1O A;  2YVE A;  4M3G A;  3PM1 A;  2PZ9 A;  2XDN A;  3ZQF A;  3MVP A;  3VOX A;  3NNR A;  3WHB A;  1ORK A;  2QOP A;  2XPV A;  4X1E A;  3ON2 A;  2DTZ A;  3BR0 A;  4JKZ A;  3DCF A;  4W1U A;  2G7S A;  2ID3 A;  3BR1 A;  4MO7 A;  4HKU A;  3BTC A;  2G3B A;  4NEL A;  3VOK A;  2G7G A;  5K7Z A;  4ICH A;  1SGM A;  2QTQ A;  5K7F A;  2ZOY A;  3VIB A;  3Q0V A;  3HTJ A;  2QWT A;  1BJZ A;  3VW1 A;  3LOC A;  4B1R A;  4B3A A;  1T56 A;  2G0E A;  4M3F A;  1JUM A;  2QCO A;  5K7H A;  2D6Y A;  2X9D A;  1ZKG A;  3CWR A;  3O8G A;  2FD5 A;  2WUI A;  4PXI A;  4MK6 A;  5FMP A;  3C07 A;  3BQZ A;  3HGG A;  5HAW A;  1JTY A;  2XB5 A;  2HKU A;  3T6N A;  4GFL A;  1U9N A;  1UI5 A;  3BR3 A;  4D5F A;  3C2B A;  2ID6 A;  3QQA A;  2HXI A;  3QBM A;  2UXU A;  4M3B A;  2WV1 A;  4AC6 A;  3TP3 A;  3HTI A;  3KNW A;  1U9O A;  2HXO A;  3BTL A;  3LSR A;  2RAS A;  4DW6 A;  4GFK A;  1JT6 A;  3BR6 A;  2UXH A;  2Y2Z A;  2ZCN A;  3VPR A;  3QPS A;  3SDG A;  2PBX A;  2HYT A;  3RH2 A;  4AUX A;  3Q0U A;  2GUH A;  3CDL A;  3KKD A;  1JTX A;  2OF7 A;  3NPI A;  5F0H A;  3FIW A;  2I10 A;  2OER A;  5EFY A;  2ZOZ A;  3VUQ A;  4AC0 A;  2VKE A;  1RKT A;  5C4Y A;  4M3D A;  5FKM A;  3KZ9 A;  3BJB A;  3PPB A;  4I6Z A;  5CXG A;  1RPW A;  5CW8 A;  2JJ7 A;  2RHA A;  2TCT A;  3AQT A;  1QVU A;  2XGD A;  3PAS A;  3RD3 A;  3CCY A;  3CJD A;  3ANP A;  3E7Q A;  3VW2 A;  3V6G A;  5EYR A;  5F0F A;  3B6A A;  2NP5 A;  2XGE A;  3QPL A;  2XRL A;  1QVT A;  3IH4 A;  3B6C A;  2HQ5 A;  3HE0 A;  3P9T A;  1QPI A;  5GP9 A;  4XK4 A;  2QIB A;  3BRU A;  3O8H A;  2FQ4 A;  3BT9 A;  5F0C A;  2IAI A;  5FGL A;  4UDS A;  3HTH A;  4M3E A;  2REK A;  5HBU A;  3LJL A;  3NXC A;  4MXM A;  3BR5 A;  3LWJ A;  2FBQ A;  2TRT A;  5FHP A;  4CGR A;  2V57 A;  3FRQ A;  4JYK A;  5EZH A;  1JUP A;  3HTA A;  5F1J A;  3VVY A;  2VKV A;  4W97 A;  4L62 A;  3LSJ A;  3FK6 A;  4ME9 A;  2G7L A;  3S5R A;  1JT0 A;  4ABZ A;  3HGY A;  2JK3 A;  2DG8 A;  2IBD A;  2VPR A;  5D19 A;  3IH3 A;  2IEK A;  2NS8 A;  2YVH A;  1VI0 A;  3ANG A;  5FKL A;  5D1R A;  3BNI A;  3ZQL A;  3Q3S A;  1Z77 A;  2NS7 A;  3BQY A;  3AQS A;  5D18 A;  5F27 A;  4JL3 A;  3V78 A;  3ZQH A;  3VVX A;  3DEW A;  5IOZ A;  2UXP A;  1UI6 A;  4V2F A;  3TP0 A;  4V2G A;  5HSZ A;  3G7R A;  3G56 A;  3VVZ A;  3KKC A;  2FX0 A;  3SFI A;  2FJ1 A;  5DAJ A;  2EH3 A;  4G12 A;  3G1L A;  2NX4 A;  3BTI A;  4D7N A;  2XPU A;  5FKN A;  3IUV A;  2ZCX A;  5H9T A;  2OPT A;  3GZI A;  4ACI A;  3ZQG A;  3COL A;  1A6I A;  2XGC A;  2DG7 A;  2F07 A;  3BR2 A;  1Z0X A;  4GCL A;  5IP6 A;  5K58 A;  3ZQI A;  5F04 A;  2GBY A;  5CXI A;  2O7O A;  3BCG A;  4JNN A;  5FKK A;  5GPC A;  3NRG A;  2RAE A;  3LSP A;  1T33 A;  5J1Y A;  2GFN A;  2IU5 A;  3QKX A;  3DPJ A;  2Q24 A;  2W53 A;  5AQC A;  3F0C A;  2QKO A;  2UXO A;  3EGQ A;  4YZE A;  4D7M A;  3O60 A;  2HYJ A;  5J1U A;  3VP5 A;  3G1M A;  1JUS A;  4NN1 A;  5J3L A;  5J1R A;  5GPA A;  4KWA A;  2GEN A;  3EUP A;  5EZG A;  3FK7 A;  1RKW A;  1ZK8 A;  3IH2 A;  3BTJ A;  4GCT A;  5IOY A;  3JSJ A;  2X6O A;  4GCK A;  4D5C A;  3NI7 A;  2OI8 A;  2ZCM A;  3F1B A;  2UXI A;  3B81 A;  5FKO A;  3CRJ A;  3BHQ A;  3LHQ A;  2WGB A;  3VW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...