2OI8A

Crystal structure of putative regulatory protein sco4313
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
209
structure length
203
Chain Sequence
TPRERYRTQVRAEIKDHAWEQIATAGASALSLNAIAKRMGMSGPALYRYFDGRDELITELIRDAYRSQADSLRAAAASGADLAGLAHALRAWALDDPQRYFLIFGTPVPGYRAPDDITEIAAETMAVIVDACAAGTDGAFDAHLDTHRQWADRPAPSSALHRALSFWSRLHGVLSLELAGQFTGMGFDSALLFEAELKDLLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative regulatory protein SCO4313
publication title Crystal structure of tetR family protein SCO4313
rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 65
structure length 203
sequence length 209
ec nomenclature
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF13305 TetR_C_33 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2oi8A00
5J1RA 2G7LA 3KKDA 5HSZA 5K7ZA 2EH3A 4HKUA 2W53A 3RH2A 1BJZA 2XB5A 4D7NA 3QBMA 2G0EA 2DTZA 3HE0A 2NP5A 2VKVA 2UXPA 3LSPA 4D7MA 4MXMA 3VOXA 3ZQLA 3BTJA 4I6ZA 5GP9A 2NS8A 3BJBA 3DEWA 2QCOA 2QOPA 5C4YA 2ID3A 3BHQA 4JNNA 5J1UA 4ICHA 2NS7A 4XK4A 4AC6A 3CWRA 3G56A 2Y30A 3SFIA 3ZQIA 3O8GA 2HYJA 4M3EA 2FX0A 3LHQA 2NX4A 2XGEA 4GCLA 4YZEA 3GZIA 3VPRA 1U9NA 2FD5A 3Q0WA 3VW0A 5HBUA 4D5FA 1JT6A 4V2GA 3NI7A 5GPAA 3HIMA 3VVYA 3PPBA 4NN1A 5F08A 1RKWA 3VP5A 5IOZA 1ZKGA 2NP3A 2UXOA 2XDNA 1SGMA 1VI0A 2VKEA 4M3DA 4UDSA 3LWJA 2GUHA 2ZCMA 5F04A 2FJ1A 2PBXA 3WHCA 3F0CA 3LOCA 2WV1A 5IPAA 2F07A 3VUQA 3AQSA 4D5CA 3O8HA 3BQYA 2XPUA 3LJLA 3PM1A 3G1LA 3RD3A 3BRUA 2ZOYA 5H9TA 3C07A 3V6GA 3EGQA 3BR1A 3MVPA 2X6OA 1JTXA 2GBYA 3GEUA 3Q0VA 3E7QA 5EFYA 3HGYA 5F0CA 4B3AA 4ME9A 2REKA 3AQTA 1Z0XA 1QVUA 2ZOZA 2V57A 3BTIA 4JL3A 4DW6A 2PZ9A 5CW8A 2HYTA 2YVHA 4ACIA 2QKOA 2TRTA 3DCFA 3CCYA 1UI6A 2IU5A 2XRLA 2OF7A 2GFNA 3S5RA 3ANGA 4M3BA 4JKZA 5EZGA 4KWAA 3V78A 1ZK8A 3HTHA 2YVEA 3BCGA 3CJDA 4I76A 2ZCXA 2IAIA 3QPLA 3TP3A 3IH2A 2QTQA 3QKXA 1QVTA 2D6YA 3ON4A 2I10A 4JYKA 3NXCA 2VPRA 5J1YA 1UI5A 2XGCA 4GFLA 5D1RA 3COLA 2G7GA 3KNWA 4M3GA 5FGLA 3VOKA 3BR6A 3O60A 4PXIA 5IOYA 5FHPA 3MNLA 3ZQHA 3VIBA 1JUPA 2Y2ZA 3HTAA 5F0FA 2QWTA 3FK7A 3IUVA 3KKCA 2XPVA 3VW1A 4AUXA 2RHAA 1T33A 2Y31A 4L62A 2UXIA 3CRJA 3ON2A 5AQCA 4G12A 3BR2A 2RASA 4X1EA 3B6AA 4ABZA 2OPTA 4GCTA 3DPJA 5D19A 5K58A 1T56A 2DG8A 5J3LA 2O7OA 5DAJA 2GENA 1Z77A 2ID6A 3BNIA 3Q0UA 3G1MA 3HTJA 1JUSA 5IP6A 1U9OA 4GCKA 5K7FA 3NRGA 3T6NA 1JTYA 2TCTA 1QPIA 3BR0A 4AF5A 2XPWA 3NNRA 3FK6A 3G7RA 3CDLA 3P9TA 2UXHA 4NELA 3ZQFA 2QIBA 1RPWA 2FBQA 3JSJA 5HAWA 2FQ4A 2HKUA 3B81A 3BTCA 3QQAA 2WUIA 3IH3A 3F1BA 2Q24A 1RKTA 2G3BA 5FKMA 1JUMA 5CXGA 5K7HA 5F27A 5CXIA 4B1RA 4W1UA 5F0HA 2OERA 4V2FA 3KZ9A 4GFKA 2ZCNA 4M3FA 2ZB9A 5GPCA 4CGRA 3VVXA 2OI8A 2X9DA 3BQZA 3QPSA 3EUPA 3FRQA 5F1JA 3IH4A 3BR5A 3B6CA 1JT0A 3WHBA 2JK3A 5FKNA 2JJ7A 5D18A 4MO7A 5FMPA 3PASA 3BTLA 2IBDA 3LSRA 5EZHA 2UXUA 2HXOA 5FKOA 3LSJA 3ZQGA 3SDGA 3NPIA 3Q3SA 3HGGA 2HXIA 1A6IA 2XGDA 3VVZA 2WGBA 2IEKA 5EYRA 3BT9A 3HTIA 4W97A 3C2BA 4MK6A 3VW2A 3FIWA 2O7TA 5FKLA 3BR3A 1ORKA 3G1OA 4AC0A 2HQ5A 2RAEA 5FKKA 3ANPA 2G7SA 3TP0A 2DG7A
chains in the Genus database with same CATH superfamily
5J1RA 2G7LA 3KKDA 5HSZA 5K7ZA 2EH3A 4HKUA 2W53A 3RH2A 1BJZA 2XB5A 4D7NA 3QBMA 2G0EA 2DTZA 3HE0A 2NP5A 2VKVA 2UXPA 3LSPA 4D7MA 4MXMA 3VOXA 3ZQLA 2R7VA 3BTJA 4I6ZA 5GP9A 2NS8A 3BJBA 3DEWA 2QCOA 2QOPA 5C4YA 2ID3A 3BHQA 4JNNA 5J1UA 4ICHA 2R7RA 2NS7A 4XK4A 4AC6A 3CWRA 3G56A 2Y30A 3SFIA 3ZQIA 3O8GA 2HYJA 4M3EA 2FX0A 3LHQA 2NX4A 2XGEA 4GCLA 4YZEA 3GZIA 3VPRA 1U9NA 2FD5A 3Q0WA 3VW0A 5HBUA 4D5FA 1JT6A 2YVXA 4V2GA 4WIBA 3NI7A 2R7TA 5GPAA 3HIMA 3VVYA 2FJI1 3PPBA 4NN1A 5F08A 1RKWA 3VP5A 5IOZA 1ZKGA 2NP3A 2UXOA 2XDNA 1SGMA 4DVYP 1VI0A 2VKEA 4M3DA 4UDSA 3LWJA 2GUHA 2ZCMA 5F04A 2FJ1A 2PBXA 2R7SA 3WHCA 3F0CA 3LOCA 2WV1A 5IPAA 2F07A 3VUQA 3AQSA 4D5CA 3O8HA 3BQYA 2XPUA 2B3WA 3LJLA 3PM1A 3G1LA 2R7OA 3RD3A 3BRUA 2ZOYA 5H9TA 3C07A 3V6GA 3EGQA 3BR1A 3MVPA 2X6OA 1JTXA 2R7XA 2GBYA 3GEUA 3Q0VA 3E7QA 5EFYA 3HGYA 5F0CA 4B3AA 4ME9A 2REKA 3AQTA 1Z0XA 1QVUA 2ZOZA 2V57A 4IRVA 3BTIA 4JL3A 4DW6A 2PZ9A 5CW8A 2HYTA 2YVHA 4ACIA 3NS4A 2QKOA 2TRTA 3DCFA 3CCYA 1UI6A 2IU5A 2XRLA 2OF7A 2GFNA 3S5RA 3ANGA 4M3BA 4JKZA 5EZGA 4KWAA 3V78A 1ZK8A 3HTHA 2YVEA 3BCGA 3CJDA 4I76A 2ZCXA 2IAIA 3QPLA 3TP3A 3IH2A 2QTQA 3QKXA 1QVTA 2D6YA 3ON4A 2I10A 4JYKA 3NXCA 2VPRA 2PFVA 5J1YA 2B1EA 1UI5A 4C2MA 2XGCA 4GFLA 5D1RA 3COLA 2G7GA 3KNWA 4M3GA 5FGLA 3VOKA 3BR6A 3O60A 4PXIA 5IOYA 3DU6A 5FHPA 3MNLA 3ZQHA 3VIBA 1JUPA 2Y2ZA 3HTAA 5F0FA 2QWTA 3FK7A 3IUVA 3KKCA 2XPVA 3VW1A 4AUXA 2RHAA 1T33A 2Y31A 4L62A 2UXIA 3VTIA 3CRJA 3ON2A 5AQCA 4G12A 3BR2A 2RASA 4X1EA 3B6AA 4ABZA 2OPTA 4GCTA 3DPJA 5D19A 5K58A 1T56A 2DG8A 5J3LA 2O7OA 5DAJA 2GENA 1Z77A 2ID6A 3BNIA 3Q0UA 3G1MA 3HTJA 1JUSA 5IP6A 1U9OA 4GCKA 2A2FX 5K7FA 3DU5A 3SWHA 3NRGA 3T6NA 1JTYA 2TCTA 1QPIA 3BR0A 4AF5A 2R7UA 4U9NA 2XPWA 3NNRA 3FK6A 3G7RA 2ZY9A 3CDLA 3P9TA 2UXHA 4NELA 3ZQFA 2QIBA 4U9LA 1RPWA 2FBQA 4OD5A 3JSJA 5HAWA 2FQ4A 2HKUA 3B81A 3BTCA 3QQAA 2WUIA 3IH3A 3F1BA 2Q24A 1RKTA 2G3BA 2R7QA 5FKMA 2R7WA 1JUMA 5CXGA 5K7HA 5F27A 5CXIA 4B1RA 4W1UA 5F0HA 2OERA 4V2FA 3KZ9A 4GFKA 2ZCNA 4M3FA 2ZB9A 5GPCA 4CGRA 3VVXA 2OI8A 2X9DA 3BQZA 3K8PC 3QPSA 3EUPA 3FRQA 5F1JA 3IH4A 3BR5A 3B6CA 1JT0A 3WHBA 2JK3A 5FKNA 2JJ7A 5D18A 4MO7A 5FMPA 3PASA 3BTLA 2IBDA 3LSRA 5EZHA 2UXUA 2HXOA 5FKOA 3LSJA 3ZQGA 3SDGA 4OD4A 3NPIA 3Q3SA 3HGGA 2HXIA 1A6IA 2XGDA 5CQGA 3VVZA 2WGBA 3FHNA 2IEKA 5EYRA 3BT9A 3HTIA 4W97A 3C2BA 4MK6A 3VW2A 3FIWA 2O7TA 5FKLA 3BR3A 1ORKA 3G1OA 4AC0A 2HQ5A 2RAEA 5FKKA 3ANPA 2G7SA 3TP0A 2DG7A 3KYLA
chains in the Genus database with same CATH topology
5J1RA 2G7LA 3KKDA 5HSZA 5K7ZA 2EH3A 4HKUA 2W53A 3RH2A 1BJZA 2XB5A 4D7NA 3QBMA 2G0EA 2DTZA 3HE0A 2NP5A 2VKVA 2UXPA 3LSPA 4D7MA 4MXMA 3VOXA 3ZQLA 3BTJA 4I6ZA 5GP9A 2NS8A 3BJBA 3DEWA 2QCOA 2QOPA 5C4YA 2ID3A 3BHQA 4JNNA 5J1UA 4ICHA 2NS7A 4XK4A 4AC6A 3CWRA 3G56A 2Y30A 3SFIA 3ZQIA 3O8GA 2HYJA 4M3EA 2FX0A 3LHQA 2NX4A 2XGEA 4GCLA 4YZEA 3GZIA 3VPRA 1U9NA 2FD5A 3Q0WA 3VW0A 5HBUA 4D5FA 1JT6A 4V2GA 3NI7A 5GPAA 3HIMA 3VVYA 3PPBA 4NN1A 5F08A 1RKWA 3VP5A 5IOZA 1ZKGA 2NP3A 2UXOA 2XDNA 1SGMA 1VI0A 2VKEA 4M3DA 4UDSA 3LWJA 2GUHA 2ZCMA 5F04A 2FJ1A 2PBXA 3WHCA 3F0CA 3LOCA 2WV1A 5IPAA 2F07A 3VUQA 3AQSA 4D5CA 3O8HA 3BQYA 2XPUA 3LJLA 3PM1A 3G1LA 3RD3A 3BRUA 2ZOYA 5H9TA 3C07A 3V6GA 3EGQA 3BR1A 3MVPA 2X6OA 1JTXA 2GBYA 3GEUA 3Q0VA 3E7QA 5EFYA 3HGYA 5F0CA 4B3AA 4ME9A 2REKA 3AQTA 1Z0XA 1QVUA 2ZOZA 2V57A 3BTIA 4JL3A 4DW6A 2PZ9A 5CW8A 2HYTA 2YVHA 4ACIA 2QKOA 2TRTA 3DCFA 3CCYA 1UI6A 2IU5A 2XRLA 2OF7A 2GFNA 3S5RA 3ANGA 4M3BA 4JKZA 5EZGA 4KWAA 3V78A 1ZK8A 3HTHA 2YVEA 3BCGA 3CJDA 4I76A 2ZCXA 2IAIA 3QPLA 3TP3A 3IH2A 2QTQA 3QKXA 1QVTA 2D6YA 3ON4A 2I10A 4JYKA 3NXCA 2VPRA 5J1YA 1UI5A 2XGCA 4GFLA 5D1RA 3COLA 2G7GA 3KNWA 4M3GA 5FGLA 3VOKA 3BR6A 3O60A 4PXIA 5IOYA 5FHPA 3MNLA 3ZQHA 3VIBA 1JUPA 2Y2ZA 3HTAA 5F0FA 2QWTA 3FK7A 3IUVA 3KKCA 2XPVA 3VW1A 4AUXA 2RHAA 1T33A 2Y31A 4L62A 2UXIA 3CRJA 3ON2A 5AQCA 4G12A 3BR2A 2RASA 4X1EA 3B6AA 4ABZA 2OPTA 4GCTA 3DPJA 5D19A 5K58A 1T56A 2DG8A 5J3LA 2O7OA 5DAJA 2GENA 1Z77A 2ID6A 3BNIA 3Q0UA 3G1MA 3HTJA 1JUSA 5IP6A 1U9OA 4GCKA 5K7FA 3NRGA 3T6NA 1JTYA 2TCTA 1QPIA 3BR0A 4AF5A 2XPWA 3NNRA 3FK6A 3G7RA 3CDLA 3P9TA 2UXHA 4NELA 3ZQFA 2QIBA 1RPWA 2FBQA 3JSJA 5HAWA 2FQ4A 2HKUA 3B81A 3BTCA 3QQAA 2WUIA 3IH3A 3F1BA 2Q24A 1RKTA 2G3BA 5FKMA 1JUMA 5CXGA 5K7HA 5F27A 5CXIA 4B1RA 4W1UA 5F0HA 2OERA 4V2FA 3KZ9A 4GFKA 2ZCNA 4M3FA 2ZB9A 5GPCA 4CGRA 3VVXA 2OI8A 2X9DA 3BQZA 3QPSA 3EUPA 3FRQA 5F1JA 3IH4A 3BR5A 3B6CA 1JT0A 3WHBA 2JK3A 5FKNA 2JJ7A 5D18A 4MO7A 5FMPA 3PASA 3BTLA 2IBDA 3LSRA 5EZHA 2UXUA 2HXOA 5FKOA 3LSJA 3ZQGA 3SDGA 3NPIA 3Q3SA 3HGGA 2HXIA 1A6IA 2XGDA 3VVZA 2WGBA 2IEKA 5EYRA 3BT9A 3HTIA 4W97A 3C2BA 4MK6A 3VW2A 3FIWA 2O7TA 5FKLA 3BR3A 1ORKA 3G1OA 4AC0A 2HQ5A 2RAEA 5FKKA 3ANPA 2G7SA 3TP0A 2DG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J1R A;  2G7L A;  3KKD A;  5HSZ A;  5K7Z A;  2EH3 A;  4HKU A;  2W53 A;  3RH2 A;  1BJZ A;  2XB5 A;  4D7N A;  3QBM A;  2G0E A;  2DTZ A;  3HE0 A;  2NP5 A;  2VKV A;  2UXP A;  3LSP A;  4D7M A;  4MXM A;  3VOX A;  3ZQL A;  3BTJ A;  4I6Z A;  5GP9 A;  2NS8 A;  3BJB A;  3DEW A;  2QCO A;  2QOP A;  5C4Y A;  2ID3 A;  3BHQ A;  4JNN A;  5J1U A;  4ICH A;  2NS7 A;  4XK4 A;  4AC6 A;  3CWR A;  3G56 A;  2Y30 A;  3SFI A;  3ZQI A;  3O8G A;  2HYJ A;  4M3E A;  2FX0 A;  3LHQ A;  2NX4 A;  2XGE A;  4GCL A;  4YZE A;  3GZI A;  3VPR A;  1U9N A;  2FD5 A;  3Q0W A;  3VW0 A;  5HBU A;  4D5F A;  1JT6 A;  4V2G A;  3NI7 A;  5GPA A;  3HIM A;  3VVY A;  3PPB A;  4NN1 A;  5F08 A;  1RKW A;  3VP5 A;  5IOZ A;  1ZKG A;  2NP3 A;  2UXO A;  2XDN A;  1SGM A;  1VI0 A;  2VKE A;  4M3D A;  4UDS A;  3LWJ A;  2GUH A;  2ZCM A;  5F04 A;  2FJ1 A;  2PBX A;  3WHC A;  3F0C A;  3LOC A;  2WV1 A;  5IPA A;  2F07 A;  3VUQ A;  3AQS A;  4D5C A;  3O8H A;  3BQY A;  2XPU A;  3LJL A;  3PM1 A;  3G1L A;  3RD3 A;  3BRU A;  2ZOY A;  5H9T A;  3C07 A;  3V6G A;  3EGQ A;  3BR1 A;  3MVP A;  2X6O A;  1JTX A;  2GBY A;  3GEU A;  3Q0V A;  3E7Q A;  5EFY A;  3HGY A;  5F0C A;  4B3A A;  4ME9 A;  2REK A;  3AQT A;  1Z0X A;  1QVU A;  2ZOZ A;  2V57 A;  3BTI A;  4JL3 A;  4DW6 A;  2PZ9 A;  5CW8 A;  2HYT A;  2YVH A;  4ACI A;  2QKO A;  2TRT A;  3DCF A;  3CCY A;  1UI6 A;  2IU5 A;  2XRL A;  2OF7 A;  2GFN A;  3S5R A;  3ANG A;  4M3B A;  4JKZ A;  5EZG A;  4KWA A;  3V78 A;  1ZK8 A;  3HTH A;  2YVE A;  3BCG A;  3CJD A;  4I76 A;  2ZCX A;  2IAI A;  3QPL A;  3TP3 A;  3IH2 A;  2QTQ A;  3QKX A;  1QVT A;  2D6Y A;  3ON4 A;  2I10 A;  4JYK A;  3NXC A;  2VPR A;  5J1Y A;  1UI5 A;  2XGC A;  4GFL A;  5D1R A;  3COL A;  2G7G A;  3KNW A;  4M3G A;  5FGL A;  3VOK A;  3BR6 A;  3O60 A;  4PXI A;  5IOY A;  5FHP A;  3MNL A;  3ZQH A;  3VIB A;  1JUP A;  2Y2Z A;  3HTA A;  5F0F A;  2QWT A;  3FK7 A;  3IUV A;  3KKC A;  2XPV A;  3VW1 A;  4AUX A;  2RHA A;  1T33 A;  2Y31 A;  4L62 A;  2UXI A;  3CRJ A;  3ON2 A;  5AQC A;  4G12 A;  3BR2 A;  2RAS A;  4X1E A;  3B6A A;  4ABZ A;  2OPT A;  4GCT A;  3DPJ A;  5D19 A;  5K58 A;  1T56 A;  2DG8 A;  5J3L A;  2O7O A;  5DAJ A;  2GEN A;  1Z77 A;  2ID6 A;  3BNI A;  3Q0U A;  3G1M A;  3HTJ A;  1JUS A;  5IP6 A;  1U9O A;  4GCK A;  5K7F A;  3NRG A;  3T6N A;  1JTY A;  2TCT A;  1QPI A;  3BR0 A;  4AF5 A;  2XPW A;  3NNR A;  3FK6 A;  3G7R A;  3CDL A;  3P9T A;  2UXH A;  4NEL A;  3ZQF A;  2QIB A;  1RPW A;  2FBQ A;  3JSJ A;  5HAW A;  2FQ4 A;  2HKU A;  3B81 A;  3BTC A;  3QQA A;  2WUI A;  3IH3 A;  3F1B A;  2Q24 A;  1RKT A;  2G3B A;  5FKM A;  1JUM A;  5CXG A;  5K7H A;  5F27 A;  5CXI A;  4B1R A;  4W1U A;  5F0H A;  2OER A;  4V2F A;  3KZ9 A;  4GFK A;  2ZCN A;  4M3F A;  2ZB9 A;  5GPC A;  4CGR A;  3VVX A;  2OI8 A;  2X9D A;  3BQZ A;  3QPS A;  3EUP A;  3FRQ A;  5F1J A;  3IH4 A;  3BR5 A;  3B6C A;  1JT0 A;  3WHB A;  2JK3 A;  5FKN A;  2JJ7 A;  5D18 A;  4MO7 A;  5FMP A;  3PAS A;  3BTL A;  2IBD A;  3LSR A;  5EZH A;  2UXU A;  2HXO A;  5FKO A;  3LSJ A;  3ZQG A;  3SDG A;  3NPI A;  3Q3S A;  3HGG A;  2HXI A;  1A6I A;  2XGD A;  3VVZ A;  2WGB A;  2IEK A;  5EYR A;  3BT9 A;  3HTI A;  4W97 A;  3C2B A;  4MK6 A;  3VW2 A;  3FIW A;  2O7T A;  5FKL A;  3BR3 A;  1ORK A;  3G1O A;  4AC0 A;  2HQ5 A;  2RAE A;  5FKK A;  3ANP A;  2G7S A;  3TP0 A;  2DG7 A; 
#chains in the Genus database with same CATH topology
 5J1R A;  2G7L A;  3KKD A;  5HSZ A;  5K7Z A;  2EH3 A;  4HKU A;  2W53 A;  3RH2 A;  1BJZ A;  2XB5 A;  4D7N A;  3QBM A;  2G0E A;  2DTZ A;  3HE0 A;  2NP5 A;  2VKV A;  2UXP A;  3LSP A;  4D7M A;  4MXM A;  3VOX A;  3ZQL A;  2R7V A;  3BTJ A;  4I6Z A;  5GP9 A;  2NS8 A;  3BJB A;  3DEW A;  2QCO A;  2QOP A;  5C4Y A;  2ID3 A;  3BHQ A;  4JNN A;  5J1U A;  4ICH A;  2R7R A;  2NS7 A;  4XK4 A;  4AC6 A;  3CWR A;  3G56 A;  2Y30 A;  3SFI A;  3ZQI A;  3O8G A;  2HYJ A;  4M3E A;  2FX0 A;  3LHQ A;  2NX4 A;  2XGE A;  4GCL A;  4YZE A;  3GZI A;  3VPR A;  1U9N A;  2FD5 A;  3Q0W A;  3VW0 A;  5HBU A;  4D5F A;  1JT6 A;  2YVX A;  4V2G A;  4WIB A;  3NI7 A;  2R7T A;  5GPA A;  3HIM A;  3VVY A;  2FJI 1;  3PPB A;  4NN1 A;  5F08 A;  1RKW A;  3VP5 A;  5IOZ A;  1ZKG A;  2NP3 A;  2UXO A;  2XDN A;  1SGM A;  4DVY P;  1VI0 A;  2VKE A;  4M3D A;  4UDS A;  3LWJ A;  2GUH A;  2ZCM A;  5F04 A;  2FJ1 A;  2PBX A;  2R7S A;  3WHC A;  3F0C A;  3LOC A;  2WV1 A;  5IPA A;  2F07 A;  3VUQ A;  3AQS A;  4D5C A;  3O8H A;  3BQY A;  2XPU A;  2B3W A;  3LJL A;  3PM1 A;  3G1L A;  2R7O A;  3RD3 A;  3BRU A;  2ZOY A;  5H9T A;  3C07 A;  3V6G A;  3EGQ A;  3BR1 A;  3MVP A;  2X6O A;  1JTX A;  2R7X A;  2GBY A;  3GEU A;  3Q0V A;  3E7Q A;  5EFY A;  3HGY A;  5F0C A;  4B3A A;  4ME9 A;  2REK A;  3AQT A;  1Z0X A;  1QVU A;  2ZOZ A;  2V57 A;  4IRV A;  3BTI A;  4JL3 A;  4DW6 A;  2PZ9 A;  5CW8 A;  2HYT A;  2YVH A;  4ACI A;  3NS4 A;  2QKO A;  2TRT A;  3DCF A;  3CCY A;  1UI6 A;  2IU5 A;  2XRL A;  2OF7 A;  2GFN A;  3S5R A;  3ANG A;  4M3B A;  4JKZ A;  5EZG A;  4KWA A;  3V78 A;  1ZK8 A;  3HTH A;  2YVE A;  3BCG A;  3CJD A;  4I76 A;  2ZCX A;  2IAI A;  3QPL A;  3TP3 A;  3IH2 A;  2QTQ A;  3QKX A;  1QVT A;  2D6Y A;  3ON4 A;  2I10 A;  4JYK A;  3NXC A;  2VPR A;  2PFV A;  5J1Y A;  2B1E A;  1UI5 A;  4C2M A;  2XGC A;  4GFL A;  5D1R A;  3COL A;  2G7G A;  3KNW A;  4M3G A;  5FGL A;  3VOK A;  3BR6 A;  3O60 A;  4PXI A;  5IOY A;  3DU6 A;  5FHP A;  3MNL A;  3ZQH A;  3VIB A;  1JUP A;  2Y2Z A;  3HTA A;  5F0F A;  2QWT A;  3FK7 A;  3IUV A;  3KKC A;  2XPV A;  3VW1 A;  4AUX A;  2RHA A;  1T33 A;  2Y31 A;  4L62 A;  2UXI A;  3VTI A;  3CRJ A;  3ON2 A;  5AQC A;  4G12 A;  3BR2 A;  2RAS A;  4X1E A;  3B6A A;  4ABZ A;  2OPT A;  4GCT A;  3DPJ A;  5D19 A;  5K58 A;  1T56 A;  2DG8 A;  5J3L A;  2O7O A;  5DAJ A;  2GEN A;  1Z77 A;  2ID6 A;  3BNI A;  3Q0U A;  3G1M A;  3HTJ A;  1JUS A;  5IP6 A;  1U9O A;  4GCK A;  2A2F X;  5K7F A;  3DU5 A;  3SWH A;  3NRG A;  3T6N A;  1JTY A;  2TCT A;  1QPI A;  3BR0 A;  4AF5 A;  2R7U A;  4U9N A;  2XPW A;  3NNR A;  3FK6 A;  3G7R A;  2ZY9 A;  3CDL A;  3P9T A;  2UXH A;  4NEL A;  3ZQF A;  2QIB A;  4U9L A;  1RPW A;  2FBQ A;  4OD5 A;  3JSJ A;  5HAW A;  2FQ4 A;  2HKU A;  3B81 A;  3BTC A;  3QQA A;  2WUI A;  3IH3 A;  3F1B A;  2Q24 A;  1RKT A;  2G3B A;  2R7Q A;  5FKM A;  2R7W A;  1JUM A;  5CXG A;  5K7H A;  5F27 A;  5CXI A;  4B1R A;  4W1U A;  5F0H A;  2OER A;  4V2F A;  3KZ9 A;  4GFK A;  2ZCN A;  4M3F A;  2ZB9 A;  5GPC A;  4CGR A;  3VVX A;  2OI8 A;  2X9D A;  3BQZ A;  3K8P C;  3QPS A;  3EUP A;  3FRQ A;  5F1J A;  3IH4 A;  3BR5 A;  3B6C A;  1JT0 A;  3WHB A;  2JK3 A;  5FKN A;  2JJ7 A;  5D18 A;  4MO7 A;  5FMP A;  3PAS A;  3BTL A;  2IBD A;  3LSR A;  5EZH A;  2UXU A;  2HXO A;  5FKO A;  3LSJ A;  3ZQG A;  3SDG A;  4OD4 A;  3NPI A;  3Q3S A;  3HGG A;  2HXI A;  1A6I A;  2XGD A;  5CQG A;  3VVZ A;  2WGB A;  3FHN A;  2IEK A;  5EYR A;  3BT9 A;  3HTI A;  4W97 A;  3C2B A;  4MK6 A;  3VW2 A;  3FIW A;  2O7T A;  5FKL A;  3BR3 A;  1ORK A;  3G1O A;  4AC0 A;  2HQ5 A;  2RAE A;  5FKK A;  3ANP A;  2G7S A;  3TP0 A;  2DG7 A;  3KYL A; 
#chains in the Genus database with same CATH homology
 5J1R A;  2G7L A;  3KKD A;  5HSZ A;  5K7Z A;  2EH3 A;  4HKU A;  2W53 A;  3RH2 A;  1BJZ A;  2XB5 A;  4D7N A;  3QBM A;  2G0E A;  2DTZ A;  3HE0 A;  2NP5 A;  2VKV A;  2UXP A;  3LSP A;  4D7M A;  4MXM A;  3VOX A;  3ZQL A;  3BTJ A;  4I6Z A;  5GP9 A;  2NS8 A;  3BJB A;  3DEW A;  2QCO A;  2QOP A;  5C4Y A;  2ID3 A;  3BHQ A;  4JNN A;  5J1U A;  4ICH A;  2NS7 A;  4XK4 A;  4AC6 A;  3CWR A;  3G56 A;  2Y30 A;  3SFI A;  3ZQI A;  3O8G A;  2HYJ A;  4M3E A;  2FX0 A;  3LHQ A;  2NX4 A;  2XGE A;  4GCL A;  4YZE A;  3GZI A;  3VPR A;  1U9N A;  2FD5 A;  3Q0W A;  3VW0 A;  5HBU A;  4D5F A;  1JT6 A;  4V2G A;  3NI7 A;  5GPA A;  3HIM A;  3VVY A;  3PPB A;  4NN1 A;  5F08 A;  1RKW A;  3VP5 A;  5IOZ A;  1ZKG A;  2NP3 A;  2UXO A;  2XDN A;  1SGM A;  1VI0 A;  2VKE A;  4M3D A;  4UDS A;  3LWJ A;  2GUH A;  2ZCM A;  5F04 A;  2FJ1 A;  2PBX A;  3WHC A;  3F0C A;  3LOC A;  2WV1 A;  5IPA A;  2F07 A;  3VUQ A;  3AQS A;  4D5C A;  3O8H A;  3BQY A;  2XPU A;  3LJL A;  3PM1 A;  3G1L A;  3RD3 A;  3BRU A;  2ZOY A;  5H9T A;  3C07 A;  3V6G A;  3EGQ A;  3BR1 A;  3MVP A;  2X6O A;  1JTX A;  2GBY A;  3GEU A;  3Q0V A;  3E7Q A;  5EFY A;  3HGY A;  5F0C A;  4B3A A;  4ME9 A;  2REK A;  3AQT A;  1Z0X A;  1QVU A;  2ZOZ A;  2V57 A;  3BTI A;  4JL3 A;  4DW6 A;  2PZ9 A;  5CW8 A;  2HYT A;  2YVH A;  4ACI A;  2QKO A;  2TRT A;  3DCF A;  3CCY A;  1UI6 A;  2IU5 A;  2XRL A;  2OF7 A;  2GFN A;  3S5R A;  3ANG A;  4M3B A;  4JKZ A;  5EZG A;  4KWA A;  3V78 A;  1ZK8 A;  3HTH A;  2YVE A;  3BCG A;  3CJD A;  4I76 A;  2ZCX A;  2IAI A;  3QPL A;  3TP3 A;  3IH2 A;  2QTQ A;  3QKX A;  1QVT A;  2D6Y A;  3ON4 A;  2I10 A;  4JYK A;  3NXC A;  2VPR A;  5J1Y A;  1UI5 A;  2XGC A;  4GFL A;  5D1R A;  3COL A;  2G7G A;  3KNW A;  4M3G A;  5FGL A;  3VOK A;  3BR6 A;  3O60 A;  4PXI A;  5IOY A;  5FHP A;  3MNL A;  3ZQH A;  3VIB A;  1JUP A;  2Y2Z A;  3HTA A;  5F0F A;  2QWT A;  3FK7 A;  3IUV A;  3KKC A;  2XPV A;  3VW1 A;  4AUX A;  2RHA A;  1T33 A;  2Y31 A;  4L62 A;  2UXI A;  3CRJ A;  3ON2 A;  5AQC A;  4G12 A;  3BR2 A;  2RAS A;  4X1E A;  3B6A A;  4ABZ A;  2OPT A;  4GCT A;  3DPJ A;  5D19 A;  5K58 A;  1T56 A;  2DG8 A;  5J3L A;  2O7O A;  5DAJ A;  2GEN A;  1Z77 A;  2ID6 A;  3BNI A;  3Q0U A;  3G1M A;  3HTJ A;  1JUS A;  5IP6 A;  1U9O A;  4GCK A;  5K7F A;  3NRG A;  3T6N A;  1JTY A;  2TCT A;  1QPI A;  3BR0 A;  4AF5 A;  2XPW A;  3NNR A;  3FK6 A;  3G7R A;  3CDL A;  3P9T A;  2UXH A;  4NEL A;  3ZQF A;  2QIB A;  1RPW A;  2FBQ A;  3JSJ A;  5HAW A;  2FQ4 A;  2HKU A;  3B81 A;  3BTC A;  3QQA A;  2WUI A;  3IH3 A;  3F1B A;  2Q24 A;  1RKT A;  2G3B A;  5FKM A;  1JUM A;  5CXG A;  5K7H A;  5F27 A;  5CXI A;  4B1R A;  4W1U A;  5F0H A;  2OER A;  4V2F A;  3KZ9 A;  4GFK A;  2ZCN A;  4M3F A;  2ZB9 A;  5GPC A;  4CGR A;  3VVX A;  2OI8 A;  2X9D A;  3BQZ A;  3QPS A;  3EUP A;  3FRQ A;  5F1J A;  3IH4 A;  3BR5 A;  3B6C A;  1JT0 A;  3WHB A;  2JK3 A;  5FKN A;  2JJ7 A;  5D18 A;  4MO7 A;  5FMP A;  3PAS A;  3BTL A;  2IBD A;  3LSR A;  5EZH A;  2UXU A;  2HXO A;  5FKO A;  3LSJ A;  3ZQG A;  3SDG A;  3NPI A;  3Q3S A;  3HGG A;  2HXI A;  1A6I A;  2XGD A;  3VVZ A;  2WGB A;  2IEK A;  5EYR A;  3BT9 A;  3HTI A;  4W97 A;  3C2B A;  4MK6 A;  3VW2 A;  3FIW A;  2O7T A;  5FKL A;  3BR3 A;  1ORK A;  3G1O A;  4AC0 A;  2HQ5 A;  2RAE A;  5FKK A;  3ANP A;  2G7S A;  3TP0 A;  2DG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...