2OIBA

Crystal structure of irak4 kinase domain apo form
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
297
structure length
280
Chain Sequence
DTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGVVYKGYVNNTTVAVKKTTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEVMRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 receptor-associated kinase 4
publication title Cutting Edge: IL-1 Receptor-Associated Kinase 4 Structures Reveal Novel Features and Multiple Conformations.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 280
sequence length 297
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2oibA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2oibA01
2Y4IC 5IQCA 2XIKA 4L46A 2WOTA 1H1WA 3VS2A 3R22A 5HBEA 4CV9A 3ZFXA 2GS2A 2CCHA 4MF0A 4PRJA 4AW5A 4C8BA 4M15A 4L67A 4QMZA 2ZVAA 2XNMA 3UIMA 4Q5HA 5AX3A 2BIKB 3ODZX 3PZEA 2LAVA 3G6GA 3NAYA 1YXUA 3C4EA 4S34A 3L8SA 4BDGA 4DYMA 3PE1A 4GMYA 4QMPA 2B7AA 5LVLA 2GFCA 2ACXA 4PMTA 4XV3A 2PTKA 4O7SA 3QLFA 2I0VA 2UW9A 2XA4A 3E3BX 5FTGA 4NCTC 3WF6A 3OTUA 3PP0A 4ZY6A 5JGDA 5E90A 3GBZA 1JKSA 4H1MA 1SNXA 4DEDA 3D0EA 4JG7A 2WMSA 2IJMA 4ZY5A 3FMEA 2BHEA 4DT9A 1QCFA 2OZAB 2XBJA 5C4LA 1CM8A 5KX8A 4UMQA 2R3HA 3QTUA 1M2PA 3I0OA 3M11A 2GSFA 2VTIA 3AC1A 4O86A 2GS7A 3Q6UA 4FV5A 3JVRA 2GDOA 4JLCA 3BYOA 4YJTA 4YU2A 2G2FA 4XG6A 3KXNA 4L7FA 3QHRA 2YM6A 4RA4A 4XG8A 1OKZA 3GU8A 1RQQA 3KC3A 4AW0A 2CKEA 5D10A 3OWJA 5AR4A 1KV2A 4X2GA 2CDZA 3KN5A 4GRBA 4RT7A 3OWLA 1NVRA 2YITA 2CSNA 3EHAA 3RPSA 3TKUA 2ZV7A 4MBIA 3GU5A 2DQ7X 3PP1A 3UOJA 4CT1A 3SGCA 1MUOA 5KE0A 4TY1A 1YKRA 3PIZA 2QCSA 2XBAA 5D11A 3RBWA 4R7IA 3PDTA 3RKBA 4YHTA 5DT3A 5HCZA 1QPDA 4HJOA 4OTQA 3LM5A 3COHA 2CLXA 4USDA 1ZYCA 3QRUA 3DQXA 4F70A 4GT4A 3R21A 4BCMA 4EHGA 4R8QA 3VBTA 2WMRA 3FZOA 4KSQA 4O7VA 4KS7A 3TKHA 3EN9A 4YTCA 4D5KA 4W4XA 3GCUA 4LMUA 4IMYA 5EOBA 5ANJA 3EN4A 5EKNA 4MEDA 4PL3A 5HOAA 2BDFA 5CSVA 2YHVA 3DOGA 3FLQA 1NT2A 4NTSA 1HOWA 4FT7A 5A46A 5IQAA 3G33A 4TN6A 1LUFA 4GYIA 3DB8A 4NH1A 3BHTA 4YTFA 2UW5A 1FQ1B 2Z7QA 3IDBA 4QMMA 4HW7A 1MRUA 3V8TA 1P4OA 3MW1A 3C4FA 3P86A 4N6ZA 5AP0A 2UV2A 1TQPA 3DK7A 4FTTA 4GFOA 5AWMA 3TNIA 3QTWA 4MX9A 4WA9A 3HRCA 4WBOA 4GU9A 2C5NA 4QQTA 4ZXTA 3LCOA 2X6DA 3MVJA 4B9DA 2NNWB 2PZPA 3KY2A 5DGZA 3EOCA 3MY0A 4ANMA 3PZHA 4WSYA 1CKJA 4E6QA 4TWCA 1XH7A 1XH5A 4PDSA 2E9OA 3EZRA 4RC3A 3VUDA 4FTMA 2UZUE 3PYYA 5CTPA 5JFXA 3QALE 3CR0A 2PULA 2ZDUA 3V3VA 3V5WA 4ALVA 2HELA 3AT2A 4RZWA 4XG2A 3OBGA 4UBAA 3ROYA 2Y6MA 3F3ZA 2VTTA 4G3EA 4E8AA 5EOLA 4YR8A 2B55A 5EHOA 5CEIA 2EXCX 5HORA 3W2RA 5HO7A 2CGWA 3LPBA 2QG7A 2X2MA 2QURA 3WZUA 4QP7A 4Y5QA 5IA1A 4CEGA 4CFMA 1KV1A 1FVTA 4AOIA 2W1EA 3POOA 4QMLA 2W4JA 3BGPA 4QPSA 1UV5A 3N4UA 2VTAA 3R71A 1CKIA 4E73A 3F5XA 5AP6A 3UODA 3LMHA 2W1ZA 4UB7A 4RIXB 2P4IA 2I1MA 4XEYA 4G2FA 4WG4A 5BVNA 2VX0A 5CQUA 4JL9A 4YJOA 3HV3A 5EDPA 4KRCA 4UMPA 3ZLYA 3QAME 4MNEB 3HZTA 4EH5A 5J79A 3C9WA 4BCJA 4J99A 3PWYA 4N70A 1URWA 3ZXTA 3IOPA 4L45A 3F2NA 4HGLA 3A4PA 4E5AX 5M57A 2OXDA 2PY3A 4UALA 3QZIA 4L01A 4WKQA 4ZZOA 2WEVA 4I5MA 5H3QA 4KINA 1U46A 2VTLA 5EI6A 3VF8A 4G3FA 4L8MA 3QCSA 2QOOA 4PY1A 3F5GA 4FV7A 3PVUA 5HNIX 2XNEA 1HCKA 2CLQA 4LFIA 3REPA 4AU8A 4FKUA 1P14A 3WZEA 3MH2A 4LRJA 2BRBA 2PVRA 4NCTA 4FKLA 4RMZA 2YCQA 2XCKA 2JIIA 4RX9A 4ZMFA 4YTIA 2RFDA 4DH7A 3N4TA 4U81A 4F09A 1S9IA 2V0DA 3QYWA 4NIFB 4FMQA 2XRUA 4J8NA 4EZ3A 3EN5A 4AA0A 2YDKA 1YDSE 3CEKA 1OIUA 1CTPE 3PPZA 4Q2AA 3VN9A 3FZSA 5E4HA 5BVDA 3QTSA 4NL0A 3HP5A 3E88A 3UQCA 5HTCA 4O83A 3QWKA 2C30A 3AC3A 3AT3A 3KN6A 2J50A 4UYNA 5AV0A 4ACMA 3QHWA 2XCHA 3QQFA 3BU3A 4M97A 4OTGA 3QYZA 1S9JA 2O64A 3FWQA 4C4FA 1WBNA 4U5JA 4D5HA 2QOKA 4AUAA 5AA9A 2PVNA 2PVKA 3EFLA 3UYTA 4C3PA 5K0KA 4ANLA 3PY1A 4C58A 4XG7A 4MQ2A 2G9XA 3A60A 4X2FA 4AG8A 1GJOA 2XKEA 4M3QA 3QC9A 2HXLA 4CSVA 3QQLA 5C01A 4CQGA 2UW6A 4B8MA 3FXZA 4ENYA 5AUXA 5FRIA 4PTGA 3U4WA 1WCCA 1Q3DA 2W5BA 1OKWA 3P08A 4MXOA 2XK3A 4ZOGA 5LMAA 5HESA 2F7EE 3RAIA 3EMGA 2XIXA 2UW8A 4FSNA 5AIKA 5JT2A 3DKFA 4BGHA 3TG1A 4NJDA 2YN8A 3KRLA 4EUUA 4IWPA 3GXLA 4OTRA 5CLPA 3CJFA 1UKHA 3AG9A 4PWNA 3EQDA 3EIDA 3V5PA 4XG3A 4LGDA 5TT7A 4ANOA 4YHFA 3HV4A 2X2LA 2XB7A 3NUXA 3OEZA 3KXZA 4GH2A 4JQ7A 2WD1A 5HU9A 3DFCB 1B39A 3QA0A 5HCXA 3LHJA 3E93A 2WTIA 2VTNA 2WMXA 3G0FA 5ACBC 2EWAA 3AC8A 4FSYA 4ZIMA 4FKSA 3CPBA 4D9UA 3TUCA 5AP7A 3BE2A 3HUCA 1G3NA 3VRYA 3BYSA 4NM7A 4C4GA 4FKPA 3F7ZA 3R8LA 5JFWA 1JKKA 2LGCA 1V1KA 3G6HA 3R1QA 4HNFA 4ZJJA 3KMUA 3VBYA 4ANBA 3OT8A 4J98A 2YFXA 3PVWA 4BDDA 1J7LA 4ZS4A 3FY2A 3ZYAA 1KE5A 3FMHA 3CD3A 5CU6A 4QNAA 4U42A 4XV1A 4AZVA 4MWIA 5HX6A 3LCSA 4NM5A 3QTXA 2EB2A 4RIYB 5E8VA 4DCEA 4FNWA 1AD5A 4WUAA 5E8ZA 3PXFA 4EOOA 4KA3A 4IX3A 2PMIA 4YUQA 2FSLX 3EQGA 3GCQA 2QOQA 2NO3A 3I5NA 4G17A 4MQ1A 4Y83A 5FEDA 5DH3A 3VHKA 3P1AA 1AGWA 3GOKA 4UEUA 4JDIA 2A2AA 5DFPA 1P4FA 3TZ7A 2W9ZB 4OAVB 4LL0A 5AR7A 5JMSA 3R7OA 3HAMA 2J5FA 1OL7A 2BR1A 2R3MA 1T45A 3DBQA 1NVQA 4I92A 1DAWA 4CFFA 2SRCA 4NU1A 5HIBA 2FA2A 4GVAA 5HVJA 4IWDA 4X0MA 4UYAA 2H6DA 5C8NA 2UZWE 4I0TA 5GZ9A 2PE1A 3ET7A 2R9SA 3SOCA 4YPDA 3ELJA 4BCQA 1XH8A 4QP3A 2CNUA 4GU6A 4C62A 3KK9A 2OJFE 4I93A 2BTRA 3PUPA 3ZOSA 3KXHA 4AGUA 4HZSA 3UPXA 4BBFA 3R02A 4YMJA 2F2CB 4R3PA 4FKGA 5F9EA 1OB3A 5AIRA 2HYYA 3ZSHA 4B8LA 3GU7A 3KF7A 3R8MA 1KOAA 3F3TA 4QP8A 3NAXA 4EEVA 2XK7A 3IG7A 4ACGA 5EM5A 3PJ2A 5E9EA 4N4SA 4MCVA 4XRJA 4C4EA 3TV6A 5B7VA 5C9CA 4PTCA 5CAOA 3NIEA 3VUTA 4AZTA 4HOKA 4L00A 2R3FA 4JAJA 1OIQA 2HY0A 2CN8A 2VUWA 2YJRA 4TTHB 5I9ZA 4BDKA 4MNEA 4AX8A 4WG5A 3CQEA 4H39A 4JR7A 4AA4A 5DBXA 3UQGA 2EU9A 2XKCA 4G6LA 3KEXA 4XJ0A 3WOWA 4U40A 4E4XA 3VRZA 4XLIA 4BIBA 4XV9A 5EI8A 4KWPA 4O0WA 4MBJA 3EWHA 2ZAZA 4X3FB 2WHBA 4PQNA 3L8VA 2RKUA 3QQKA 4KBCA 2O63A 4L3PA 3D83A 2IVSA 4FV8A 1NXKA 2BIYA 2G2HA 3P4KA 3VJNA 4M69A 1AQ1A 2UUEA 2W7XA 4KD1A 3AGLA 4HYSA 2UVXA 1YRPA 4RWJA 4OTHA 2EXEA 2JITA 3FSKA 1YXXA 1SVGA 3HNGA 3THBA 1CMKE 2WU7A 3RALA 2VTSA 3QF9A 4DH1A 4C2WA 5H9BA 1JAMA 5M4FA 5M08A 4AQCA 3COMA 3QKMA 4FI1A 4D4SA 1P5EA 2V7AA 4FV0A 5CSPA 1JSTA 4V0GB 4BC6A 2Z8CA 3R30A 3VBXA 4XCUA 3VS4A 5IQFA 3DB6A 3ZLSA 1ZRZA 4GJ3A 4LQMA 4JG8A 4HCVA 4AFJA 4EQMA 2QQ7A 4BTFA 2X81A 4USEA 5K4IA 4JNWA 2VWYA 3Q9YA 4FSZA 4W4YA 3VS6A 4DC2A 4EUTA 4IZ5A 3R9DA 4FSTA 4NEUA 5JQ5A 4BHZA 2X7OA 3QCYA 4FYOA 4JX7A 5EHYA 4YZMA 5HIDA 4W9XA 3R7UA 3QQUA 5E92A 5AFVA 4LRMA 4DFNA 2W1IA 2BROA 3VW6A 4XG9A 4IX4A 4BCIA 4CMUA 5FEQA 3BU6A 3DLZA 1YI4A 2R3JA 3O23A 4H1JA 2WMAA 1ZZLA 3QTQA 3ORKA 2VO6A 3KXXA 2J5EA 2ITQA 4I6QA 4EH6A 2A4LA 1UVRA 4O0SA 4IEBA 3FY0A 3II5A 5HE0A 3ZZWA 5AR3A 4LUEA 2WQBA 3OCTA 4X3JA 5T68A 1M7QA 2QKRA 1ZAOA 2PMOX 3G90X 3WZDA 4XYFA 3D15A 3TL8A 1WBOA 4CFNA 2OI4X 3RNIA 4QTDA 1H1QA 2JFLA 3IO7A 3JYAA 4K6ZA 3NDMA 5KO1A 4XG4A 2J7TA 4MK0A 5L2WA 4C4HA 3LFQA 3HV6A 3VULA 4I4FA 2E9VA 1A06A 2JIUA 4WSQA 2BKZA 3ZXZA 2P3GX 4XRLA 2NP8A 3KB7A 3ZEPA 4CKRA 4E6AA 4FV2A 5FWKK 3VUKA 5ITAA 1W83A 2J4ZA 4G34A 3DA6A 3CPCA 2WZJA 4UXLA 3HMMA 4Y73A 4NJ3A 2ITZA 3LXKA 5HG9A 5IH5A 4RRVA 3D94A 4L3LA 2GNHA 2FUMA 2JBOA 2ETRA 2XK4A 1PKGA 4O22A 3UZPA 2JDVA 1QPEA 2WTCA 4I94A 2KULA 4R3RA 3FQSA 4BKZA 3ORZA 4DGLC 2R3QA 4EJNA 2J0KA 2X4FA 3DDPA 2VWXA 2XNNA 2JDTA 1JOWB 2J0JA 2OJ9A 4E4NA 4DCAA 4Z9LA 4RWKA 3IW8A 3R28A 3ZFYA 2ITWA 4GEOA 3FQEA 5DYJA 4IB5A 3D7ZA 5EI2A 4W4WA 5CF6A 3K5UA 3WF7A 4MVFA 2ZMCA 3KL8A 5HO8A 5M51A 2UW7A 1PKDA 4HGTA 3CTJA 4ZTLA 4FR4A 5AADA 4TL0A 4NTTA 4QP4A 3ZH8A 5KMJA 4IWOA 4ZTSA 4EYJA 2VWWA 1IA8A 2PL0A 4ENXA 4ZTNA 2V62A 3IPHA 4RGJA 1JKTA 4TW9A 4IVBA 4BTMA 1YOJA 4BI0A 4M66A 4FEUA 4EBWA 3FE3A 4I5PA 2UW3A 4FUYA 4M67A 1UNGA 5K9IA 5LWNA 2PWLA 1H4LA 2RSVA 1Q41A 2YCRA 4A9YA 4II5A 3SKCA 3ENMA 3TNQB 2BCJA 3FI3A 1O6KA 4IJ9A 3A62A 2ZM3A 4RIWA 2XUUA 5IG1A 2CMWA 4G16A 4K9YA 4BN1A 3QU0A 3AC2A 1IA9A 2E9PA 3GQIA 1APME 2PU8A 4OUCA 1YHVA 2HK5A 4F1OA 3OWPA 1OUKA 2O8YA 4FSWA 2GHGA 3LM0A 4DFLA 1DS5A 3G0EA 5M55A 4DTAA 2JDSA 4FTJA 4BBEA 5LOHA 3BWFA 4JR3A 2P55A 5CF4A 3IGOA 1H1PA 4QMQA 5HZNA 4WD5A 2C6KA 3W8QA 2C47A 2HZNA 2XNGA 4KIKA 4JT3A 1XH4A 4P90A 3KMWA 4YJPA 1OECA 3AMYA 3NUPA 1BKXA 3ZO3A 2Z7SA 4R5YA 4C0TA 3RPRA 2VNYA 1M2QA 4KAOA 4CYIA 2OF4A 1RW8A 5ANEA 2OFVA 2IWIA 1OM1A 3MFRA 4BZNA 3SC1A 3WYYA 4OR5A 4JRNA 5AMNA 3Q60A 2ZB0A 4NW5A 3MIYA 4FGRA 1R0EA 4S33A 4IZAA 4X6QC 1H01A 1RJBA 3WF8A 3QUEA 5J7HA 2C3IB 2O65A 2QO7A 3HMOA 5IA5A 2WU6A 1JVPP 3C4CA 3LFNA 4L3JA 1ZWSA 5KHWA 5BVKA 4U41A 1H08A 5H8EA 5GIPE 1H1SA 5JQ8A 1FPUA 3JY9A 4PPAA 5EDQA 3NCGA 3O8UA 3UO6A 4HPTE 3Q4TA 1Y8GA 4R7HA 2Q0NA 3FV8A 5LVOA 3D7TA 4QOXA 3QCXA 4F6WA 2WTJA 4CZYB 4EH4A 4BCOA 4DGOA 3CKXA 1QPJA 4E1ZA 1GIJA 4M8TA 4R7BA 4KS8A 3E8NA 4RC2A 3FZTA 5IUIA 2IPXA 2VTQA 1JSUA 3U6HA 3UNZA 2QD9A 1ZYSA 4GIHA 2X8IA 3TJCA 3CD8A 4P7EA 3TTIA 1PXLA 4Q9ZA 3QBNA 4QP1A 5FQDC 4DE4A 3QRIA 2XJ1A 2GS6A 3R04A 2W1DA 4S30A 5BVOA 5CI7A 3U9NA 4BR3A 4ZP5A 4BCFA 2R3NA 5M06A 5IEVA 3PSBA 4CZUA 5D9HA 4ZMEA 1M2RA 2Y4PA 4RWIA 4OLIA 1TKIA 3OTVA 1W8CA 3CQWA 4EHEA 4X2KA 4DFXE 4EOKA 2QO9A 4YC6A 2W1FA 2CHLA 3EYHA 3IW7A 2B52A 4HYHA 4KIOA 4L42A 3DK3A 4MKCA 3HDNA 4F9AA 3OCGA 1FVRA 3ZEWA 3KXMA 5CSWA 1W98A 5EM6A 2W1HA 1MRYA 1YDTE 2WEIA 4RPVA 2W0JA 4IIRA 4PMPA 3W16A 4XV2A 3OVVA 5D41A 5L3AA 4RZVA 4DEGA 4TXCA 4ZJIA 5BMSA 3D5UA 3FMJA 4A7CA 4XUFA 5HNGA 5A14A 3BU5A 3GFEA 2OBJA 4IB0A 4QYHA 5IA3A 5K5XA 3DKCA 4FKTA 1YQJA 2PVHA 4YZDA 5FXRA 1PXPA 2ZMDA 5BYYA 2WIHA 3DZQA 4JBOA 4CZTA 3QD2B 5DIAA 3F3WA 4JIAA 3U55A 4WNMA 3UIXA 3VO3A 4C02A 4RG0A 4FTQA 4XOYA 4IC7A 4Z55A 4FVPA 2C6LA 5CF8A 3C7QA 1OMWA 1Q61A 1WZYA 3OS3A 5LMKC 4O21A 4BCGA 4AXAA 2PE0A 3E87A 3RZBA 2QG5A 4YBKA 5HTBA 3LFAA 4LOOA 2RG6A 3OOGA 4LV5A 1OKVA 3WF5A 4JDHA 3EQPA 2C0OA 5EG3A 2V22A 5A6OA 5J95A 1ZOHA 3RCJA 4HZRA 4OAUC 5IA2A 2PZYA 3H4JA 4NWMA 4PP7A 3Q2MA 2E2BA 3ORMA 4W4VA 3BZ3A 4H05A 1FGKA 1Q8YA 2BUJA 1YDRE 3NRMA 4GUBA 3ROCA 4EWQA 5EW3A 5ACKA 5BVEA 4X6RA 1A9UA 1Q62A 5E1SA 1PXKA 1ZMWA 5HVYA 1WBVA 5IQDA 3ZC6A 4FV3A 4U8ZA 4Z16A 2RFEA 5LCJA 5AJQA 3BHUA 1IRKA 4QMWA 3ZRMA 5ETFA 5B2MA 3JVSA 1WBTA 4PV0A 5HCYA 4PF4A 2RIOA 3B8QA 1PYEA 3DGKA 2QU5A 4FICA 4HNIA 3WIKA 3FPQA 4AS0A 4PDYA 2OKRA 3G9LX 4L7SA 3KULA 3W10A 3DBFA 3FC1X 1J1BA 1UNHA 4DEEA 4DG3E 5A4QA 1O6LA 3FI8A 3DTWA 1RDQE 5BYZA 4GK3A 3VHEA 4P5QA 5CEMA 3HP2A 1GZKA 1M52A 3D5VA 4LUDA 5DR2A 4EH8A 3D2KA 4TYHA 3ULZA 1FMOE 4K11A 3R7VA 4D58A 2OXYA 3UOHA 1IAJA 3C4XA 4F7JA 2J9MA 4FTIA 2O5KA 3I5ZA 5CYIA 4GKIA 4AZWA 2R4BA 4APCA 4FT3A 2JDOA 2DYLA 3BYUA 3QQGA 2A0CX 5FEEA 4AN3A 1OBGA 1KOBA 3MTFA 2VU3A 4MAOA 4ZLZA 3RAHA 4ZY4A 3W32A 3EB0A 3TNWA 3EQHA 5KHXA 1H27A 1MP8A 3UOLA 3HA8A 2Z60A 4ALUA 3ZCLA 4DFYA 4YC3A 2X7FA 2H9VA 3FAAA 2C69A 1JWHA 3CBLA 2VGPA 4MD7E 3Q53A 4J1RA 4QYFA 1JPAA 5CAVA 5AM7A 4EOIA 2P0CA 3QA8A 3C0IA 3PWDA 2A27A 4ERKA 3L8XA 1KE8A 5J9LA 4GJ2A 5GJGA 3S0OA 3O96A 4EK8A 4AGDA 5HO6A 3EN7A 2ETKA 3F2AA 4LI5A 3ZZEA 3L8PA 2X4ZA 4RJ6A 3DNDA 3DZOA 4O82A 2QOCA 3P78A 2PSQA 2BZIB 5AP2A 3VAPA 3FXWA 4OT5A 2G01A 3U51A 1R39A 4M13A 3KU2A 3LJ0A 4NM0A 3W2CA 3F5UA 3LCTA 2W4OA 4JI9A 2QLUA 5C8MA 2OG8A 4D2SA 5KMOA 4X7QA 2P2HA 5IF1A 2C6TA 2JEDA 1KSWA 4EOMA 3DJ5A 2YDIA 4QYYA 3BHYA 3ZLXA 4CG8A 1X8BA 2R2PA 4IH8A 4RVLA 3ZSIA 4A4LA 4EKLA 3OZ6A 3SRVA 4JG6A 4W9WA 1UU7A 2WTKB 3R7GA 5CEPA 5K3YA 3PXQA 4B4LA 4EK5A 3F3UA 3L9NA 3IDCA 3N51A 3GGFA 3UIUA 3ANQA 3MI9A 4LMNA 1OITA 3R9HA 3QTIA 4PMMA 3KRXA 3Q9XA 4FKIA 3LXPA 3IS5A 1M7NA 1WBSA 3LJ1A 1UWHA 2REIA 5FBOA 4UZDA 4DG2E 3PJ3A 3PA5A 2PZ5A 3R2YA 1LP4A 1YHSA 1U4DA 4IVCA 3LCDA 4JRVA 2RG5A 4IC8A 4EORA 2PUIA 3PRIA 1J7IA 5GIOE 4BDCA 3GVUA 3CCNA 3F9NA 3V5JA 3R9RA 2WXVA 3RK7A 3MBLA 3JY0A 3TN8A 3NLBA 4CCBA 3O71A 2W1GA 2H34A 1M17A 1ZOEA 3NZ0A 3RAKA 2B9IA 3TTJA 2PUUA 5FUTA 3F3VA 5JRSA 3MFUA 3RTPA 2OIBA 4JBVA 4IWQA 1H24A 3TCPA 3UJGA 4YJUA 2VX1A 5KMLA 1FVVA 3D4QA 4IXPA 2X8EA 2B4SB 3DAEA 3OC1A 3MY5A 4CKIA 4L68A 4AAAA 4ALWA 3TNHA 4U79A 5HI2A 5LMKA 2GPHA 4EH2A 4X2NA 2DUVA 5JFVA 1JKLA 5A4EA 3Q96A 1JSVA 2WMBA 2B54A 5M09A 5KBRA 2XM9A 1UU9A 5KMMA 4DFBA 1PJKA 3T9TA 3LFSA 3B8RA 2WAJA 1ZOGA 2VWIA 5L8KA 3RPOA 2XIYA 4O2PA 4TYIA 1ZY4A 3QL8A 4IQ6A 3R8PA 4CNHA 4Y5HA 1REJA 4C38A 2C5YA 5HU3A 4KKGA 1IG1A 3OD6X 4RC4A 4FG9A 5E8TA 1KWPA 4BDEA 4FKWA 1STCE 5ETCA 3W2SA 4I3ZA 3LCKA 3NNWA 4EH9A 4AGCA 3NEWA 2FVDA 3OUKA 4QMYA 4OBOA 3NWWA 2VAGA 3F69A 2BAQA 3MSSA 3Q3BA 4BDIA 2ITNA 2R0UA 3A4OX 2OZAA 3G51A 4IZYA 3WI6A 3UVRA 2JIVA 3H10A 4BHNA 2X9FA 3O51A 2XKFA 3NW6A 3GP0A 2RF9A 3W18A 5HTIA 3CY3A 1U5RA 3K5VA 5LCKA 4DEHA 3FLSA 5KKRB 5AM6A 1T46A 4ONAA 5DG5A 3R8VA 4HVSA 5IA4A 4UMUA 2BAJA 3HYHA 3CIKA 3CQUA 4QMOA 3P7AA 4LOQA 1E9HA 4QP6A 1B38A 1SNUA 1OKYA 3FI4A 4HYUA 4IADA 3JPVA 4P4CA 4RJ8A 2YEXA 3IGGA 1Y6AA 3ZDUA 3WIGA 5CS6A 4DH3A 4EOJA 2Y8OA 4F9CA 2WMTA 4GFGA 2VWZA 5CX9A 3N9XA 1QPCA 2W1CA 3F7WA 1G8SA 4RVTA 4PTEA 4I5HA 4BKYA 3OMVA 4DGMA 3PSDA 2VGOA 4M0ZA 3V6RA 4QD6A 3VQHA 4W8EA 5J5SA 4C36A 4FKVA 5TE0A 4D0XA 4F7NA 3ZO4A 3GU6A 3NYXA 3PSCA 4R3CA 2BALA 4XBRA 3CKWA 3Q5ZA 4M7IA 5HBHA 2ZV2A 2BAKA 3DJ6A 2BZKB 3QKKA 2V5QA 1DI8A 2BRMA 2YLEA 4HVIA 3EKNA 4ZJVA 4Y46A 4FV1A 3EN6A 1SVEA 3TXOA 4ZLYA 4WOVA 3ORLA 3MPTA 2UW4A 5DEYA 4D4VA 4Z7GA 4BDAA 5CANA 3BLQA 3PJ8A 2FSTX 4O6EA 4FV6A 2VNWA 2O3PA 1R1WA 3RGFA 4F64A 5HD4A 2HENA 3RPYA 5BPYA 2F57A 2AC3A 5J7BA 4FIGA 1U54B 3O7LD 4CKJA 2XVDA 1UWJA 5ETAA 4K8AA 1W7HA 1XWSA 2JFMA 3DFAA 3FSFA 4G3GA 1Y57A 5J1VA 5AUYA 2QU6A 3E8DA 5IH4A 3LIJA 3W2OA 1G8AA 3R6XA 2QONA 1XHAA 3H9OA 5CU2A 5J9ZA 2YM4A 4MH7A 2VZ6A 2JAMA 5IZFA 4EQCA 5HQ0A 1V0BA 1OZ1A 4NFMA 1R3CA 2YWPA 4EOQA 4F99A 4Y95A 5I9WA 2BRNA 3WE4A 3RHXA 3FUPA 2VWVA 4BKJA 3DU8A 5J5TA 4AFEA 3DBEA 2BILB 4MHAA 3GNIB 3HV5A 1H0WA 4BZOA 3HGKA 1PF8A 3E7OA 4O0VA 3V6SA 3R1SA 3BQCA 2X8DA 3ACJA 1XH6A 2UW0A 4PPBA 5KMKA 1KUTA 4YO4A 1TQMA 3ZSGA 1XR1A 2WGJA 3UTOA 3BKBA 4EK4A 2PPQA 5F94A 2IVUA 1RE8A 3ZM4A 4O7NA 3L1SA 3SXSA 3HA6A 4I6BA 4YZBA 2R5TA 5CNNA 5KMIA 5L8LA 2WQNA 2WMWA 1Q3WA 2ZB1A 1Z57A 1YWRA 2YIQA 3F6XA 2YM5A 3FXXA 3DK6A 4UN0C 3F61A 2VTHA 5DR6A 4U7ZA 1VJYA 2W17A 5AUZA 5JZNA 4EJ7A 3GCVA 3FKLA 3TIZA 4C35A 4JOAA 1U59A 4FL1A 4I21A 1H25A 2XK6A 3ORXA 4QMXA 3R7YA 3DBDA 3EL8A 4OW8A 2P33A 4XP0A 3BEGA 3FHRA 1SYKA 5CU3A 3SAYA 2C6OA 2WTWA 3TEIA 5GJDA 4WNOA 2HY81 4YURA 1Q8UA 4KABA 4RIXA 3RAWA 4CQEA 3LKMA 3C51A 2QLQA 3E5AA 2QR8A 1SMHA 3OWKA 3O2MA 1H07A 4NM3A 4G6NA 3VW8A 3V51A 4YJQA 2C4GA 1PW2A 1FINA 2BZJA 3IW4A 4IAKA 4J8MA 4PDOA 3RWQA 4BWXA 4GV1A 4DAWA 1CDKA 3DXNA 4V01A 3QKLA 3CTQA 3T8OA 4DINA 2BHHA 2GNFA 3EQRA 3UP2A 1Q4LA 4FTLA 2BDWA 4ACCA 3S00A 4O38A 3W1FA 4O27B 4FX3A 3C4WA 4RWLA 3TT0A 2NRYA 1LPUA 3G9NA 2O0UA 5HE2A 3ZM9A 4O0UA 3FDNA 3EQFA 4K2RA 2IN6A 5ANKA 4FIJA 2PZIA 4RX8A 5AUVA 4RFYA 3O17A 1XBCA 5EM8A 5ANDA 3R9OA 3DQWA 3OXIA 4FV9A 4QQJA 4X3FC 4UX9A 1CSNA 5CAPA 3BGZA 2WFYA 2Y6OA 3DAKA 3TZMA 4GFMA 2ERZE 3EYGA 4IAAA 4ANNA 3QX2A 2QNJA 4NIFA 3P5KA 4FIFA 5ANOA 2BTSA 4MNFA 5HLPA 1H1RA 3FMDA 3OCBA 2XNPA 4U80A 3KMMA 1CKPA 3DKOA 3QFVA 2CCIA 5A4CA 3KREA 2CJMA 2UVZA 3S3IA 3ZRKA 4E26A 4B99A 3NSZA 3U8WA 3DNEA 3ANRA 2FGIA 2GFSA 2WTDA 2C6DA 4J71A 2JKOA 1WBPA 3MFSA 4XLVA 4U97A 2ZDTA 3KRRA 1XH9A 3ALOA 3QTRA 1W84A 2I0HA 4YLJA 3PJCA 4YO6A 4FSQA 3IONA 4A06A 4DFZE 4F0GA 5CU4A 4BI1A 2OGVA 3LQ8A 4X21A 2GHMA 3AGMA 4DTBA 3ETAA 3MPAA 5TO8A 5DT4A 2C6IA 4E3CA 3BRBA 2BFXA 4NFNA 3K2LA 3DS6A 2WNTA 3VUMA 2HZ4A 5AUUA 3ZC5A 4FNXA 4TKSA 3KQ7A 1KE9A 5JZJA 4KNBA 1L8TA 1H00A 5EH0A 5FDPA 4QNYA 3EFJA 4TNDA 5I9UA 5I9XA 3EZVA 4BDBA 4FTOA 3OCSA 3P7BA 4C61A 4FEWA 2PVYA 2GNGA 4AW2A 4CXAA 2R7IA 3GB2A 4AZFA 4IAIA 4WBBB 4LGHA 4C2VA 4CRSA 5DEWA 3KFAA 4CFUA 3ID6C 5H2UA 2C6MA 4M84A 2XK9A 3AD6A 4GK4A 5FXSA 3NW5A 4F6SA 4RX5A 4FZAB 1BI7A 3RNYA 2X6EA 2Z2WA 1YXTA 5KCVA 3V04A 4BIDA 2QHMA 4U3YA 2B1PA 2R3PA 3DTCA 4D1ZA 4G31A 3VUHA 4DN5A 2FYSA 2WMVA 4U43A 3E92A 4QPAA 1XBAA 2CN5A 5C03A 3OUNB 4TT7A 1Y8YA 3CGOA 4S2ZA 5FG8A 3UIBA 4DEBA 4DTKA 4BWPA 2JKMA 3VUIA 1VR2A 4G9CA 2UVYA 3ZBFA 4XOZA 3LMIA 3C4ZA 3FQHA 2OO8X 4J7BA 4JJRA 5HGIA 2E9UA 4KBKA 4AP7A 3EFKA 2C3JA 3JXWA 5AP1A 3AD5A 3LLAA 2UZTA 4NW6A 4QP9A 1ZZ2A 3I0QA 2OIDA 2RL5A 4FG8A 3R63A 3EKKA 2WMQA 3TDWA 3ITZA 3NPCA 1ZYJA 3ERKA 4YZNA 3RP9A 2AC5A 4FODA 1ZMVA 1IR3A 3VS1A 4RIYA 4D2PA 4MXYA 3TACA 3NCZA 5HIEA 3NUYA 2GTMA 3VF9A 3ODYX 1OL2A 4GIIA 4ORKA 4I23A 3L9MA 3KRJA 5LXMA 4DH8A 4TYEA 4TWOA 4K77A 4AGWA 4MXCA 2XEYA 3V8WA 4MD9E 4O6LA 3S2PA 4GVJA 1VYZA 3RK9A 1YVJA 4ZSAA 3MN3A 4YPSA 3F5PA 4ZS0A 3SXRA 3PA4A 3E7VA 3K3JA 4ACHA 3PJ1A 4AT3A 3NUAA 4FZDB 2XH5A 1YHWA 4ZSJA 3S1HA 5IQEA 1UA2A 3ZLWA 2F9GA 5T3QA 3PA3A 4O7LA 4ASDA 1OL5A 4JBPA 4XH6A 4AWIA 3WYXA 4WHZA 3LXLA 3NW7A 3HV7A 3MVLA 2R3KA 4NKAA 4EZ5A 3GCPA 3LXNA 3M42A 3PVBA 4I5CA 4ZSEA 3PXZA 5IEXA 4AF3A 2CKOA 2IW6A 3ZONA 3GC9A 4O1OA 3LQ3A 4FZ6A 3VBQA 5M44A 4JS8A 4XMOA 4CRLA 4E4MA 4QMNA 5JN2A 3FLYA 2YM8A 3I6WA 5FD2A 4EQUA 4X2JA 4BB4A 4CG9A 2VV9A 3AC4A 5DRDA 3MA3A 4S32A 4FG7A 4MBLA 4GK2A 1H0VA 4TRLA 3FMNA 4FUXA 4I22A 1WMKA 2X0GA 2G15A 4ACDA 4EONA 3PG1A 5TKDA 4IM0A 2WO6A 3MJ1A 4FOBA 5HG7A 3FYKX 4PL5A 4WIHA 3GC8A 4QO9A 3I60A 2Q83A 4EOSA 5EDRA 5IU2A 5HG5A 4HCUA 1LEZA 1WVWA 1YI6A 3KCFA 3QC4A 4CFVA 2O2UA 4HGSA 4X3FA 5HD7A 3ORIA 1YOMA 3BCEA 4FSRA 4DEAA 5CEOA 2PZRA 1NA7A 3O8PA 4JX3A 3G2FA 4GSBA 2I7QA 5I3RA 5AA8A 3QRTA 1ZXEA 3QRJA 4OBPA 3SLSA 4IAZA 3BV3A 3MB6A 5DE2A 3TJDA 4FTKA 4QMVA 4F65A 5C1QB 5HE1A 3KA0A 3L9PA 3LJ2A 1OPJA 3RMFA 3HRBA 4D55A 3R2BA 4CMOA 3RM6A 1PXOA 3GC0A 3NYNA 3OF0A 2C68A 4L52A 4UV0A 4E5WA 2VWUA 3QZHA 2B9JA 3LMGA 4QTCA 5AAFA 5JFSA 2OU7A 1ZYDA 2CGUA 4Q5EA 3UMWA 2OZOA 4YZ9A 4YJRA 2F49A 4V0GA 5EQPA 4QTEA 3I81A 4MF1A 2PUNA 3DBCA 4LGGA 5ETIA 3PVGA 4RFMA 4J95A 2UZLA 4QRCA 2B9FA 4YSMA 4JQEA 2PHKA 2BRHA 3MYGA 5E91A 4CYJA 5J8IA 2UZNA 4BVUA 3NGAA 4AW1A 4U0IA 2IZSA 4J97A 2IZRA 4O1PA 3R7EA 3ZO2A 5E8YA 3QUPA 5AV4A 4DLJA 2ITOA 2ITPA 3V01A 2QI8A 4EK6A 2C0IA 4F4PA 5A4LA 1BMKA 2GTNA 2QHNA 2WOUA 4J53A 2ZOQA 4NT4A 1UU3A 4JAIA 2BPMA 2C1AA 2QO2A 3QXPA 3L9LA 2X1NA 1V0PA 2AYPA 2R3LA 4ZTHA 5CENA 2F4JA 4F08A 4HGEA 1PMEA 2C1BA 3BLHA 3NNVA 1O6YA 3ZFMA 5GZ8A 4FT9A 1GZ8A 4FEXA 4FGBA 4RJ3A 1G5SA 3DCVA 2WQOA 1IEPA 4PUZA 4I41A 4JIKA 3Q9WA 3NX8A 5CY3A 3LFCA 5BNJA 5I5ZA 1PRYA 5IDPA 2V55A 3R9NA 3PPJA 4D0WA 4PX6A 2FSOX 5CT7A 2B53A 4FK6A 5DMZA 4O2ZA 1OVEA 4FVRA 4ITHA 3Q5IA 2X9EA 4FTCA 5TF9A 3TZ8A 4IB3A 3PIXA 4TWNA 4J96A 4RVMA 3IECA 3JUHA 1P2AA 3GOPA 2GNJA 1GZNA 3MY1A 2GQGA 5CEKA 3HMIA 4A9RA 3VQUA 1I09A 3ORNA 5CQWA 5JGAA 4FKRA 3FMMA 2YERA 3V5TA 3Q2JA 3NUUA 2GCDA 3ZMMA 4D2VA 2W05A 1Q24A 3Q4UA 4DA5A 1L3RE 3PXRA 5F20A 2W9FB 4IFCA 4IFGA 3ZUTA 3BWJA 3OROA 4R6VA 3CS9A 4H3QA 4QTAA 4UWCA 3IK3A 5DWRA 5EYDA 2BZHB 4LV8A 5GNKA 3WILA 4USFA 5AAEA 5IEYA 5IQGA 1Y6BA 3QD4A 3QTZA 4RBLA 5HKMA 2EB3A 4IW0A 4Y72A 3HKOA 2Z7RA 4IX6A 2IZTA 4BCPA 5CVFA 1E1XA 4MYGA 5IPJA 4E6CA 4K1BA 3QX4A 3ZRLA 1REKA 4YJNA 4F7SA 3MPMA 3F82A 3I4BA 3NR9A 2IW9A 4BDJA 3H9RA 2VO0A 4OGRA 3UG1A 4V05A 4Z3VA 3QRKA 4RVKA 5EQYA 4GYGA 3DV3A 5DVRA 5IQHA 2WIPA 5L2IA 4M68A 4KBAA 4YSJA 5HVKA 1F0QA 5C26A 3FI2A 5CASA 5A9UA 3HLLA 5KUPA 4IZ7A 2HCKA 4N57A 2PUPA 3GI3A 2GHLA 3B2WA 3AD4A 1JBPE 3ZO1A 4IE9A 4YGAA 1WFCA 4L53A 3KF4A 4CD0A 5HLWA 2Y0AA 4EZ7A 3FZPA 4GG7A 3ZTXA 2OH4A 4FV4A 5AP5A 2XRWA 2YIRA 5KNJA 2OF2A 1PY5A 2XIZA 4XP3A 4C34A 1TVOA 4AE9A 4C3RA 3W8LA 1O9UA 3A99A 3IW5A 3O50A 4CCUA 2V7OA 4FEVA 3COIA 3OP5A 4UZHA 3TV7A 4I6HA 4QMSA 4ARKA 3LFDA 5C27A 5DLSA 3OY3A 3SHEA 3EQCA 1GIHA 4U6RA 2F7ZE 4LM5A 4QMTA 3RPVA 4ERWA 3ZDIA 5BVWA 2YCFA 2XF0A 4RQVA 5I3OA 5E7RA 4ID7A 4PPCA 4GCJA 3U4UA 3G5DA 1H8FA 5EM7A 5C8KA 2XNOA 3AOXA 2OIQA 2I0YA 3C13A 4BYJA 2PVJA 3IDPA 3OW3A 5BYLA 3MH0A 1MRVA 2E9NA 3RM7A 3VBVA 5JKGA 4N0SA 3HUBA 4ZTMA 1TQIA 2EXMA 3FL4A 4H3PA 3MGYA 3OT3A 3H9FA 1VZOA 5D7AA 3WZKA 2FSMX 2W5HA 5LMBA 3QZGA 4AOJA 3TKIA 4DLIA 4FOCA 5AP4A 4EH7A 2YIYA 4QYEA 5LARA 2WTVA 4FL3A 3ZBXA 2YAAA 5LVMA 3DXQA 3FEGA 4P2KA 5IH6A 4YBJA 3LE6A 3OFMA 2DWBA 3A2CA 1PMNA 5GZAA 1Y91A 4BFMA 1OIRA 2YDJA 3TDVA 3B2TA 4RIOA 3FHIA 2Q0BA 1K3AA 2F7XE 4MWHA 4UXQA 4BIEA 3EL7A 5LVPA 1BL6A 3KKVA 4MXXA 1NVSA 4M12A 5E8SA 3BEAA 3NMUF 4J52A 3OY1A 4CFXA 2R3OA 3CLYA 4E4LA 4O7TA 3E62A 2ITUA 5A54A 1XJDA 3D5XA 2W99B 4RJ4A 4FKOA 3HECA 2CKPA 3DT1A 5FTQA 4PDPA 2YAKA 3W2QA 4KKHA 1ZYLA 4PNKA 5CALA 4FVQA 4RSSA 3PFQA 4QP2A 2C5XA 2XYNA 4YP8A 3OXZA 3MB7A 4FZFB 4ZTQA 4QMUA 3CJGA 3VS3A 4B7TA 3SOAA 4CLJA 4EYMA 3E63A 5AV1A 4IAYA 4I0RA 1OUYA 3D9VA 3BX5A 2R3GA 3QQJA 4BRXA 5K0XA 5BMMA 5JK3A 3GENA 1Z9XA 5CZIA 5HLNA 2RFNA 2OK1A 4O0RA 4I20A 4HVHA 2WQMA 4ITJA 5CVHA 3OXTA 3QXOA 4BWKA 3GQLA 4D28A 1A48A 3HMNA 3NUNA 4MXZA 5A3XA 3SXFA 1M14A 1FMKA 4P5ZA 2C0TA 3CP9A 3VS0A 4APPA 2CGXA 3NIZA 2WTKC 4IAFA 1GNGA 3R1NA 5BX0A 5CSHA 2C3KA 2A19B 2J6MA 3UC3A 3UNKA 3BV2A 2W06A 3TWJA 4DT8A 1J3HA 5FDXA 1OIYA 1PMVA 2JAVA 4PMSA 3UNJA 3UQFA 4R77A 1H26A 4E5BA 4NSTA 2P2IA 5CXHA 1GY3A 4A9TA 1Q99A 2J2IB 2VTOA 2OJGA 3F66A 1HCLA 4K18A 4GT5A 4DG0E 2PVMA 3KGAA 3R73A 2QODA 4S31A 5F1ZA 4G3DA 5H8BA 3BI6A 3MFTA 5EK7A 1YW2A 5E8WA 5EW9A 3ZUUA 3OHTA 5HX8A 3FMLA 4OTDA 5JGBA 3AT4A 2HZ0A 5EHLA 3MTLA 2HAKA 1PXIA 4G5JA 3FLNC 3NNXA 3P23A 1YI3A 3QD3A 4IACA 3PIYA 4D2TA 5JEBA 1Q8ZA 5AR5A 4DFUA 5TOZA 5EFQA 1QMZA 3ORTA 4ANSA 1F5QA 3VBWA 4HVDA 1OPKA 3SD0A 1KE6A 4AT5A 2YM7A 4M69B 4UMRA 3BELA 4R1VA 5DA3A 4WNKA 5IMEA 4QQ5A 3C0GA 3IOKA 4IVDA 5FM3A 5DI1A 2ITXA 4FE2A 2QKWB 4IB1A 1Q8TA 4ZZNA 3SW4A 3OW4A 3CC6A 2JDRA 3UVQA 4E93A 4FIEA 4YLLA 3ZUVA 2J0IA 4H36A 2J0LA 3QGWA 4IBMA 5CSXA 1BL7A 3HX4A 3EH9A 4C3FA 3PLSA 3V8SA 4NUSA 5AAGA 4FC0A 3TV4A 5DRBA 2VN9A 3H0YA 2H8HA 2VTRA 4FNZA 5BUEA 2C5VA 4C59A 1J1CA 1DAYA 3LFBA 1PXMA 4JVGA 4XHKB 2YCSA 3DLSA 4E7WA 5HBJA 3GCSA 4FTAA 3WE8A 4C37A 4OTPA 3LVPA 3NUSA 2JKKA 4AN2A 4BGGA 3FZ1A 3GT8A 3R8UA 5B2KA 3UG2A 2ZJWA 4WO5A 4Y8DA 3BLRA 3SQQA 3D14A 4C4JA 4AOTA 1LR4A 2HOGA 2XZSA 3CE3A 3HRFA 3MS9A 1JQHA 3FL5A 3IQ7A 3MVMA 4IANA 1EH4A 3P0MA 4U44A 4XX9A 4YZCA 5CZHA 4ASXA 5KKRC 2YIXA 2HW7A 2ZV9A 3A61A 4TPTA 1SZMA 4EK3A 4EC9A 1PXNA 4FKJA 5ICPA 4KIPA 1UKIA 4F0IA 1OI9A 2XS0A 2ZYBA 1V0OA 4FTRA 3U87A 4YJVA 2W96B 2WMUA 4FT5A 3VJOA 3RK5A 2OLCA 3AXWA 5FP5A 4QYGA 3BHVA 5DNRA 3SG9A 4L9IA 5D1JA 3AMBA 3ENHA 3NVKI 4RLKA 3MDYA 5CNOA 3RVGA 3UZTA 4D2RA 2X2KA 1J91A 5DT0A 4R78A 4DBXA 2JKQA 4FT0A 5ANGA 2QOHA 3KCKA 1GOLA 5DN3A 2GQSA 2B0QA 5KBQA 5CT0A 2XNBA 3PY3A 3U54A 5M4UA 4UY9A 4JXFA 1WVYA 3S95A 2NRUA 2R7BA 2VO3A 3R01A 2BKKA 2WPAA 3LAUA 5AX9A 4HCTA 2XKDA 5M4IA 4AN9A 4F0FA 2XIRA 1U5QA 3HAVA 3U9CA 5CAUA 2QR7A 5JRQA 1FOTA 3G15A 3A7IA 3P7CA 1BUHA 4UWBA 3FJQE 4DITA 4G9RA 4BL1A 4ZLOA 3UBDA 2HW6A 3RZFA 2ETMA 2IVTA 5A6NA 4IVAA 4M14A 3TI1A 4EBVA 3GUBA 3QGYA 1PXJA 3JR1A 4RLLA 4RX7A 2B9HA 1MQBA 3DAJA 4DHFA 1ZLTA 4YTHA 5HNBA 2IO6A 4DBNA 1IAHA 5LVNA 4ANQA 4D1XA 3CGFA 1BI8A 2YISA 4FSMA 4JDKA 4XP2A 3A8WA 4EC8A 4Y85A 2WQEA 2EVAA 2YACA 3KVXA 3UOKA 2ESMA 4AT4A 4LRKA 5I0BA 2NPQA 3UE4A 4BF2A 3KK8A 1FBNA 3K3IA 3OG7A 4JDJA 4F9YA 4FIHA 3VC4A 4IDVA 2QC6A 3SDJA 5DR9A 2Y9QA 3FBVA 4KIQA 3QZFA 4AZEA 5AP3A 2C5OA 5H8GA 4O81A 3T3UA 1SVHA 2J90A 1E1VA 3LZBA 3VNTA 4E20A 3PTGA 4G3CA 4O7YA 4O7RA 1PMUA 4GUEA 4IHPA 5TR6A 3R83A 5CF5A 4RIWB 3UP7A 4F1MA 5FGKA 5IMXA 3PRFA 4F9WA 3MV5A 4RA5A 4YLKA 5BQ0A 4QTBA 3O8TA 5GJFA 3LW0A 4H3BA 4A4OA 3DKGA 3LQ5A 5CXZA 3GC7A 5KZIA 3I1AA 4BCKA 5BVFA 2VO7A 4OTFA 4EL9A 3KVWA 2OICA 5EW8A 4I24A 3RINA 2VTMA 3OOMA 3PXYA 2PK9A 4NKSA 4ZSLA 5I9VA 2PVLA 5IISA 2ONLC 2VTJA 3TZ9A 3CTHA 3H3CA 5B2LA 2HXQA 4BY9E 2PYWA 4V04A 4BTJA 3FKNA 4D4RA 4F9BA 2YA9A 4EI4A 2Z02A 4KIKB 2Y7JA 2PMLX 2YABA 3GU4A 4I6FA 5CEQA 4FNYA 2HZIA 4FIIA 4TNBA 3ULIA 4YC8A 4F6UA 3NYVA 3AMAA 1YOLA 3UZRA 3FLWA 4U45A 3Q4CA 4BICA 2R3IA 4IM2A 1GZOA 4BDHA 4FK3A 4JQ8A 4OBQA 3E3PA 4O0TA 2I0EA 3DJ7A 4WRSA 2ZV8A 2I40A 4XNEA 4BDFA 3KRWA 3OEFX 4TZRA 5LJJA 4B0GA 3E8EA 3LLTA 4PNIA 4BCNA 2BFYA 1KE7A 3A8XA 5IKWA 3ORPA 3OBJA 3RCDA 3VS7A 4BTKA 2R64A 4CFWA 1Q8WA 2XEZA 4W8DA 4ZTRA 2CPKE 4ZZMA 3EFWA 4FBXA 4AACA 4OT6A 4I1ZA 4EWHA 1H28A 4GW8A 2XYUA 5J87A 5D12A 5E1EA 5KMNA 4O7ZA 1ERKA 3WF9A 1YWNA 4IJPA 3V5LA 4ASEA 5T6KA 5EQEA 2J0MB 2JC6A 3DPKA 4D2WA 4KRDA 3TNPC 1OL1A 2FB8A 2JGZA 3HVCA 4L43A 3TIYA 5K4JA 3LFFA 3JS2A 2WKMA 4EOPA 3SG8A 4WG3A 4FSUA 4DH5A 3TM0A 3BGQA 4K33A 5K5NA 5M07A 3D7TB 3C0HA 2G2IA 3RJCA 4WRGA 3QUDA 5L8JA 3M2WA 3MJ2A 5AUWA 3PY0A 3ACKA 2VTPA 2VD5A 1URCA 1J7UA 4LG4A 4M0YA 3HL7A 3TUDA 2ZM4A 1ATPE 1B6CB 5I9YA 3BYVA 2VWBA 1GAGA 3DY7A 2UZBA 5AUTA 3QWJA 4O0XA 4OTWA 5IUHA 3RI1A 5BUJA 4YHJA 4DGNA 1NW1A 2F2UA 3Q04A 4F63A 1OBDA 3GFWA 1VEBA 2QVSE 1DM2A 4WT6A 2ERKA 1YXVA 5FXQA 4CLIA 3KXGA 5E8UA 5CI6A 1Q97A 1BYGA 3C5UA 2J51A 4PP9A 3FC2A 3E64A 5GHVA 4C4IA 5I4NA 2C3LA 1XO2B 3MWUA 5L2TA 1OGUA 3FMKA 3Q6WA 1GIIA 3BBWA 4BCHA 5AV2A 3T3VA 5J1WA 2UZVA 1JNKA 2A1AB 4WNPA 3F88A 5F95A 4BI2A 3VWAA 4F7LA 2AUHA 5IQIA 5E8XA 4ASZA 5BUIA 5EYCA 2IZUA 3A7JA 2OWBA 2PE2A 5M4CA 1WBWA 4CTCA 3MVHA 3QD0A 3R00A 2HIWA 3WZJA 2IVVA 4CGAA 5A4TA 3E8CA 4ITIA 3Q9ZA 4A4XA 1ZY5A 5AV3A 3FZRA 4QT1A 4L44A 1Q5KA 2FH9A 2YIWA 3QCQA 5LQFA 1U54A 3A7GA 2X7GA 3IW6A 3MA6A 3QQHA 4KSPA 4FTNA 4RFZA 4RJ7A 5G1XA 3UYSA 3VIDA 4D9TA 2CNQA 1W82A 4GG5A 3MESA 2UZDA 4NK9A 3V5QA 3R8ZA 2YLFA 5HICA 2QOBA 1OL6A 2GQRA 2OH0E 1R78A 4FYNA 4EHVA 2W5AA 4FF8A 3SVVA 3CSVA 4GT3A 4IM3A 4O7WA 5DHJA 1WAKA 3I79A 3ATSA 2DS1A 3BHHA 2RFSA 3BQRA 3NYOA 4K0YA 2BDJA 5CAQA 3ATTA 4EOLA 1XKKA 3EQIA 2VRXA 4E6DA 1UU8A 4RJ5A 2H96A 4AA5A 5J9YA 3POZA 4IX5A 4PL4A 3WARA 2OXXA 4Q9SA 4EKKA 4C57A 3UPZA 2UZOA 1R0PA 3R1YA 4NYEA 4CMTA 2X39A 3PE2A 3C1XA 1OPLA 3W2PA 4AZSA 2PMNX 3ZHPC 4UMTA 3MH3A 3P9JA 5M56A 1JLUE 2JBPA 2WB8A 3NS9A 4C7TA 4LOPA 4ZSGA 4RQKA 2CNVA 3N4VA 3O7LB 4A07A 3H30A 4TYJA 2R0IA 4B6LA 4DF3A 5IUGA 5FTOA 5ANIA 4EH3A 5L6PA 4FEQA 5L6OA 1QL6A 3UO5A 1BX6A 2QOFA 2HWOA 3MIAA 4BZDA 2G1TA 2QOIA 2C6EA 3IKAA 3BIZA 3PG3A 1DI9A 5D7VA 5HEZA 2XJ2A 5L2QA 3SX9A 3U6IA 3D5WA 3O0GA 1NY3A 3C50A 2GNIA 2YZLA 2RGPA 1K9AA 2GU8A 5GINE 3UDBA 3KULB 4FKQA 5FLFA 4AE6A 2JLDA 5L4QA 3CY2A 5AR2A 4EHZA 4C33A 5EKOA 1W0XC 2ONLA 3EJ1A 3AQVA 5F4NA 4FTUA 5KZ0A 5IA0A 4CVAA 4NZWB 3SW7A 2BRGA 4TYHB 3CXWA 3F2RA 4QQCA 2OJIA 2OFUA 4Z7HA 2ITYA 4G1WA 4YNEA 1PYXA 2W4KA 2R3RA 5HHWA 4FL2A 3DXPA 4L6QA 4MTAA 5DPVA 3AC5A 2OJJA 4ZAUA 2PVFA 2XJ0A 5IQBA 3ZU7A 4BBMA 3HMPA 2XMYA 5JSMA 1WVXA 3K54A 4YJSA 4I0SA 3Q4ZA 2BVAA 4BYIA 3BE9A 1FGIA 4UWYA 4U9AA 4MD8E 2KTYA 5JH6A 4GS6A 5L6WL 3VUGA 1BLXA 3LFEA 5AEPA 1XQZA 1YWVA 4XS2A 4GKHA 5CU0A 3MH1A 4O96A 4R5SA 1Z5MA 3PXKA 3EQBA 3M1SA 2VX3A 4GL9A 3FLZA 5G6VA 3I7BA 3I7CA 4O0YA 3BYMA 3DDQA 2I6LA 2YJSA 4U3ZA 2YWVA 1ND4A 3PLAE 3VVHA 4CT2A 3RWPA 5AR8A 3UVPA 3D2IA 2YM3A 4JBQA 2CGVA 2HWPA 3ALNA 3W33A 5FM2A 5EYMA 3R7IA 4IDTA 3HDMA 5CVGA 4DEIA 1LEWA 4O84A 4FZ7A 5B0XA 3UMXA 4ZK5A 4O91A 4QPMA 5IDNA 2XK8A 2OSCA 2JD5A 3QLGA 4KB8A 3LOKA 5HG8A 4XBUA 3A7HA 1XBBA 3BBTB 2ITTA 3SRVB 2UZEA 2XP2A 1UNLA 4I4EA 1F3MC 1K2PA 1YXSA 3U6JA 3SA0A 2CKQA 5DOSA 3Q52A 2EUFB 4A9SA 4F1TA 3R0TA 4YNOA 4R1YA 2BMCA 2FO0A 3BPRA 1MQ4A 4OTIA 4WUNA 3COKA 3PPKA 5FP6A 4LL5A 4DGGA 3FYJX 4H58A 4TWPA 3FPMA 5EYKA 1ZMUA 4A9UA 4D4YA 3H0ZA 3I6UA 4CTBA 1I44A 2Z7LA 5C4KA 3FKOA 2QOLA 3UC4A 4FA2A 4N6YA 3C5IA 4TYGA 2WELA 1IASA 3UO4A 2XM8A 3UGCA 3NVMB 3HEGA 2IG7A 5HE3A 3P79A 4HYIA 4KUJA 3Q32A 2Y4IB 5FBNC 4ZEGA 3ZS5A 2ITVA 3NNUA 2YZAA 1VYWA 1PHKA 3RHKA 4D1SA 4KKEA 3A7FA 4MXAA 3SV0A 5LWMA 5CWZA 3S4QA 5L2SA 2OW3A 4HVGA 3GEQA 4LYNA 2GMXA 1SM2A 3WBLA 4BGQA 4G6OA 4CV8A 2IW8A 3TUBA 3VS5A 4G5PA 5M53A 3W55A 3T9IA 1ZARA 2GNLA 2ZM1A 4HPUE
chains in the Genus database with same CATH superfamily
2Y4IC 5IQCA 2XIKA 4L46A 2WOTA 1H1WA 3VS2A 3R22A 5HBEA 4CV9A 3ZFXA 2GS2A 2CCHA 4MF0A 4PRJA 4AW5A 4C8BA 4M15A 4L67A 4QMZA 2ZVAA 2XNMA 3UIMA 4Q5HA 5AX3A 2BIKB 3ODZX 3PZEA 2LAVA 3G6GA 3NAYA 1YXUA 3C4EA 4S34A 3L8SA 4BDGA 4DYMA 3PE1A 4GMYA 4QMPA 2B7AA 5LVLA 2GFCA 2ACXA 4PMTA 4XV3A 2PTKA 4O7SA 3QLFA 2I0VA 2UW9A 2XA4A 3E3BX 5FTGA 4NCTC 3WF6A 3OTUA 3PP0A 4ZY6A 5JGDA 5E90A 3GBZA 1JKSA 4H1MA 1SNXA 4DEDA 3D0EA 4JG7A 2WMSA 2IJMA 4ZY5A 3FMEA 2BHEA 4DT9A 1QCFA 2OZAB 2XBJA 5C4LA 1CM8A 5KX8A 4UMQA 2R3HA 3QTUA 1M2PA 3I0OA 3M11A 2GSFA 2VTIA 3AC1A 4O86A 2GS7A 3Q6UA 4FV5A 3JVRA 2GDOA 4JLCA 3BYOA 4YJTA 4QDVA 4YU2A 2G2FA 4XG6A 3KXNA 4L7FA 3QHRA 2YM6A 4RA4A 4XG8A 1OKZA 3GU8A 1RQQA 3KC3A 4AW0A 2CKEA 5D10A 3OWJA 5AR4A 1KV2A 4X2GA 2CDZA 3KN5A 4GRBA 4RT7A 3OWLA 1NVRA 2YITA 2CSNA 3EHAA 3RPSA 3TKUA 2ZV7A 4MBIA 3GU5A 2DQ7X 3PP1A 3UOJA 4CT1A 3SGCA 1MUOA 5KE0A 4TY1A 1YKRA 3PIZA 2QCSA 2XBAA 5D11A 3RBWA 4R7IA 3PDTA 3RKBA 4YHTA 5DT3A 5HCZA 1QPDA 4HJOA 4OTQA 3LM5A 3COHA 2CLXA 4USDA 2AQXA 1ZYCA 3QRUA 3DQXA 4F70A 4GT4A 3R21A 4BCMA 4EHGA 4R8QA 3VBTA 2WMRA 3FZOA 4KSQA 3NFGB 4KS7A 3TKHA 3EN9A 4YTCA 4D5KA 4O7VA 4W4XA 3GCUA 4LMUA 3VONA 4AXDA 4IMYA 5EOBA 5ANJA 3EN4A 5EKNA 4MEDA 4PL3A 5HOAA 2BDFA 5CSVA 2YHVA 3DOGA 3FLQA 1NT2A 4NTSA 2X0OA 1HOWA 4FT7A 5A46A 5IQAA 3G33A 4TN6A 1LUFA 4GYIA 3DB8A 4NH1A 3BHTA 4YTFA 2UW5A 1FQ1B 2Z7QA 3IDBA 4QMMA 4HW7A 1MRUA 3V8TA 1P4OA 3MW1A 3C4FA 3P86A 4N6ZA 5AP0A 2UV2A 1TQPA 3DK7A 4FTTA 4GFOA 5AWMA 3TNIA 2NYAA 3QTWA 4MX9A 4WA9A 3HRCA 4WBOA 4GU9A 4O4DA 2ZFYA 2C5NA 4QQTA 4ZXTA 3LCOA 2X6DA 3MVJA 4B9DA 2NNWB 2PZPA 3KY2A 5DGZA 3EOCA 3MY0A 4ANMA 3PZHA 4WSYA 1CKJA 4E6QA 4TWCA 1XH7A 1XH5A 4PDSA 2E9OA 3EZRA 4RC3A 3VUDA 4FTMA 2UZUE 3PYYA 5CTPA 5JFXA 3QALE 3CR0A 2PULA 2ZDUA 3V3VA 3V5WA 4ALVA 2HELA 3AT2A 4RZWA 4XG2A 3OBGA 4UBAA 3ROYA 2Y6MA 3AKJA 3F3ZA 2VTTA 4G3EA 4E8AA 5EOLA 4YR8A 2B55A 5EHOA 5CEIA 2EXCX 5HORA 3W2RA 5HO7A 2XAOA 2CGWA 3LPBA 2QG7A 2X2MA 2QURA 3WZUA 4QP7A 4Y5QA 5IA1A 4CEGA 4CFMA 1KV1A 1FVTA 4AOIA 2W1EA 3POOA 4QMLA 2W4JA 3BGPA 4QPSA 1UV5A 3N4UA 2VTAA 3R71A 1CKIA 4E73A 3F5XA 5AP6A 3UODA 2IF8A 2W1ZA 3LMHA 4UB7A 4F78A 4RIXB 2P4IA 2I1MA 4XEYA 4G2FA 4WG4A 5BVNA 2VX0A 5CQUA 4JL9A 4YJOA 3HV3A 5EDPA 4KRCA 4UMPA 3ZLYA 3QAME 4MNEB 3HZTA 4EH5A 5J79A 3C9WA 4BCJA 4J99A 3PWYA 4N70A 1URWA 3ZXTA 3IOPA 4L45A 3F2NA 4HGLA 3A4PA 4E5AX 5M57A 2OXDA 2PY3A 4UALA 3QZIA 4L01A 4WKQA 4ZZOA 2WEVA 4I5MA 5H3QA 4KINA 1U46A 2VTLA 5EI6A 3VF8A 4G3FA 4L8MA 3QCSA 2QOOA 4PY1A 3F5GA 4FV7A 3PVUA 5HNIX 2XNEA 1HCKA 2CLQA 4LFIA 3REPA 4AU8A 4FKUA 1P14A 3WZEA 3MH2A 4LRJA 2BRBA 2PVRA 4NCTA 4FKLA 4RMZA 2YCQA 2XCKA 2JIIA 4RX9A 4ZMFA 4YTIA 2RFDA 4DH7A 3N4TA 4U81A 4F09A 1S9IA 2V0DA 3QYWA 4NIFB 4FMQA 2XRUA 4J8NA 4EZ3A 3EN5A 4AA0A 2YDKA 1YDSE 4QDEA 3CEKA 1OIUA 1CTPE 3PPZA 4Q2AA 3VN9A 3FZSA 5E4HA 5BVDA 3QTSA 4NL0A 3HP5A 3E88A 3UQCA 5HTCA 4O83A 3QWKA 2C30A 3AC3A 3AT3A 3KN6A 2J50A 4UYNA 5AV0A 4ACMA 3QHWA 2XCHA 3QQFA 3BU3A 4M97A 4OTGA 3QYZA 1S9JA 2O64A 3FWQA 4C4FA 1WBNA 4U5JA 4D5HA 2QOKA 4AUAA 5AA9A 2PVNA 2PVKA 3EFLA 3UYTA 4C3PA 5K0KA 4ANLA 3PY1A 4C58A 4XG7A 4MQ2A 2G9XA 3A60A 4X2FA 4AG8A 1GJOA 2XKEA 4M3QA 3QC9A 2HXLA 4CSVA 3QQLA 5C01A 4CQGA 2UW6A 4B8MA 3FXZA 4ENYA 5AUXA 5FRIA 4PTGA 3U4WA 1WCCA 1Q3DA 2W5BA 1OKWA 3P08A 4MXOA 2XK3A 4ZOGA 5LMAA 5HESA 2F7EE 3RAIA 4AXEA 3EMGA 2XIXA 2UW8A 4FSNA 5AIKA 5JT2A 3DKFA 4BGHA 3TG1A 4NJDA 2YN8A 3KRLA 4EUUA 4IWPA 3GXLA 4OTRA 5CLPA 3CJFA 1UKHA 3AG9A 4PWNA 3EQDA 3EIDA 3V5PA 4XG3A 4LGDA 5TT7A 4ANOA 4YHFA 3HV4A 2X2LA 2XB7A 3NUXA 3OEZA 3KXZA 4GH2A 4JQ7A 2WD1A 5HU9A 3DFCB 1B39A 2IEWA 3QA0A 5HCXA 3LHJA 3E93A 2WTIA 2VTNA 2WMXA 3G0FA 5ACBC 2EWAA 3AC8A 4FSYA 4ZIMA 4FKSA 3CPBA 4D9UA 3TUCA 5AP7A 3BE2A 3HUCA 1G3NA 3VRYA 3BYSA 4NM7A 4C4GA 4FKPA 3F7ZA 3R8LA 5JFWA 1JKKA 2LGCA 1V1KA 3G6HA 3R1QA 4HNFA 4ZJJA 3KMUA 3VBYA 4ANBA 3OT8A 4J98A 2YFXA 3PVWA 4BDDA 1J7LA 4ZS4A 3FY2A 3ZYAA 1KE5A 3FMHA 3CD3A 5CU6A 4QNAA 4U42A 4XV1A 4AZVA 4MWIA 5HX6A 3LCSA 4NM5A 3QTXA 2EB2A 4RIYB 5E8VA 4DCEA 4FNWA 1AD5A 4WUAA 5E8ZA 3PXFA 4EOOA 4KA3A 4IX3A 2PMIA 4YUQA 2FSLX 3EQGA 3GCQA 2QOQA 2NO3A 3I5NA 4G17A 4MQ1A 4Y83A 5FEDA 5DH3A 3VHKA 3P1AA 1AGWA 3GOKA 4UEUA 4JDIA 2A2AA 5DFPA 1P4FA 3TZ7A 2W9ZB 4OAVB 4LL0A 5AR7A 5JMSA 3R7OA 3HAMA 4DHJA 2J5FA 1OL7A 2BR1A 2R3MA 1T45A 3DBQA 1NVQA 4I92A 1DAWA 4CFFA 2SRCA 4NU1A 5HIBA 2FA2A 4GVAA 5HVJA 4IWDA 4X0MA 4UYAA 2H6DA 5C8NA 2UZWE 4I0TA 5GZ9A 2PE1A 3ET7A 2R9SA 3SOCA 4YPDA 3ELJA 4BCQA 1XH8A 4QP3A 2CNUA 4GU6A 4C62A 3KK9A 2OJFE 4I93A 2BTRA 3PUPA 3ZOSA 3KXHA 4AGUA 4HZSA 3UPXA 4BBFA 3R02A 4YMJA 2F2CB 4R3PA 4FKGA 5F9EA 1OB3A 5AIRA 2HYYA 3ZSHA 4B8LA 3GU7A 3KF7A 3R8MA 1KOAA 3F3TA 4QP8A 3NAXA 4EEVA 2XK7A 3IG7A 4ACGA 5EM5A 3PJ2A 5E9EA 4N4SA 4MCVA 4XRJA 4C4EA 3TV6A 5B7VA 1VLRA 5C9CA 4PTCA 5CAOA 3NIEA 3VUTA 4AZTA 4HOKA 4L00A 2R3FA 4JAJA 1OIQA 2HY0A 2CN8A 2VUWA 2YJRA 4TTHB 5I9ZA 4BDKA 4MNEA 4AX8A 4WG5A 3CQEA 4H39A 3P5JC 4JR7A 4AA4A 5DBXA 3UQGA 2EU9A 2XKCA 4G6LA 3KEXA 4XJ0A 3WOWA 4U40A 4E4XA 3VRZA 4XLIA 4BIBA 4XV9A 5EI8A 4KWPA 4O0WA 4MBJA 3EWHA 2ZAZA 4X3FB 2WHBA 4PQNA 3L8VA 2RKUA 3QQKA 4KBCA 2O63A 4L3PA 3D83A 2IVSA 4FV8A 1NXKA 2BIYA 2G2HA 3P4KA 3VJNA 4M69A 1AQ1A 2UUEA 2W7XA 4KD1A 3W0PA 3AGLA 4HYSA 2UVXA 1YRPA 4RWJA 4OTHA 2EXEA 2JITA 3FSKA 1YXXA 1SVGA 3HNGA 3THBA 1CMKE 2WU7A 3RALA 2VTSA 3QF9A 4DH1A 4C2WA 5H9BA 1JAMA 5M4FA 5M08A 4AQCA 3COMA 3QKMA 4FI1A 4D4SA 1P5EA 2V7AA 4FV0A 5CSPA 1JSTA 4V0GB 4BC6A 2Z8CA 3R30A 3VBXA 4XCUA 3VS4A 5IQFA 3DB6A 3ZLSA 1ZRZA 4GJ3A 4LQMA 4JG8A 4HCVA 4AFJA 4EQMA 2QQ7A 4BTFA 2X81A 4USEA 5K4IA 4JNWA 2VWYA 3Q9YA 4FSZA 4W4YA 3VS6A 4DC2A 4EUTA 4IZ5A 3R9DA 4FSTA 4NEUA 5JQ5A 4BHZA 2X7OA 3QCYA 4FYOA 4JX7A 5EHYA 4YZMA 5HIDA 4W9XA 3R7UA 3QQUA 5E92A 5AFVA 3W0MA 4LRMA 4DFNA 2W1IA 2BROA 3VW6A 4XG9A 4IX4A 4BCIA 4CMUA 5FEQA 3BU6A 3DLZA 1YI4A 2R3JA 3O23A 4H1JA 2WMAA 1ZZLA 3QTQA 3ORKA 2VO6A 3KXXA 2J5EA 2ITQA 4I6QA 4EH6A 2A4LA 1UVRA 4O0SA 3BL7A 4IEBA 3FY0A 3II5A 5HE0A 3ZZWA 5AR3A 4LUEA 2WQBA 3OCTA 4X3JA 5T68A 1M7QA 2QKRA 1ZAOA 2PMOX 3G90X 3WZDA 4XYFA 3D15A 3TL8A 1WBOA 4CFNA 2OI4X 3RNIA 4QTDA 1H1QA 2JFLA 1W2DA 3IO7A 3JYAA 3NDMA 4K6ZA 4XG4A 5KO1A 2J7TA 4MK0A 5L2WA 4C4HA 3LFQA 3HV6A 3VULA 4I4FA 2E9VA 1A06A 2JIUA 4WSQA 2BKZA 4FRFA 3ZXZA 2P3GX 4XRLA 2NP8A 3KB7A 3ZEPA 4CKRA 4E6AA 4FV2A 5FWKK 3VUKA 5ITAA 1W83A 2J4ZA 4G34A 3DA6A 3CPCA 2WZJA 4UXLA 3HMMA 4Y73A 4NJ3A 2ITZA 3LXKA 5HG9A 5IH5A 4RRVA 3D94A 4L3LA 2GNHA 2FUMA 2JBOA 2ETRA 2XK4A 1PKGA 4O22A 3UZPA 2JDVA 1QPEA 2WTCA 4I94A 2KULA 1G8JA 4R3RA 3FQSA 4BKZA 3ORZA 4DGLC 2R3QA 4EJNA 2X0QA 2J0KA 2X4FA 3DDPA 2VWXA 2XNNA 2JDTA 1JOWB 2J0JA 2OJ9A 4E4NA 4DCAA 4Z9LA 4RWKA 3IW8A 3R28A 3ZFYA 2ITWA 4GEOA 3FQEA 5DYJA 4IB5A 3D7ZA 5EI2A 4W4WA 5CF6A 3K5UA 3WF7A 4MVFA 2ZMCA 3KL8A 5HO8A 5M51A 2UW7A 1PKDA 4HGTA 3CTJA 4ZTLA 4FR4A 5AADA 4TL0A 4NTTA 4QP4A 3ZH8A 5KMJA 4IWOA 4ZTSA 4EYJA 2VWWA 1IA8A 2PL0A 4ENXA 4ZTNA 2V62A 3IPHA 4RGJA 1JKTA 4TW9A 4IVBA 4BTMA 1YOJA 4BI0A 4M66A 4FEUA 4EBWA 3FE3A 4I5PA 2UW3A 4FUYA 4M67A 1UNGA 5K9IA 5LWNA 2PWLA 1H4LA 2RSVA 1Q41A 2YCRA 4A9YA 4II5A 3SKCA 3ENMA 3TNQB 2BCJA 3FI3A 1O6KA 4IJ9A 3A62A 2ZM3A 4RIWA 2XUUA 5IG1A 2CMWA 4G16A 4K9YA 4BN1A 3QU0A 3AC2A 1IA9A 2E9PA 3GQIA 1APME 2PU8A 4OUCA 1YHVA 2HK5A 4F1OA 3OWPA 1OUKA 2O8YA 4FSWA 2GHGA 3LM0A 4O4BB 4DFLA 1DS5A 3G0EA 5M55A 4DTAA 2JDSA 4FTJA 4BBEA 5LOHA 3BWFA 4JR3A 2P55A 5CF4A 3IGOA 1H1PA 4QMQA 5HZNA 4WD5A 2C6KA 3W8QA 2C47A 2HZNA 1ST4A 2XNGA 4KIKA 4JT3A 1XH4A 4P90A 3KMWA 4YJPA 1OECA 3AMYA 3NUPA 1BKXA 3ZO3A 2Z7SA 4R5YA 3PUFC 4C0TA 3RPRA 4AXCA 2VNYA 1M2QA 4KAOA 4CYIA 2OF4A 1RW8A 5ANEA 2OFVA 2IWIA 1OM1A 3UDSA 3MFRA 4BZNA 3SC1A 3WYYA 4OR5A 4JRNA 5AMNA 3Q60A 2ZB0A 4NW5A 3MIYA 4FGRA 1R0EA 4S33A 4IZAA 4X6QC 1H01A 1RJBA 3WF8A 3QUEA 5J7HA 2C3IB 2O65A 2QO7A 3HMOA 5IA5A 2WU6A 1JVPP 3C4CA 3LFNA 4L3JA 1ZWSA 5KHWA 5BVKA 4U41A 1H08A 5H8EA 5GIPE 1H1SA 5JQ8A 1FPUA 3JY9A 4PPAA 5EDQA 3NCGA 3O8UA 3UO6A 4HPTE 3Q4TA 1Y8GA 4R7HA 2Q0NA 3FV8A 5LVOA 3D7TA 4QOXA 3QCXA 4F6WA 2WTJA 4CZYB 4EH4A 4BCOA 4DGOA 3CKXA 1QPJA 4E1ZA 1GIJA 4M8TA 4R7BA 4KS8A 3E8NA 1G8KA 4RC2A 3FZTA 5IUIA 2IPXA 2VTQA 1JSUA 3U6HA 3UNZA 2QD9A 1ZYSA 4GIHA 2X8IA 3TJCA 3CD8A 4P7EA 3TTIA 1PXLA 4Q9ZA 3QBNA 4QP1A 5FQDC 4DE4A 3QRIA 2XJ1A 2GS6A 3R04A 2W1DA 4S30A 5BVOA 5CI7A 3U9NA 4BR3A 4ZP5A 4BCFA 2R3NA 5M06A 5IEVA 3PSBA 4CZUA 5D9HA 4ZMEA 1M2RA 2Y4PA 4RWIA 4OLIA 1TKIA 3OTVA 1W8CA 3CQWA 4EHEA 4X2KA 4DFXE 4EOKA 2QO9A 4YC6A 2W1FA 2CHLA 3EYHA 3IW7A 2B52A 4HYHA 4KIOA 4L42A 3DK3A 4MKCA 3HDNA 4F9AA 3OCGA 1FVRA 3ZEWA 3KXMA 5CSWA 1W98A 5EM6A 2W1HA 1MRYA 1YDTE 2WEIA 4RPVA 2W0JA 4IIRA 4PMPA 3W16A 4XV2A 3OVVA 5D41A 5L3AA 4RZVA 4DEGA 3W0NA 4TXCA 4ZJIA 5BMSA 3D5UA 3FMJA 4A7CA 4XUFA 5HNGA 5A14A 3BU5A 3GFEA 2OBJA 4IB0A 4QYHA 5IA3A 5K5XA 3DKCA 4FKTA 1YQJA 2PVHA 4YZDA 5FXRA 1PXPA 2ZMDA 5BYYA 2WIHA 3DZQA 4JBOA 4CZTA 3QD2B 5DIAA 3F3WA 4JIAA 3U55A 4WNMA 3UIXA 3VO3A 4C02A 4RG0A 4FTQA 4XOYA 4IC7A 4Z55A 4FVPA 2C6LA 5CF8A 3C7QA 1OMWA 1Q61A 1WZYA 3OS3A 5LMKC 4O21A 4BCGA 4AXAA 2PE0A 3E87A 3RZBA 2QG5A 4YBKA 5HTBA 3LFAA 4LOOA 2RG6A 3OOGA 4LV5A 1OKVA 3WF5A 4JDHA 3EQPA 3AKLA 2C0OA 4LV7A 5EG3A 2V22A 5A6OA 5J95A 1ZOHA 3RCJA 4HZRA 4OAUC 5IA2A 2PZYA 3H4JA 4NWMA 4PP7A 3Q2MA 2E2BA 3ORMA 4W4VA 3BZ3A 4H05A 1FGKA 1Q8YA 2BUJA 1YDRE 3NRMA 4GUBA 3ROCA 4EWQA 5EW3A 5ACKA 5BVEA 4X6RA 1A9UA 1Q62A 5E1SA 1PXKA 1ZMWA 5HVYA 1WBVA 5IQDA 3ZC6A 4FV3A 4U8ZA 4Z16A 2RFEA 5LCJA 5AJQA 3BHUA 1IRKA 4QMWA 3ZRMA 5ETFA 5B2MA 3JVSA 1WBTA 4PV0A 5HCYA 4PF4A 2RIOA 3B8QA 1PYEA 3DGKA 2QU5A 4FICA 4HNIA 3WIKA 3FPQA 4AS0A 4PDYA 2OKRA 3G9LX 4L7SA 3KULA 3W10A 3DBFA 3FC1X 1J1BA 1UNHA 4DEEA 4DG3E 5A4QA 1O6LA 3FI8A 3DTWA 1RDQE 5BYZA 4GK3A 3VHEA 4P5QA 5CEMA 3HP2A 1GZKA 1M52A 3D5VA 4LUDA 5DR2A 4EH8A 3D2KA 4TYHA 3ULZA 1FMOE 4K11A 3R7VA 4D58A 2OXYA 3UOHA 1IAJA 3C4XA 4F7JA 2J9MA 4FTIA 2O5KA 3I5ZA 5CYIA 4GKIA 4AZWA 2R4BA 4APCA 4FT3A 2JDOA 2DYLA 3BYUA 3QQGA 2A0CX 5FEEA 4AN3A 1OBGA 1KOBA 3MTFA 2VU3A 4MAOA 4ZLZA 3RAHA 4ZY4A 3W32A 3EB0A 3TNWA 3EQHA 5KHXA 1H27A 1MP8A 3UOLA 3HA8A 2Z60A 4ALUA 3ZCLA 4DFYA 4YC3A 2X7FA 4JMQA 2H9VA 3FAAA 2C69A 1JWHA 3CBLA 2VGPA 4MD7E 3Q53A 4J1RA 4QYFA 1JPAA 5CAVA 5AM7A 4EOIA 2P0CA 3QA8A 3C0IA 3PWDA 2A27A 4ERKA 3L8XA 1KE8A 1W2CA 5J9LA 4GJ2A 5GJGA 3S0OA 3O96A 4EK8A 4AGDA 5HO6A 3EN7A 2ETKA 3F2AA 4LI5A 3ZZEA 3L8PA 2X4ZA 4RJ6A 3DNDA 3DZOA 3PFYA 4O82A 2QOCA 3P78A 2PSQA 2BZIB 5AP2A 3VAPA 3FXWA 4OT5A 2G01A 3U51A 1R39A 4DDIA 4M13A 3KU2A 3LJ0A 4NM0A 3W2CA 3F5UA 3LCTA 2W4OA 4JI9A 2QLUA 5C8MA 2OG8A 4D2SA 5KMOA 3O5AA 4X7QA 2P2HA 5IF1A 2C6TA 2JEDA 1KSWA 4EOMA 3DJ5A 2YDIA 4QYYA 3BHYA 3ZLXA 4CG8A 1X8BA 2R2PA 4IH8A 4RVLA 3ZSIA 4A4LA 4EKLA 3OZ6A 3SRVA 4JG6A 4W9WA 1UU7A 2WTKB 3R7GA 5CEPA 5K3YA 3PXQA 4B4LA 4EK5A 3F3UA 3L9NA 3IDCA 3N51A 3GGFA 3UIUA 3ANQA 3MI9A 4LMNA 1OITA 3R9HA 3QTIA 4PMMA 3KRXA 3Q9XA 4FKIA 3LXPA 3IS5A 1M7NA 1WBSA 3LJ1A 1UWHA 2REIA 5FBOA 4UZDA 4DG2E 3PJ3A 3PA5A 2PZ5A 4I6LA 3R2YA 1LP4A 1YHSA 1U4DA 4IVCA 3LCDA 4JRVA 2RG5A 4IC8A 4EORA 2PUIA 3PRIA 1J7IA 5GIOE 4BDCA 3GVUA 3CCNA 3F9NA 3V5JA 3R9RA 2WXVA 3RK7A 3MBLA 3JY0A 3TN8A 3NLBA 4CCBA 3O71A 2W1GA 2H34A 1M17A 1ZOEA 3NZ0A 3RAKA 2B9IA 3TTJA 2PUUA 5FUTA 3F3VA 5JRSA 3MFUA 3RTPA 2OIBA 4JBVA 4IWQA 1H24A 3TCPA 3UJGA 4YJUA 2VX1A 5KMLA 1FVVA 3D4QA 4IXPA 2X8EA 2B4SB 3DAEA 3OC1A 3MY5A 4CKIA 4L68A 4AAAA 4ALWA 3TNHA 4U79A 5HI2A 5LMKA 2GPHA 4EH2A 4X2NA 2DUVA 5JFVA 1JKLA 5A4EA 3Q96A 1JSVA 2WMBA 2B54A 5M09A 5KBRA 2XM9A 1UU9A 5KMMA 4DFBA 1PJKA 3T9TA 3LFSA 3B8RA 2WAJA 1ZOGA 2VWIA 5L8KA 1OGYA 3RPOA 2XIYA 4O2PA 4TYIA 1ZY4A 3QL8A 4IQ6A 3R8PA 4CNHA 4Y5HA 1REJA 4C38A 2C5YA 5HU3A 4KKGA 1IG1A 3OD6X 4RC4A 4FG9A 5E8TA 1KWPA 4BDEA 4FKWA 1STCE 5ETCA 3W2SA 4I3ZA 3LCKA 3NNWA 4EH9A 4AGCA 3NEWA 2FVDA 3OUKA 4QMYA 4OBOA 3NWWA 2VAGA 3F69A 2BAQA 3MSSA 3Q3BA 4BDIA 2ITNA 2R0UA 3A4OX 2OZAA 3G51A 4IZYA 3WI6A 3UVRA 2JIVA 3H10A 4BHNA 2X9FA 3O51A 2XKFA 3NW6A 3GP0A 2RF9A 3W18A 5HTIA 3CY3A 1U5RA 3K5VA 5LCKA 4DEHA 3FLSA 5KKRB 5AM6A 1T46A 4ONAA 5DG5A 3R8VA 4HVSA 5IA4A 4UMUA 2BAJA 3HYHA 3CIKA 3CQUA 4QMOA 3P7AA 4LOQA 1E9HA 4QP6A 1B38A 1SNUA 1OKYA 3FI4A 4HYUA 4IADA 3JPVA 4P4CA 4RJ8A 2YEXA 3IGGA 1Y6AA 3ZDUA 3WIGA 5CS6A 4DH3A 4EOJA 2Y8OA 4F9CA 2WMTA 4GFGA 2VWZA 5CX9A 3N9XA 1QPCA 2W1CA 3F7WA 1G8SA 4RVTA 4PTEA 4I5HA 4BKYA 3OMVA 4DGMA 3PSDA 2VGOA 4M0ZA 3V6RA 4QD6A 4DDGA 3VQHA 4W8EA 5J5SA 4C36A 4FKVA 5TE0A 4D0XA 4F7NA 3ZO4A 3GU6A 3NYXA 3PSCA 4R3CA 2BALA 4XBRA 3CKWA 3Q5ZA 4M7IA 5HBHA 2ZV2A 2BAKA 3DJ6A 2BZKB 3QKKA 2V5QA 1DI8A 2BRMA 2YLEA 4HVIA 3EKNA 4ZJVA 4Y46A 4FV1A 3EN6A 1SVEA 3TXOA 4ZLYA 4WOVA 3ORLA 3MPTA 2UW4A 5DEYA 4D4VA 4Z7GA 4BDAA 5CANA 3BLQA 4QEBA 3PJ8A 2FSTX 4O6EA 4FV6A 2VNWA 2O3PA 1R1WA 3RGFA 4F64A 5HD4A 2HENA 3RPYA 5BPYA 2F57A 2AC3A 5J7BA 4FIGA 1U54B 3O7LD 4CKJA 2XVDA 1UWJA 5ETAA 4K8AA 1W7HA 1XWSA 2JFMA 3DFAA 3FSFA 4G3GA 1Y57A 5J1VA 5AUYA 2QU6A 3E8DA 5IH4A 3LIJA 3W2OA 1G8AA 3R6XA 2QONA 1XHAA 3H9OA 5CU2A 5J9ZA 2YM4A 2AEGA 4MH7A 2VZ6A 2JAMA 5IZFA 4EQCA 5HQ0A 1V0BA 1OZ1A 4NFMA 1R3CA 2YWPA 4EOQA 4F99A 4Y95A 5I9WA 2BRNA 3WE4A 3RHXA 3FUPA 2VWVA 4BKJA 3DU8A 5J5TA 4AFEA 3DBEA 2BILB 4MHAA 3GNIB 3HV5A 1H0WA 4BZOA 3HGKA 1PF8A 3E7OA 4O0VA 3V6SA 3R1SA 3BQCA 2X8DA 3ACJA 1XH6A 2UW0A 4PPBA 5KMKA 1KUTA 4YO4A 1TQMA 3ZSGA 1XR1A 2WGJA 3UTOA 3BKBA 4EK4A 2PPQA 5F94A 2IVUA 1RE8A 3ZM4A 4O7NA 3L1SA 3SXSA 3HA6A 4I6BA 4YZBA 2R5TA 5CNNA 5KMIA 5L8LA 2WQNA 2WMWA 1Q3WA 2ZB1A 1Z57A 1YWRA 2YIQA 3F6XA 2YM5A 3FXXA 3DK6A 4UN0C 3F61A 2VTHA 5DR6A 4U7ZA 1VJYA 2W17A 5AUZA 5JZNA 4EJ7A 3GCVA 3FKLA 3TIZA 4C35A 4JOAA 1U59A 4FL1A 4I21A 1H25A 2XK6A 3ORXA 4QMXA 3R7YA 3DBDA 3EL8A 4OW8A 2P33A 4XP0A 3BEGA 3FHRA 1SYKA 5CU3A 3SAYA 2C6OA 2WTWA 3TEIA 5GJDA 4WNOA 2HY81 4YURA 1Q8UA 4KABA 4RIXA 3RAWA 4CQEA 3LKMA 3C51A 3UDTA 2QLQA 1TZDA 2QR8A 3E5AA 2A98A