2OIGA

Crystal structure of rs21-c6 core segment and dm5ctp complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
b'PFRFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKSDTEPGPQAWPPKERAALQEELSDVLIYLVALAARCHVDLPQAVISKMDTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RS21-C6
publication title Crystal Structure of RS21-C6, Involved in Nucleoside Triphosphate Pyrophosphohydrolysis
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 26
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.12: dCTP diphosphatase.
pdb deposition date 2007-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2oigA00
2P06A 2Q4PA 4QGPA 2GTAA 1YXBA 1YVWA 2A3QA 3CRCA 5IE9A 2YXHA 1Y6XA 2Q9LA 3C90A 2OIEA 2OIGA 2Q5ZA 3CRAA 2Q73A 1VMGA 2A7WA
chains in the Genus database with same CATH superfamily
4KL1A 3BAAA 4QGPA 4WFAV 5EBWC 1Y4MA 4RWUA 3ZEDA 3LNNA 4LF5O 3JD3A 1EN4A 2CGNA 5EYPB 1IXBA 2WLMA 4LF8B 4UV8A 4ZOLB 4DV5O 4JI8B 2AHZA 5L3DA 1BZKA 1IBKB 3UO2A 1QNMA 3QVNA 2EZOA 4LP8A 2E3CA 3G6EV 2Q68A 2ZNJA 4MVMA 1R6KA 1PM9A 4MT8A 2AXTZ 4UB8Z 5IYCO 3DTUB 5JWPA 2GHYA 4JI2O 4RUFA 3ZMSA 1TVKB 2BTQA 3ZHRA 5TISZ 4KXRA 1M1KW 3STLC 3HPLC 1S77D 3AK3A 3PJSK 1Q8IA 2BSKB 3IC9A 1O9GA 1GMGA 3MHHC 4GYCB 2DYSC 5HFLA 2YXHA 1M90W 4P2ZA 3CB2A 2ZE8A 3AG4C 3IC7A 1IZ3A 3APQA 3TK1A 1BT8A 2E5LB 4I9QA 4JAAA 1Q6IA 2UXCO 4X66B 4LFAB 3ZHQA 2YSUB 2X0LA 4J11A 4WFFA 1SQFA 2ZT9B 2HKOA 4GX2A 3RN4A 2IU0A 4KFMA 1XBLA 4X1YA 2BTOA 5JQGB 4LFCO 1H8HG 2XNDG 3QF7A 3EXAA 1UPGA 5JJNB 2Q5ZA 3CRAA 4I55B 3G4SV 1GRJA 3E2EA 1L0LH 3SYOA 4ICGA 3OGIB 4OPAA 4YJ2B 1VP7A 1AJQA 2QSAA 1SA0B 4DUZO 1LUWA 3O9OA 2EINC 4G28B 4DYLA 4D6TH 1AJPA 2JS5A 3ZHVA 1PNMA 1P7BA 4PD4F 1UJWB 2ZDIA 1EBOA 5C93A 5KHGA 2H3OA 3HR0A 4BAYA 2PGGA 3P3PA 5EIBC 4RQEA 3DXRB 3RFRA 1FFTB 5IYDO 5IYBO 1JA8A 5IE9A 2VWJA 2HEPA 3L74H 3UCSC 2OYQA 4F6EA 1AR1B 1R3JC 2GTSA 2ZE5A 2VQFB 4NYKA 2VRZA 4LWSA 2R9IA 4G27B 4W4KA 3SYPA 1SQGA 3MD0A 2EJRA 2W0FC 1Q6HA 1YXBA 3CCLV 2XAQA 1K5QA 4LBEC 3JCZA 5KAIZ 3HKBA 5B1BC 1M5IA 4HNAB 3MDSA 1G1XB 4EEQA 4LF7O 4DR3O 3LDDA 5IYZB 3U0ZA 3BY6A 4NXMO 4ZHQA 3ABUA 1S76D 4I5SA 4PHZA 2FTKA 3I55V 2RJZA 1Q5OA 2CTWA 1SZXA 2E74B 1V9PA 4DR1O 4LNUA 4ZKIA 3J81N 1MABG 3SPIA 4B3MO 2Q0OC 4MTOA 2WA3A 3AG2C 3DC6A 2M6YA 1DF4A 3S3XA 2QM8A 3K08A 3OE7G 2A06H 1R6TA 1NT2B 3C90A 1H2SB 3W7WA 3BABA 4YIPA 3K9SA 4JI6B 2DYSB 3AEIA 4GKJB 4TWKA 2XUMA 4FFBA 3UQ8A 1PL4A 1RPRA 3AG4B 1WN7A 2JGDB 4X9QA 1BCCH 1NVPD 2XT9A 1R3KC 3DGEA 5IJ0A 5CA0A 4DV0B 1NKDA 3B40A 2RDCA 5H9CA 3W7XA 1HR0O 2YEVB 3L73H 2WWWA 4TOIA 3T1YB 1A32A 5IY5B 3A0RA 2EIKC 1RM1C 5EIBD 5E1AC 5H6QA 4UV9A 1OCOC 3TETA 3K57A 2H94A 2IBZH 3AK1A 1VQ5V 4UFZA 2HR3A 5IT9N 3K5MA 2ZR2A 3D8CA 4NXNO 1OCCB 2EINB 2YDEA 3SYQA 4HAMA 4PDVA 4O4IB 3PN1A 1SQBH 2PYLA 1YF2A 5ITZA 4JI7B 2R9RB 3BRCA 3OUFA 1GH6A 5C8YA 2RQ6A 3LDEA 2IH1C 1GO3F 1XNRO 4MTFA 3FFQA 3UKMA 4JASA 3TCUA 1F23A 1K33A 2HHHO 3MHSC 1H8EG 5B3SC 3K04A 2LFSA 3VQYA 4JI0B 2F4VB 1XMOB 1S3JA 1WLEA 1JQ0A 1XILA 4JTDB 3CCMV 3FKSG 4I0XB 2FYUH 2JEXA 1THZA 3VBBA 1BSMA 4DUZB 2F95B 1M56C 3N2GA 2JRIA 3RYHB 2ADPA 2DYRC 4BWAA 1AR4A 2CTPA 5LA6A 3JAMN 5LXTB 2AGAA 4TV8A 4X64B 4JYBA 2DWEC 3JAWB 1YHQV 4I50B 1L1FA 3CYOA 4Z1VA 5IJ9B 4DRXB 1JJOA 4DR4B 1FD9A 4JI8O 4F4LA 1AI7A 4CS2A 2EIJC 3IAYA 1OHHG 1RSOA 1PV0A 4GCZA 3WG7C 1VQNV 2Q73A 3T1CA 4DR7B 3QNEA 4U3JA 1PPJH 3BA8A 5LL6Y 4JI3O 3A8TA 1QR8A 4R50A 3CCRV 3R65A 2YI8A 1URFA 5A9GA 1IBLB 3AG2B 1N4CA 1QU7A 4R6ZA 4TUYB 4TQDA 3JAKA 4YJ3B 4IHJA 4PA3A 4I9WA 2YXYA 4EFBA 4ZI7A 1CP9A 1JPXA 2OT5A 2E5LO 1XHXA 1EZVH 1HP8A 1GN6A 4LF7B 1YI2V 4UVBA 5KAFZ 4X66O 4O4HB 3HKCA 4WBNA 3JYCA 2GDSA 1Q6UA 1WAZA 3B77A 4GX5A 1IX9A 1NR1A 1FPOA 1SC5B 4U3FH 2IH3C 4BW9A 3LNMB 4DUYO 3ZN0A 5CBHA 3T2MA 1SQPH 1K92A 1ENVA 1KMIZ 1AILA 4X62O 3X2QC 5LP6A 2XAGA 1Y6XA 3EHBB 2O57A 5KHHA 3G71V 4Z1MG 3CP1A 1VQPV 4O2AA 4D7TA 2EIKB 2ZE7A 1RM1B 2D3OW 1FXHA 2OCCC 1O9HA 1P84F 4JF3A 4MTXA 4K35A 1OCOB 1H2MA 1WPBA 1PL0A 3ZMZA 1ROPA 3P32A 1IXMA 4O4LB 1WA8B 1NZ6A 4FLUA 3OD4A 3QG5A 4X20B 1UFIA 4LF6B 1Q81W 1M93A 2KB1A 1OZ0A 4FLXA 5J2UB 1BQ0A 2P22C 3OT7A 3SJQC 2L35A 1ZL8B 4MW8A 2RNBA 5B3SB 1I0HA 3H1JH 2X6CA 1QVGU 2FL4A 2ZINA 4FLYA 5J2TA 1F51A 3CJHB 4JTAB 3JASA 1V54B 1VQ8V 1GAXA 4FIPC 3VQWA 1JCHA 5DECA 5KX5B 1GN3A 4RAIA 4DK1A 5CA1B 1T5EA 4PI0A 1IVSA 3ASOC 2F66C 1NBMG 4WCEV 4MVSA 2DWDC 3JARB 2DYRB 1NU1H 3AK2A 2RMKB 1YJ9V 2Y4UA 5LHIA 4LFBO 2WLHA 4IIJA 1IDSA 3FAVB 4JI4O 5DM6V 3CRQA 2EIJB 2UXNA 3CMEV 3LSSA 1QLNA 3UO3A 2EILC 5CB4B 1DGSA 1JOYA 2GUZA 5LOVB 1K7DA 2PY5A 3ZHUA 3E8HA 3CPWU 3U11A 4K8XA 1S72V 4DV6B 2GV9A 4J80A 3SYCA 1AB3A 4NTWA 3QO8A 3TXSA 2A7WA 1J5EB 1TUBB 2EBOA 2Q7GA 3E8GA 3BFRA 3RYFA 2JDIG 3QTCA 4FK5C 1EN6A 3CCJV 4JI6O 5H2FZ 3SPCA 2CGOA 1Q3EA 4GKJO 1KECA 3K5OA 2B1IA 2ZIMA 3D3QA 4JI1B 4OX9B 1BHBA 3UT5B 2Y0PA 3T4DA 3CSXA 3ABKB 1HNZO 1FJGB 4DV0O 2RN9A 4UVAA 4TT3G 2P5OA 3BPZA 3ZBHA 4CC6A 3CCUV 3GWOA 2JK5C 1R1BA 2ZKOA 3ZMTA 1SZTA 2V4DA 2W6IG 3T1YO 3JSNA 1SQVH 4JI3B 3I5DA 2ZNIA 2JJ1G 2CTRA 3X2QB 1Q43A 2JS3A 2Q8VA 4O2BB 2OCCB 3JATB 4RQFA 4WF9V 1KKDA 4X1KA 4X1IB 1EFRG 3OR6C 1ZTEA 2QEXV 5IYZA 1CXZB 3ML0A 4JAVA 5EK0A 4JI7O 3ICXA 2QA4V 1B06A 4JYYA 4UXNA 2P7TC 1KB9F 5IWAB 2JEUA 3EVKA 1U96A 3K9AA 4GX0A 1BL8A 4U7NA 2GTAA 3FYEB 4HYOA 5EZYA 5LGNA 1VIBA 4JI0O 2F4VO 1W0KG 5BR8B 4KP4A 1XMOO 3ZRWB 4DUYB 5H6RA 3G6BA 4L8JA 2FMLA 2ZDIC 5BXZA 5LMUO 3E22B 2QDOA 4X62B 1TA8A 1OV9A 5LYJB 1K8AW 5BMVA 5DEDA 5JVDB 5KUKA 1F4MA 2OTLV 3BHPA 5GONA 2OTJV 4X88A 2ILMA 1N36B 2IM9A 2QKCA 2HVJC 5CN0A 3LSQA 4X65B 3JALA 4W4LA 1HNWB 2LO1A 1WNSA 1MZEA 4EB6A 2NR5A 3ASOB 4X64O 2WLLB 2CK3G 1DF5A 5CMUA 1Y74B 1Y76B 1DTOA 4DR4O 4JI5B 1K4CC 3W7SA 1FFXB 1EN5A 2LW1A 1H38A 2OWOA 4MVUA 1K9MW 2HP8A 2DQ3A 1V55C 3RYIA 5L3BA 1DK1A 4O4JA 4DR7O 4CC5A 4TSFG 5JH7B 2P6JA 3KCYA 4PI2A 2F93B 1YIJV 3GVMA 1J95A 1JFFB 2VQEB 5KHJA 3K5NA 3ZRVA 2BCCH 3OUSA 4GX1A 2Y4TA 2A9HA 1Z2GA 3BEHA 5FL7G 2NLJC 4XDKA 2ZM6B 3U10A 2UUCB 1IBLO 2QTOA 1N8RW 3L70H 2NN4A 5LBQA 4R7CA 3UM7A 1AP6A 1S5JA 3JSLA 2Q7EA 2LFRA 4H44B 1H2GA 3H9VA 3K3WA 1BHAA 5GTHZ 1F4NA 4EKWA 4ZIBA 1BMFG 4CH4A 3G67A 5CBGA 4LFBB 1R6NA 3ZHSA 4JI4B 1I5YA 1KKCA 2BTQB 1I08A 4CS4A 3NR7A 1VF5B 3KCXA 1XL6A 2P67A 1YCIA 5KHKA 3OTOB 4H0LB 2XAFA 1N34O 2JJ2G 1HW7A 4J41A 1KC8W 2X6AA 1I94B 5FPOA 4X89A 4P9PA 2JVDA 1ZX3A 4H13B 3RYHA 1B6QA 4PELA 4H33A 1TAEA 1B04A 3CWBH 2YIBA 3ABTA 2XOKG 1I7FA 3R66A 3D3IA 3E35A 2OIGA 3JAWA 2D2CB 2Q69A 1NI8A 4B3RB 2ZQMA 3OMIB 4X1YB 4R8CA 2QR4A 4LF6O 1H2LA 2JIZG 3ZHTA 1SS3A 4B7EA 2YIDA 3H01A 1PP9H 1HNZB 4J42A 5LHHA 3HKDA 1NH2D 5K1XA 4GT1A 4I4TA 3OEHG 3DC5A 4LF9B 3H1HH 3ZJZA 4Q20A 1XQ8A 3RBZA 4FLZA 4TUYA 4B3SO 5B1NA 1XMQB 5FNVA 4FJCC 2WAMA 4HBNA 3CCSV 5JCOA 2LGQA 1NVPB 1SESA 2CE4A 4A5UB 4DV7B 1Q7YW 4PA9A 1BS3A 2CTQA 3JD0A 4MVQA 1QBZA 1JVMA 2PF4E 3N2KA 3E86A 4TV9A 4YY3B 4MW3A 5AG2A 1NTZH 2V7QG 3SPGA 5B5EZ 2UU9O 1N33B 1NTMH 2WLJA 4J9ZB 4BIZA 2M7WA 3E89A 4QPKA 1K73W 1V55B 2R9AA 4UCTA 3CS5A 5KA6A 2MW2B 2ZD9A 1E1RG 2ITCC 4DV3B 3B4SA 3IGAC 3HKBB 3SR2C 2LW7A 4AQYB 4DV6O 3HKEA 5LMNO 5LMUB 5GTIZ 2PI4A 4J10A 3ETDA 1J5EO 2JGUA 2VWKA 2GSMB 4U7OA 1XNQO 2G38A 4JGSA 4FM2A 3L72H 4QPJA 3J80N 1S0VA 2A79B 3H1KH 2QKAA 3ZCCA 1XHZA 5B1BB 3RW0A 5EBMC 4F6RA 3C3SA 1H2KA 3RYCB 4LR3A 1P7GA 4JI1O 4OX9O 1ZL8A 4MVZA 2DW4A 1FJGO 2Z5UA 4PA7A 3T1HB 5JJJB 4FFKA 3TXQA 1ORQC 3BCCH 3OAAG 4BR6A 3OR7C 1L8DA 1Z5VA 1BQZA 1JX9A 4LH7A 4DV4B 3N27A 4J7ZA 4PDLA 4FLTA 2Q0AA 3FB8C 5CA1A 4FFBB 2QE7G 3Q4HA 4JZ2A 3ETQA 4K8ZA 2AW9A 4ABMA 4WFEA 5L3GA 4FZ0A 1GM9A 3ZMVA 5IJ0B 5CA0B 3ZN1A 1Q86W 2P90A 4NVPA 4Z2WA 2Q67A 2KG7A 4HZ3A 3H1IH 4TQFA 2X7RB 5IWAO 1VARA 1FXKA 3G80A 5KMGB 1L0NH 4FVMA 1K4DC 3ZRSA 5LOVA 5J9PC 4UCRA 4OXSA 2YS8A 5BR8O 2KQXA 4DW1A 4MS2A 1QVFU 1VQ9V 1XL4A 4OGQB 4P9OA 3FB6C 4CZZA 1N34B 1Y66A 1MOFA 4NB5A 4OPHA 1DLBA 5ITZB 3K58A 2WLIB 1N36O 2F1MA 1B3QA 3KG2A 5C8YB 3ZS8C 4X65O 5EBLC 1HNWO 1Q90D 4JTCB 4JYAB 1NTKH 4YHHB 3CEIA 5F2VO 5EYPA 4ZOLA 1AJNA 2XAJA 4JI5O 1CEZA 2NNUA 3AG1C 5CBFA 2H8PC 1XREA 4GUNA 3E8BA 1YITV 1YJNV 4FLVA 4I7ZB 1WP7A 2WLNA 4JV5B 1G8MA 1ZLZA 2UUBB 4GKKB 1VEWA 2CAZC 3SPJA 3STZC 3M8AA 5B66Z 2VQEO 2A0LA 3N2GB 1TVKA 1AI4A 4PV1B 1X4TA 2ADQB 1COWG 2V1DA 3QO7A 3ABLC 1H2NA 1OCZC 3JATA 4PDMA 4X1IA 5LA6B 5CA3A 2ZM6O 2UUCO 2BSKA 4LH6A 4B3SB 4TV8B 1E1QG 3ASNC 2N05A 3JCUZ 3LUTB 1VQOV 3CXHF 1HNXB 3E83A 1RSOB 3VQXA 2B1GA 1M56B 1M4UA 5LHGA 1AP5A 4DK0A 3IJ4A 4U3JB 3CC4V 1XDCA 4J7KA 4PJ0Z 2CDYA 3ZIAG 5JQGA 3S3WA 2UU9B 1YZBA 1K97A 1EZJA 1BE3H 2GBOA 3FB7C 2N74A 4QE9A 3KZIZ 3WG7B 4MTGA 3FD9A 2YIAA 3E22A 4I55A 2WSSG 3CRRA 3OTOO 4PA6A 2WLKA 3FB5C 4KHPB 4YJ2A 1R3IC 3ZMUA 3A0BZ 3W7UA 1I94O 3D36A 1SA0A 3WB1A 1K34A 4ZI7B 5LMNB 4IGGA 3SJAC 3VOUA 1VF6A 3HKCB 1N32B 4WBNB 2ETNA 1XNQB 3DSQA 1GM8A 5BZBA 2UXBB 3SJBC 3C3TA 1OCRC 4B3RO 2ZIOA 3SGIA 1FFXA 3DXRA 4DV1B 2CH7B 2IJHA 1Q82W 1N0NA 1KP3A 4DR6B 4J7JA 3OGCC 1JFFA 2HJFC 4CH3A 3QO5A 1JMKC 5B1AC 4O2AB 1R3LC 4LF9O 2LP7A 3APOA 2OIEA 5LGTA 1WB7A 4BIUA 4FLWA 4ASUG 1XMQO 5LGUA 4B7KA 4IYIA 2ATKC 4HNAA 5IDJA 4NTXA 4DV7O 2UXDB 3M99B 3O65A 3B8MA 4CS3A 2A3QA 2WA4A 2CUGA 3VQVA 1IURA 2EULA 5KHIA 2UUAB 1VQ7V 1Y67A 4YY3O 1TUEB 2BE3A 1E79G 1LNQA 5DN6G 3M7MX 4IYHA 5J2TB 1KD1W 1N33O 2QM4A 4P30A 2ZXWC 4K0KO 2KKWA 3AG1B 2QWRB 3CMAV 3JASB 4N23A 1BGYH 2HFEC 3CRMA 4LF4O 2IJKA 4KUMA 4DV3O 4B3TB 4LC1A 1AI5A 3P30A 2EIMC 4AQYO 1FS0G 5D5QA 2QGNA 3K59A 3WB0A 4CH5A 3ABLB 1OCZB 1SKVA 3ASNB 3CE2A 4IIJB 3RWRD 4QNHB 3CC7V 2PUSA 2E76B 2XHBA 2AZ0A 1D5NA 1VF7A 1AR5A 5IY5C 1ZUQA 1YSCA 2JGDA 1WB8A 1SF9A 1WP8A 4UB6Z 5EC1C 1FAFA 2GUZB 2RCVA 3WB2A 5KLVH 2DJVA 4NTYA 3RVZA 3T1HO 2KSDA 1OCCC 2YEVA 1KUQA 3SDLA 4ZBMA 2K9PA 3JD2A 1PNKA 3RGBA 4IT5A 1HDJA 4DV4O 2XTAA 3RYFB 2EILB 1FYJA 1VMGA 4XDJA 5GW7A 1YDXA 3A2FA 2Y0IA 2YUAA 3WU2Z 2IW5A 3OMAB 4O4IA 2HJDA 2YXLA 3L75H 4XBFA 2ODMA 4H37A 4K3AA 4NKGB 1OCRB 3F5TA 3B8NA 1US6A 1MSDA 1QCEA 2W6JG 2K1EA 4EFEA 1SRYA 4XDLA 1IBMO 4DR5B 1GKFA 2QM7A 5HFMA 4DR2B 3CRCA 4DV2O 3OW2U 1KP2A 2Q9LA 1QQCA 5B1AB 1Z5WA 1JJ2U 4I0XA 3ABMC 2ARHA 5L3EA 3F7YC 4X1KB 4MVRA 3HB3B 3AG3C 2LGWA 1M57C 3FYIB 3JD4A 3B2EE 2Y48A 5LXTA 2YI9A 4IL6Z 3RYCA 4JYAO 5B1OA 4BIOA 4YHHO 1SERA 4I50A 5H5NA 5EC2C 5IJ9A 2DN9A 4DRXA 2R72A 1QHTA 5EZYB 4PA4A 1MZFA 4DXWA 1G4YB 3OM3B 2Q4PA 1RPOA 2C2AA 3TGUH 2ZCEA 5BMVB 2ZXWB 4JV5O 3BVOA 5JCOC 2UUBO 4GKKO 2ZR3A 5GONB 2AZ2A 3JALB 4UVCA 4LF5B 2Q6AA 4EB6B 3A0HZ 2EIMB 1XUQA 1SQXH 1KU9A 4YJ3A 4DV5B 2B5UA 2HVKC 1W2BU 1HNXO 4FM1A 1NH2B 4RUEA 2PYJA 3TJTA 2UXXA 4MVOA 1HWYA 4QJFB 2PTMA 4FMTA 1M9NA 3RYIB 3F5WC 4O4HA 4O4JB 3SPHA 5KMGA 3RT3C 4AHCA 1AROP 4DO2A 4JI2B 4LWSB 3H1LH 2PZSA 2IJIA 3IFXA 3L9DA 1NQTA 3K0GA 3AG7A 3ETGA 4K0KB 3L71H 4WFGA 2AHYA 2W0XA 2XAHA 5KA5A 4LF4B 4KHPO 4QIWF 4J9YB 1GN2A 3GB7C 5FLXN 3EFFK 4Q6GA 2WLIA 1KBHA 2Z3YA 1JR9A 4FPPA 4LCUC 4RO2A 2UXCB 1ZWIC 2QWOB 2L6LA 2E75B 3ETEA 1LUVA 1N32O 4AILC 5BY1A 5D5PA 1WPXA 4O4LA 4ZHQB 4CH6A 1WA8A 2Y69C 2UXBO 1S5LZ 1CPYA 1FXVA 1VQMV 1MNGA 4X20A 2EJ7A 2YIBD 4LFCB 1FKAO 1W59A 4DV1O 1AVMA 3RVYA 1QLEC 4GLXA 1V54C 3CD6V 1I5XA 2ITDC 5J2UA 1SQQH 3K0DA 3E8FA 4DW0A 2VS0A 4LNUB 4DR6O 3K03A 1SETA 4C7UA 1P49A 4D7SA 4CBCA 4UCSA 2DOSA 3SYAA 1ZAUA 3CJHA 4UCUA 3ABMB 3P3NA 1AI6A 1F7YA 1X59A 2F43G 3CX5F 4LF8O 1LR1A 5KX5A 2DQ0A 2R70A 2B9ZA 3J7AU 3AG3B 1M57B 2OCHA 1IBKO 2EZPA 1FXKC 1RFYA 3ZX6A 1MSWD 2UXDO 3JARA 5A2QN 1VQ4V 1D5AA 4B08A 3HKDB 2UUAO 4I4TB 1VQLV 3FAVA 2F23A 2YC0A 3K06A 2QWNB 1YEWA 5LP6C 2LQTA 1IBMB 5CB4A 3WFVA 4QE7A 5FNVB 2YICA 4DV2B 3CC2V 1TGOA 3W7TA 2P4KA 4B3TO 5KUMA 2P06A 1PNLA 1ZSPA 1P4RA 4NR1A 2QWQB 3OFNG 1YVWA 3LDCA 1TUBA 4DR3B 3KKYA 1MG1A 3ABKC 1OJHA 4WFBV 3BA9A 4YXWG 4LFAO 5E79Z 1EM1A 4NXMB 3N2KB 4TV9B 2BOBC 3SJCC 2Z0AA 4E2LA 4JAUA 3NXSA 1N0JA 2CH7A 2IU3A 2N04A 3FX7A 2XASA 1VQ6V 2WPDG 1PKXA 3UT5A 4DR1B 2QTSA 1U97A 4B3MB 3CHXA 1GN4A 4PDRA 5L3CA 3HKEB 3OTFA 1XEQA 3OEEG 5L3FA 1NS1A 4JYCA 1XI1A 2QJ1A 4N21A 2PI5A 4O2BA 4F6RB 3OMNB 2DMXA 3CCQV 2QKSA 1WJZA 1K5SA 4UCOA 1NJIW 2VQFO 1HR0B 2Y69B 1S5HC 4BW5A 2FKXA 4FM0A 5FPRA 1QLEB 4UCVA 3D36C 4JZGA 4DR5O 4DR2O 5K1PA 3ZRWA 4AI8A 1KQSU 3T4ZA 3F7VC 4G2KA 4E4EA 4NXNB 1W0JG 3Q4HB 1VF6C 1G6UA 1YTFD 4WFHA 1KYOF 5LYJA 2ZE6A 3K79A 4FZ1A 3K5LA 3JAKB 1VQKV 5JVDA 4IHJB 1MMMA 2FB5A 1XOUA 1MA1A 1GTOA 3ZRXA 1PD3A 4L87A 2KG7B 3GWKC 4UUJC 1XNRB 1GK9A 1K3EA 2QWPB 1FXKB 2HHHB 2WLLA 4YIOA 3CCEV 2DE0X 1Y74A 1RP3B 3CCVV 1YTFB 1Y76A 2BOCC 2IJJA 2LJ2A 4JPRA 1YJWV 3B09A 3I56V 1NR7A 1QR9A 2Q7HA 3THOA 5JJEB 2HG5C 3LSUA 3CXCU 4GZRB 1R73A 2MK3A 4MSWC 3MAQA 1GM7A 2X6BA 2HLDG 5JH7A 1D2DA 2P4VA 4X8AA 2EX3A 3JD1A 5LP6B
chains in the Genus database with same CATH topology
2P06A 2Q4PA 4QGPA 2GTAA 1YXBA 1YVWA 2A3QA 3CRCA 5IE9A 2YXHA 1Y6XA 2Q9LA 3C90A 2OIEA 2OIGA 2Q5ZA 3CRAA 2Q73A 1VMGA 2A7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P06 A;  2Q4P A;  4QGP A;  2GTA A;  1YXB A;  1YVW A;  2A3Q A;  3CRC A;  5IE9 A;  2YXH A;  1Y6X A;  2Q9L A;  3C90 A;  2OIE A;  2OIG A;  2Q5Z A;  3CRA A;  2Q73 A;  1VMG A;  2A7W A; 
#chains in the Genus database with same CATH topology
 4KL1 A;  3BAA A;  4QGP A;  4WFA V;  5EBW C;  1Y4M A;  4RWU A;  3ZED A;  3LNN A;  4LF5 O;  3JD3 A;  1EN4 A;  2CGN A;  5EYP B;  1IXB A;  2WLM A;  4LF8 B;  4UV8 A;  4ZOL B;  4DV5 O;  4JI8 B;  2AHZ A;  5L3D A;  1BZK A;  1IBK B;  3UO2 A;  1QNM A;  3QVN A;  2EZO A;  4LP8 A;  2E3C A;  3G6E V;  2Q68 A;  2ZNJ A;  4MVM A;  1R6K A;  1PM9 A;  4MT8 A;  2AXT Z;  4UB8 Z;  5IYC O;  3DTU B;  5JWP A;  2GHY A;  4JI2 O;  4RUF A;  3ZMS A;  1TVK B;  2BTQ A;  3ZHR A;  5TIS Z;  4KXR A;  1M1K W;  3STL C;  3HPL C;  1S77 D;  3AK3 A;  3PJS K;  1Q8I A;  2BSK B;  3IC9 A;  1O9G A;  1GMG A;  3MHH C;  4GYC B;  2DYS C;  5HFL A;  2YXH A;  1M90 W;  4P2Z A;  3CB2 A;  2ZE8 A;  3AG4 C;  3IC7 A;  1IZ3 A;  3APQ A;  3TK1 A;  1BT8 A;  2E5L B;  4I9Q A;  4JAA A;  1Q6I A;  2UXC O;  4X66 B;  4LFA B;  3ZHQ A;  2YSU B;  2X0L A;  4J11 A;  4WFF A;  1SQF A;  2ZT9 B;  2HKO A;  4GX2 A;  3RN4 A;  2IU0 A;  4KFM A;  1XBL A;  4X1Y A;  2BTO A;  5JQG B;  4LFC O;  1H8H G;  2XND G;  3QF7 A;  3EXA A;  1UPG A;  5JJN B;  2Q5Z A;  3CRA A;  4I55 B;  3G4S V;  1GRJ A;  3E2E A;  1L0L H;  3SYO A;  4ICG A;  3OGI B;  4OPA A;  4YJ2 B;  1VP7 A;  1AJQ A;  2QSA A;  1SA0 B;  4DUZ O;  1LUW A;  3O9O A;  2EIN C;  4G28 B;  4DYL A;  4D6T H;  1AJP A;  2JS5 A;  3ZHV A;  1PNM A;  1P7B A;  4PD4 F;  1UJW B;  2ZDI A;  1EBO A;  5C93 A;  5KHG A;  2H3O A;  3HR0 A;  4BAY A;  2PGG A;  3P3P A;  5EIB C;  4RQE A;  3DXR B;  3RFR A;  1FFT B;  5IYD O;  5IYB O;  1JA8 A;  5IE9 A;  2VWJ A;  2HEP A;  3L74 H;  3UCS C;  2OYQ A;  4F6E A;  1AR1 B;  1R3J C;  2GTS A;  2ZE5 A;  2VQF B;  4NYK A;  2VRZ A;  4LWS A;  2R9I A;  4G27 B;  4W4K A;  3SYP A;  1SQG A;  3MD0 A;  2EJR A;  2W0F C;  1Q6H A;  1YXB A;  3CCL V;  2XAQ A;  1K5Q A;  4LBE C;  3JCZ A;  5KAI Z;  3HKB A;  5B1B C;  1M5I A;  4HNA B;  3MDS A;  1G1X B;  4EEQ A;  4LF7 O;  4DR3 O;  3LDD A;  5IYZ B;  3U0Z A;  3BY6 A;  4NXM O;  4ZHQ A;  3ABU A;  1S76 D;  4I5S A;  4PHZ A;  2FTK A;  3I55 V;  2RJZ A;  1Q5O A;  2CTW A;  1SZX A;  2E74 B;  1V9P A;  4DR1 O;  4LNU A;  4ZKI A;  3J81 N;  1MAB G;  3SPI A;  4B3M O;  2Q0O C;  4MTO A;  2WA3 A;  3AG2 C;  3DC6 A;  2M6Y A;  1DF4 A;  3S3X A;  2QM8 A;  3K08 A;  3OE7 G;  2A06 H;  1R6T A;  1NT2 B;  3C90 A;  1H2S B;  3W7W A;  3BAB A;  4YIP A;  3K9S A;  4JI6 B;  2DYS B;  3AEI A;  4GKJ B;  4TWK A;  2XUM A;  4FFB A;  3UQ8 A;  1PL4 A;  1RPR A;  3AG4 B;  1WN7 A;  2JGD B;  4X9Q A;  1BCC H;  1NVP D;  2XT9 A;  1R3K C;  3DGE A;  5IJ0 A;  5CA0 A;  4DV0 B;  1NKD A;  3B40 A;  2RDC A;  5H9C A;  3W7X A;  1HR0 O;  2YEV B;  3L73 H;  2WWW A;  4TOI A;  3T1Y B;  1A32 A;  5IY5 B;  3A0R A;  2EIK C;  1RM1 C;  5EIB D;  5E1A C;  5H6Q A;  4UV9 A;  1OCO C;  3TET A;  3K57 A;  2H94 A;  2IBZ H;  3AK1 A;  1VQ5 V;  4UFZ A;  2HR3 A;  5IT9 N;  3K5M A;  2ZR2 A;  3D8C A;  4NXN O;  1OCC B;  2EIN B;  2YDE A;  3SYQ A;  4HAM A;  4PDV A;  4O4I B;  3PN1 A;  1SQB H;  2PYL A;  1YF2 A;  5ITZ A;  4JI7 B;  2R9R B;  3BRC A;  3OUF A;  1GH6 A;  5C8Y A;  2RQ6 A;  3LDE A;  2IH1 C;  1GO3 F;  1XNR O;  4MTF A;  3FFQ A;  3UKM A;  4JAS A;  3TCU A;  1F23 A;  1K33 A;  2HHH O;  3MHS C;  1H8E G;  5B3S C;  3K04 A;  2LFS A;  3VQY A;  4JI0 B;  2F4V B;  1XMO B;  1S3J A;  1WLE A;  1JQ0 A;  1XIL A;  4JTD B;  3CCM V;  3FKS G;  4I0X B;  2FYU H;  2JEX A;  1THZ A;  3VBB A;  1BSM A;  4DUZ B;  2F95 B;  1M56 C;  3N2G A;  2JRI A;  3RYH B;  2ADP A;  2DYR C;  4BWA A;  1AR4 A;  2CTP A;  5LA6 A;  3JAM N;  5LXT B;  2AGA A;  4TV8 A;  4X64 B;  4JYB A;  2DWE C;  3JAW B;  1YHQ V;  4I50 B;  1L1F A;  3CYO A;  4Z1V A;  5IJ9 B;  4DRX B;  1JJO A;  4DR4 B;  1FD9 A;  4JI8 O;  4F4L A;  1AI7 A;  4CS2 A;  2EIJ C;  3IAY A;  1OHH G;  1RSO A;  1PV0 A;  4GCZ A;  3WG7 C;  1VQN V;  2Q73 A;  3T1C A;  4DR7 B;  3QNE A;  4U3J A;  1PPJ H;  3BA8 A;  5LL6 Y;  4JI3 O;  3A8T A;  1QR8 A;  4R50 A;  3CCR V;  3R65 A;  2YI8 A;  1URF A;  5A9G A;  1IBL B;  3AG2 B;  1N4C A;  1QU7 A;  4R6Z A;  4TUY B;  4TQD A;  3JAK A;  4YJ3 B;  4IHJ A;  4PA3 A;  4I9W A;  2YXY A;  4EFB A;  4ZI7 A;  1CP9 A;  1JPX A;  2OT5 A;  2E5L O;  1XHX A;  1EZV H;  1HP8 A;  1GN6 A;  4LF7 B;  1YI2 V;  4UVB A;  5KAF Z;  4X66 O;  4O4H B;  3HKC A;  4WBN A;  3JYC A;  2GDS A;  1Q6U A;  1WAZ A;  3B77 A;  4GX5 A;  1IX9 A;  1NR1 A;  1FPO A;  1SC5 B;  4U3F H;  2IH3 C;  4BW9 A;  3LNM B;  4DUY O;  3ZN0 A;  5CBH A;  3T2M A;  1SQP H;  1K92 A;  1ENV A;  1KMI Z;  1AIL A;  4X62 O;  3X2Q C;  5LP6 A;  2XAG A;  1Y6X A;  3EHB B;  2O57 A;  5KHH A;  3G71 V;  4Z1M G;  3CP1 A;  1VQP V;  4O2A A;  4D7T A;  2EIK B;  2ZE7 A;  1RM1 B;  2D3O W;  1FXH A;  2OCC C;  1O9H A;  1P84 F;  4JF3 A;  4MTX A;  4K35 A;  1OCO B;  1H2M A;  1WPB A;  1PL0 A;  3ZMZ A;  1ROP A;  3P32 A;  1IXM A;  4O4L B;  1WA8 B;  1NZ6 A;  4FLU A;  3OD4 A;  3QG5 A;  4X20 B;  1UFI A;  4LF6 B;  1Q81 W;  1M93 A;  2KB1 A;  1OZ0 A;  4FLX A;  5J2U B;  1BQ0 A;  2P22 C;  3OT7 A;  3SJQ C;  2L35 A;  1ZL8 B;  4MW8 A;  2RNB A;  5B3S B;  1I0H A;  3H1J H;  2X6C A;  1QVG U;  2FL4 A;  2ZIN A;  4FLY A;  5J2T A;  1F51 A;  3CJH B;  4JTA B;  3JAS A;  1V54 B;  1VQ8 V;  1GAX A;  4FIP C;  3VQW A;  1JCH A;  5DEC A;  5KX5 B;  1GN3 A;  4RAI A;  4DK1 A;  5CA1 B;  1T5E A;  4PI0 A;  1IVS A;  3ASO C;  2F66 C;  1NBM G;  4WCE V;  4MVS A;  2DWD C;  3JAR B;  2DYR B;  1NU1 H;  3AK2 A;  2RMK B;  1YJ9 V;  2Y4U A;  5LHI A;  4LFB O;  2WLH A;  4IIJ A;  1IDS A;  3FAV B;  4JI4 O;  5DM6 V;  3CRQ A;  2EIJ B;  2UXN A;  3CME V;  3LSS A;  1QLN A;  3UO3 A;  2EIL C;  5CB4 B;  1DGS A;  1JOY A;  2GUZ A;  5LOV B;  1K7D A;  2PY5 A;  3ZHU A;  3E8H A;  3CPW U;  3U11 A;  4K8X A;  1S72 V;  4DV6 B;  2GV9 A;  4J80 A;  3SYC A;  1AB3 A;  4NTW A;  3QO8 A;  3TXS A;  2A7W A;  1J5E B;  1TUB B;  2EBO A;  2Q7G A;  3E8G A;  3BFR A;  3RYF A;  2JDI G;  3QTC A;  4FK5 C;  1EN6 A;  3CCJ V;  4JI6 O;  5H2F Z;  3SPC A;  2CGO A;  1Q3E A;  4GKJ O;  1KEC A;  3K5O A;  2B1I A;  2ZIM A;  3D3Q A;  4JI1 B;  4OX9 B;  1BHB A;  3UT5 B;  2Y0P A;  3T4D A;  3CSX A;  3ABK B;  1HNZ O;  1FJG B;  4DV0 O;  2RN9 A;  4UVA A;  4TT3 G;  2P5O A;  3BPZ A;  3ZBH A;  4CC6 A;  3CCU V;  3GWO A;  2JK5 C;  1R1B A;  2ZKO A;  3ZMT A;  1SZT A;  2V4D A;  2W6I G;  3T1Y O;  3JSN A;  1SQV H;  4JI3 B;  3I5D A;  2ZNI A;  2JJ1 G;  2CTR A;  3X2Q B;  1Q43 A;  2JS3 A;  2Q8V A;  4O2B B;  2OCC B;  3JAT B;  4RQF A;  4WF9 V;  1KKD A;  4X1K A;  4X1I B;  1EFR G;  3OR6 C;  1ZTE A;  2QEX V;  5IYZ A;  1CXZ B;  3ML0 A;  4JAV A;  5EK0 A;  4JI7 O;  3ICX A;  2QA4 V;  1B06 A;  4JYY A;  4UXN A;  2P7T C;  1KB9 F;  5IWA B;  2JEU A;  3EVK A;  1U96 A;  3K9A A;  4GX0 A;  1BL8 A;  4U7N A;  2GTA A;  3FYE B;  4HYO A;  5EZY A;  5LGN A;  1VIB A;  4JI0 O;  2F4V O;  1W0K G;  5BR8 B;  4KP4 A;  1XMO O;  3ZRW B;  4DUY B;  5H6R A;  3G6B A;  4L8J A;  2FML A;  2ZDI C;  5BXZ A;  5LMU O;  3E22 B;  2QDO A;  4X62 B;  1TA8 A;  1OV9 A;  5LYJ B;  1K8A W;  5BMV A;  5DED A;  5JVD B;  5KUK A;  1F4M A;  2OTL V;  3BHP A;  5GON A;  2OTJ V;  4X88 A;  2ILM A;  1N36 B;  2IM9 A;  2QKC A;  2HVJ C;  5CN0 A;  3LSQ A;  4X65 B;  3JAL A;  4W4L A;  1HNW B;  2LO1 A;  1WNS A;  1MZE A;  4EB6 A;  2NR5 A;  3ASO B;  4X64 O;  2WLL B;  2CK3 G;  1DF5 A;  5CMU A;  1Y74 B;  1Y76 B;  1DTO A;  4DR4 O;  4JI5 B;  1K4C C;  3W7S A;  1FFX B;  1EN5 A;  2LW1 A;  1H38 A;  2OWO A;  4MVU A;  1K9M W;  2HP8 A;  2DQ3 A;  1V55 C;  3RYI A;  5L3B A;  1DK1 A;  4O4J A;  4DR7 O;  4CC5 A;  4TSF G;  5JH7 B;  2P6J A;  3KCY A;  4PI2 A;  2F93 B;  1YIJ V;  3GVM A;  1J95 A;  1JFF B;  2VQE B;  5KHJ A;  3K5N A;  3ZRV A;  2BCC H;  3OUS A;  4GX1 A;  2Y4T A;  2A9H A;  1Z2G A;  3BEH A;  5FL7 G;  2NLJ C;  4XDK A;  2ZM6 B;  3U10 A;  2UUC B;  1IBL O;  2QTO A;  1N8R W;  3L70 H;  2NN4 A;  5LBQ A;  4R7C A;  3UM7 A;  1AP6 A;  1S5J A;  3JSL A;  2Q7E A;  2LFR A;  4H44 B;  1H2G A;  3H9V A;  3K3W A;  1BHA A;  5GTH Z;  1F4N A;  4EKW A;  4ZIB A;  1BMF G;  4CH4 A;  3G67 A;  5CBG A;  4LFB B;  1R6N A;  3ZHS A;  4JI4 B;  1I5Y A;  1KKC A;  2BTQ B;  1I08 A;  4CS4 A;  3NR7 A;  1VF5 B;  3KCX A;  1XL6 A;  2P67 A;  1YCI A;  5KHK A;  3OTO B;  4H0L B;  2XAF A;  1N34 O;  2JJ2 G;  1HW7 A;  4J41 A;  1KC8 W;  2X6A A;  1I94 B;  5FPO A;  4X89 A;  4P9P A;  2JVD A;  1ZX3 A;  4H13 B;  3RYH A;  1B6Q A;  4PEL A;  4H33 A;  1TAE A;  1B04 A;  3CWB H;  2YIB A;  3ABT A;  2XOK G;  1I7F A;  3R66 A;  3D3I A;  3E35 A;  2OIG A;  3JAW A;  2D2C B;  2Q69 A;  1NI8 A;  4B3R B;  2ZQM A;  3OMI B;  4X1Y B;  4R8C A;  2QR4 A;  4LF6 O;  1H2L A;  2JIZ G;  3ZHT A;  1SS3 A;  4B7E A;  2YID A;  3H01 A;  1PP9 H;  1HNZ B;  4J42 A;  5LHH A;  3HKD A;  1NH2 D;  5K1X A;  4GT1 A;  4I4T A;  3OEH G;  3DC5 A;  4LF9 B;  3H1H H;  3ZJZ A;  4Q20 A;  1XQ8 A;  3RBZ A;  4FLZ A;  4TUY A;  4B3S O;  5B1N A;  1XMQ B;  5FNV A;  4FJC C;  2WAM A;  4HBN A;  3CCS V;  5JCO A;  2LGQ A;  1NVP B;  1SES A;  2CE4 A;  4A5U B;  4DV7 B;  1Q7Y W;  4PA9 A;  1BS3 A;  2CTQ A;  3JD0 A;  4MVQ A;  1QBZ A;  1JVM A;  2PF4 E;  3N2K A;  3E86 A;  4TV9 A;  4YY3 B;  4MW3 A;  5AG2 A;  1NTZ H;  2V7Q G;  3SPG A;  5B5E Z;  2UU9 O;  1N33 B;  1NTM H;  2WLJ A;  4J9Z B;  4BIZ A;  2M7W A;  3E89 A;  4QPK A;  1K73 W;  1V55 B;  2R9A A;  4UCT A;  3CS5 A;  5KA6 A;  2MW2 B;  2ZD9 A;  1E1R G;  2ITC C;  4DV3 B;  3B4S A;  3IGA C;  3HKB B;  3SR2 C;  2LW7 A;  4AQY B;  4DV6 O;  3HKE A;  5LMN O;  5LMU B;  5GTI Z;  2PI4 A;  4J10 A;  3ETD A;  1J5E O;  2JGU A;  2VWK A;  2GSM B;  4U7O A;  1XNQ O;  2G38 A;  4JGS A;  4FM2 A;  3L72 H;  4QPJ A;  3J80 N;  1S0V A;  2A79 B;  3H1K H;  2QKA A;  3ZCC A;  1XHZ A;  5B1B B;  3RW0 A;  5EBM C;  4F6R A;  3C3S A;  1H2K A;  3RYC B;  4LR3 A;  1P7G A;  4JI1 O;  4OX9 O;  1ZL8 A;  4MVZ A;  2DW4 A;  1FJG O;  2Z5U A;  4PA7 A;  3T1H B;  5JJJ B;  4FFK A;  3TXQ A;  1ORQ C;  3BCC H;  3OAA G;  4BR6 A;  3OR7 C;  1L8D A;  1Z5V A;  1BQZ A;  1JX9 A;  4LH7 A;  4DV4 B;  3N27 A;  4J7Z A;  4PDL A;  4FLT A;  2Q0A A;  3FB8 C;  5CA1 A;  4FFB B;  2QE7 G;  3Q4H A;  4JZ2 A;  3ETQ A;  4K8Z A;  2AW9 A;  4ABM A;  4WFE A;  5L3G A;  4FZ0 A;  1GM9 A;  3ZMV A;  5IJ0 B;  5CA0 B;  3ZN1 A;  1Q86 W;  2P90 A;  4NVP A;  4Z2W A;  2Q67 A;  2KG7 A;  4HZ3 A;  3H1I H;  4TQF A;  2X7R B;  5IWA O;  1VAR A;  1FXK A;  3G80 A;  5KMG B;  1L0N H;  4FVM A;  1K4D C;  3ZRS A;  5LOV A;  5J9P C;  4UCR A;  4OXS A;  2YS8 A;  5BR8 O;  2KQX A;  4DW1 A;  4MS2 A;  1QVF U;  1VQ9 V;  1XL4 A;  4OGQ B;  4P9O A;  3FB6 C;  4CZZ A;  1N34 B;  1Y66 A;  1MOF A;  4NB5 A;  4OPH A;  1DLB A;  5ITZ B;  3K58 A;  2WLI B;  1N36 O;  2F1M A;  1B3Q A;  3KG2 A;  5C8Y B;  3ZS8 C;  4X65 O;  5EBL C;  1HNW O;  1Q90 D;  4JTC B;  4JYA B;  1NTK H;  4YHH B;  3CEI A;  5F2V O;  5EYP A;  4ZOL A;  1AJN A;  2XAJ A;  4JI5 O;  1CEZ A;  2NNU A;  3AG1 C;  5CBF A;  2H8P C;  1XRE A;  4GUN A;  3E8B A;  1YIT V;  1YJN V;  4FLV A;  4I7Z B;  1WP7 A;  2WLN A;  4JV5 B;  1G8M A;  1ZLZ A;  2UUB B;  4GKK B;  1VEW A;  2CAZ C;  3SPJ A;  3STZ C;  3M8A A;  5B66 Z;  2VQE O;  2A0L A;  3N2G B;  1TVK A;  1AI4 A;  4PV1 B;  1X4T A;  2ADQ B;  1COW G;  2V1D A;  3QO7 A;  3ABL C;  1H2N A;  1OCZ C;  3JAT A;  4PDM A;  4X1I A;  5LA6 B;  5CA3 A;  2ZM6 O;  2UUC O;  2BSK A;  4LH6 A;  4B3S B;  4TV8 B;  1E1Q G;  3ASN C;  2N05 A;  3JCU Z;  3LUT B;  1VQO V;  3CXH F;  1HNX B;  3E83 A;  1RSO B;  3VQX A;  2B1G A;  1M56 B;  1M4U A;  5LHG A;  1AP5 A;  4DK0 A;  3IJ4 A;  4U3J B;  3CC4 V;  1XDC A;  4J7K A;  4PJ0 Z;  2CDY A;  3ZIA G;  5JQG A;  3S3W A;  2UU9 B;  1YZB A;  1K97 A;  1EZJ A;  1BE3 H;  2GBO A;  3FB7 C;  2N74 A;  4QE9 A;  3KZI Z;  3WG7 B;  4MTG A;  3FD9 A;  2YIA A;  3E22 A;  4I55 A;  2WSS G;  3CRR A;  3OTO O;  4PA6 A;  2WLK A;  3FB5 C;  4KHP B;  4YJ2 A;  1R3I C;  3ZMU A;  3A0B Z;  3W7U A;  1I94 O;  3D36 A;  1SA0 A;  3WB1 A;  1K34 A;  4ZI7 B;  5LMN B;  4IGG A;  3SJA C;  3VOU A;  1VF6 A;  3HKC B;  1N32 B;  4WBN B;  2ETN A;  1XNQ B;  3DSQ A;  1GM8 A;  5BZB A;  2UXB B;  3SJB C;  3C3T A;  1OCR C;  4B3R O;  2ZIO A;  3SGI A;  1FFX A;  3DXR A;  4DV1 B;  2CH7 B;  2IJH A;  1Q82 W;  1N0N A;  1KP3 A;  4DR6 B;  4J7J A;  3OGC C;  1JFF A;  2HJF C;  4CH3 A;  3QO5 A;  1JMK C;  5B1A C;  4O2A B;  1R3L C;  4LF9 O;  2LP7 A;  3APO A;  2OIE A;  5LGT A;  1WB7 A;  4BIU A;  4FLW A;  4ASU G;  1XMQ O;  5LGU A;  4B7K A;  4IYI A;  2ATK C;  4HNA A;  5IDJ A;  4NTX A;  4DV7 O;  2UXD B;  3M99 B;  3O65 A;  3B8M A;  4CS3 A;  2A3Q A;  2WA4 A;  2CUG A;  3VQV A;  1IUR A;  2EUL A;  5KHI A;  2UUA B;  1VQ7 V;  1Y67 A;  4YY3 O;  1TUE B;  2BE3 A;  1E79 G;  1LNQ A;  5DN6 G;  3M7M X;  4IYH A;  5J2T B;  1KD1 W;  1N33 O;  2QM4 A;  4P30 A;  2ZXW C;  4K0K O;  2KKW A;  3AG1 B;  2QWR B;  3CMA V;  3JAS B;  4N23 A;  1BGY H;  2HFE C;  3CRM A;  4LF4 O;  2IJK A;  4KUM A;  4DV3 O;  4B3T B;  4LC1 A;  1AI5 A;  3P30 A;  2EIM C;  4AQY O;  1FS0 G;  5D5Q A;  2QGN A;  3K59 A;  3WB0 A;  4CH5 A;  3ABL B;  1OCZ B;  1SKV A;  3ASN B;  3CE2 A;  4IIJ B;  3RWR D;  4QNH B;  3CC7 V;  2PUS A;  2E76 B;  2XHB A;  2AZ0 A;  1D5N A;  1VF7 A;  1AR5 A;  5IY5 C;  1ZUQ A;  1YSC A;  2JGD A;  1WB8 A;  1SF9 A;  1WP8 A;  4UB6 Z;  5EC1 C;  1FAF A;  2GUZ B;  2RCV A;  3WB2 A;  5KLV H;  2DJV A;  4NTY A;  3RVZ A;  3T1H O;  2KSD A;  1OCC C;  2YEV A;  1KUQ A;  3SDL A;  4ZBM A;  2K9P A;  3JD2 A;  1PNK A;  3RGB A;  4IT5 A;  1HDJ A;  4DV4 O;  2XTA A;  3RYF B;  2EIL B;  1FYJ A;  1VMG A;  4XDJ A;  5GW7 A;  1YDX A;  3A2F A;  2Y0I A;  2YUA A;  3WU2 Z;  2IW5 A;  3OMA B;  4O4I A;  2HJD A;  2YXL A;  3L75 H;  4XBF A;  2ODM A;  4H37 A;  4K3A A;  4NKG B;  1OCR B;  3F5T A;  3B8N A;  1US6 A;  1MSD A;  1QCE A;  2W6J G;  2K1E A;  4EFE A;  1SRY A;  4XDL A;  1IBM O;  4DR5 B;  1GKF A;  2QM7 A;  5HFM A;  4DR2 B;  3CRC A;  4DV2 O;  3OW2 U;  1KP2 A;  2Q9L A;  1QQC A;  5B1A B;  1Z5W A;  1JJ2 U;  4I0X A;  3ABM C;  2ARH A;  5L3E A;  3F7Y C;  4X1K B;  4MVR A;  3HB3 B;  3AG3 C;  2LGW A;  1M57 C;  3FYI B;  3JD4 A;  3B2E E;  2Y48 A;  5LXT A;  2YI9 A;  4IL6 Z;  3RYC A;  4JYA O;  5B1O A;  4BIO A;  4YHH O;  1SER A;  4I50 A;  5H5N A;  5EC2 C;  5IJ9 A;  2DN9 A;  4DRX A;  2R72 A;  1QHT A;  5EZY B;  4PA4 A;  1MZF A;  4DXW A;  1G4Y B;  3OM3 B;  2Q4P A;  1RPO A;  2C2A A;  3TGU H;  2ZCE A;  5BMV B;  2ZXW B;  4JV5 O;  3BVO A;  5JCO C;  2UUB O;  4GKK O;  2ZR3 A;  5GON B;  2AZ2 A;  3JAL B;  4UVC A;  4LF5 B;  2Q6A A;  4EB6 B;  3A0H Z;  2EIM B;  1XUQ A;  1SQX H;  1KU9 A;  4YJ3 A;  4DV5 B;  2B5U A;  2HVK C;  1W2B U;  1HNX O;  4FM1 A;  1NH2 B;  4RUE A;  2PYJ A;  3TJT A;  2UXX A;  4MVO A;  1HWY A;  4QJF B;  2PTM A;  4FMT A;  1M9N A;  3RYI B;  3F5W C;  4O4H A;  4O4J B;  3SPH A;  5KMG A;  3RT3 C;  4AHC A;  1ARO P;  4DO2 A;  4JI2 B;  4LWS B;  3H1L H;  2PZS A;  2IJI A;  3IFX A;  3L9D A;  1NQT A;  3K0G A;  3AG7 A;  3ETG A;  4K0K B;  3L71 H;  4WFG A;  2AHY A;  2W0X A;  2XAH A;  5KA5 A;  4LF4 B;  4KHP O;  4QIW F;  4J9Y B;  1GN2 A;  3GB7 C;  5FLX N;  3EFF K;  4Q6G A;  2WLI A;  1KBH A;  2Z3Y A;  1JR9 A;  4FPP A;  4LCU C;  4RO2 A;  2UXC B;  1ZWI C;  2QWO B;  2L6L A;  2E75 B;  3ETE A;  1LUV A;  1N32 O;  4AIL C;  5BY1 A;  5D5P A;  1WPX A;  4O4L A;  4ZHQ B;  4CH6 A;  1WA8 A;  2Y69 C;  2UXB O;  1S5L Z;  1CPY A;  1FXV A;  1VQM V;  1MNG A;  4X20 A;  2EJ7 A;  2YIB D;  4LFC B;  1FKA O;  1W59 A;  4DV1 O;  1AVM A;  3RVY A;  1QLE C;  4GLX A;  1V54 C;  3CD6 V;  1I5X A;  2ITD C;  5J2U A;  1SQQ H;  3K0D A;  3E8F A;  4DW0 A;  2VS0 A;  4LNU B;  4DR6 O;  3K03 A;  1SET A;  4C7U A;  1P49 A;  4D7S A;  4CBC A;  4UCS A;  2DOS A;  3SYA A;  1ZAU A;  3CJH A;  4UCU A;  3ABM B;  3P3N A;  1AI6 A;  1F7Y A;  1X59 A;  2F43 G;  3CX5 F;  4LF8 O;  1LR1 A;  5KX5 A;  2DQ0 A;  2R70 A;  2B9Z A;  3J7A U;  3AG3 B;  1M57 B;  2OCH A;  1IBK O;  2EZP A;  1FXK C;  1RFY A;  3ZX6 A;  1MSW D;  2UXD O;  3JAR A;  5A2Q N;  1VQ4 V;  1D5A A;  4B08 A;  3HKD B;  2UUA O;  4I4T B;  1VQL V;  3FAV A;  2F23 A;  2YC0 A;  3K06 A;  2QWN B;  1YEW A;  5LP6 C;  2LQT A;  1IBM B;  5CB4 A;  3WFV A;  4QE7 A;  5FNV B;  2YIC A;  4DV2 B;  3CC2 V;  1TGO A;  3W7T A;  2P4K A;  4B3T O;  5KUM A;  2P06 A;  1PNL A;  1ZSP A;  1P4R A;  4NR1 A;  2QWQ B;  3OFN G;  1YVW A;  3LDC A;  1TUB A;  4DR3 B;  3KKY A;  1MG1 A;  3ABK C;  1OJH A;  4WFB V;  3BA9 A;  4YXW G;  4LFA O;  5E79 Z;  1EM1 A;  4NXM B;  3N2K B;  4TV9 B;  2BOB C;  3SJC C;  2Z0A A;  4E2L A;  4JAU A;  3NXS A;  1N0J A;  2CH7 A;  2IU3 A;  2N04 A;  3FX7 A;  2XAS A;  1VQ6 V;  2WPD G;  1PKX A;  3UT5 A;  4DR1 B;  2QTS A;  1U97 A;  4B3M B;  3CHX A;  1GN4 A;  4PDR A;  5L3C A;  3HKE B;  3OTF A;  1XEQ A;  3OEE G;  5L3F A;  1NS1 A;  4JYC A;  1XI1 A;  2QJ1 A;  4N21 A;  2PI5 A;  4O2B A;  4F6R B;  3OMN B;  2DMX A;  3CCQ V;  2QKS A;  1WJZ A;  1K5S A;  4UCO A;  1NJI W;  2VQF O;  1HR0 B;  2Y69 B;  1S5H C;  4BW5 A;  2FKX A;  4FM0 A;  5FPR A;  1QLE B;  4UCV A;  3D36 C;  4JZG A;  4DR5 O;  4DR2 O;  5K1P A;  3ZRW A;  4AI8 A;  1KQS U;  3T4Z A;  3F7V C;  4G2K A;  4E4E A;  4NXN B;  1W0J G;  3Q4H B;  1VF6 C;  1G6U A;  1YTF D;  4WFH A;  1KYO F;  5LYJ A;  2ZE6 A;  3K79 A;  4FZ1 A;  3K5L A;  3JAK B;  1VQK V;  5JVD A;  4IHJ B;  1MMM A;  2FB5 A;  1XOU A;  1MA1 A;  1GTO A;  3ZRX A;  1PD3 A;  4L87 A;  2KG7 B;  3GWK C;  4UUJ C;  1XNR B;  1GK9 A;  1K3E A;  2QWP B;  1FXK B;  2HHH B;  2WLL A;  4YIO A;  3CCE V;  2DE0 X;  1Y74 A;  1RP3 B;  3CCV V;  1YTF B;  1Y76 A;  2BOC C;  2IJJ A;  2LJ2 A;  4JPR A;  1YJW V;  3B09 A;  3I56 V;  1NR7 A;  1QR9 A;  2Q7H A;  3THO A;  5JJE B;  2HG5 C;  3LSU A;  3CXC U;  4GZR B;  1R73 A;  2MK3 A;  4MSW C;  3MAQ A;  1GM7 A;  2X6B A;  2HLD G;  5JH7 A;  1D2D A;  2P4V A;  4X8A A;  2EX3 A;  3JD1 A;  5LP6 B; 
#chains in the Genus database with same CATH homology
 2P06 A;  2Q4P A;  4QGP A;  2GTA A;  1YXB A;  1YVW A;  2A3Q A;  3CRC A;  5IE9 A;  2YXH A;  1Y6X A;  2Q9L A;  3C90 A;  2OIE A;  2OIG A;  2Q5Z A;  3CRA A;  2Q73 A;  1VMG A;  2A7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...