2OIGA

Crystal structure of rs21-c6 core segment and dm5ctp complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
PFRFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKSDTEPGPQAWPPKERAALQEELSDVLIYLVALAARCHVDLPQAVISKMDTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of RS21-C6, Involved in Nucleoside Triphosphate Pyrophosphohydrolysis
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords RS21-C6
total genus 26
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.12: dCTP diphosphatase.
pdb deposition date 2007-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2oigA00
4QGPA 2OIGA 1YXBA 3CRAA 2A7WA 2P06A 2Q9LA 2Q5ZA 2YXHA 2Q73A 1Y6XA 3C90A 2A3QA 3CRCA 5IE9A 2OIEA 1VMGA 2Q4PA 1YVWA 2GTAA
chains in the Genus database with same CATH superfamily
3ML0A 1NR7A 1PKXA 3OR6C 2WWWA 4I55B 3CCUV 1DF5A 1N33B 3OW2U 3CCEV 1M9NA 5CN0A 1GKFA 1KP2A 4H13B 1N36O 1KYOF 3CC7V 2HFEC 3K08A 3OEEG 3U10A 3ETGA 2UUAO 4LFAO 1HR0B 3AG3C 3EVKA 5EYPB 1JA8A 3DC5A 1AJPA 3OEHG 2E5LO 3SJQC 4DV6O 1LUVA 2RMKB 4YIPA 1X59A 2P4VA 2Z3YA 5JCOC 3I56V 1AI4A 5IY5B 3SYAA 2Q6AA 2R72A 3ZHUA 4QNHB 4JI4B 4LF5O 3KG2A 3ZHQA 2Q4PA 2ZDIA 4DV4O 1SESA 3K79A 1M1KW 4X62O 2IH3C 5A2QN 3AG1B 2QWOB 1VQLV 1RSOA 1XEQA 1M5IA 5H5NA 5HFMA 3BA9A 3E8BA 4LWSB 1F7YA 2IJJA 4YHHB 4MVOA 2DYRB 4JYBA 4LNUA 4R7CA 4JASA 4KHPO 2F23A 4MTGA 3J80N 1YCIA 2BE3A 4GKJO 3B09A 2OWOA 4IHJA 2ZE5A 1COWG 3H01A 3ZIAG 1MABG 1TUBB 3G4SV 2M7WA 5LHGA 1Z5WA 3CCQV 3AG4B 4Z1VA 3RYCB 1GH6A 2LO1A 1FXKB 3B40A 3CYOA 2F66C 2F4VB 5HFLA 5H6QA 3ETEA 2EZPA 3SJAC 3IGAC 4MSWC 5KHJA 2Y0PA 1V55B 2D3OW 4AQYB 1D5NA 1K33A 2ILMA 3E35A 5H2FZ 1GRJA 1KBHA 1Q86W 2V1DA 4TQFA 4JI8B 1S5JA 2UU9O 3O9OA 4UVAA 1VIBA 1PPJH 3N27A 1J5EB 2XAGA 5EC1C 4H0LB 3ZN1A 5LYJA 2EILC 2JJ2G 1XUQA 1XNRB 1KB9F 5LA6A 4ZHQA 1H2SB 1ZSPA 3W7SA 1SQFA 2GV9A 1PV0A 3B2EE 2ZNIA 2QKSA 3RT3C 3OTOB 4JI3B 1AR1B 4CC6A 5FPOA 5KA6A 2HLDG 4KXRA 3CRAA 1MNGA 4B3MO 1R6KA 2ZM6O 5IY5C 2QWQB 3K0GA 1ZL8A 3CB2A 5IYBO 4IYHA 1AJNA 2EIJB 2ATKC 4X20A 5DECA 3SYQA 2HP8A 3OTFA 2PZSA 1K73W 2F93B 3AG1C 2WLKA 4CH6A 2W6IG 4ICGA 1RM1B 4NVPA 3JCUZ 3DGEA 4K3AA 1NJIW 5KX5B 2EILB 2JS3A 1YZBA 4LCUC 5JQGA 4DR2B 4O2BA 1OCRC 1JQ0A 4Z1MG 4DUYO 5CBHA 1R6TA 4KHPB 4YIOA 2LFSA 2JEXA 1JCHA 4MTXA 1EN6A 5KUMA 1TUEB 1MZEA 1XBLA 2VQEO 4DV5O 2OTJV 2EX3A 2IU0A 4TQDA 4MTFA 4FM1A 3UCSC 4RUFA 3K57A 2Z0AA 1H8HG 2QWNB 3B8MA 3AG2C 4CH4A 3BHPA 2L6LA 1HR0O 2WLHA 3W7XA 5DM6V 4JI0B 1VQOV 4DR3B 2HVKC 1YJWV 4DV3B 1KP3A 3ZCCA 1R6NA 4JI2B 4DV2O 1GN3A 1YDXA 2CDYA 2W0XA 3BRCA 4DV6B 4DUZO 1JR9A 1VQ6V 1TA8A 1IXMA 4DK0A 4RAIA 3ZHVA 4MVRA 4P2ZA 4B7EA 4IL6Z 5DN6G 2XUMA 2YEVA 3L71H 4YY3B 1P49A 3RYIB 4FJCC 5IJ9A 1W0JG 2M6YA 1FXVA 1V54B 4QE7A 4KL1A 1SC5B 4OX9O 3OFNG 1NZ6A 2A0LA 4OGQB 3F5TA 3VBBA 4ZOLB 2RCVA 3ZHRA 4DR6B 3ZN0A 4IYIA 5KAIZ 1SQQH 1FKAO 4FVMA 1PNLA 2R70A 1IBKO 2N74A 2P90A 4MW3A 4JI1O 3E8FA 2OIGA 5IYCO 1VQNV 2Y69B 1SA0B 2DQ3A 2OCCB 1QNMA 1WLEA 4JV5O 5LXTA 4UCUA 2BTOA 4I9QA 2JK5C 4KP4A 4PJ0Z 5GW7A 1BHAA 2P6JA 2XNDG 2CTRA 4QGPA 2JDIG 2UUCO 2ZE8A 2Q8VA 4J41A 5JVDA 5C8YB 2ZQMA 2W6JG 1EN4A 2X0LA 3SJBC 3K0DA 1OCZC 3L70H 1XNQO 4J7KA 1KU9A 1I5YA 4MS2A 5B3SC 4CS4A 3X2QC 2W0FC 2H8PC 2BOBC 2RJZA 3ZMUA 5KAFZ 1XILA 4OPAA 1S5HC 1YF2A 1ZAUA 3DXRB 2HR3A 1ZX3A 2QTSA 3CRCA 4K8XA 5J2UB 1XMOB 3FAVA 5CA0A 3CRMA 2UUAB 2AZ0A 3ZMTA 4UVCA 5J2TA 4MVQA 4O4LB 4I0XA 4NKGB 5KHHA 5IJ9B 3RYHB 4K35A 1SKVA 3FB7C 2QGNA 4O2AB 2JRIA 2VRZA 3BVOA 3OT7A 2PI5A 4JI4O 4BIUA 2QKCA 2YXHA 4FFBA 2ZDIC 2XAHA 4TUYB 2A7WA 1KD1W 2YS8A 1PD3A 1FFTB 3ZRVA 1VQMV 1BSMA 3CS5A 1Y66A 1LR1A 2CTPA 4JI6B 2EJ7A 1LNQA 4HNAB 4WCEV 2YICA 4PI2A 2CH7A 4AI8A 1XREA 1BQ0A 3HKDB 2DJVA 5CBFA 3AK3A 1BL8A 2V4DA 3E89A 2E5LB 3Q4HB 4QIWF 3OR7C 5CMUA 3FFQA 2PUSA 3D3QA 4JAUA 3SJCC 2OYQA 4GKJB 1WA8B 2QE7G 5JH7A 1IBKB 4DUYB 4R6ZA 2EJRA 2VS0A 2OIEA 3RBZA 2YXLA 5IE9A 2XAQA 4ZIBA 1JJ2U 3RYIA 1ZLZA 2DQ0A 3ABLC 4OXSA 3LSUA 3RFRA 1PL0A 5LOVA 5IYZB 5H9CA 3T1YB 1YJNV 4X1IB 5GTIZ 3AG7A 4J10A 1H38A 4GX0A 1QU7A 4J7JA 2XOKG 4PA9A 5FNVB 1K4CC 2Q68A 4DUZB 2QM8A 5B1AC 2QWRB 1QBZA 4DW0A 2UXNA 1SS3A 1AROP 3CMAV 2WLJA 3AG2B 2DOSA 4O4IB 1S0VA 1HNWO 4C7UA 4NXNB 1KC8W 3IAYA 2ADQB 1XL6A 1I94O 3P3NA 4PDVA 5LGUA 4X89A 1WP7A 2BOCC 1S72V 4BIOA 5FPRA 4DV7B 5KX5A 5KMGA 1N32B 1FFXA 2AXTZ 2BTQB 4TV9B 1YXBA 4O2BB 2JIZG 1R3KC 1YTFB 4LF6B 1L0LH 4LR3A 4B3SB 3ABLB 1PNMA 4UXNA 4ABMA 5TISZ 3BFRA 5LGNA 1HNZB 1I5XA 1G1XB 2UU9B 3SR2C 4JI7O 5BR8B 5IWAO 1XOUA 1NTZH 5KHGA 3ZRSA 1THZA 1R73A 4QJFB 4LP8A 3K58A 5ITZA 4HYOA 3MD0A 2GUZB 3UKMA 1BZKA 3G6EV 1FXKC 4H33A 3CCSV 3T4ZA 3E8GA 1K92A 4LH6A 5EC2C 3ZHTA 5IJ0B 4JYAO 2ZNJA 3ZEDA 4I7ZB 1BHBA 2FKXA 1XHXA 4CH5A 2QDOA 4X1IA 3CC4V 1UJWB 3ABMB 2YEVB 3K5NA 1L0NH 1XNRO 2V7QG 5B1BC 4J9YB 3CP1A 3FX7A 2IJHA 3KCYA 3D3IA 3DXRA 3JALB 4PDMA 5LP6B 1CXZB 4ZOLA 3SPIA 3P3PA 5LMNO 3R65A 2ARHA 1M4UA 4PA4A 1YI2V 3X2QB 2JJ1G 5A9GA 3JAWB 4RQFA 4DV2B 2FL4A 2HJFC 3FYIB 4FLXA 1RPOA 1TUBA 3HKBB 1Y76A 4BIZA 4LF8B 4UB6Z 4DR7B 1HP8A 2C2AA 2HJDA 3JAKB 2NLJC 1XHZA 3JYCA 3QNEA 2ETNA 4R8CA 2BTQA 3GWKC 3CC2V 3ZRWA 3UO3A 4JTAB 1GM9A 3ABMC 2IU3A 3GWOA 1VQ7V 5K1XA 4MW8A 1ENVA 1ZTEA 4I55A 1IX9A 2Y4TA 3U11A 1I94B 1D5AA 4FM2A 2YSUB 4NTXA 5DEDA 4YJ3B 3QO8A 1DLBA 5B1NA 4JI1B 2F43G 1T5EA 4Q20A 2K1EA 5KLVH 1H8EG 5LBQA 1AR5A 1R1BA 3FD9A 1Q82W 4J80A 5LP6C 2WLIB 2EINC 2YDEA 4LC1A 5CBGA 3HR0A 4H37A 3GVMA 4HZ3A 5JH7B 1DGSA 3WU2Z 4XDJA 1B6QA 1KMIZ 1HWYA 2A06H 4B3RB 5J2TB 4B3TB 2IH1C 4FM0A 4JI7B 2ODMA 1EFRG 4JZ2A 5CB4B 1WNSA 2NR5A 3ABKC 3TXSA 2Q69A 3TK1A 4NTYA 2Q73A 1GM7A 1TVKA 4DV1O 3O65A 4YY3O 5JCOA 1F4MA 1E1RG 2HHHB 1AB3A 4AILC 2LJ2A 5B5EZ 4DV5B 4DO2A 1FXKA 3J7AU 4W4KA 1RP3B 1SETA 3LSQA 2ITDC 4P30A 1GN6A 2ZD9A 1G8MA 3E2EA 5KHKA 1YVWA 4X64B 2EIKB 4GZRB 2WLNA 3J81N 4PA6A 1FAFA 2JGUA 5KHIA 3TETA 2GUZA 4F4LA 4D7TA 3MDSA 1N8RW 1OCOB 3JD1A 4MT8A 5B66Z 4LFCB 1EZVH 3P32A 4JGSA 3A0BZ 4WFAV 1I7FA 1DK1A 4RWUA 5BMVA 3C3SA 1CP9A 1FXHA 2XASA 4YHHO 2GTSA 3QO7A 2DYRC 4O4JB 2YI9A 3K3WA 4YJ3A 1Q3EA 3CEIA 1XI1A 4LF8O 2KG7B 1W59A 3H9VA 4JI6O 4MTOA 1R3JC 4MVSA 4X8AA 1K3EA 2E76B 4IIJA 1Q6IA 5IDJA 5D5QA 2YIDA 2Y48A 3JD3A 3K06A 1XNQB 5EZYB 4B7KA 2HEPA 4BAYA 4JAVA 4GX1A 2DYSC 2YIBA 4KFMA 5EIBC 4X9QA 1FYJA 3RVZA 1YSCA 2VWKA 4GYCB 3C3TA 4TSFG 3OMIB 1OCOC 1BS3A 4UV8A 5C93A 1Y76B 2UXDO 2GDSA 3FKSG 3PN1A 1SF9A 3D36C 4XBFA 3QTCA 4I9WA 1US6A 2WA4A 2X6AA 5JQGB 4AQYO 3L72H 1VQ9V 3H1HH 2A3QA 1F4NA 1R3LC 2K9PA 1XMQB 2PF4E 2XHBA 1GK9A 3IFXA 2JEUA 1SQGA 1VQKV 3ZMSA 1FJGB 5LP6A 3C90A 1NVPD 3ABUA 2VWJA 3VQYA 1SQPH 3CX5F 2CAZC 1NR1A 4RUEA 4TV9A 4UCRA 4LF9O 2FTKA 1XL4A 4A5UB 2FYUH 5LXTB 3K9AA 2CUGA 3UT5A 4O4HA 2P5OA 2LW7A 2FMLA 1IVSA 3L9DA 2Z5UA 5GTHZ 3CXHF 4EFBA 4JPRA 3ASNC 2GBOA 4MVMA 2F95B 2KSDA 3BAAA 1MG1A 2E75B 2P06A 3SPGA 4JI2O 4G27B 4X1YB 4RO2A 3N2GA 2JVDA 3E22B 2EIMB 1TAEA 3HKCA 4X64O 1K34A 1GN2A 3D36A 1B06A 4G28B 3HKEA 2G38A 2AHYA 1B04A 1Q5OA 3WB1A 3CWBH 3ETDA 1WPBA 4FLTA 3SPJA 3JCZA 1MOFA 1HNXB 1M57C 2PTMA 2DN9A 2E3CA 1V9PA 5IWAB 1A32A 2ZIMA 2WLIA 3APQA 4JTCB 4IGGA 3JASA 5LGTA 2EBOA 3RWRD 2B1GA 4JI5O 1AVMA 5D5PA 4GLXA 3ZBHA 4GKKO 2PY5A 1OCRB 3HPLC 4NR1A 4EKWA 3F5WC 3LNMB 2GSMB 3THOA 2UXCB 2ITCC 2JGDA 5CB4A 4UFZA 4DYLA 4K8ZA 2ZXWC 1SQVH 1AP6A 1AILA 3E8HA 1YEWA 4LFBO 4FFBB 4LF6O 1NVPB 1RPRA 2LP7A 3HKBA 1MMMA 2WA3A 1MSDA 2RN9A 3ICXA 5E79Z 4WFGA 1NTKH 2P67A 2Q9LA 4DR3O 2LFRA 3ZJZA 5JVDB 2Q0OC 3T2MA 4BR6A 3FB6C 2PYJA 4JYYA 2X7RB 2UUCB 4NXMO 4DRXB 1GAXA 4U7NA 2AGAA 5FL7G 2AW9A 2Q7EA 1N32O 3KCXA 1Q8IA 1KKCA 2EIJC 4I50B 4U3JA 1NI8A 3L74H 2WLLA 3STZC 1IURA 1Q6UA 2QA4V 1WA8A 1IBMO 1ZUQA 2Y0IA 3SYOA 3GB7C 3CRQA 3TJTA 5IYDO 4UCSA 2B5UA 5CA3A 4QE9A 3W7UA 3EFFK 2DWDC 1NQTA 1HNWB 4F6EA 4IT5A 1Y67A 1Q6HA 2DE0X 4QPJA 1L8DA 5BXZA 1H2LA 1O9GA 1B3QA 1NTMH 2R9IA 3OGCC 1EM1A 2WSSG 5IT9N 3DSQA 1Z2GA 1SZXA 5L3GA 4X66O 4HBNA 1P84F 4CZZA 2IBZH 3RYFB 4WBNA 1YJ9V 1Y6XA 1WB8A 2OCCC 3K5OA 3LDCA 1F51A 3K03A 1JMKC 5E1AC 4EEQA 3ASNB 4WFEA 1PNKA 4TUYA 4B3SO 1BQZA 2IM9A 3JATA 4LBEC 4J7ZA 3JARB 3FAVB 3JD4A 2KKWA 5CA0B 3OMNB 3A8TA 1JFFB 3TCUA 2UXDB 1KQSU 3QF7A 4O4LA 3UO2A 1K97A 2ZR3A 3LDDA 3OD4A 3Q4HA 3CCMV 3JSNA 1H2NA 4O2AA 1U97A 5L3EA 4DR4O 4KUMA 4I5SA 3SPCA 4WFBV 1K8AW 4UB8Z 2WPDG 1IXBA 3E86A 1KECA 4X1YA 4DR7O 3CHXA 3HKCB 4K0KB 4NYKA 1UFIA 3QO5A 4FZ1A 4I50A 4U3JB 3HKEB 5BMVB 1S3JA 5L3CA 4P9OA 4P9PA 4O4JA 4EFEA 5LMUO 4FLZA 1PM9A 2HVJC 3OUSA 3K04A 4XDLA 2X6CA 1GO3F 3B4SA 3W7WA 1N34B 4LWSA 4DV0B 1EZJA 1U96A 3QVNA 2LQTA 3UM7A 3K5LA 4H44B 1IBLB 4X65O 1K9MW 5EZYA 4O4IA 3VQXA 3WB2A 1BT8A 4WBNB 2BSKB 3LDEA 4DV1B 1ORQC 2Y4UA 3UQ8A 4LF4B 2LW1A 1VF5B 5EK0A 3AG3B 4I0XB 3AK1A 4DV4B 1P7GA 3BCCH 4FZ0A 2YI8A 4UV9A 5B1OA 5BY1A 1BE3H 2UUBB 3BY6A 3JARA 2ZT9B 4NB5A 1H2MA 4DV7O 1M90W 5FNVA 1IZ3A 4X1KA 3CMEV 1JPXA 4DR5B 3ASOC 3STLC 4N21A 4LNUB 4FFKA 4F6RB 1R3IC 3IC7A 1BGYH 3BABA 4DR1O 3EHBB 4LF7B 2D2CB 1EN5A 4JTDB 2GTAA 4MVZA 3ZRWB 3T1YO 1OCCB 2Q5ZA 2OCHA 3G6BA 3OUFA 4O4HB 4DK1A 2LGWA 2ZM6B 3DC6A 2ADPA 4EB6B 4CH3A 1OJHA 2QEXV 4YJ2B 4NXMB 3ZRXA 3RYCA 1XMQO 3B77A 5KUKA 2LGQA 1HW7A 3G67A 1QLNA 3CE2A 3E22A 1SZTA 1Y74A 1IBMB 1WB7A 1PL4A 5JJNB 2ZCEA 1JJOA 1AP5A 5LHHA 4DR2O 2WLLB 1N0NA 3APOA 1KKDA 1K4DC 3OMAB 1N36B 1M93A 1QVFU 4J11A 3CRRA 3N2KA 3K59A 4LFAB 3WG7B 3T1HB 2HKOA 4Z2WA 2QKAA 2P7TC 2KB1A 2IW5A 1K7DA 5LYJB 1VQ8V 2QJ1A 4X66B 2PI4A 3CJHA 3DTUB 5LA6B 4D6TH 4LFCO 3JAKA 3G80A 2JS5A 5L3FA 1J95A 2XTAA 4ZBMA 1DF4A 4JI0O 4BW5A 1FJGO 2DWEC 1N34O 5BR8O 4TV8A 4JZGA 2JGDB 3RW0A 3OGIB 1G4YB 1VF7A 4DV0O 1SRYA 2QTOA 2DYSB 3CCJV 3MHHC 1D2DA 3CPWU 5B3SB 1M56C 1FFXB 2QSAA 5K1PA 1AJQA 4JYAB 3JD2A 1QLEC 1V54C 2N04A 4X20B 4DRXA 5EIBD 2H94A 3L75H 4FPPA 4J9ZB 3A0RA 1VP7A 2CK3G 2Q7GA 3VQVA 3ZS8C 3LUTB 2A79B 2YIAA 2MK3A 2R9AA 5L3BA 1S77D 3VQWA 5EBMC 4PV1B 2NNUA 1VF6C 1MA1A 2WAMA 2Y69C 1HNXO 1JVMA 3H1LH 1K5QA 1QCEA 3TGUH 4B3TO 4CS3A 3PJSK 1QR8A 1VQPV 5LHIA 5J9PC 2VQFB 1NH2B 4HAMA 1Y4MA 2Q67A 4UVBA 4ZI7A 1VQ5V 4JI5B 2EULA 5LL6Y 1OCCC 1XDCA 3RYFA 3K5MA 3SPHA 1WPXA 3H1JH 2OTLV 1M56B 1W0KG 2ZINA 4TOIA 4X1KB 4X65B 1P7BA 1NS1A 2MW2B 4LFBB 4PA7A 3QG5A 2QR4A 4JF3A 2PYLA 2OT5A 4D7SA 1SA0A 3MAQA 1ZL8B 3BEHA 1WN7A 5BZBA 2P4KA 2BSKA 5F2VO 4TV8B 4MVUA 4E2LA 4W4LA 1GTOA 2E74B 1L1FA 4GKKB 2O57A 1MSWD 4TT3G 4NTWA 4DR6O 1ZWIC 3U0ZA 1UPGA 3M7MX 4PD4F 1TVKB 1M57B 2EINB 3ZMVA 2YXYA 5GONB 3W7TA 3T1HO 4U7OA 4RQEA 3MHSC 1VF6A 1HDJA 3I5DA 2CGOA 2CH7B 4JI3O 5EBLC 1RFYA 3RN4A 3CD6V 1SQBH 4PI0A 3CCVV 3UT5B 1TGOA 3AK2A 4TWKA 2UXXA 2ZR2A 2WLMA 1O9HA 4IIJB 4F6RA 4JV5B 1QR9A 3ETQA 1BMFG 4WFHA 5J2UA 3F7YC 1I0HA 1NBMG 5L3DA 2EIKC 1DTOA 2HHHO 2Q7HA 4FLVA 1VQ4V 1FD9A 4FK5C 4EB6A 1QQCA 3CXCU 3AG4C 4JYCA 5CA1A 3IC9A 3S3WA 3VOUA 4JI8O 1QHTA 2YC0A 1FS0G 3OTOO 1QLEB 4FLUA 2X6BA 3OAAG 2KQXA 1AR4A 3OM3B 4E4EA 1QVGU 1J5EO 1S5LZ 2Q0AA 4PA3A 4I4TB 4L8JA 2KG7A 2UXBB 1YIJV 1E79G 3JAMN 3L73H 1AI7A 2NN4A 1W2BU 4XDKA 3JD0A 1SQXH 5AG2A 1NU1H 3WFVA 1Q43A 4DW1A 3JSLA 2ZIOA 5KA5A 4N23A 3ZHSA 4CC5A 3RVYA 4FLYA 4IHJB 1IBLO 1URFA 1N33O 4LF9B 4B3MB 3RYHA 2GHYA 3EXAA 1H2KA 1Q90D 1CPYA 2P22C 1YTFD 4LF4O 4FMTA 2ZE6A 2BCCH 5EYPA 4PHZA 1NT2B 2VQEB 5B1AB 3T1CA 4GT1A 2QWPB 5LMUB 2YIBD 4AHCA 3B8NA 2DW4A 4B08A 3CCLV 2UUBO 1WJZA 3I55V 1X4TA 1VMGA 4YJ2A 3H1IH 5IYZA 1JOYA 5C8YA 4GCZA 4HNAA 2H3OA 4DV3O 2XAJA 5ITZB 3HB3B 3IJ4A 2AZ2A 1AI5A 2DMXA 3OE7G 2IJKA 4Q6GA 1RSOB 1RM1C 1Q7YW 2ZE7A 1Y74B 2AHZA 3P30A 5FLXN 3D8CA 4G2KA 4UUJC 5JJEB 3JASB 3LNNA 5CA1B 1AI6A 4J42A 1LUWA 4ZHQB 3TXQA 4CBCA 2QM7A 1HNZO 4OX9B 2N05A 4LH7A 3N2KB 4UCVA 3N2GB 3SYPA 4U3FH 1OZ0A 2VQFO 2IJIA 2CTWA 4BW9A 3CJHB 5LOVB 1ROPA 1VARA 1MZFA 4K0KO 3WB0A 4WF9V 4FIPC 4ZI7B 3M8AA 3A2FA 3SDLA 1P4RA 1Q81W 1JFFA 4GUNA 4DR1B 5JWPA 1XMOO 4NXNO 2HG5C 2F4VO 2XAFA 1NH2D 3E83A 3F7VC 5B1BB 4ASUG 1OHHG 4UCOA 1WP8A 1WAZA 2CE4A 1CEZA 2B9ZA 3T4DA 4CS2A 2F1MA 2EIMC 4DR5O 4FLWA 4GX2A 1OV9A 2A9HA 2CGNA 3CCRV 4LF5B 3K9SA 1I08A 3HKDA 3R66A 1S76D 4PDLA 1KUQA 3WG7C 4GX5A 4X62B 5LMNB 4R50A 4WFFA 2ZXWB 2ZKOA 5IJ0A 3FB8C 5GONA 3ASOB 5KMGB 2FB5A 1NKDA 2PGGA 4BWAA 1GM8A 3ABKB 1GN4A 3BPZA 2RDCA 2RNBA 3RGBA 2QM4A 1Z5VA 3SGIA 3A0HZ 1K5SA 3LSSA 3ZMZA 4DXWA 1JX9A 2XT9A 2UXCO 3FB5C 2L35A 3FYEB 3JALA 4YXWG 1H2GA 1N0JA 3NXSA 4PDRA 1BCCH 1G6UA 1IDSA 1YHQV 3ABTA 2EZOA 4L87A 1EBOA 3M99B 1GMGA 3JAWA 4LF7O 3BA8A 5JJJB 4OPHA 3CSXA 1YITV 1N4CA 3H1KH 2UXBO 2R9RB 1OCZB 2B1IA 1F23A 5EBWC 1VEWA 3S3XA 4I4TA 4X88A 4JAAA 2RQ6A 1V55C 2YUAA 1PP9H 4DR4B 1FPOA 4PELA 1E1QG 1SERA 3NR7A 4UCTA 1XQ8A 3SYCA 2CTQA 4B3RO 4QPKA 3AEIA 3KZIZ 3JATB 5H6RA 3G71V 3KKYA 4ZKIA 3ZX6A
chains in the Genus database with same CATH topology
4QGPA 2OIGA 1YXBA 3CRAA 2A7WA 2P06A 2Q9LA 2Q5ZA 2YXHA 2Q73A 1Y6XA 3C90A 2A3QA 3CRCA 5IE9A 2OIEA 1VMGA 2Q4PA 1YVWA 2GTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QGP A;  2OIG A;  1YXB A;  3CRA A;  2A7W A;  2P06 A;  2Q9L A;  2Q5Z A;  2YXH A;  2Q73 A;  1Y6X A;  3C90 A;  2A3Q A;  3CRC A;  5IE9 A;  2OIE A;  1VMG A;  2Q4P A;  1YVW A;  2GTA A; 
#chains in the Genus database with same CATH topology
 3ML0 A;  1NR7 A;  1PKX A;  3OR6 C;  2WWW A;  4I55 B;  3CCU V;  1DF5 A;  1N33 B;  3OW2 U;  3CCE V;  1M9N A;  5CN0 A;  1GKF A;  1KP2 A;  4H13 B;  1N36 O;  1KYO F;  3CC7 V;  2HFE C;  3K08 A;  3OEE G;  3U10 A;  3ETG A;  2UUA O;  4LFA O;  1HR0 B;  3AG3 C;  3EVK A;  5EYP B;  1JA8 A;  3DC5 A;  1AJP A;  3OEH G;  2E5L O;  3SJQ C;  4DV6 O;  1LUV A;  2RMK B;  4YIP A;  1X59 A;  2P4V A;  2Z3Y A;  5JCO C;  3I56 V;  1AI4 A;  5IY5 B;  3SYA A;  2Q6A A;  2R72 A;  3ZHU A;  4QNH B;  4JI4 B;  4LF5 O;  3KG2 A;  3ZHQ A;  2Q4P A;  2ZDI A;  4DV4 O;  1SES A;  3K79 A;  1M1K W;  4X62 O;  2IH3 C;  5A2Q N;  3AG1 B;  2QWO B;  1VQL V;  1RSO A;  1XEQ A;  1M5I A;  5H5N A;  5HFM A;  3BA9 A;  3E8B A;  4LWS B;  1F7Y A;  2IJJ A;  4YHH B;  4MVO A;  2DYR B;  4JYB A;  4LNU A;  4R7C A;  4JAS A;  4KHP O;  2F23 A;  4MTG A;  3J80 N;  1YCI A;  2BE3 A;  4GKJ O;  3B09 A;  2OWO A;  4IHJ A;  2ZE5 A;  1COW G;  3H01 A;  3ZIA G;  1MAB G;  1TUB B;  3G4S V;  2M7W A;  5LHG A;  1Z5W A;  3CCQ V;  3AG4 B;  4Z1V A;  3RYC B;  1GH6 A;  2LO1 A;  1FXK B;  3B40 A;  3CYO A;  2F66 C;  2F4V B;  5HFL A;  5H6Q A;  3ETE A;  2EZP A;  3SJA C;  3IGA C;  4MSW C;  5KHJ A;  2Y0P A;  1V55 B;  2D3O W;  4AQY B;  1D5N A;  1K33 A;  2ILM A;  3E35 A;  5H2F Z;  1GRJ A;  1KBH A;  1Q86 W;  2V1D A;  4TQF A;  4JI8 B;  1S5J A;  2UU9 O;  3O9O A;  4UVA A;  1VIB A;  1PPJ H;  3N27 A;  1J5E B;  2XAG A;  5EC1 C;  4H0L B;  3ZN1 A;  5LYJ A;  2EIL C;  2JJ2 G;  1XUQ A;  1XNR B;  1KB9 F;  5LA6 A;  4ZHQ A;  1H2S B;  1ZSP A;  3W7S A;  1SQF A;  2GV9 A;  1PV0 A;  3B2E E;  2ZNI A;  2QKS A;  3RT3 C;  3OTO B;  4JI3 B;  1AR1 B;  4CC6 A;  5FPO A;  5KA6 A;  2HLD G;  4KXR A;  3CRA A;  1MNG A;  4B3M O;  1R6K A;  2ZM6 O;  5IY5 C;  2QWQ B;  3K0G A;  1ZL8 A;  3CB2 A;  5IYB O;  4IYH A;  1AJN A;  2EIJ B;  2ATK C;  4X20 A;  5DEC A;  3SYQ A;  2HP8 A;  3OTF A;  2PZS A;  1K73 W;  2F93 B;  3AG1 C;  2WLK A;  4CH6 A;  2W6I G;  4ICG A;  1RM1 B;  4NVP A;  3JCU Z;  3DGE A;  4K3A A;  1NJI W;  5KX5 B;  2EIL B;  2JS3 A;  1YZB A;  4LCU C;  5JQG A;  4DR2 B;  4O2B A;  1OCR C;  1JQ0 A;  4Z1M G;  4DUY O;  5CBH A;  1R6T A;  4KHP B;  4YIO A;  2LFS A;  2JEX A;  1JCH A;  4MTX A;  1EN6 A;  5KUM A;  1TUE B;  1MZE A;  1XBL A;  2VQE O;  4DV5 O;  2OTJ V;  2EX3 A;  2IU0 A;  4TQD A;  4MTF A;  4FM1 A;  3UCS C;  4RUF A;  3K57 A;  2Z0A A;  1H8H G;  2QWN B;  3B8M A;  3AG2 C;  4CH4 A;  3BHP A;  2L6L A;  1HR0 O;  2WLH A;  3W7X A;  5DM6 V;  4JI0 B;  1VQO V;  4DR3 B;  2HVK C;  1YJW V;  4DV3 B;  1KP3 A;  3ZCC A;  1R6N A;  4JI2 B;  4DV2 O;  1GN3 A;  1YDX A;  2CDY A;  2W0X A;  3BRC A;  4DV6 B;  4DUZ O;  1JR9 A;  1VQ6 V;  1TA8 A;  1IXM A;  4DK0 A;  4RAI A;  3ZHV A;  4MVR A;  4P2Z A;  4B7E A;  4IL6 Z;  5DN6 G;  2XUM A;  2YEV A;  3L71 H;  4YY3 B;  1P49 A;  3RYI B;  4FJC C;  5IJ9 A;  1W0J G;  2M6Y A;  1FXV A;  1V54 B;  4QE7 A;  4KL1 A;  1SC5 B;  4OX9 O;  3OFN G;  1NZ6 A;  2A0L A;  4OGQ B;  3F5T A;  3VBB A;  4ZOL B;  2RCV A;  3ZHR A;  4DR6 B;  3ZN0 A;  4IYI A;  5KAI Z;  1SQQ H;  1FKA O;  4FVM A;  1PNL A;  2R70 A;  1IBK O;  2N74 A;  2P90 A;  4MW3 A;  4JI1 O;  3E8F A;  2OIG A;  5IYC O;  1VQN V;  2Y69 B;  1SA0 B;  2DQ3 A;  2OCC B;  1QNM A;  1WLE A;  4JV5 O;  5LXT A;  4UCU A;  2BTO A;  4I9Q A;  2JK5 C;  4KP4 A;  4PJ0 Z;  5GW7 A;  1BHA A;  2P6J A;  2XND G;  2CTR A;  4QGP A;  2JDI G;  2UUC O;  2ZE8 A;  2Q8V A;  4J41 A;  5JVD A;  5C8Y B;  2ZQM A;  2W6J G;  1EN4 A;  2X0L A;  3SJB C;  3K0D A;  1OCZ C;  3L70 H;  1XNQ O;  4J7K A;  1KU9 A;  1I5Y A;  4MS2 A;  5B3S C;  4CS4 A;  3X2Q C;  2W0F C;  2H8P C;  2BOB C;  2RJZ A;  3ZMU A;  5KAF Z;  1XIL A;  4OPA A;  1S5H C;  1YF2 A;  1ZAU A;  3DXR B;  2HR3 A;  1ZX3 A;  2QTS A;  3CRC A;  4K8X A;  5J2U B;  1XMO B;  3FAV A;  5CA0 A;  3CRM A;  2UUA B;  2AZ0 A;  3ZMT A;  4UVC A;  5J2T A;  4MVQ A;  4O4L B;  4I0X A;  4NKG B;  5KHH A;  5IJ9 B;  3RYH B;  4K35 A;  1SKV A;  3FB7 C;  2QGN A;  4O2A B;  2JRI A;  2VRZ A;  3BVO A;  3OT7 A;  2PI5 A;  4JI4 O;  4BIU A;  2QKC A;  2YXH A;  4FFB A;  2ZDI C;  2XAH A;  4TUY B;  2A7W A;  1KD1 W;  2YS8 A;  1PD3 A;  1FFT B;  3ZRV A;  1VQM V;  1BSM A;  3CS5 A;  1Y66 A;  1LR1 A;  2CTP A;  4JI6 B;  2EJ7 A;  1LNQ A;  4HNA B;  4WCE V;  2YIC A;  4PI2 A;  2CH7 A;  4AI8 A;  1XRE A;  1BQ0 A;  3HKD B;  2DJV A;  5CBF A;  3AK3 A;  1BL8 A;  2V4D A;  3E89 A;  2E5L B;  3Q4H B;  4QIW F;  3OR7 C;  5CMU A;  3FFQ A;  2PUS A;  3D3Q A;  4JAU A;  3SJC C;  2OYQ A;  4GKJ B;  1WA8 B;  2QE7 G;  5JH7 A;  1IBK B;  4DUY B;  4R6Z A;  2EJR A;  2VS0 A;  2OIE A;  3RBZ A;  2YXL A;  5IE9 A;  2XAQ A;  4ZIB A;  1JJ2 U;  3RYI A;  1ZLZ A;  2DQ0 A;  3ABL C;  4OXS A;  3LSU A;  3RFR A;  1PL0 A;  5LOV A;  5IYZ B;  5H9C A;  3T1Y B;  1YJN V;  4X1I B;  5GTI Z;  3AG7 A;  4J10 A;  1H38 A;  4GX0 A;  1QU7 A;  4J7J A;  2XOK G;  4PA9 A;  5FNV B;  1K4C C;  2Q68 A;  4DUZ B;  2QM8 A;  5B1A C;  2QWR B;  1QBZ A;  4DW0 A;  2UXN A;  1SS3 A;  1ARO P;  3CMA V;  2WLJ A;  3AG2 B;  2DOS A;  4O4I B;  1S0V A;  1HNW O;  4C7U A;  4NXN B;  1KC8 W;  3IAY A;  2ADQ B;  1XL6 A;  1I94 O;  3P3N A;  4PDV A;  5LGU A;  4X89 A;  1WP7 A;  2BOC C;  1S72 V;  4BIO A;  5FPR A;  4DV7 B;  5KX5 A;  5KMG A;  1N32 B;  1FFX A;  2AXT Z;  2BTQ B;  4TV9 B;  1YXB A;  4O2B B;  2JIZ G;  1R3K C;  1YTF B;  4LF6 B;  1L0L H;  4LR3 A;  4B3S B;  3ABL B;  1PNM A;  4UXN A;  4ABM A;  5TIS Z;  3BFR A;  5LGN A;  1HNZ B;  1I5X A;  1G1X B;  2UU9 B;  3SR2 C;  4JI7 O;  5BR8 B;  5IWA O;  1XOU A;  1NTZ H;  5KHG A;  3ZRS A;  1THZ A;  1R73 A;  4QJF B;  4LP8 A;  3K58 A;  5ITZ A;  4HYO A;  3MD0 A;  2GUZ B;  3UKM A;  1BZK A;  3G6E V;  1FXK C;  4H33 A;  3CCS V;  3T4Z A;  3E8G A;  1K92 A;  4LH6 A;  5EC2 C;  3ZHT A;  5IJ0 B;  4JYA O;  2ZNJ A;  3ZED A;  4I7Z B;  1BHB A;  2FKX A;  1XHX A;  4CH5 A;  2QDO A;  4X1I A;  3CC4 V;  1UJW B;  3ABM B;  2YEV B;  3K5N A;  1L0N H;  1XNR O;  2V7Q G;  5B1B C;  4J9Y B;  3CP1 A;  3FX7 A;  2IJH A;  3KCY A;  3D3I A;  3DXR A;  3JAL B;  4PDM A;  5LP6 B;  1CXZ B;  4ZOL A;  3SPI A;  3P3P A;  5LMN O;  3R65 A;  2ARH A;  1M4U A;  4PA4 A;  1YI2 V;  3X2Q B;  2JJ1 G;  5A9G A;  3JAW B;  4RQF A;  4DV2 B;  2FL4 A;  2HJF C;  3FYI B;  4FLX A;  1RPO A;  1TUB A;  3HKB B;  1Y76 A;  4BIZ A;  4LF8 B;  4UB6 Z;  4DR7 B;  1HP8 A;  2C2A A;  2HJD A;  3JAK B;  2NLJ C;  1XHZ A;  3JYC A;  3QNE A;  2ETN A;  4R8C A;  2BTQ A;  3GWK C;  3CC2 V;  3ZRW A;  3UO3 A;  4JTA B;  1GM9 A;  3ABM C;  2IU3 A;  3GWO A;  1VQ7 V;  5K1X A;  4MW8 A;  1ENV A;  1ZTE A;  4I55 A;  1IX9 A;  2Y4T A;  3U11 A;  1I94 B;  1D5A A;  4FM2 A;  2YSU B;  4NTX A;  5DED A;  4YJ3 B;  3QO8 A;  1DLB A;  5B1N A;  4JI1 B;  2F43 G;  1T5E A;  4Q20 A;  2K1E A;  5KLV H;  1H8E G;  5LBQ A;  1AR5 A;  1R1B A;  3FD9 A;  1Q82 W;  4J80 A;  5LP6 C;  2WLI B;  2EIN C;  2YDE A;  4LC1 A;  5CBG A;  3HR0 A;  4H37 A;  3GVM A;  4HZ3 A;  5JH7 B;  1DGS A;  3WU2 Z;  4XDJ A;  1B6Q A;  1KMI Z;  1HWY A;  2A06 H;  4B3R B;  5J2T B;  4B3T B;  2IH1 C;  4FM0 A;  4JI7 B;  2ODM A;  1EFR G;  4JZ2 A;  5CB4 B;  1WNS A;  2NR5 A;  3ABK C;  3TXS A;  2Q69 A;  3TK1 A;  4NTY A;  2Q73 A;  1GM7 A;  1TVK A;  4DV1 O;  3O65 A;  4YY3 O;  5JCO A;  1F4M A;  1E1R G;  2HHH B;  1AB3 A;  4AIL C;  2LJ2 A;  5B5E Z;  4DV5 B;  4DO2 A;  1FXK A;  3J7A U;  4W4K A;  1RP3 B;  1SET A;  3LSQ A;  2ITD C;  4P30 A;  1GN6 A;  2ZD9 A;  1G8M A;  3E2E A;  5KHK A;  1YVW A;  4X64 B;  2EIK B;  4GZR B;  2WLN A;  3J81 N;  4PA6 A;  1FAF A;  2JGU A;  5KHI A;  3TET A;  2GUZ A;  4F4L A;  4D7T A;  3MDS A;  1N8R W;  1OCO B;  3JD1 A;  4MT8 A;  5B66 Z;  4LFC B;  1EZV H;  3P32 A;  4JGS A;  3A0B Z;  4WFA V;  1I7F A;  1DK1 A;  4RWU A;  5BMV A;  3C3S A;  1CP9 A;  1FXH A;  2XAS A;  4YHH O;  2GTS A;  3QO7 A;  2DYR C;  4O4J B;  2YI9 A;  3K3W A;  4YJ3 A;  1Q3E A;  3CEI A;  1XI1 A;  4LF8 O;  2KG7 B;  1W59 A;  3H9V A;  4JI6 O;  4MTO A;  1R3J C;  4MVS A;  4X8A A;  1K3E A;  2E76 B;  4IIJ A;  1Q6I A;  5IDJ A;  5D5Q A;  2YID A;  2Y48 A;  3JD3 A;  3K06 A;  1XNQ B;  5EZY B;  4B7K A;  2HEP A;  4BAY A;  4JAV A;  4GX1 A;  2DYS C;  2YIB A;  4KFM A;  5EIB C;  4X9Q A;  1FYJ A;  3RVZ A;  1YSC A;  2VWK A;  4GYC B;  3C3T A;  4TSF G;  3OMI B;  1OCO C;  1BS3 A;  4UV8 A;  5C93 A;  1Y76 B;  2UXD O;  2GDS A;  3FKS G;  3PN1 A;  1SF9 A;  3D36 C;  4XBF A;  3QTC A;  4I9W A;  1US6 A;  2WA4 A;  2X6A A;  5JQG B;  4AQY O;  3L72 H;  1VQ9 V;  3H1H H;  2A3Q A;  1F4N A;  1R3L C;  2K9P A;  1XMQ B;  2PF4 E;  2XHB A;  1GK9 A;  3IFX A;  2JEU A;  1SQG A;  1VQK V;  3ZMS A;  1FJG B;  5LP6 A;  3C90 A;  1NVP D;  3ABU A;  2VWJ A;  3VQY A;  1SQP H;  3CX5 F;  2CAZ C;  1NR1 A;  4RUE A;  4TV9 A;  4UCR A;  4LF9 O;  2FTK A;  1XL4 A;  4A5U B;  2FYU H;  5LXT B;  3K9A A;  2CUG A;  3UT5 A;  4O4H A;  2P5O A;  2LW7 A;  2FML A;  1IVS A;  3L9D A;  2Z5U A;  5GTH Z;  3CXH F;  4EFB A;  4JPR A;  3ASN C;  2GBO A;  4MVM A;  2F95 B;  2KSD A;  3BAA A;  1MG1 A;  2E75 B;  2P06 A;  3SPG A;  4JI2 O;  4G27 B;  4X1Y B;  4RO2 A;  3N2G A;  2JVD A;  3E22 B;  2EIM B;  1TAE A;  3HKC A;  4X64 O;  1K34 A;  1GN2 A;  3D36 A;  1B06 A;  4G28 B;  3HKE A;  2G38 A;  2AHY A;  1B04 A;  1Q5O A;  3WB1 A;  3CWB H;  3ETD A;  1WPB A;  4FLT A;  3SPJ A;  3JCZ A;  1MOF A;  1HNX B;  1M57 C;  2PTM A;  2DN9 A;  2E3C A;  1V9P A;  5IWA B;  1A32 A;  2ZIM A;  2WLI A;  3APQ A;  4JTC B;  4IGG A;  3JAS A;  5LGT A;  2EBO A;  3RWR D;  2B1G A;  4JI5 O;  1AVM A;  5D5P A;  4GLX A;  3ZBH A;  4GKK O;  2PY5 A;  1OCR B;  3HPL C;  4NR1 A;  4EKW A;  3F5W C;  3LNM B;  2GSM B;  3THO A;  2UXC B;  2ITC C;  2JGD A;  5CB4 A;  4UFZ A;  4DYL A;  4K8Z A;  2ZXW C;  1SQV H;  1AP6 A;  1AIL A;  3E8H A;  1YEW A;  4LFB O;  4FFB B;  4LF6 O;  1NVP B;  1RPR A;  2LP7 A;  3HKB A;  1MMM A;  2WA3 A;  1MSD A;  2RN9 A;  3ICX A;  5E79 Z;  4WFG A;  1NTK H;  2P67 A;  2Q9L A;  4DR3 O;  2LFR A;  3ZJZ A;  5JVD B;  2Q0O C;  3T2M A;  4BR6 A;  3FB6 C;  2PYJ A;  4JYY A;  2X7R B;  2UUC B;  4NXM O;  4DRX B;  1GAX A;  4U7N A;  2AGA A;  5FL7 G;  2AW9 A;  2Q7E A;  1N32 O;  3KCX A;  1Q8I A;  1KKC A;  2EIJ C;  4I50 B;  4U3J A;  1NI8 A;  3L74 H;  2WLL A;  3STZ C;  1IUR A;  1Q6U A;  2QA4 V;  1WA8 A;  1IBM O;  1ZUQ A;  2Y0I A;  3SYO A;  3GB7 C;  3CRQ A;  3TJT A;  5IYD O;  4UCS A;  2B5U A;  5CA3 A;  4QE9 A;  3W7U A;  3EFF K;  2DWD C;  1NQT A;  1HNW B;  4F6E A;  4IT5 A;  1Y67 A;  1Q6H A;  2DE0 X;  4QPJ A;  1L8D A;  5BXZ A;  1H2L A;  1O9G A;  1B3Q A;  1NTM H;  2R9I A;  3OGC C;  1EM1 A;  2WSS G;  5IT9 N;  3DSQ A;  1Z2G A;  1SZX A;  5L3G A;  4X66 O;  4HBN A;  1P84 F;  4CZZ A;  2IBZ H;  3RYF B;  4WBN A;  1YJ9 V;  1Y6X A;  1WB8 A;  2OCC C;  3K5O A;  3LDC A;  1F51 A;  3K03 A;  1JMK C;  5E1A C;  4EEQ A;  3ASN B;  4WFE A;  1PNK A;  4TUY A;  4B3S O;  1BQZ A;  2IM9 A;  3JAT A;  4LBE C;  4J7Z A;  3JAR B;  3FAV B;  3JD4 A;  2KKW A;  5CA0 B;  3OMN B;  3A8T A;  1JFF B;  3TCU A;  2UXD B;  1KQS U;  3QF7 A;  4O4L A;  3UO2 A;  1K97 A;  2ZR3 A;  3LDD A;  3OD4 A;  3Q4H A;  3CCM V;  3JSN A;  1H2N A;  4O2A A;  1U97 A;  5L3E A;  4DR4 O;  4KUM A;  4I5S A;  3SPC A;  4WFB V;  1K8A W;  4UB8 Z;  2WPD G;  1IXB A;  3E86 A;  1KEC A;  4X1Y A;  4DR7 O;  3CHX A;  3HKC B;  4K0K B;  4NYK A;  1UFI A;  3QO5 A;  4FZ1 A;  4I50 A;  4U3J B;  3HKE B;  5BMV B;  1S3J A;  5L3C A;  4P9O A;  4P9P A;  4O4J A;  4EFE A;  5LMU O;  4FLZ A;  1PM9 A;  2HVJ C;  3OUS A;  3K04 A;  4XDL A;  2X6C A;  1GO3 F;  3B4S A;  3W7W A;  1N34 B;  4LWS A;  4DV0 B;  1EZJ A;  1U96 A;  3QVN A;  2LQT A;  3UM7 A;  3K5L A;  4H44 B;  1IBL B;  4X65 O;  1K9M W;  5EZY A;  4O4I A;  3VQX A;  3WB2 A;  1BT8 A;  4WBN B;  2BSK B;  3LDE A;  4DV1 B;  1ORQ C;  2Y4U A;  3UQ8 A;  4LF4 B;  2LW1 A;  1VF5 B;  5EK0 A;  3AG3 B;  4I0X B;  3AK1 A;  4DV4 B;  1P7G A;  3BCC H;  4FZ0 A;  2YI8 A;  4UV9 A;  5B1O A;  5BY1 A;  1BE3 H;  2UUB B;  3BY6 A;  3JAR A;  2ZT9 B;  4NB5 A;  1H2M A;  4DV7 O;  1M90 W;  5FNV A;  1IZ3 A;  4X1K A;  3CME V;  1JPX A;  4DR5 B;  3ASO C;  3STL C;  4N21 A;  4LNU B;  4FFK A;  4F6R B;  1R3I C;  3IC7 A;  1BGY H;  3BAB A;  4DR1 O;  3EHB B;  4LF7 B;  2D2C B;  1EN5 A;  4JTD B;  2GTA A;  4MVZ A;  3ZRW B;  3T1Y O;  1OCC B;  2Q5Z A;  2OCH A;  3G6B A;  3OUF A;  4O4H B;  4DK1 A;  2LGW A;  2ZM6 B;  3DC6 A;  2ADP A;  4EB6 B;  4CH3 A;  1OJH A;  2QEX V;  4YJ2 B;  4NXM B;  3ZRX A;  3RYC A;  1XMQ O;  3B77 A;  5KUK A;  2LGQ A;  1HW7 A;  3G67 A;  1QLN A;  3CE2 A;  3E22 A;  1SZT A;  1Y74 A;  1IBM B;  1WB7 A;  1PL4 A;  5JJN B;  2ZCE A;  1JJO A;  1AP5 A;  5LHH A;  4DR2 O;  2WLL B;  1N0N A;  3APO A;  1KKD A;  1K4D C;  3OMA B;  1N36 B;  1M93 A;  1QVF U;  4J11 A;  3CRR A;  3N2K A;  3K59 A;  4LFA B;  3WG7 B;  3T1H B;  2HKO A;  4Z2W A;  2QKA A;  2P7T C;  2KB1 A;  2IW5 A;  1K7D A;  5LYJ B;  1VQ8 V;  2QJ1 A;  4X66 B;  2PI4 A;  3CJH A;  3DTU B;  5LA6 B;  4D6T H;  4LFC O;  3JAK A;  3G80 A;  2JS5 A;  5L3F A;  1J95 A;  2XTA A;  4ZBM A;  1DF4 A;  4JI0 O;  4BW5 A;  1FJG O;  2DWE C;  1N34 O;  5BR8 O;  4TV8 A;  4JZG A;  2JGD B;  3RW0 A;  3OGI B;  1G4Y B;  1VF7 A;  4DV0 O;  1SRY A;  2QTO A;  2DYS B;  3CCJ V;  3MHH C;  1D2D A;  3CPW U;  5B3S B;  1M56 C;  1FFX B;  2QSA A;  5K1P A;  1AJQ A;  4JYA B;  3JD2 A;  1QLE C;  1V54 C;  2N04 A;  4X20 B;  4DRX A;  5EIB D;  2H94 A;  3L75 H;  4FPP A;  4J9Z B;  3A0R A;  1VP7 A;  2CK3 G;  2Q7G A;  3VQV A;  3ZS8 C;  3LUT B;  2A79 B;  2YIA A;  2MK3 A;  2R9A A;  5L3B A;  1S77 D;  3VQW A;  5EBM C;  4PV1 B;  2NNU A;  1VF6 C;  1MA1 A;  2WAM A;  2Y69 C;  1HNX O;  1JVM A;  3H1L H;  1K5Q A;  1QCE A;  3TGU H;  4B3T O;  4CS3 A;  3PJS K;  1QR8 A;  1VQP V;  5LHI A;  5J9P C;  2VQF B;  1NH2 B;  4HAM A;  1Y4M A;  2Q67 A;  4UVB A;  4ZI7 A;  1VQ5 V;  4JI5 B;  2EUL A;  5LL6 Y;  1OCC C;  1XDC A;  3RYF A;  3K5M A;  3SPH A;  1WPX A;  3H1J H;  2OTL V;  1M56 B;  1W0K G;  2ZIN A;  4TOI A;  4X1K B;  4X65 B;  1P7B A;  1NS1 A;  2MW2 B;  4LFB B;  4PA7 A;  3QG5 A;  2QR4 A;  4JF3 A;  2PYL A;  2OT5 A;  4D7S A;  1SA0 A;  3MAQ A;  1ZL8 B;  3BEH A;  1WN7 A;  5BZB A;  2P4K A;  2BSK A;  5F2V O;  4TV8 B;  4MVU A;  4E2L A;  4W4L A;  1GTO A;  2E74 B;  1L1F A;  4GKK B;  2O57 A;  1MSW D;  4TT3 G;  4NTW A;  4DR6 O;  1ZWI C;  3U0Z A;  1UPG A;  3M7M X;  4PD4 F;  1TVK B;  1M57 B;  2EIN B;  3ZMV A;  2YXY A;  5GON B;  3W7T A;  3T1H O;  4U7O A;  4RQE A;  3MHS C;  1VF6 A;  1HDJ A;  3I5D A;  2CGO A;  2CH7 B;  4JI3 O;  5EBL C;  1RFY A;  3RN4 A;  3CD6 V;  1SQB H;  4PI0 A;  3CCV V;  3UT5 B;  1TGO A;  3AK2 A;  4TWK A;  2UXX A;  2ZR2 A;  2WLM A;  1O9H A;  4IIJ B;  4F6R A;  4JV5 B;  1QR9 A;  3ETQ A;  1BMF G;  4WFH A;  5J2U A;  3F7Y C;  1I0H A;  1NBM G;  5L3D A;  2EIK C;  1DTO A;  2HHH O;  2Q7H A;  4FLV A;  1VQ4 V;  1FD9 A;  4FK5 C;  4EB6 A;  1QQC A;  3CXC U;  3AG4 C;  4JYC A;  5CA1 A;  3IC9 A;  3S3W A;  3VOU A;  4JI8 O;  1QHT A;  2YC0 A;  1FS0 G;  3OTO O;  1QLE B;  4FLU A;  2X6B A;  3OAA G;  2KQX A;  1AR4 A;  3OM3 B;  4E4E A;  1QVG U;  1J5E O;  1S5L Z;  2Q0A A;  4PA3 A;  4I4T B;  4L8J A;  2KG7 A;  2UXB B;  1YIJ V;  1E79 G;  3JAM N;  3L73 H;  1AI7 A;  2NN4 A;  1W2B U;  4XDK A;  3JD0 A;  1SQX H;  5AG2 A;  1NU1 H;  3WFV A;  1Q43 A;  4DW1 A;  3JSL A;  2ZIO A;  5KA5 A;  4N23 A;  3ZHS A;  4CC5 A;  3RVY A;  4FLY A;  4IHJ B;  1IBL O;  1URF A;  1N33 O;  4LF9 B;  4B3M B;  3RYH A;  2GHY A;  3EXA A;  1H2K A;  1Q90 D;  1CPY A;  2P22 C;  1YTF D;  4LF4 O;  4FMT A;  2ZE6 A;  2BCC H;  5EYP A;  4PHZ A;  1NT2 B;  2VQE B;  5B1A B;  3T1C A;  4GT1 A;  2QWP B;  5LMU B;  2YIB D;  4AHC A;  3B8N A;  2DW4 A;  4B08 A;  3CCL V;  2UUB O;  1WJZ A;  3I55 V;  1X4T A;  1VMG A;  4YJ2 A;  3H1I H;  5IYZ A;  1JOY A;  5C8Y A;  4GCZ A;  4HNA A;  2H3O A;  4DV3 O;  2XAJ A;  5ITZ B;  3HB3 B;  3IJ4 A;  2AZ2 A;  1AI5 A;  2DMX A;  3OE7 G;  2IJK A;  4Q6G A;  1RSO B;  1RM1 C;  1Q7Y W;  2ZE7 A;  1Y74 B;  2AHZ A;  3P30 A;  5FLX N;  3D8C A;  4G2K A;  4UUJ C;  5JJE B;  3JAS B;  3LNN A;  5CA1 B;  1AI6 A;  4J42 A;  1LUW A;  4ZHQ B;  3TXQ A;  4CBC A;  2QM7 A;  1HNZ O;  4OX9 B;  2N05 A;  4LH7 A;  3N2K B;  4UCV A;  3N2G B;  3SYP A;  4U3F H;  1OZ0 A;  2VQF O;  2IJI A;  2CTW A;  4BW9 A;  3CJH B;  5LOV B;  1ROP A;  1VAR A;  1MZF A;  4K0K O;  3WB0 A;  4WF9 V;  4FIP C;  4ZI7 B;  3M8A A;  3A2F A;  3SDL A;  1P4R A;  1Q81 W;  1JFF A;  4GUN A;  4DR1 B;  5JWP A;  1XMO O;  4NXN O;  2HG5 C;  2F4V O;  2XAF A;  1NH2 D;  3E83 A;  3F7V C;  5B1B B;  4ASU G;  1OHH G;  4UCO A;  1WP8 A;  1WAZ A;  2CE4 A;  1CEZ A;  2B9Z A;  3T4D A;  4CS2 A;  2F1M A;  2EIM C;  4DR5 O;  4FLW A;  4GX2 A;  1OV9 A;  2A9H A;  2CGN A;  3CCR V;  4LF5 B;  3K9S A;  1I08 A;  3HKD A;  3R66 A;  1S76 D;  4PDL A;  1KUQ A;  3WG7 C;  4GX5 A;  4X62 B;  5LMN B;  4R50 A;  4WFF A;  2ZXW B;  2ZKO A;  5IJ0 A;  3FB8 C;  5GON A;  3ASO B;  5KMG B;  2FB5 A;  1NKD A;  2PGG A;  4BWA A;  1GM8 A;  3ABK B;  1GN4 A;  3BPZ A;  2RDC A;  2RNB A;  3RGB A;  2QM4 A;  1Z5V A;  3SGI A;  3A0H Z;  1K5S A;  3LSS A;  3ZMZ A;  4DXW A;  1JX9 A;  2XT9 A;  2UXC O;  3FB5 C;  2L35 A;  3FYE B;  3JAL A;  4YXW G;  1H2G A;  1N0J A;  3NXS A;  4PDR A;  1BCC H;  1G6U A;  1IDS A;  1YHQ V;  3ABT A;  2EZO A;  4L87 A;  1EBO A;  3M99 B;  1GMG A;  3JAW A;  4LF7 O;  3BA8 A;  5JJJ B;  4OPH A;  3CSX A;  1YIT V;  1N4C A;  3H1K H;  2UXB O;  2R9R B;  1OCZ B;  2B1I A;  1F23 A;  5EBW C;  1VEW A;  3S3X A;  4I4T A;  4X88 A;  4JAA A;  2RQ6 A;  1V55 C;  2YUA A;  1PP9 H;  4DR4 B;  1FPO A;  4PEL A;  1E1Q G;  1SER A;  3NR7 A;  4UCT A;  1XQ8 A;  3SYC A;  2CTQ A;  4B3R O;  4QPK A;  3AEI A;  3KZI Z;  3JAT B;  5H6R A;  3G71 V;  3KKY A;  4ZKI A;  3ZX6 A; 
#chains in the Genus database with same CATH homology
 4QGP A;  2OIG A;  1YXB A;  3CRA A;  2A7W A;  2P06 A;  2Q9L A;  2Q5Z A;  2YXH A;  2Q73 A;  1Y6X A;  3C90 A;  2A3Q A;  3CRC A;  5IE9 A;  2OIE A;  1VMG A;  2Q4P A;  1YVW A;  2GTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...