2OIGA

Crystal structure of rs21-c6 core segment and dm5ctp complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
PFRFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKSDTEPGPQAWPPKERAALQEELSDVLIYLVALAARCHVDLPQAVISKMDTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RS21-C6
publication title Crystal Structure of RS21-C6, Involved in Nucleoside Triphosphate Pyrophosphohydrolysis
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 26
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.12: dCTP diphosphatase.
pdb deposition date 2007-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2oigA00
2GTAA 3C90A 1Y6XA 2OIEA 2OIGA 3CRCA 4QGPA 2Q9LA 2Q73A 3CRAA 2A7WA 2Q4PA 1YXBA 1YVWA 2Q5ZA 2YXHA 2A3QA 5IE9A 2P06A 1VMGA
chains in the Genus database with same CATH superfamily
4MTFA 5DM6V 4DRXA 1Q90D 4ZHQB 1Y6XA 4GCZA 2QWRB 3BCCH 1AJQA 1G1XB 2W0FC 2F43G 1D5NA 2QR4A 2CGOA 4DRXB 2UUBO 1E79G 5LMNB 5IT9N 1OCRB 4MS2A 5B66Z 2Y0IA 4WBNA 4GX1A 1V55C 4I7ZB 4CH6A 1P49A 4LWSA 1M93A 3L74H 3NR7A 3K9SA 1R1BA 1FFXA 4LF4O 1I94O 4E2LA 4RUEA 4P9OA 2AXTZ 4FVMA 2L35A 2DOSA 3F5WC 4DXWA 2PYJA 4MVOA 3RGBA 4QE9A 2VWKA 2W0XA 2R70A 1XEQA 3AG7A 2PZSA 1QBZA 2QJ1A 3QO7A 4L87A 3PN1A 2Z5UA 4O4HA 4JI6O 1JCHA 2QE7G 4H37A 1H2GA 2ZDIC 1CPYA 3EHBB 5GTHZ 5IJ0B 1B06A 4Q6GA 2FL4A 3ZMUA 5HFMA 1WB7A 2F23A 2PY5A 1YF2A 4JTAB 2EIMC 2FYUH 3WG7C 4LCUC 4B08A 2ZR2A 2P67A 3ML0A 3FX7A 3ZRVA 1HNZO 1FS0G 3OAAG 2Y69C 1M56B 1K4CC 4I4TB 3OFNG 4TT3G 1W59A 4DR5O 1FPOA 2ADPA 3OR6C 2DE0X 1TA8A 4X1KA 5EIBD 1Y67A 1EN4A 2XOKG 1R3LC 2ZXWC 4O2BA 5J2TA 1B3QA 4DR7O 1J5EO 3JCZA 5IJ9A 1IXMA 3AK1A 4GYCB 2DMXA 4R6ZA 3AG4B 1QHTA 4YJ2A 3KCXA 3JD0A 2P06A 2EJRA 3AG3B 5EBMC 5LXTA 3BPZA 3OTFA 2PGGA 4WFFA 3ABKC 4TOIA 3QO5A 2A0LA 2K1EA 1FXKA 3CYOA 2CTWA 1QVGU 2JEUA 3CXHF 3IC7A 5JJEB 1JOYA 1FJGB 1EM1A 1H2LA 3BA9A 5L3EA 3X2QB 1DGSA 5EZYA 1OCZC 1SZXA 3ZRWB 3OMNB 4WF9V 3KKYA 2EX3A 1KQSU 3TXQA 2DW4A 5EZYB 1UFIA 4DV1B 4OXSA 1EBOA 4LFBB 1Y76B 4B7EA 1I5XA 4UVBA 3CC7V 4DR2B 1YHQV 1R73A 2JK5C 2V1DA 3HKEB 4D7TA 1JJ2U 1JA8A 1TUBA 4PI2A 3OGCC 3BAAA 4G27B 3FKSG 1BQZA 2AZ0A 4QIWF 4FM2A 4JI7B 2JDIG 3ABLC 2Q5ZA 2UUAB 4JYAO 3W7WA 3T1YB 5L3FA 2FB5A 2LW7A 1VP7A 4JPRA 2DQ3A 1TAEA 3UKMA 1BQ0A 3E22B 2ZNJA 3L70H 1JPXA 4DV0B 1SQFA 4TUYB 5LYJB 1MA1A 2F4VO 4KHPO 4JI2O 4ABMA 3CCRV 4X64B 1SF9A 1V54C 1JQ0A 2E74B 4X9QA 5BXZA 3JARA 3H1LH 2CK3G 5L3BA 1AILA 4IHJB 2WLNA 4KFMA 1IVSA 4RUFA 2R9IA 5KHJA 4PJ0Z 3U0ZA 1WNSA 3VQWA 1AJPA 3AG1B 1N8RW 2MW2B 3ZRSA 4JI0B 3ASOC 1HDJA 2E5LO 1RPRA 4UCSA 2Y48A 2YSUB 1H8HG 3K08A 2X7RB 3L73H 1GK9A 5LGNA 4MW3A 4Z1MG 3D36C 2IJJA 4DR6B 2M6YA 1VIBA 3K0GA 1KKDA 5GONA 2K9PA 2AHZA 3JD2A 4TV9A 4X62B 5LMUO 4UB6Z 1AR4A 4BW5A 3BA8A 2EINC 5A9GA 2IJIA 1JX9A 1G6UA 1SQQH 4B7KA 2ITDC 3M99B 4LP8A 3OUSA 3JAWA 2Q7EA 1Z5WA 1BHAA 4RO2A 1YSCA 4MTXA 5CBFA 5IYZB 3H1KH 4AILC 2UXBB 1KECA 4UUJC 5B3SB 2QWOB 1K92A 1R3IC 3N2GA 1ZUQA 3QG5A 5IY5B 5JVDB 2ZD9A 4B3TB 2Q67A 5KHGA 3JATB 3IC9A 2OCHA 3S3WA 2IJKA 2ZINA 5D5PA 2LO1A 2Q4PA 5FNVA 2EJ7A 1QCEA 3H1JH 1VQMV 3BY6A 3GWKC 2YI8A 3LSUA 5KHHA 2ZM6O 5CBGA 4LF9O 2CDYA 1I94B 3T1HB 2OIEA 2OIGA 2UXDO 1GAXA 3CRCA 4IL6Z 2UXXA 1XHZA 4DUYB 5JWPA 3P32A 4U3FH 5JCOA 5B1AC 4PELA 3Q4HA 3CSXA 4FM1A 4NXMB 2UU9O 1I7FA 1XMQB 1WN7A 3BHPA 4ZI7A 1QQCA 3K79A 3M8AA 3CRQA 1FD9A 3G6EV 1VQ7V 1PPJH 1IURA 2IU0A 3OR7C 3K57A 2DYSC 2XASA 3SYAA 2Y4UA 4MTGA 2LGWA 1M57C 3CB2A 4GKKO 1WPXA 3QO8A 1ROPA 1AB3A 5B1BC 2GUZB 3RWRD 1PD3A 2QTSA 1S5HC 3K5NA 5EIBC 5FPRA 4DV6B 3H1IH 2LW1A 4DUZO 3JD1A 1UPGA 3CMAV 3CC2V 2QSAA 2FKXA 4O2AA 2QTOA 4L8JA 4BAYA 3H1HH 5FPOA 4GKJB 1PL0A 2FTKA 2ZE6A 3K06A 2Z0AA 5BMVA 4ASUG 3CCMV 2EIJC 3A0RA 4O2AB 4K8XA 3C3TA 3DXRA 3J7AU 4JI1B 1N36B 5IYBO 4NTYA 3LNNA 4JI5B 2PF4E 2ZCEA 3BABA 4J80A 4ZIBA 2KB1A 5LA6A 4FLUA 3UQ8A 1QLEB 3KG2A 3CJHB 3LSQA 5E1AC 4ZOLB 4QNHB 1R6KA 4X1YA 2ETNA 4B3MB 1Q6HA 3N27A 1XNRO 4DV7O 3ZX6A 2NR5A 1H2MA 4LF7B 1DF4A 2BOCC 4X1IA 1DTOA 3UT5B 4J9YB 4LFCO 1QNMA 4NVPA 4LFAB 3CRAA 3OUFA 2BTQA 4K8ZA 1RPOA 1VF5B 3I55V 2X6AA 1PNKA 1N34O 2A3QA 1BZKA 2DQ0A 4DV2O 4K0KB 1GMGA 4LF5B 4CZZA 4AQYO 3ETEA 2VQEB 1XQ8A 1F23A 3OTOB 3DC5A 2CTQA 4GX2A 4B3SO 2A7WA 3GB7C 1FAFA 1AJNA 4UCUA 3FB8C 2B5UA 4JYYA 3SJQC 4DR1O 3KZIZ 4JV5O 2ZDIA 1LUWA 1Q3EA 3IAYA 1ZWIC 2XT9A 1NR7A 2G38A 1IBKO 5GTIZ 4X66B 2CH7A 5C8YA 2HEPA 1Y74A 3W7XA 1LR1A 1PNLA 3H01A 4F6RA 2XTAA 1N0JA 3RN4A 4O4IA 1Y74B 3WG7B 4PV1B 2Y69B 1KP3A 3A8TA 2RNBA 1M9NA 4CS2A 5KX5A 2YICA 1XOUA 2ZR3A 3FAVA 2XNDG 3ZN0A 4LF8B 2NLJC 2WLLB 2DWEC 1XL4A 1AVMA 2CGNA 5EYPA 3RVZA 4BIUA 2X0LA 4UXNA 5LP6C 3HKDB 4HZ3A 2LFRA 1VQ6V 1KMIZ 4X65B 4EFEA 2DJVA 5LOVB 3G4SV 3OW2U 1WLEA 1IXBA 4CBCA 3CS5A 5KMGB 1DK1A 2RMKB 2AGAA 4DO2A 2UXCO 3ETQA 2QWNB 5LGTA 1TVKB 2P4VA 5EC1C 5IYCO 1OCCC 4YIOA 5J2UA 3SYOA 1M90W 3DTUB 3HKCA 3K5LA 1N32O 2IH1C 4MVQA 4EFBA 4NXNB 4FLWA 3MDSA 2R9AA 1M5IA 4GZRB 3JAKB 2HR3A 3ZS8C 1I08A 2R72A 3SYQA 2NNUA 2HP8A 3D3QA 1H2KA 3TXSA 4D6TH 2ZE8A 3IJ4A 2KG7A 1ENVA 4FLZA 4C7UA 3ZMSA 1F4MA 1Q81W 2GTAA 2JGDA 2E75B 2Q9LA 2MK3A 1MABG 2WSSG 4N21A 4FM0A 3RBZA 5KUKA 4WBNB 3W7UA 2ILMA 1L0NH 2JGDB 2YIBA 1OCOC 3R65A 4LWSB 3ABLB 1X4TA 2B9ZA 1FFXB 3DC6A 3OT7A 4JGSA 4IGGA 4MVUA 1PKXA 2H8PC 4PA4A 3HR0A 1V9PA 2P4KA 5ITZA 5KA5A 4JI8O 1U96A 3IGAC 2XAQA 3QF7A 2UUCO 4NB5A 1H2SB 1VQOV 3FYIB 1JJOA 1Q6IA 2X6BA 3IFXA 1V54B 4DV3B 4K3AA 5AG2A 4O4HB 3N2KA 2BSKA 3G80A 2GHYA 3CHXA 1HR0O 1JFFA 4DV5B 2N04A 1MZFA 2XUMA 2EULA 3JALA 3JASA 5LHGA 1BGYH 3F7VC 1H8EG 5EBWC 4DV4O 4P9PA 3JSLA 2EIKC 1HWYA 3D36A 2GSMB 1FXHA 3E8GA 4JTDB 5FL7G 4X1KB 4O2BB 5J2TB 1XREA 3B77A 3CD6V 1Y4MA 4BWAA 4BIOA 5IJ9B 2LP7A 4GUNA 4U7NA 2QEXV 2EZOA 1OHHG 1BMFG 4KL1A 4YJ2B 3WU2Z 3CCJV 5LXTB 4JAVA 4G2KA 5JH7A 5D5QA 2W6IG 1FXKB 4CC6A 1MSWD 4NKGB 2JJ2G 1P4RA 2IM9A 1WA8A 3L75H 5CBHA 1K7DA 1PP9H 5LGUA 5JQGA 3MD0A 4B3RO 4JI4O 3DSQA 4JI3O 4F6EA 1XMOB 4PDLA 5H5NA 3CRRA 3VBBA 1IBLB 4X88A 1VF6A 4HAMA 2RCVA 4DR4O 4YJ3A 1S5LZ 4FFBA 5BY1A 2ZNIA 1VQ8V 4MVSA 3OE7G 1YITV 3F5TA 3AG2C 1TGOA 4BIZA 1AP5A 3AK3A 4FFKA 2H3OA 3I5DA 1Q7YW 1F51A 1TUBB 5IWAB 3SJCC 3APOA 2YEVA 1JVMA 3K5OA 3CP1A 4GX0A 1K97A 4CH3A 2XAHA 5B1AB 2OYQA 1GKFA 3L71H 4YY3O 2VQFB 2WLIA 1SETA 4UB8Z 3HKBA 3ZN1A 1SRYA 4OX9B 2ZIOA 2M7WA 2E76B 4UVAA 3ICXA 2Q7GA 2JVDA 2ODMA 2V4DA 5LHIA 2WLIB 2H94A 4IYIA 4I0XA 3JARB 5B1OA 1M57B 1HNXO 3B09A 3G71V 1KKCA 5BR8O 2RN9A 1WAZA 1MG1A 3CC4V 2EILB 1GM9A 1S77D 1IBMO 1SS3A 4PA3A 4JZ2A 4RQEA 4Q20A 4YHHO 3B40A 3E2EA 2QA4V 2WLMA 3SDLA 4I9QA 4P2ZA 3OMAB 1U97A 1GO3F 1QU7A 2EIJB 1K9MW 3RVYA 4J42A 3AG4C 1VMGA 2FMLA 3FYEB 1HNWB 3AG3C 2JRIA 4NTWA 2CTRA 2QKCA 5GONB 2YC0A 4TV9B 2Q73A 2EBOA 4MVMA 1N33B 1BL8A 1PM9A 3ABUA 2F66C 3ZEDA 4LF6O 1B6QA 1YI2V 3JAWB 2Q0AA 4DR3O 1VQ4V 5CA0A 1YJ9V 4J7JA 2HHHO 1H38A 3BFRA 2DYRB 2OT5A 4I5SA 2E3CA 2UUBB 2F93B 1E1QG 3N2GB 1K5SA 1VF6C 5CA1A 1Q82W 3RFRA 4FJCC 4UCOA 4MVRA 3U10A 5KUMA 5CB4A 4UV9A 1RSOA 5KAFZ 1KP2A 4LNUA 5LMNO 1GTOA 3RYCA 5FNVB 4LF4B 1ZL8A 3SPJA 2WPDG 3ZHRA 3S3XA 1J95A 3L72H 2OTLV 3E86A 4LBEC 1YTFB 3JSNA 2HKOA 1W0JG 2YIDA 2VWJA 1VQ5V 2Q6AA 5LL6Y 2YXLA 3FB6C 4UCRA 1SQBH 5H9CA 3KCYA 1ZAUA 4HNAA 4JI6B 3Q4HB 1K8AW 5KLVH 4ZI7B 2ZE7A 2D2CB 2QM4A 5DN6G 3JYCA 3CCEV 4MVZA 1GN3A 4UCTA 5KAIZ 1BT8A 4Z1VA 3CRMA 2V7QG 1HNZB 4X20A 4DR5B 3ZCCA 4WFBV 3BEHA 2LGQA 3RYFA 1YJNV 1YEWA 3L9DA 2AZ2A 2PI5A 2X6CA 3W7SA 5LP6A 1YIJV 4DR7B 2BTOA 1J5EB 3RYIA 4F4LA 3J80N 1AI6A 1P7GA 5B5EZ 5LP6B 3JCUZ 3AG1C 4R7CA 1SQXH 3E8BA 2Q69A 2IW5A 2OCCC 1NT2B 2BOBC 4U7OA 1SA0A 5L3DA 2HG5C 4CH5A 5BMVB 1M1KW 2YIAA 1AI5A 3ABMC 3SPCA 3DXRB 2KKWA 2XHBA 4QE7A 3M7MX 4NYKA 2AHYA 4H44B 1KUQA 3ABTA 3SR2C 1PV0A 3FFQA 1YVWA 4PD4F 5LA6B 5L3CA 1KYOF 4WFHA 1FJGO 1KU9A 1Z2GA 3RYHA 3EXAA 4TV8A 4X1YB 3D8CA 1FKAO 1R3JC 4DK0A 5DEDA 4QJFB 4X1IB 3CE2A 1GRJA 3RYHB 3WB1A 2Y4TA 1MOFA 4JASA 1Q86W 1URFA 4FPPA 1Y66A 2AW9A 1L0LH 4I55A 4DV1O 3E89A 3NXSA 1V55B 5IY5C 1GM8A 1OJHA 4I50A 2BTQB 4LFBO 4EB6A 3ASNC 4IIJA 3OMIB 4PDRA 2IBZH 4U3JA 3SYPA 1US6A 1S3JA 4JYAB 4GT1A 1P84F 3T4ZA 2P22C 3SYCA 3STLC 2KSDA 1E1RG 4J9ZB 1K5QA 1OZ0A 2GV9A 1D5AA 2GBOA 4CH4A 2JS5A 3TETA 2UUAO 3OEEG 2JJ1G 3T1YO 4BW9A 2F4VB 4KHPB 4JI2B 2QDOA 1MZEA 2ZKOA 3UO3A 3RW0A 3H9VA 3TK1A 1Z5VA 2CH7B 2EIMB 5C8YB 4DV0O 1NQTA 1BSMA 4JAAA 3THOA 1F4NA 4X64O 4F6RB 4FZ0A 2JIZG 3BRCA 4O4JA 4O4IB 3SGIA 5H6QA 2XAFA 3DGEA 2ZXWB 2E5LB 2A79B 2EIKB 1M4UA 2P6JA 3OM3B 2Q7HA 5KX5B 1VQKV 3FAVB 1I5YA 1P7BA 1NVPB 1CEZA 3SJAC 4JI0O 4X89A 2CE4A 5EYPB 2N05A 1S72V 4J41A 3VQXA 3ABKB 1W0KG 3F7YC 3ZBHA 3K58A 1WJZA 3U11A 5LMUB 4W4KA 4G28B 3K0DA 1NS1A 5EC2C 2QM8A 1LUVA 5H6RA 3QVNA 3CXCU 2Z3YA 2IH3C 1OCZB 2ADQB 1MMMA 4X62O 5J2UB 2CAZC 2OTJV 2HFEC 4FIPC 3UCSC 1IX9A 1S76D 3HKCB 2IU3A 1VF7A 4NTXA 4XBFA 3WB2A 1ZTEA 1QLEC 4DK1A 4ZHQA 3CCSV 3APQA 1ZLZA 4PI0A 4FLYA 2QM7A 4FLXA 1PNMA 5LHHA 2UXBO 3GWOA 1AROP 1KB9F 2KG7B 3G6BA 3AG2B 3ZMTA 2ZT9B 3OGIB 3D3IA 1NH2B 1IZ3A 4B3TO 4QPKA 2ZM6B 4LF9B 2ZQMA 1N4CA 2YXHA 2UXDB 3B8MA 5EK0A 2QWPB 2W6JG 3ZMVA 4TSFG 2UU9B 3PJSK 2P5OA 2JGUA 2YS8A 3ZMZA 3T1HO 1WP8A 1WPBA 3WFVA 1K33A 1RM1C 4JYBA 1BE3H 4XDJA 5ITZB 4DUYO 4YIPA 3CCUV 3HPLC 1SQVH 4TQDA 1NBMG 4WFEA 4NXMO 3LSSA 5IJ0A 1XMQO 1JR9A 1Q43A 5BZBA 4TWKA 1VEWA 1AP6A 1ORQC 3K9AA 4UVCA 3ZIAG 3N2KB 2BSKB 3CEIA 4GKKB 1JFFB 1YDXA 3GVMA 1EN6A 1JMKC 3ASOB 4I4TA 5L3GA 5KHKA 3JALB 1YXBA 3JASB 5F2VO 1GN6A 3J81N 4DUZB 4HBNA 4RAIA 3ZHVA 3K59A 1KBHA 4K35A 2P90A 4DV6O 2QKAA 4MT8A 5TISZ 3FD9A 1SQPH 4PA9A 4GKJO 2EINB 3OD4A 4ZKIA 1G8MA 2PUSA 4MTOA 2ZE5A 3A0HZ 4E4EA 3ZHUA 3A2FA 1NJIW 5KA6A 3B2EE 3VQYA 1XUQA 5JH7B 3ZHSA 1R6TA 4JI1O 3I56V 1N36O 4N23A 1XNRB 4DV7B 4JI5O 1CXZB 3ZRWA 1XDCA 3E8FA 4LC1A 1WA8B 4LFCB 4JAUA 4D7SA 1NKDA 4W4LA 4RWUA 5JQGB 1QR9A 1A32A 4B3MO 2Q8VA 4EKWA 1SQGA 3TCUA 3JD4A 1RP3B 4LF7O 1Y76A 1NTMH 2CTPA 1N34B 3G67A 4YJ3B 4DV2B 4FFBB 4LFAO 3HKEA 4AQYB 3B8NA 1VARA 1OCRC 4HYOA 3FB7C 3VOUA 4OPAA 2UXNA 4B3SB 2C2AA 2WWWA 3E8HA 4CC5A 5JJJB 4DR1B 4JV5B 1NU1H 1K73W 2YI9A 4LF5O 4K0KO 2WA3A 4PHZA 2VQEO 3STZC 2YEVB 3OTOO 2HVKC 1XNQO 1W2BU 1IBKB 2DN9A 4LH7A 2JS3A 3E22A 5IE9A 4OGQB 3CCLV 4PA6A 1YTFD 4P30A 4TUYA 5LYJA 2PYLA 4OPHA 5JJNB 3E83A 3CPWU 2DYSB 1NR1A 3ETGA 1RFYA 4R50A 4MW8A 1GN2A 3HKBB 1D2DA 3CMEV 4X66O 3MAQA 3T4DA 2Q68A 4IHJA 4NR1A 5B1BB 4H13B 3K3WA 1Q5OA 4JZGA 4I0XB 3TJTA 3P30A 3CCVV 3ZJZA 4JF3A 1HW7A 1TUEB 2QKSA 1M56C 3UO2A 4PA7A 4KXRA 1VQLV 3C3SA 1H2NA 4LF8O 4ICGA 1THZA 2OCCB 4GLXA 2UXCB 3O65A 2WLJA 4PDMA 1GM7A 5J9PC 4X65O 5IYDO 3ABMB 1QVFU 1N32B 1YJWV 5KHIA 3LDCA 3FB5C 2HJFC 5FLXN 2CUGA 3P3NA 2LJ2A 4J10A 4UV8A 4IYHA 1X59A 1XL6A 1FXKC 3X2QC 2OWOA 2GTSA 3AK2A 5IDJA 3T1CA 5IYZA 2GDSA 4AHCA 3EFFK 1T5EA 2PI4A 4H33A 4QGPA 2LFSA 4NXNO 2XAGA 1F7YA 3SPIA 5CA0B 2ITCC 2WAMA 2HVJC 2Y0PA 2EZPA 3QTCA 5JVDA 2F1MA 2RQ6A 3JATA 5EBLC 2XAJA 4UCVA 4LH6A 1BCCH 2DWDC 4H0LB 1L8DA 3C90A 5CA1B 1O9HA 3ASNB 1QLNA 3MHHC 4FLVA 5CB4B 5HFLA 2IJHA 1RSOB 1EZVH 1EFRG 1NTZH 4J7ZA 2B1IA 4LNUB 3K5MA 3RYCB 1ZX3A 4FMTA 1ZL8B 3LDDA 2WA4A 3MHSC 4JI8B 1AI4A 1DLBA 4WFGA 4CS4A 2UUCB 2N74A 3ZHTA 1HP8A 2HJDA 4IT5A 1NI8A 3AEIA 1VQ9V 1B04A 3ZRXA 4HNAB 1CP9A 1HR0B 1GH6A 1PL4A 2LQTA 1S5JA 3T2MA 2JEXA 3HB3B 4MSWC 5CMUA 1ZSPA 4YXWG 4DW1A 4DV3O 3OEHG 2F95B 1COWG 4DV4B 3SPGA 4EEQA 1O9GA 2GUZA 4DV5O 4KUMA 4X20B 3ETDA 4AI8A 1Q8IA 1FFTB 1UJWB 2RDCA 3LDEA 3R66A 5GW7A 3RYFB 3EVKA 1XI1A 4GX5A 1SESA 3VQVA 4TQFA 3RYIB 3LUTB 1GN4A 2EILC 4FLTA 3LNMB 1BHBA 1AR5A 3BVOA 4XDKA 1XILA 1MSDA 1NVPD 2WLHA 1N0NA 1OCCB 1KD1W 1OV9A 5CN0A 4RQFA 1SA0B 3RT3C 5CA3A 1EZJA 2ARHA 4J11A 3O9OA 5B1NA 2BE3A 4JYCA 2PTMA 3CJHA 3CWBH 4B3RB 1WB8A 3P3PA 4ZOLA 4JI4B 1EN5A 2NN4A 4JI3B 2WLKA 1R3KC 2A06H 4CS3A 2QWQB 3E35A 3SJBC 1FXVA 5K1XA 1SKVA 4I9WA 3UT5A 4JTCB 1K4DC 4DR4B 1DF5A 2Q0OC 4TV8B 4LR3A 5B3SC 1XMOO 1I0HA 1Q6UA 1IBLO 2DYRC 4XDLA 2HLDG 1YCIA 2ZIMA 3W7TA 4I55B 4DR2O 1OCOB 4I50B 4EB6B 4IIJB 4DW0A 1BS3A 2D3OW 1S0VA 4U3JB 1NH2D 4FZ1A 3QNEA 4JI7O 5C93A 2YUAA 1XNQB 4WFAV 4BR6A 3ZHQA 5IWAO 4YY3B 1VQNV 5K1PA 1RM1B 1XHXA 3UM7A 3K04A 2YIBD 4O4LA 3K03A 3A0BZ 1NTKH 4KP4A 4PDVA 4A5UB 2R9RB 1SZTA 5JCOC 4Z2WA 1AI7A 4O4LB 2QGNA 1AR1B 2VQFO 2ATKC 1HNXB 1LNQA 4WCEV 3WB0A 3JD3A 5BR8B 4OX9O 4X8AA 1SC5B 4ZBMA 3B4SA 5LBQA 1G4YB 2L6LA 1VQPV 1IBMB 2YXYA 4O4JB 4YHHB 1XBLA 2WLLA 2KQXA 4R8CA 4UFZA 5DECA 1MNGA 2BCCH 1KC8W 4J7KA 1K34A 2B1GA 3HKDA 2P7TC 2VRZA 5LOVA 2VS0A 4DYLA 1NZ6A 5A2QN 5KMGA 1QR8A 1FYJA 2O57A 4DR6O 1TVKA 1K3EA 4FK5C 5E79Z 1L1FA 1SERA 3CX5F 1IDSA 1R6NA 3JAMN 3TGUH 1HNWO 4LF6B 3SPHA 5H2FZ 3JAKA 4DR3B 1YZBA 3CCQV 1WP7A 1N33O 4QPJA 2HHHB 2YDEA 2RJZA 2A9HA
chains in the Genus database with same CATH topology
2GTAA 3C90A 1Y6XA 2OIEA 2OIGA 3CRCA 4QGPA 2Q9LA 2Q73A 3CRAA 2A7WA 2Q4PA 1YXBA 1YVWA 2Q5ZA 2YXHA 2A3QA 5IE9A 2P06A 1VMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GTA A;  3C90 A;  1Y6X A;  2OIE A;  2OIG A;  3CRC A;  4QGP A;  2Q9L A;  2Q73 A;  3CRA A;  2A7W A;  2Q4P A;  1YXB A;  1YVW A;  2Q5Z A;  2YXH A;  2A3Q A;  5IE9 A;  2P06 A;  1VMG A; 
#chains in the Genus database with same CATH topology
 4MTF A;  5DM6 V;  4DRX A;  1Q90 D;  4ZHQ B;  1Y6X A;  4GCZ A;  2QWR B;  3BCC H;  1AJQ A;  1G1X B;  2W0F C;  2F43 G;  1D5N A;  2QR4 A;  2CGO A;  4DRX B;  2UUB O;  1E79 G;  5LMN B;  5IT9 N;  1OCR B;  4MS2 A;  5B66 Z;  2Y0I A;  4WBN A;  4GX1 A;  1V55 C;  4I7Z B;  4CH6 A;  1P49 A;  4LWS A;  1M93 A;  3L74 H;  3NR7 A;  3K9S A;  1R1B A;  1FFX A;  4LF4 O;  1I94 O;  4E2L A;  4RUE A;  4P9O A;  2AXT Z;  4FVM A;  2L35 A;  2DOS A;  3F5W C;  4DXW A;  2PYJ A;  4MVO A;  3RGB A;  4QE9 A;  2VWK A;  2W0X A;  2R70 A;  1XEQ A;  3AG7 A;  2PZS A;  1QBZ A;  2QJ1 A;  3QO7 A;  4L87 A;  3PN1 A;  2Z5U A;  4O4H A;  4JI6 O;  1JCH A;  2QE7 G;  4H37 A;  1H2G A;  2ZDI C;  1CPY A;  3EHB B;  5GTH Z;  5IJ0 B;  1B06 A;  4Q6G A;  2FL4 A;  3ZMU A;  5HFM A;  1WB7 A;  2F23 A;  2PY5 A;  1YF2 A;  4JTA B;  2EIM C;  2FYU H;  3WG7 C;  4LCU C;  4B08 A;  2ZR2 A;  2P67 A;  3ML0 A;  3FX7 A;  3ZRV A;  1HNZ O;  1FS0 G;  3OAA G;  2Y69 C;  1M56 B;  1K4C C;  4I4T B;  3OFN G;  4TT3 G;  1W59 A;  4DR5 O;  1FPO A;  2ADP A;  3OR6 C;  2DE0 X;  1TA8 A;  4X1K A;  5EIB D;  1Y67 A;  1EN4 A;  2XOK G;  1R3L C;  2ZXW C;  4O2B A;  5J2T A;  1B3Q A;  4DR7 O;  1J5E O;  3JCZ A;  5IJ9 A;  1IXM A;  3AK1 A;  4GYC B;  2DMX A;  4R6Z A;  3AG4 B;  1QHT A;  4YJ2 A;  3KCX A;  3JD0 A;  2P06 A;  2EJR A;  3AG3 B;  5EBM C;  5LXT A;  3BPZ A;  3OTF A;  2PGG A;  4WFF A;  3ABK C;  4TOI A;  3QO5 A;  2A0L A;  2K1E A;  1FXK A;  3CYO A;  2CTW A;  1QVG U;  2JEU A;  3CXH F;  3IC7 A;  5JJE B;  1JOY A;  1FJG B;  1EM1 A;  1H2L A;  3BA9 A;  5L3E A;  3X2Q B;  1DGS A;  5EZY A;  1OCZ C;  1SZX A;  3ZRW B;  3OMN B;  4WF9 V;  3KKY A;  2EX3 A;  1KQS U;  3TXQ A;  2DW4 A;  5EZY B;  1UFI A;  4DV1 B;  4OXS A;  1EBO A;  4LFB B;  1Y76 B;  4B7E A;  1I5X A;  4UVB A;  3CC7 V;  4DR2 B;  1YHQ V;  1R73 A;  2JK5 C;  2V1D A;  3HKE B;  4D7T A;  1JJ2 U;  1JA8 A;  1TUB A;  4PI2 A;  3OGC C;  3BAA A;  4G27 B;  3FKS G;  1BQZ A;  2AZ0 A;  4QIW F;  4FM2 A;  4JI7 B;  2JDI G;  3ABL C;  2Q5Z A;  2UUA B;  4JYA O;  3W7W A;  3T1Y B;  5L3F A;  2FB5 A;  2LW7 A;  1VP7 A;  4JPR A;  2DQ3 A;  1TAE A;  3UKM A;  1BQ0 A;  3E22 B;  2ZNJ A;  3L70 H;  1JPX A;  4DV0 B;  1SQF A;  4TUY B;  5LYJ B;  1MA1 A;  2F4V O;  4KHP O;  4JI2 O;  4ABM A;  3CCR V;  4X64 B;  1SF9 A;  1V54 C;  1JQ0 A;  2E74 B;  4X9Q A;  5BXZ A;  3JAR A;  3H1L H;  2CK3 G;  5L3B A;  1AIL A;  4IHJ B;  2WLN A;  4KFM A;  1IVS A;  4RUF A;  2R9I A;  5KHJ A;  4PJ0 Z;  3U0Z A;  1WNS A;  3VQW A;  1AJP A;  3AG1 B;  1N8R W;  2MW2 B;  3ZRS A;  4JI0 B;  3ASO C;  1HDJ A;  2E5L O;  1RPR A;  4UCS A;  2Y48 A;  2YSU B;  1H8H G;  3K08 A;  2X7R B;  3L73 H;  1GK9 A;  5LGN A;  4MW3 A;  4Z1M G;  3D36 C;  2IJJ A;  4DR6 B;  2M6Y A;  1VIB A;  3K0G A;  1KKD A;  5GON A;  2K9P A;  2AHZ A;  3JD2 A;  4TV9 A;  4X62 B;  5LMU O;  4UB6 Z;  1AR4 A;  4BW5 A;  3BA8 A;  2EIN C;  5A9G A;  2IJI A;  1JX9 A;  1G6U A;  1SQQ H;  4B7K A;  2ITD C;  3M99 B;  4LP8 A;  3OUS A;  3JAW A;  2Q7E A;  1Z5W A;  1BHA A;  4RO2 A;  1YSC A;  4MTX A;  5CBF A;  5IYZ B;  3H1K H;  4AIL C;  2UXB B;  1KEC A;  4UUJ C;  5B3S B;  2QWO B;  1K92 A;  1R3I C;  3N2G A;  1ZUQ A;  3QG5 A;  5IY5 B;  5JVD B;  2ZD9 A;  4B3T B;  2Q67 A;  5KHG A;  3JAT B;  3IC9 A;  2OCH A;  3S3W A;  2IJK A;  2ZIN A;  5D5P A;  2LO1 A;  2Q4P A;  5FNV A;  2EJ7 A;  1QCE A;  3H1J H;  1VQM V;  3BY6 A;  3GWK C;  2YI8 A;  3LSU A;  5KHH A;  2ZM6 O;  5CBG A;  4LF9 O;  2CDY A;  1I94 B;  3T1H B;  2OIE A;  2OIG A;  2UXD O;  1GAX A;  3CRC A;  4IL6 Z;  2UXX A;  1XHZ A;  4DUY B;  5JWP A;  3P32 A;  4U3F H;  5JCO A;  5B1A C;  4PEL A;  3Q4H A;  3CSX A;  4FM1 A;  4NXM B;  2UU9 O;  1I7F A;  1XMQ B;  1WN7 A;  3BHP A;  4ZI7 A;  1QQC A;  3K79 A;  3M8A A;  3CRQ A;  1FD9 A;  3G6E V;  1VQ7 V;  1PPJ H;  1IUR A;  2IU0 A;  3OR7 C;  3K57 A;  2DYS C;  2XAS A;  3SYA A;  2Y4U A;  4MTG A;  2LGW A;  1M57 C;  3CB2 A;  4GKK O;  1WPX A;  3QO8 A;  1ROP A;  1AB3 A;  5B1B C;  2GUZ B;  3RWR D;  1PD3 A;  2QTS A;  1S5H C;  3K5N A;  5EIB C;  5FPR A;  4DV6 B;  3H1I H;  2LW1 A;  4DUZ O;  3JD1 A;  1UPG A;  3CMA V;  3CC2 V;  2QSA A;  2FKX A;  4O2A A;  2QTO A;  4L8J A;  4BAY A;  3H1H H;  5FPO A;  4GKJ B;  1PL0 A;  2FTK A;  2ZE6 A;  3K06 A;  2Z0A A;  5BMV A;  4ASU G;  3CCM V;  2EIJ C;  3A0R A;  4O2A B;  4K8X A;  3C3T A;  3DXR A;  3J7A U;  4JI1 B;  1N36 B;  5IYB O;  4NTY A;  3LNN A;  4JI5 B;  2PF4 E;  2ZCE A;  3BAB A;  4J80 A;  4ZIB A;  2KB1 A;  5LA6 A;  4FLU A;  3UQ8 A;  1QLE B;  3KG2 A;  3CJH B;  3LSQ A;  5E1A C;  4ZOL B;  4QNH B;  1R6K A;  4X1Y A;  2ETN A;  4B3M B;  1Q6H A;  3N27 A;  1XNR O;  4DV7 O;  3ZX6 A;  2NR5 A;  1H2M A;  4LF7 B;  1DF4 A;  2BOC C;  4X1I A;  1DTO A;  3UT5 B;  4J9Y B;  4LFC O;  1QNM A;  4NVP A;  4LFA B;  3CRA A;  3OUF A;  2BTQ A;  4K8Z A;  1RPO A;  1VF5 B;  3I55 V;  2X6A A;  1PNK A;  1N34 O;  2A3Q A;  1BZK A;  2DQ0 A;  4DV2 O;  4K0K B;  1GMG A;  4LF5 B;  4CZZ A;  4AQY O;  3ETE A;  2VQE B;  1XQ8 A;  1F23 A;  3OTO B;  3DC5 A;  2CTQ A;  4GX2 A;  4B3S O;  2A7W A;  3GB7 C;  1FAF A;  1AJN A;  4UCU A;  3FB8 C;  2B5U A;  4JYY A;  3SJQ C;  4DR1 O;  3KZI Z;  4JV5 O;  2ZDI A;  1LUW A;  1Q3E A;  3IAY A;  1ZWI C;  2XT9 A;  1NR7 A;  2G38 A;  1IBK O;  5GTI Z;  4X66 B;  2CH7 A;  5C8Y A;  2HEP A;  1Y74 A;  3W7X A;  1LR1 A;  1PNL A;  3H01 A;  4F6R A;  2XTA A;  1N0J A;  3RN4 A;  4O4I A;  1Y74 B;  3WG7 B;  4PV1 B;  2Y69 B;  1KP3 A;  3A8T A;  2RNB A;  1M9N A;  4CS2 A;  5KX5 A;  2YIC A;  1XOU A;  2ZR3 A;  3FAV A;  2XND G;  3ZN0 A;  4LF8 B;  2NLJ C;  2WLL B;  2DWE C;  1XL4 A;  1AVM A;  2CGN A;  5EYP A;  3RVZ A;  4BIU A;  2X0L A;  4UXN A;  5LP6 C;  3HKD B;  4HZ3 A;  2LFR A;  1VQ6 V;  1KMI Z;  4X65 B;  4EFE A;  2DJV A;  5LOV B;  3G4S V;  3OW2 U;  1WLE A;  1IXB A;  4CBC A;  3CS5 A;  5KMG B;  1DK1 A;  2RMK B;  2AGA A;  4DO2 A;  2UXC O;  3ETQ A;  2QWN B;  5LGT A;  1TVK B;  2P4V A;  5EC1 C;  5IYC O;  1OCC C;  4YIO A;  5J2U A;  3SYO A;  1M90 W;  3DTU B;  3HKC A;  3K5L A;  1N32 O;  2IH1 C;  4MVQ A;  4EFB A;  4NXN B;  4FLW A;  3MDS A;  2R9A A;  1M5I A;  4GZR B;  3JAK B;  2HR3 A;  3ZS8 C;  1I08 A;  2R72 A;  3SYQ A;  2NNU A;  2HP8 A;  3D3Q A;  1H2K A;  3TXS A;  4D6T H;  2ZE8 A;  3IJ4 A;  2KG7 A;  1ENV A;  4FLZ A;  4C7U A;  3ZMS A;  1F4M A;  1Q81 W;  2GTA A;  2JGD A;  2E75 B;  2Q9L A;  2MK3 A;  1MAB G;  2WSS G;  4N21 A;  4FM0 A;  3RBZ A;  5KUK A;  4WBN B;  3W7U A;  2ILM A;  1L0N H;  2JGD B;  2YIB A;  1OCO C;  3R65 A;  4LWS B;  3ABL B;  1X4T A;  2B9Z A;  1FFX B;  3DC6 A;  3OT7 A;  4JGS A;  4IGG A;  4MVU A;  1PKX A;  2H8P C;  4PA4 A;  3HR0 A;  1V9P A;  2P4K A;  5ITZ A;  5KA5 A;  4JI8 O;  1U96 A;  3IGA C;  2XAQ A;  3QF7 A;  2UUC O;  4NB5 A;  1H2S B;  1VQO V;  3FYI B;  1JJO A;  1Q6I A;  2X6B A;  3IFX A;  1V54 B;  4DV3 B;  4K3A A;  5AG2 A;  4O4H B;  3N2K A;  2BSK A;  3G80 A;  2GHY A;  3CHX A;  1HR0 O;  1JFF A;  4DV5 B;  2N04 A;  1MZF A;  2XUM A;  2EUL A;  3JAL A;  3JAS A;  5LHG A;  1BGY H;  3F7V C;  1H8E G;  5EBW C;  4DV4 O;  4P9P A;  3JSL A;  2EIK C;  1HWY A;  3D36 A;  2GSM B;  1FXH A;  3E8G A;  4JTD B;  5FL7 G;  4X1K B;  4O2B B;  5J2T B;  1XRE A;  3B77 A;  3CD6 V;  1Y4M A;  4BWA A;  4BIO A;  5IJ9 B;  2LP7 A;  4GUN A;  4U7N A;  2QEX V;  2EZO A;  1OHH G;  1BMF G;  4KL1 A;  4YJ2 B;  3WU2 Z;  3CCJ V;  5LXT B;  4JAV A;  4G2K A;  5JH7 A;  5D5Q A;  2W6I G;  1FXK B;  4CC6 A;  1MSW D;  4NKG B;  2JJ2 G;  1P4R A;  2IM9 A;  1WA8 A;  3L75 H;  5CBH A;  1K7D A;  1PP9 H;  5LGU A;  5JQG A;  3MD0 A;  4B3R O;  4JI4 O;  3DSQ A;  4JI3 O;  4F6E A;  1XMO B;  4PDL A;  5H5N A;  3CRR A;  3VBB A;  1IBL B;  4X88 A;  1VF6 A;  4HAM A;  2RCV A;  4DR4 O;  4YJ3 A;  1S5L Z;  4FFB A;  5BY1 A;  2ZNI A;  1VQ8 V;  4MVS A;  3OE7 G;  1YIT V;  3F5T A;  3AG2 C;  1TGO A;  4BIZ A;  1AP5 A;  3AK3 A;  4FFK A;  2H3O A;  3I5D A;  1Q7Y W;  1F51 A;  1TUB B;  5IWA B;  3SJC C;  3APO A;  2YEV A;  1JVM A;  3K5O A;  3CP1 A;  4GX0 A;  1K97 A;  4CH3 A;  2XAH A;  5B1A B;  2OYQ A;  1GKF A;  3L71 H;  4YY3 O;  2VQF B;  2WLI A;  1SET A;  4UB8 Z;  3HKB A;  3ZN1 A;  1SRY A;  4OX9 B;  2ZIO A;  2M7W A;  2E76 B;  4UVA A;  3ICX A;  2Q7G A;  2JVD A;  2ODM A;  2V4D A;  5LHI A;  2WLI B;  2H94 A;  4IYI A;  4I0X A;  3JAR B;  5B1O A;  1M57 B;  1HNX O;  3B09 A;  3G71 V;  1KKC A;  5BR8 O;  2RN9 A;  1WAZ A;  1MG1 A;  3CC4 V;  2EIL B;  1GM9 A;  1S77 D;  1IBM O;  1SS3 A;  4PA3 A;  4JZ2 A;  4RQE A;  4Q20 A;  4YHH O;  3B40 A;  3E2E A;  2QA4 V;  2WLM A;  3SDL A;  4I9Q A;  4P2Z A;  3OMA B;  1U97 A;  1GO3 F;  1QU7 A;  2EIJ B;  1K9M W;  3RVY A;  4J42 A;  3AG4 C;  1VMG A;  2FML A;  3FYE B;  1HNW B;  3AG3 C;  2JRI A;  4NTW A;  2CTR A;  2QKC A;  5GON B;  2YC0 A;  4TV9 B;  2Q73 A;  2EBO A;  4MVM A;  1N33 B;  1BL8 A;  1PM9 A;  3ABU A;  2F66 C;  3ZED A;  4LF6 O;  1B6Q A;  1YI2 V;  3JAW B;  2Q0A A;  4DR3 O;  1VQ4 V;  5CA0 A;  1YJ9 V;  4J7J A;  2HHH O;  1H38 A;  3BFR A;  2DYR B;  2OT5 A;  4I5S A;  2E3C A;  2UUB B;  2F93 B;  1E1Q G;  3N2G B;  1K5S A;  1VF6 C;  5CA1 A;  1Q82 W;  3RFR A;  4FJC C;  4UCO A;  4MVR A;  3U10 A;  5KUM A;  5CB4 A;  4UV9 A;  1RSO A;  5KAF Z;  1KP2 A;  4LNU A;  5LMN O;  1GTO A;  3RYC A;  5FNV B;  4LF4 B;  1ZL8 A;  3SPJ A;  2WPD G;  3ZHR A;  3S3X A;  1J95 A;  3L72 H;  2OTL V;  3E86 A;  4LBE C;  1YTF B;  3JSN A;  2HKO A;  1W0J G;  2YID A;  2VWJ A;  1VQ5 V;  2Q6A A;  5LL6 Y;  2YXL A;  3FB6 C;  4UCR A;  1SQB H;  5H9C A;  3KCY A;  1ZAU A;  4HNA A;  4JI6 B;  3Q4H B;  1K8A W;  5KLV H;  4ZI7 B;  2ZE7 A;  2D2C B;  2QM4 A;  5DN6 G;  3JYC A;  3CCE V;  4MVZ A;  1GN3 A;  4UCT A;  5KAI Z;  1BT8 A;  4Z1V A;  3CRM A;  2V7Q G;  1HNZ B;  4X20 A;  4DR5 B;  3ZCC A;  4WFB V;  3BEH A;  2LGQ A;  3RYF A;  1YJN V;  1YEW A;  3L9D A;  2AZ2 A;  2PI5 A;  2X6C A;  3W7S A;  5LP6 A;  1YIJ V;  4DR7 B;  2BTO A;  1J5E B;  3RYI A;  4F4L A;  3J80 N;  1AI6 A;  1P7G A;  5B5E Z;  5LP6 B;  3JCU Z;  3AG1 C;  4R7C A;  1SQX H;  3E8B A;  2Q69 A;  2IW5 A;  2OCC C;  1NT2 B;  2BOB C;  4U7O A;  1SA0 A;  5L3D A;  2HG5 C;  4CH5 A;  5BMV B;  1M1K W;  2YIA A;  1AI5 A;  3ABM C;  3SPC A;  3DXR B;  2KKW A;  2XHB A;  4QE7 A;  3M7M X;  4NYK A;  2AHY A;  4H44 B;  1KUQ A;  3ABT A;  3SR2 C;  1PV0 A;  3FFQ A;  1YVW A;  4PD4 F;  5LA6 B;  5L3C A;  1KYO F;  4WFH A;  1FJG O;  1KU9 A;  1Z2G A;  3RYH A;  3EXA A;  4TV8 A;  4X1Y B;  3D8C A;  1FKA O;  1R3J C;  4DK0 A;  5DED A;  4QJF B;  4X1I B;  3CE2 A;  1GRJ A;  3RYH B;  3WB1 A;  2Y4T A;  1MOF A;  4JAS A;  1Q86 W;  1URF A;  4FPP A;  1Y66 A;  2AW9 A;  1L0L H;  4I55 A;  4DV1 O;  3E89 A;  3NXS A;  1V55 B;  5IY5 C;  1GM8 A;  1OJH A;  4I50 A;  2BTQ B;  4LFB O;  4EB6 A;  3ASN C;  4IIJ A;  3OMI B;  4PDR A;  2IBZ H;  4U3J A;  3SYP A;  1US6 A;  1S3J A;  4JYA B;  4GT1 A;  1P84 F;  3T4Z A;  2P22 C;  3SYC A;  3STL C;  2KSD A;  1E1R G;  4J9Z B;  1K5Q A;  1OZ0 A;  2GV9 A;  1D5A A;  2GBO A;  4CH4 A;  2JS5 A;  3TET A;  2UUA O;  3OEE G;  2JJ1 G;  3T1Y O;  4BW9 A;  2F4V B;  4KHP B;  4JI2 B;  2QDO A;  1MZE A;  2ZKO A;  3UO3 A;  3RW0 A;  3H9V A;  3TK1 A;  1Z5V A;  2CH7 B;  2EIM B;  5C8Y B;  4DV0 O;  1NQT A;  1BSM A;  4JAA A;  3THO A;  1F4N A;  4X64 O;  4F6R B;  4FZ0 A;  2JIZ G;  3BRC A;  4O4J A;  4O4I B;  3SGI A;  5H6Q A;  2XAF A;  3DGE A;  2ZXW B;  2E5L B;  2A79 B;  2EIK B;  1M4U A;  2P6J A;  3OM3 B;  2Q7H A;  5KX5 B;  1VQK V;  3FAV B;  1I5Y A;  1P7B A;  1NVP B;  1CEZ A;  3SJA C;  4JI0 O;  4X89 A;  2CE4 A;  5EYP B;  2N05 A;  1S72 V;  4J41 A;  3VQX A;  3ABK B;  1W0K G;  3F7Y C;  3ZBH A;  3K58 A;  1WJZ A;  3U11 A;  5LMU B;  4W4K A;  4G28 B;  3K0D A;  1NS1 A;  5EC2 C;  2QM8 A;  1LUV A;  5H6R A;  3QVN A;  3CXC U;  2Z3Y A;  2IH3 C;  1OCZ B;  2ADQ B;  1MMM A;  4X62 O;  5J2U B;  2CAZ C;  2OTJ V;  2HFE C;  4FIP C;  3UCS C;  1IX9 A;  1S76 D;  3HKC B;  2IU3 A;  1VF7 A;  4NTX A;  4XBF A;  3WB2 A;  1ZTE A;  1QLE C;  4DK1 A;  4ZHQ A;  3CCS V;  3APQ A;  1ZLZ A;  4PI0 A;  4FLY A;  2QM7 A;  4FLX A;  1PNM A;  5LHH A;  2UXB O;  3GWO A;  1ARO P;  1KB9 F;  2KG7 B;  3G6B A;  3AG2 B;  3ZMT A;  2ZT9 B;  3OGI B;  3D3I A;  1NH2 B;  1IZ3 A;  4B3T O;  4QPK A;  2ZM6 B;  4LF9 B;  2ZQM A;  1N4C A;  2YXH A;  2UXD B;  3B8M A;  5EK0 A;  2QWP B;  2W6J G;  3ZMV A;  4TSF G;  2UU9 B;  3PJS K;  2P5O A;  2JGU A;  2YS8 A;  3ZMZ A;  3T1H O;  1WP8 A;  1WPB A;  3WFV A;  1K33 A;  1RM1 C;  4JYB A;  1BE3 H;  4XDJ A;  5ITZ B;  4DUY O;  4YIP A;  3CCU V;  3HPL C;  1SQV H;  4TQD A;  1NBM G;  4WFE A;  4NXM O;  3LSS A;  5IJ0 A;  1XMQ O;  1JR9 A;  1Q43 A;  5BZB A;  4TWK A;  1VEW A;  1AP6 A;  1ORQ C;  3K9A A;  4UVC A;  3ZIA G;  3N2K B;  2BSK B;  3CEI A;  4GKK B;  1JFF B;  1YDX A;  3GVM A;  1EN6 A;  1JMK C;  3ASO B;  4I4T A;  5L3G A;  5KHK A;  3JAL B;  1YXB A;  3JAS B;  5F2V O;  1GN6 A;  3J81 N;  4DUZ B;  4HBN A;  4RAI A;  3ZHV A;  3K59 A;  1KBH A;  4K35 A;  2P90 A;  4DV6 O;  2QKA A;  4MT8 A;  5TIS Z;  3FD9 A;  1SQP H;  4PA9 A;  4GKJ O;  2EIN B;  3OD4 A;  4ZKI A;  1G8M A;  2PUS A;  4MTO A;  2ZE5 A;  3A0H Z;  4E4E A;  3ZHU A;  3A2F A;  1NJI W;  5KA6 A;  3B2E E;  3VQY A;  1XUQ A;  5JH7 B;  3ZHS A;  1R6T A;  4JI1 O;  3I56 V;  1N36 O;  4N23 A;  1XNR B;  4DV7 B;  4JI5 O;  1CXZ B;  3ZRW A;  1XDC A;  3E8F A;  4LC1 A;  1WA8 B;  4LFC B;  4JAU A;  4D7S A;  1NKD A;  4W4L A;  4RWU A;  5JQG B;  1QR9 A;  1A32 A;  4B3M O;  2Q8V A;  4EKW A;  1SQG A;  3TCU A;  3JD4 A;  1RP3 B;  4LF7 O;  1Y76 A;  1NTM H;  2CTP A;  1N34 B;  3G67 A;  4YJ3 B;  4DV2 B;  4FFB B;  4LFA O;  3HKE A;  4AQY B;  3B8N A;  1VAR A;  1OCR C;  4HYO A;  3FB7 C;  3VOU A;  4OPA A;  2UXN A;  4B3S B;  2C2A A;  2WWW A;  3E8H A;  4CC5 A;  5JJJ B;  4DR1 B;  4JV5 B;  1NU1 H;  1K73 W;  2YI9 A;  4LF5 O;  4K0K O;  2WA3 A;  4PHZ A;  2VQE O;  3STZ C;  2YEV B;  3OTO O;  2HVK C;  1XNQ O;  1W2B U;  1IBK B;  2DN9 A;  4LH7 A;  2JS3 A;  3E22 A;  5IE9 A;  4OGQ B;  3CCL V;  4PA6 A;  1YTF D;  4P30 A;  4TUY A;  5LYJ A;  2PYL A;  4OPH A;  5JJN B;  3E83 A;  3CPW U;  2DYS B;  1NR1 A;  3ETG A;  1RFY A;  4R50 A;  4MW8 A;  1GN2 A;  3HKB B;  1D2D A;  3CME V;  4X66 O;  3MAQ A;  3T4D A;  2Q68 A;  4IHJ A;  4NR1 A;  5B1B B;  4H13 B;  3K3W A;  1Q5O A;  4JZG A;  4I0X B;  3TJT A;  3P30 A;  3CCV V;  3ZJZ A;  4JF3 A;  1HW7 A;  1TUE B;  2QKS A;  1M56 C;  3UO2 A;  4PA7 A;  4KXR A;  1VQL V;  3C3S A;  1H2N A;  4LF8 O;  4ICG A;  1THZ A;  2OCC B;  4GLX A;  2UXC B;  3O65 A;  2WLJ A;  4PDM A;  1GM7 A;  5J9P C;  4X65 O;  5IYD O;  3ABM B;  1QVF U;  1N32 B;  1YJW V;  5KHI A;  3LDC A;  3FB5 C;  2HJF C;  5FLX N;  2CUG A;  3P3N A;  2LJ2 A;  4J10 A;  4UV8 A;  4IYH A;  1X59 A;  1XL6 A;  1FXK C;  3X2Q C;  2OWO A;  2GTS A;  3AK2 A;  5IDJ A;  3T1C A;  5IYZ A;  2GDS A;  4AHC A;  3EFF K;  1T5E A;  2PI4 A;  4H33 A;  4QGP A;  2LFS A;  4NXN O;  2XAG A;  1F7Y A;  3SPI A;  5CA0 B;  2ITC C;  2WAM A;  2HVJ C;  2Y0P A;  2EZP A;  3QTC A;  5JVD A;  2F1M A;  2RQ6 A;  3JAT A;  5EBL C;  2XAJ A;  4UCV A;  4LH6 A;  1BCC H;  2DWD C;  4H0L B;  1L8D A;  3C90 A;  5CA1 B;  1O9H A;  3ASN B;  1QLN A;  3MHH C;  4FLV A;  5CB4 B;  5HFL A;  2IJH A;  1RSO B;  1EZV H;  1EFR G;  1NTZ H;  4J7Z A;  2B1I A;  4LNU B;  3K5M A;  3RYC B;  1ZX3 A;  4FMT A;  1ZL8 B;  3LDD A;  2WA4 A;  3MHS C;  4JI8 B;  1AI4 A;  1DLB A;  4WFG A;  4CS4 A;  2UUC B;  2N74 A;  3ZHT A;  1HP8 A;  2HJD A;  4IT5 A;  1NI8 A;  3AEI A;  1VQ9 V;  1B04 A;  3ZRX A;  4HNA B;  1CP9 A;  1HR0 B;  1GH6 A;  1PL4 A;  2LQT A;  1S5J A;  3T2M A;  2JEX A;  3HB3 B;  4MSW C;  5CMU A;  1ZSP A;  4YXW G;  4DW1 A;  4DV3 O;  3OEH G;  2F95 B;  1COW G;  4DV4 B;  3SPG A;  4EEQ A;  1O9G A;  2GUZ A;  4DV5 O;  4KUM A;  4X20 B;  3ETD A;  4AI8 A;  1Q8I A;  1FFT B;  1UJW B;  2RDC A;  3LDE A;  3R66 A;  5GW7 A;  3RYF B;  3EVK A;  1XI1 A;  4GX5 A;  1SES A;  3VQV A;  4TQF A;  3RYI B;  3LUT B;  1GN4 A;  2EIL C;  4FLT A;  3LNM B;  1BHB A;  1AR5 A;  3BVO A;  4XDK A;  1XIL A;  1MSD A;  1NVP D;  2WLH A;  1N0N A;  1OCC B;  1KD1 W;  1OV9 A;  5CN0 A;  4RQF A;  1SA0 B;  3RT3 C;  5CA3 A;  1EZJ A;  2ARH A;  4J11 A;  3O9O A;  5B1N A;  2BE3 A;  4JYC A;  2PTM A;  3CJH A;  3CWB H;  4B3R B;  1WB8 A;  3P3P A;  4ZOL A;  4JI4 B;  1EN5 A;  2NN4 A;  4JI3 B;  2WLK A;  1R3K C;  2A06 H;  4CS3 A;  2QWQ B;  3E35 A;  3SJB C;  1FXV A;  5K1X A;  1SKV A;  4I9W A;  3UT5 A;  4JTC B;  1K4D C;  4DR4 B;  1DF5 A;  2Q0O C;  4TV8 B;  4LR3 A;  5B3S C;  1XMO O;  1I0H A;  1Q6U A;  1IBL O;  2DYR C;  4XDL A;  2HLD G;  1YCI A;  2ZIM A;  3W7T A;  4I55 B;  4DR2 O;  1OCO B;  4I50 B;  4EB6 B;  4IIJ B;  4DW0 A;  1BS3 A;  2D3O W;  1S0V A;  4U3J B;  1NH2 D;  4FZ1 A;  3QNE A;  4JI7 O;  5C93 A;  2YUA A;  1XNQ B;  4WFA V;  4BR6 A;  3ZHQ A;  5IWA O;  4YY3 B;  1VQN V;  5K1P A;  1RM1 B;  1XHX A;  3UM7 A;  3K04 A;  2YIB D;  4O4L A;  3K03 A;  3A0B Z;  1NTK H;  4KP4 A;  4PDV A;  4A5U B;  2R9R B;  1SZT A;  5JCO C;  4Z2W A;  1AI7 A;  4O4L B;  2QGN A;  1AR1 B;  2VQF O;  2ATK C;  1HNX B;  1LNQ A;  4WCE V;  3WB0 A;  3JD3 A;  5BR8 B;  4OX9 O;  4X8A A;  1SC5 B;  4ZBM A;  3B4S A;  5LBQ A;  1G4Y B;  2L6L A;  1VQP V;  1IBM B;  2YXY A;  4O4J B;  4YHH B;  1XBL A;  2WLL A;  2KQX A;  4R8C A;  4UFZ A;  5DEC A;  1MNG A;  2BCC H;  1KC8 W;  4J7K A;  1K34 A;  2B1G A;  3HKD A;  2P7T C;  2VRZ A;  5LOV A;  2VS0 A;  4DYL A;  1NZ6 A;  5A2Q N;  5KMG A;  1QR8 A;  1FYJ A;  2O57 A;  4DR6 O;  1TVK A;  1K3E A;  4FK5 C;  5E79 Z;  1L1F A;  1SER A;  3CX5 F;  1IDS A;  1R6N A;  3JAM N;  3TGU H;  1HNW O;  4LF6 B;  3SPH A;  5H2F Z;  3JAK A;  4DR3 B;  1YZB A;  3CCQ V;  1WP7 A;  1N33 O;  4QPJ A;  2HHH B;  2YDE A;  2RJZ A;  2A9H A; 
#chains in the Genus database with same CATH homology
 2GTA A;  3C90 A;  1Y6X A;  2OIE A;  2OIG A;  3CRC A;  4QGP A;  2Q9L A;  2Q73 A;  3CRA A;  2A7W A;  2Q4P A;  1YXB A;  1YVW A;  2Q5Z A;  2YXH A;  2A3Q A;  5IE9 A;  2P06 A;  1VMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...