2OIGA

Crystal structure of rs21-c6 core segment and dm5ctp complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
PFRFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKSDTEPGPQAWPPKERAALQEELSDVLIYLVALAARCHVDLPQAVISKMDTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of RS21-C6, Involved in Nucleoside Triphosphate Pyrophosphohydrolysis
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords RS21-C6
total genus 26
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.12: dCTP diphosphatase.
pdb deposition date 2007-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2oigA00
2OIGA 2OIEA 2GTAA 2Q4PA 3CRAA 3CRCA 1YXBA 2Q73A 1Y6XA 2A3QA 2Q5ZA 3C90A 4QGPA 2A7WA 2YXHA 5IE9A 2Q9LA 1YVWA 2P06A 1VMGA
chains in the Genus database with same CATH superfamily
3RW0A 1SA0B 3WU2Z 4X65B 2X0LA 4PDMA 4PD4F 2UXDO 1Y76B 4OPAA 4YJ2A 1X59A 1ORQC 1JMKC 1AI5A 5KUMA 4JI3O 1U97A 2GDSA 2WLIA 4BIUA 4XDKA 4GX1A 1VF6A 5KUKA 4IL6Z 1FKAO 3OFNG 4CS4A 2Q67A 4DR1B 4B7EA 5DEDA 5FL7G 2ZQMA 3AG2B 1EZVH 3ZHTA 4JTCB 4DV7B 3EXAA 2UXCO 3JD2A 4PI0A 5CA3A 4N23A 2ADPA 2WLHA 3IC9A 4LH6A 4DR5O 1GM7A 2N04A 1R3JC 2DWDC 3GB7C 3RN4A 4ZKIA 2ZT9B 3LNMB 5C93A 3TXQA 1KD1W 3BABA 1GRJA 3JAWA 1MZFA 1D5NA 5B3SC 4PA9A 2QWRB 2N74A 1E79G 3QG5A 1BS3A 3ZMZA 2V1DA 1R3IC 3AK3A 2OIGA 5LXTA 2CUGA 2RQ6A 4WFFA 5EYPA 3WFVA 3KCXA 3WB0A 2Q0OC 5GONB 1N36O 1BE3H 3SJCC 5KMGA 3OR6C 3OGCC 2AHYA 3JD1A 1GM8A 1GMGA 2QWOB 2N05A 3UCSC 4EEQA 1K8AW 3SYQA 1YSCA 2K9PA 4TWKA 4OXSA 3RYHB 4J11A 1LUWA 4LWSA 1M56C 2NNUA 1LNQA 2EINC 5LGNA 1YXBA 5FPOA 2EILC 1FXVA 4WBNA 2CTPA 3ABMC 4DR2B 1WP7A 3AK1A 3QNEA 5KX5A 4UCSA 1E1RG 4CC6A 1WLEA 3LSQA 1IDSA 3VQWA 4MSWC 2OTLV 5H5NA 4DR3B 4K8ZA 4LFBO 1H2MA 5L3FA 5IYCO 1S5JA 2JEXA 5KAFZ 3CE2A 2P22C 1FXKA 2R70A 4JYCA 2LW1A 2CK3G 2WLJA 5IY5B 2ZE6A 4X65O 2EZOA 4B3RB 4JV5O 1Y74B 1H8HG 4FFBB 4ABMA 4FLXA 4JAAA 4X9QA 5IY5C 4I4TA 2YXHA 1AR1B 1L0LH 4J7KA 3ZHRA 5E79Z 2X6CA 1AI4A 2LFSA 3CJHB 4KHPO 4FLWA 1WB8A 2YICA 1MMMA 1AB3A 5B3SB 3N2KB 3IAYA 3E89A 1AVMA 1K73W 3GWKC 1YIJV 2W6JG 1THZA 1I7FA 4E2LA 4R50A 2Q69A 1H8EG 3I56V 2QGNA 3FFQA 1VQMV 4X66O 3CCRV 4MVOA 4MVMA 3T1HO 4QNHB 1FYJA 3A8TA 4LFAO 3K79A 4X62B 1S3JA 2WLKA 1GAXA 2P4KA 4U3FH 1XDCA 3ABUA 1W0KG 4KXRA 2R9AA 3MHHC 4TUYB 4LCUC 2ZR2A 4B08A 4DUZO 4JYAB 4K8XA 4B3TO 2WAMA 4B3TB 2EJ7A 3ASNB 1Q6HA 3JCUZ 2XAHA 5DECA 3STZC 2EIMC 4LF8B 4K0KO 2MK3A 1WNSA 3H01A 3N27A 1QLEB 1JPXA 3L72H 3JARA 1K7DA 4IHJA 4JAUA 2F43G 3R65A 5C8YB 3SJQC 5LOVB 2LGQA 3CC2V 4ZOLB 2F93B 1H2NA 2QDOA 2BE3A 2VRZA 3CCUV 1S0VA 4X88A 3JAMN 1XMOO 2PYLA 1AP6A 1OCCC 1QVGU 3B8NA 4UVCA 1DGSA 3OTOO 3OTOB 2IU3A 1AJQA 3LDDA 5IJ0B 4RWUA 1SZTA 1NR1A 3L74H 4JAVA 4ZI7B 3L9DA 1T5EA 2XHBA 3FAVA 1XI1A 1YEWA 3HKCB 2JRIA 4KFMA 1OCRC 3CEIA 2ILMA 3ZN0A 5IYZA 1TGOA 3ZHUA 2QWQB 3H1JH 1CP9A 4JF3A 2XAQA 3L71H 4O4JA 5IDJA 1HR0B 4RAIA 3ZIAG 2L6LA 5JJEB 1NTZH 4U7OA 3JCZA 3ZMSA 2JEUA 4O4IA 2ZM6B 4JYBA 4QPJA 3QO8A 1F4MA 3D36C 3F7VC 2LW7A 2E75B 2GTAA 1JOYA 1N4CA 3ETGA 3EFFK 2F23A 4DK0A 3TJTA 4UVBA 1I94B 4EB6B 4G27B 3HB3B 2FKXA 3RYFB 4O4LA 3RYIA 4X20B 4FLYA 2JGUA 2CAZC 5KMGB 2D2CB 5CB4A 1WJZA 3ASOB 2XT9A 4U3JA 1UJWB 1YTFB 3APQA 5L3DA 4DR4O 3S3WA 1AI6A 2EX3A 1XNRO 1K9MW 5JCOA 1U96A 4X1KB 4JI7B 4JZGA 2ARHA 4ZHQA 5LL6Y 3BA8A 2ZE8A 4PDRA 5IJ9B 1K3EA 1RFYA 2Q4PA 4QIWF 3K0DA 4NTYA 1KKDA 4GUNA 3SPIA 3SYCA 1VQ5V 5EIBC 4FLUA 3AK2A 3GWOA 5J2UA 2Q5ZA 2GTSA 2F4VB 4GKJO 1S76D 2ZDIC 2UU9B 1NH2B 2GV9A 3STLC 4NXMB 2DOSA 1XMQO 3T4DA 1Q86W 1TUBB 4J7ZA 2W6IG 4JI2O 3K08A 1NJIW 2DYSB 1F7YA 2H8PC 1VF5B 4JI6O 1FXKC 4FFBA 2AHZA 4RQFA 2Q68A 3DC5A 1KU9A 5B5EZ 4O2AA 1KQSU 5LA6A 2CH7A 1VP7A 4X89A 3C90A 4PA3A 4FLZA 4HYOA 1F4NA 4FLVA 3OEEG 4EKWA 3P3PA 1G6UA 5LMUO 1EN6A 4L8JA 1XNQO 3DXRA 3CRMA 1BHAA 1IX9A 4W4KA 3SYOA 4LF4O 5C8YA 3S3XA 4J41A 5LOVA 2OWOA 4TOIA 1N36B 1OV9A 1OCRB 3RVZA 3OMNB 2HJDA 2YXLA 1RM1B 4QGPA 1R73A 1AP5A 1LR1A 1QCEA 3M8AA 3OGIB 1HNWB 2PI5A 1NKDA 2IU0A 3G6EV 4F6EA 1ENVA 1XBLA 4N21A 1SQFA 2CE4A 4EFEA 5LYJB 2EIJB 5A2QN 1VQPV 4TT3G 3O65A 1BCCH 1MOFA 2RDCA 1NTMH 1VF6C 2WSSG 2A9HA 2HVKC 1DF4A 3SPJA 4TV9B 1FXKB 2EIMB 3AG4C 1I94O 2Y4TA 3KKYA 1O9HA 4IGGA 4RQEA 3SJAC 4DV6O 2DW4A 1QU7A 1DLBA 1B06A 1SC5B 2EIKB 1J95A 2ADQB 2YEVA 1V54C 4UVAA 2PYJA 4DV3B 4DR2O 1R3KC 3JALA 1M57C 1QQCA 4X20A 4NR1A 1L8DA 2B1IA 1S5HC 4O2AB 3JYCA 5CB4B 4JASA 4IHJB 1JR9A 2FYUH 4U3JB 2Y0IA 2KB1A 1TAEA 2OIEA 3WB1A 1IBKO 2Q73A 1US6A 1R1BA 1WPXA 1FFTB 4D7SA 2JIZG 2YI8A 4E4EA 2UXDB 4GKKB 3ML0A 5A9GA 1BHBA 3T1HB 5HFMA 4NKGB 5K1PA 1K5QA 2W0XA 4DRXA 3RFRA 5FLXN 4JI0B 4JI0O 4JI1O 1Z5VA 4UXNA 1VQKV 3SYPA 1ZSPA 4MVRA 5H6QA 4IIJB 2QWPB 1G1XB 4UCVA 1L0NH 1CEZA 5FNVA 3RGBA 4H13B 4BR6A 4DUYB 2FB5A 2ZCEA 5IYBO 5CA0A 3M7MX 4MTXA 1EZJA 3JASB 3ABLB 2W0FC 5KA6A 2BTQB 4NB5A 4JI5O 1KP3A 2CH7B 3H1IH 3OUFA 2QEXV 1K4DC 5LMNB 1YI2V 5LP6B 1OCCB 4DR7B 4AI8A 2EBOA 1Y76A 1N33B 1JJ2U 1QR8A 2DQ3A 1M9NA 5JH7A 3ABMB 4JPRA 1Q82W 2WLLB 2EILB 2IW5A 3HKCA 2GUZB 3ZHVA 2IJKA 3JD3A 2XOKG 3OM3B 1VEWA 3AG3B 2BOCC 1FXHA 1QLEC 1ZWIC 3CCVV 1TUEB 2P7TC 4BW9A 4JI2B 3JATB 1MABG 2CTQA 4JTDB 2C2AA 4JI4B 1PKXA 3CMEV 3UT5B 5EBLC 1EN4A 1VQOV 4I55B 1LUVA 5KAIZ 1ZX3A 1BQ0A 1XMOB 2KKWA 1VQ9V 1AR4A 3E8GA 2Z0AA 1Q43A 3CPWU 1RSOB 3K58A 4J7JA 3CB2A 2EJRA 1JFFA 3CP1A 3LUTB 3PN1A 5H2FZ 4QPKA 3FB6C 2DMXA 5CA0B 2EULA 1GN6A 3CRRA 4IT5A 5LHGA 4MVUA 4Q6GA 2BTQA 1N0JA 2UUCB 2PI4A 3WB2A 2XAJA 1AI7A 4J9ZB 2IM9A 1N34O 1OCOC 3OT7A 5J2TA 4GX2A 4WF9V 2FMLA 1XUQA 4GT1A 3E8FA 2Q8VA 4F6RA 5JQGB 5D5PA 2VQFB 2DN9A 3AG2C 1RP3B 3ICXA 3A0HZ 4X8AA 3CCJV 1IBLB 3M99B 4TSFG 2DWEC 2HP8A 3FB7C 3W7TA 1H2LA 1MNGA 1SQPH 1PNLA 4WFBV 2GUZA 4QE9A 5HFLA 3LSUA 4DRXB 1JCHA 1W59A 3PJSK 5EBMC 3HR0A 3TK1A 1Z2GA 1VQ4V 4NTWA 2PZSA 3BRCA 3JAWB 5EZYA 4AILC 4J42A 3L70H 3B2EE 3IC7A 1BQZA 2DYRB 3VOUA 3OEHG 2JJ1G 1Q8IA 2IJIA 2R72A 2JDIG 1ROPA 3OAAG 3N2GA 3AG3C 2A7WA 2AGAA 2YI9A 5KHGA 3K57A 1GM9A 3UO3A 1UPGA 5B1AC 3D3IA 4R8CA 3IFXA 1P7BA 1ZAUA 2P90A 1W2BU 1SS3A 4PHZA 2EINB 1I0HA 2VWKA 3BFRA 4LF7O 3HKDA 1Y6XA 4DR6B 4CH6A 2FTKA 1BZKA 1PL0A 5AG2A 1KP2A 1YJWV 4DUZB 3SPCA 2LP7A 3CJHA 3RYHA 2UXCB 2QM7A 2B5UA 1FJGB 1OCZB 3L73H 1H2KA 3OE7G 3JSLA 3E2EA 1M56B 2PY5A 3J7AU 2RN9A 1L1FA 3RWRD 4LF6O 3CCSV 4GZRB 3T1CA 4DV0B 4ZI7A 5TISZ 3P3NA 3E86A 3QVNA 1BT8A 5JJJB 3AG7A 2HJFC 3SYAA 4X1YA 5EBWC 2G38A 3DSQA 2CTRA 3Q4HA 4FM0A 1QLNA 4KHPB 2DE0X 4JI8B 4I50B 3BA9A 1S5LZ 2QSAA 3JAKB 5LGTA 3G71V 2UUAB 4O4HA 3MDSA 2Y69C 4GX0A 3ZJZA 4DR7O 3A0BZ 2QKSA 2OYQA 3JALB 4YJ3A 2F95B 1R3LC 3N2GB 1JFFB 4LNUB 4FZ1A 4B7KA 2QE7G 3CRQA 3DTUB 4J10A 2UXXA 4CBCA 2WWWA 5F2VO 1N34B 2IH1C 3UO2A 4Z1VA 1K92A 3CCMV 1N8RW 3JARB 4I9WA 1ZTEA 1V55B 2RCVA 1PL4A 2BSKA 2WLNA 3ZRWA 1M1KW 2AZ2A 1CXZB 4Q20A 2Q7HA 5BZBA 1GTOA 3BHPA 4UB6Z 4NXNO 4BW5A 4GYCB 2NN4A 4O2BB 5BR8O 2BCCH 3VQXA 4ZHQB 3CX5F 3CD6V 2CGOA 2F66C 1YITV 3OMIB 4EFBA 5CN0A 3I55V 1ZUQA 4DR1O 2E76B 2WLMA 4GKKO 1V54B 2YIBA 4JI6B 4PDVA 3E22A 2EIKC 2DJVA 4IIJA 3X2QC 4YHHO 5CBHA 5EK0A 3G4SV 1M5IA 3AG4B 3FYEB 2ZNJA 1J5EB 1J5EO 1GN3A 4JZ2A 3ZX6A 3W7WA 1FAFA 2NLJC 2QA4V 4LFCO 4DV5O 1WA8B 2KQXA 3HKBA 4OX9B 3UKMA 1Q6IA 1RM1C 4OX9O 2QM8A 3TGUH 3DC6A 4I4TB 1H2SB 2QKCA 2B9ZA 5LP6A 3CSXA 5LP6C 4NVPA 3HKDB 1NVPB 5L3BA 4KUMA 3CMAV 1SA0A 3LDEA 3W7SA 3CCLV 5GTIZ 4DV1O 3ABLC 3A0RA 4FMTA 1BMFG 1Z5WA 1I08A 1NT2B 4IYIA 4MVSA 4DW0A 4RUFA 1NS1A 2DYSC 2H3OA 1AROP 3IGAC 4PELA 4MT8A 3ZRWB 2MW2B 4G2KA 5K1XA 4UCTA 1Y66A 5IYZB 3W7UA 4F4LA 3ZRVA 2ODMA 1SQBH 1Y4MA 2GSMB 4MTGA 1VQLV 1HP8A 4JI8O 2Q6AA 4O4JB 5JVDA 1IVSA 3CC7V 3E83A 3I5DA 2HKOA 1OHHG 1Q5OA 2YXYA 3OUSA 1TVKB 1XOUA 3WG7B 1DK1A 1YDXA 2JS5A 2ZM6O 3ABKB 3K5NA 1RPOA 2M7WA 2AZ0A 3E8BA 5FPRA 4DV4B 1SERA 2M6YA 4DV4O 3EHBB 5CMUA 4O4LB 4LF9B 1HDJA 3APOA 1BGYH 2Y0PA 4AQYO 2F1MA 1V9PA 4UCRA 1SF9A 2QR4A 1URFA 4JTAB 1DF5A 3CRAA 2YEVB 4Z1MG 1N0NA 4DV3O 3QO7A 1NR7A 2VWJA 1PV0A 2R9RB 4ZIBA 3P32A 4F6RB 4FM2A 4P30A 2Z3YA 1H2GA 4MVZA 1M57B 3FD9A 1SETA 2WA4A 2NR5A 1HNXO 1XILA 2E74B 3BVOA 1SRYA 5IJ9A 1JJOA 1KMIZ 3ASOC 5EC2C 3J81N 4I9QA 1KECA 4FLTA 4P9PA 1IXMA 3VBBA 4LFAB 3ZHSA 4YHHB 4I7ZB 4DXWA 2XTAA 3OW2U 4FZ0A 2HEPA 4RO2A 2XUMA 4HNAA 3K3WA 5J2UB 1FPOA 4K35A 2ITDC 3E8HA 3H1LH 2X7RB 4FJCC 4I50A 4WFHA 4CS2A 2PGGA 3QTCA 4LF5B 5DN6G 4D6TH 3RYFA 1VQ7V 4U7NA 4DO2A 3MHSC 4DW1A 1P7GA 1O9GA 5B1NA 5LA6B 5EYPB 3RT3C 1XNRB 1JX9A 1M90W 3JASA 1DTOA 4IYHA 5JJNB 1Y74A 4KP4A 3K9SA 1GO3F 3CXHF 3QF7A 3B40A 1ZLZA 1R6KA 1YTFD 4X1KA 4JV5B 1EFRG 5H9CA 4UCUA 1K97A 1QR9A 4B3MO 3W7XA 4RUEA 4HBNA 4O2BA 3X2QB 1G4YB 3U0ZA 3SPGA 1P4RA 2V4DA 4NYKA 1IXBA 2ATKC 4B3SB 1NI8A 1IBMB 2F4VO 5LHHA 4XDJA 5LGUA 3QO5A 3AG1B 4CH5A 1SESA 3H1KH 4FK5C 3K5OA 4R6ZA 2Q7EA 3JATA 4ICGA 3TETA 4I0XA 3ZN1A 5KHHA 4HNAB 4NTXA 1VARA 4HZ3A 5LHIA 1KC8W 2OT5A 1V55C 3RYCB 1VIBA 1XL4A 5KA5A 4YY3O 1WA8A 1SZXA 2UXBB 4TUYA 3D36A 3B4SA 2ZIOA 3O9OA 1N32O 1K33A 2YUAA 1RSOA 1XHZA 3DXRB 1WAZA 3HPLC 2YC0A 4R7CA 4DV7O 5DM6V 4GKJB 2QJ1A 4H0LB 2VS0A 2HVJC 5BR8B 1XREA 4NXMO 3F5WC 1XMQB 1HNXB 2Y69B 1PNMA 2BTOA 2YDEA 4D7TA 2DYRC 2R9IA 1NBMG 2PUSA 1AR5A 2ZINA 5JQGA 4PA7A 2JGDA 4UV9A 3FB8C 1YHQV 1SKVA 2A06H 3BY6A 1VQ8V 4TV8B 2D3OW 4MVQA 3AEIA 1K34A 5IYDO 1Y67A 5JVDB 1HNZB 1BL8A 5KHJA 2XAFA 3CCEV 2QWNB 1S77D 4WFEA 1HW7A 2DQ0A 3ZCCA 4LF7B 2HHHO 2ETNA 2RNBA 2YIDA 1OCZC 3RBZA 2HR3A 4DYLA 3K04A 4DUYO 4C7UA 2KG7B 2QM4A 1Q90D 5GONA 2P4VA 4DR5B 4JYYA 1AILA 2Z5UA 3HKEA 1MG1A 4YIOA 1OZ0A 4H44B 3MD0A 4JI5B 5B1AB 4LF8O 4K0KB 4TQDA 3D8CA 1F23A 2ITCC 5EC1C 5B66Z 1NVPD 3CHXA 1AJNA 3JSNA 1FFXA 2E5LO 1PNKA 3AG1C 3K0GA 4WFGA 3H1HH 1COWG 1NU1H 2GBOA 2CDYA 3L75H 4GX5A 5BMVB 3CC4V 4LFBB 3ASNC 3RVYA 4B3SO 1ZL8A 1IBMO 1E1QG 2UUAO 3E35A 4YIPA 5KX5B 4G28B 1MSDA 3ETEA 4X64O 2JGDB 4KL1A 1I5XA 2GHYA 5IWAO 1NTKH 2JS3A 1HNWO 5JWPA 1SQXH 2ZD9A 2LJ2A 4OGQB 1M93A 3ZS8C 2QTSA 1WP8A 5EZYB 2EZPA 3H9VA 3B77A 5BXZA 1VQ6V 3K5MA 3SPHA 1N32B 5CBFA 5IT9N 3FKSG 5JCOC 1OCOB 1NQTA 3ETDA 4QJFB 1SQGA 3JAKA 1JA8A 2X6AA 1D2DA 1QBZA 2Y48A 1QVFU 2LFRA 1KKCA 1IURA 4DR4B 3T1YB 2OTJV 1B6QA 1B04A 1N33O 4JI3B 4X1IB 3FB5C 3TCUA 4AHCA 5IE9A 4LNUA 4P9OA 2VQEO 1HR0O 1EM1A 1H38A 2ZIMA 2VQEB 1IZ3A 4CH3A 5JH7B 4CZZA 2ZNIA 3DGEA 4BAYA 2P5OA 4WCEV 2YIAA 3T2MA 4X62O 3CCQV 2IJHA 1AJPA 2OCHA 1R6NA 2BSKB 1W0JG 1NH2D 1Q81W 4UCOA 4CS3A 2XASA 1JVMA 1HNZO 2ZXWC 4JI1B 2IJJA 5GW7A 4YY3B 1K4CC 1PPJH 4W4LA 3VQYA 2HHHB 4FVMA 2O57A 2XAGA 2XNDG 3ETQA 1IBLO 4I55A 3K5LA 3EVKA 2X6BA 4Z2WA 2RMKB 4BIOA 4JYAO 2UU9O 1GK9A 3KCYA 3ZMTA 1VQNV 4O4HB 1MZEA 4LP8A 1IBKB 4UUJC 4XBFA 4TV9A 1VMGA 3GVMA 1TUBA 3ZRSA 3BEHA 2KG7A 4K3AA 3RYIB 2P06A 1EN5A 3LSSA 4DV2B 4J80A 4LF5O 4DV2O 4FIPC 1YZBA 3HKEB 5B1BC 1JQ0A 2Q7GA 5J2TB 4CC5A 3JD4A 4PI2A 4XDLA 1XNQB 5L3EA 1XL6A 2ZE7A 3ZMVA 1RPRA 3K59A 1QNMA 1XEQA 5J9PC 3SJBC 1MA1A 1FJGO 5IJ0A 3ABTA 4OPHA 1TA8A 3KZIZ 1YF2A 3OD4A 2WLIB 4X64B 4TQFA 4YXWG 3R66A 3BAAA 2EIJC 1ZL8B 4DR6O 3D3QA 4BIZA 3C3TA 4LF6B 4GCZA 5IWAB 5CBGA 4TV8A 4FFKA 3U10A 3J80N 5LBQA 4X1YB 2ZE5A 1YVWA 3THOA 2JVDA 4B3MB 4AQYB 5CA1B 3FX7A 5LYJA 2VQFO 5ITZB 1P49A 4DV1B 3A2FA 3JD0A 1SQQH 4MW3A 4PJ0Z 3KG2A 5KHIA 4DV0O 3B8MA 2K1EA 1OJHA 2B1GA 3K03A 2P67A 4NXNB 3T1YO 4MS2A 3G67A 2UUBO 2P6JA 2UUBB 3LDCA 2OCCB 4PA6A 4HAMA 4PA4A 5FNVB 2A3QA 2FL4A 1MSWD 5L3CA 3K9AA 4QE7A 3G6BA 4X66B 3ZRXA 5H6RA 3T4ZA 3SR2C 1QHTA 2A0LA 3UQ8A 2A79B 3BPZA 3OTFA 1FFXB 1M4UA 4A5UB 4JI7O 2JJ2G 1XQ8A 5D5QA 5B1OA 4L87A 5EIBD 2CGNA 2YS8A 4ZBMA 2PF4E 3K06A 3F5TA 4LFCB 4I5SA 2OCCC 2UXBO 2YSUB 4UB8Z 3N2KA 2WLLA 3NR7A 4JGSA 1WPBA 3TXSA 3SGIA 1Q7YW 1SQVH 3CYOA 1GKFA 3E22B 3Q4HB 4FPPA 4ASUG 4P2ZA 1KB9F 2QKAA 3UM7A 3LNNA 1I5YA 3FYIB 2LGWA 5BY1A 3F7YC 1EBOA 1KUQA 5CA1A 1F51A 1KBHA 5LMUB 2LQTA 1WN7A 5GTHZ 4MTFA 3UT5A 3WG7C 1NZ6A 4GLXA 4YJ3B 4LF4B 4LH7A 5LMNO 1YJ9V 1VF7A 2HFEC 1Q6UA 3CS5A 4DV5B 3OR7C 3CXCU 3HKBB 3VQVA 5L3GA 1GN2A 1A32A 1B3QA 1P84F 1CPYA 3ABKC 4X1IA 4UV8A 1PD3A 2HG5C 3CWBH 1R6TA 4WFAV 1D5AA 4YJ2B 4MW8A 2CTWA 2WPDG 2AXTZ 3NXSA 4H33A 5E1AC 2UXNA 1S72V 5BMVA 1GN4A 2HLDG 1Q3EA 2YIBD 3P30A 3G80A 4FM1A 2RJZA 2Q9LA 2JK5C 1X4TA 2UUCO 4ZOLA 2IH3C 4LWSB 3C3SA 1WB7A 3SDLA 2ZDIA 4UFZA 4J9YB 1YJNV 4JI4O 1PM9A 5KHKA 4PV1B 2E5LB 1G8MA 2ZKOA 2QTOA 4WBNB 2Y4UA 1GH6A 1HWYA 1UFIA 2KSDA 5B1BB 1FS0G 3FAVB 2LO1A 2BOBC 2H94A 4BWAA 4CH4A 4DK1A 1KYOF 1FD9A 1BSMA 3ZBHA 4MTOA 2AW9A 4PDLA 4H37A 1TVKA 5ITZA 1YCIA 4DV6B 3CRCA 2PTMA 2V7QG 3ZHQA 3B09A 4I0XB 3ZMUA 4LC1A 4LR3A 4DR3O 2E3CA 2L35A 2ZXWB 5LXTB 4O4IB 3MAQA 2WA3A 3ZEDA 3U11A 3RYCA 4LBEC 4LF9O 3OMAB 1K5SA 2Q0AA 3IJ4A 1PP9H 1XHXA 2IBZH 2ZR3A 3BCCH 4EB6A 5KLVH 4B3RO
chains in the Genus database with same CATH topology
2OIGA 2OIEA 2GTAA 2Q4PA 3CRAA 3CRCA 1YXBA 2Q73A 1Y6XA 2A3QA 2Q5ZA 3C90A 4QGPA 2A7WA 2YXHA 5IE9A 2Q9LA 1YVWA 2P06A 1VMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OIG A;  2OIE A;  2GTA A;  2Q4P A;  3CRA A;  3CRC A;  1YXB A;  2Q73 A;  1Y6X A;  2A3Q A;  2Q5Z A;  3C90 A;  4QGP A;  2A7W A;  2YXH A;  5IE9 A;  2Q9L A;  1YVW A;  2P06 A;  1VMG A; 
#chains in the Genus database with same CATH topology
 3RW0 A;  1SA0 B;  3WU2 Z;  4X65 B;  2X0L A;  4PDM A;  4PD4 F;  2UXD O;  1Y76 B;  4OPA A;  4YJ2 A;  1X59 A;  1ORQ C;  1JMK C;  1AI5 A;  5KUM A;  4JI3 O;  1U97 A;  2GDS A;  2WLI A;  4BIU A;  4XDK A;  4GX1 A;  1VF6 A;  5KUK A;  4IL6 Z;  1FKA O;  3OFN G;  4CS4 A;  2Q67 A;  4DR1 B;  4B7E A;  5DED A;  5FL7 G;  2ZQM A;  3AG2 B;  1EZV H;  3ZHT A;  4JTC B;  4DV7 B;  3EXA A;  2UXC O;  3JD2 A;  4PI0 A;  5CA3 A;  4N23 A;  2ADP A;  2WLH A;  3IC9 A;  4LH6 A;  4DR5 O;  1GM7 A;  2N04 A;  1R3J C;  2DWD C;  3GB7 C;  3RN4 A;  4ZKI A;  2ZT9 B;  3LNM B;  5C93 A;  3TXQ A;  1KD1 W;  3BAB A;  1GRJ A;  3JAW A;  1MZF A;  1D5N A;  5B3S C;  4PA9 A;  2QWR B;  2N74 A;  1E79 G;  3QG5 A;  1BS3 A;  3ZMZ A;  2V1D A;  1R3I C;  3AK3 A;  2OIG A;  5LXT A;  2CUG A;  2RQ6 A;  4WFF A;  5EYP A;  3WFV A;  3KCX A;  3WB0 A;  2Q0O C;  5GON B;  1N36 O;  1BE3 H;  3SJC C;  5KMG A;  3OR6 C;  3OGC C;  2AHY A;  3JD1 A;  1GM8 A;  1GMG A;  2QWO B;  2N05 A;  3UCS C;  4EEQ A;  1K8A W;  3SYQ A;  1YSC A;  2K9P A;  4TWK A;  4OXS A;  3RYH B;  4J11 A;  1LUW A;  4LWS A;  1M56 C;  2NNU A;  1LNQ A;  2EIN C;  5LGN A;  1YXB A;  5FPO A;  2EIL C;  1FXV A;  4WBN A;  2CTP A;  3ABM C;  4DR2 B;  1WP7 A;  3AK1 A;  3QNE A;  5KX5 A;  4UCS A;  1E1R G;  4CC6 A;  1WLE A;  3LSQ A;  1IDS A;  3VQW A;  4MSW C;  2OTL V;  5H5N A;  4DR3 B;  4K8Z A;  4LFB O;  1H2M A;  5L3F A;  5IYC O;  1S5J A;  2JEX A;  5KAF Z;  3CE2 A;  2P22 C;  1FXK A;  2R70 A;  4JYC A;  2LW1 A;  2CK3 G;  2WLJ A;  5IY5 B;  2ZE6 A;  4X65 O;  2EZO A;  4B3R B;  4JV5 O;  1Y74 B;  1H8H G;  4FFB B;  4ABM A;  4FLX A;  4JAA A;  4X9Q A;  5IY5 C;  4I4T A;  2YXH A;  1AR1 B;  1L0L H;  4J7K A;  3ZHR A;  5E79 Z;  2X6C A;  1AI4 A;  2LFS A;  3CJH B;  4KHP O;  4FLW A;  1WB8 A;  2YIC A;  1MMM A;  1AB3 A;  5B3S B;  3N2K B;  3IAY A;  3E89 A;  1AVM A;  1K73 W;  3GWK C;  1YIJ V;  2W6J G;  1THZ A;  1I7F A;  4E2L A;  4R50 A;  2Q69 A;  1H8E G;  3I56 V;  2QGN A;  3FFQ A;  1VQM V;  4X66 O;  3CCR V;  4MVO A;  4MVM A;  3T1H O;  4QNH B;  1FYJ A;  3A8T A;  4LFA O;  3K79 A;  4X62 B;  1S3J A;  2WLK A;  1GAX A;  2P4K A;  4U3F H;  1XDC A;  3ABU A;  1W0K G;  4KXR A;  2R9A A;  3MHH C;  4TUY B;  4LCU C;  2ZR2 A;  4B08 A;  4DUZ O;  4JYA B;  4K8X A;  4B3T O;  2WAM A;  4B3T B;  2EJ7 A;  3ASN B;  1Q6H A;  3JCU Z;  2XAH A;  5DEC A;  3STZ C;  2EIM C;  4LF8 B;  4K0K O;  2MK3 A;  1WNS A;  3H01 A;  3N27 A;  1QLE B;  1JPX A;  3L72 H;  3JAR A;  1K7D A;  4IHJ A;  4JAU A;  2F43 G;  3R65 A;  5C8Y B;  3SJQ C;  5LOV B;  2LGQ A;  3CC2 V;  4ZOL B;  2F93 B;  1H2N A;  2QDO A;  2BE3 A;  2VRZ A;  3CCU V;  1S0V A;  4X88 A;  3JAM N;  1XMO O;  2PYL A;  1AP6 A;  1OCC C;  1QVG U;  3B8N A;  4UVC A;  1DGS A;  3OTO O;  3OTO B;  2IU3 A;  1AJQ A;  3LDD A;  5IJ0 B;  4RWU A;  1SZT A;  1NR1 A;  3L74 H;  4JAV A;  4ZI7 B;  3L9D A;  1T5E A;  2XHB A;  3FAV A;  1XI1 A;  1YEW A;  3HKC B;  2JRI A;  4KFM A;  1OCR C;  3CEI A;  2ILM A;  3ZN0 A;  5IYZ A;  1TGO A;  3ZHU A;  2QWQ B;  3H1J H;  1CP9 A;  4JF3 A;  2XAQ A;  3L71 H;  4O4J A;  5IDJ A;  1HR0 B;  4RAI A;  3ZIA G;  2L6L A;  5JJE B;  1NTZ H;  4U7O A;  3JCZ A;  3ZMS A;  2JEU A;  4O4I A;  2ZM6 B;  4JYB A;  4QPJ A;  3QO8 A;  1F4M A;  3D36 C;  3F7V C;  2LW7 A;  2E75 B;  2GTA A;  1JOY A;  1N4C A;  3ETG A;  3EFF K;  2F23 A;  4DK0 A;  3TJT A;  4UVB A;  1I94 B;  4EB6 B;  4G27 B;  3HB3 B;  2FKX A;  3RYF B;  4O4L A;  3RYI A;  4X20 B;  4FLY A;  2JGU A;  2CAZ C;  5KMG B;  2D2C B;  5CB4 A;  1WJZ A;  3ASO B;  2XT9 A;  4U3J A;  1UJW B;  1YTF B;  3APQ A;  5L3D A;  4DR4 O;  3S3W A;  1AI6 A;  2EX3 A;  1XNR O;  1K9M W;  5JCO A;  1U96 A;  4X1K B;  4JI7 B;  4JZG A;  2ARH A;  4ZHQ A;  5LL6 Y;  3BA8 A;  2ZE8 A;  4PDR A;  5IJ9 B;  1K3E A;  1RFY A;  2Q4P A;  4QIW F;  3K0D A;  4NTY A;  1KKD A;  4GUN A;  3SPI A;  3SYC A;  1VQ5 V;  5EIB C;  4FLU A;  3AK2 A;  3GWO A;  5J2U A;  2Q5Z A;  2GTS A;  2F4V B;  4GKJ O;  1S76 D;  2ZDI C;  2UU9 B;  1NH2 B;  2GV9 A;  3STL C;  4NXM B;  2DOS A;  1XMQ O;  3T4D A;  1Q86 W;  1TUB B;  4J7Z A;  2W6I G;  4JI2 O;  3K08 A;  1NJI W;  2DYS B;  1F7Y A;  2H8P C;  1VF5 B;  4JI6 O;  1FXK C;  4FFB A;  2AHZ A;  4RQF A;  2Q68 A;  3DC5 A;  1KU9 A;  5B5E Z;  4O2A A;  1KQS U;  5LA6 A;  2CH7 A;  1VP7 A;  4X89 A;  3C90 A;  4PA3 A;  4FLZ A;  4HYO A;  1F4N A;  4FLV A;  3OEE G;  4EKW A;  3P3P A;  1G6U A;  5LMU O;  1EN6 A;  4L8J A;  1XNQ O;  3DXR A;  3CRM A;  1BHA A;  1IX9 A;  4W4K A;  3SYO A;  4LF4 O;  5C8Y A;  3S3X A;  4J41 A;  5LOV A;  2OWO A;  4TOI A;  1N36 B;  1OV9 A;  1OCR B;  3RVZ A;  3OMN B;  2HJD A;  2YXL A;  1RM1 B;  4QGP A;  1R73 A;  1AP5 A;  1LR1 A;  1QCE A;  3M8A A;  3OGI B;  1HNW B;  2PI5 A;  1NKD A;  2IU0 A;  3G6E V;  4F6E A;  1ENV A;  1XBL A;  4N21 A;  1SQF A;  2CE4 A;  4EFE A;  5LYJ B;  2EIJ B;  5A2Q N;  1VQP V;  4TT3 G;  3O65 A;  1BCC H;  1MOF A;  2RDC A;  1NTM H;  1VF6 C;  2WSS G;  2A9H A;  2HVK C;  1DF4 A;  3SPJ A;  4TV9 B;  1FXK B;  2EIM B;  3AG4 C;  1I94 O;  2Y4T A;  3KKY A;  1O9H A;  4IGG A;  4RQE A;  3SJA C;  4DV6 O;  2DW4 A;  1QU7 A;  1DLB A;  1B06 A;  1SC5 B;  2EIK B;  1J95 A;  2ADQ B;  2YEV A;  1V54 C;  4UVA A;  2PYJ A;  4DV3 B;  4DR2 O;  1R3K C;  3JAL A;  1M57 C;  1QQC A;  4X20 A;  4NR1 A;  1L8D A;  2B1I A;  1S5H C;  4O2A B;  3JYC A;  5CB4 B;  4JAS A;  4IHJ B;  1JR9 A;  2FYU H;  4U3J B;  2Y0I A;  2KB1 A;  1TAE A;  2OIE A;  3WB1 A;  1IBK O;  2Q73 A;  1US6 A;  1R1B A;  1WPX A;  1FFT B;  4D7S A;  2JIZ G;  2YI8 A;  4E4E A;  2UXD B;  4GKK B;  3ML0 A;  5A9G A;  1BHB A;  3T1H B;  5HFM A;  4NKG B;  5K1P A;  1K5Q A;  2W0X A;  4DRX A;  3RFR A;  5FLX N;  4JI0 B;  4JI0 O;  4JI1 O;  1Z5V A;  4UXN A;  1VQK V;  3SYP A;  1ZSP A;  4MVR A;  5H6Q A;  4IIJ B;  2QWP B;  1G1X B;  4UCV A;  1L0N H;  1CEZ A;  5FNV A;  3RGB A;  4H13 B;  4BR6 A;  4DUY B;  2FB5 A;  2ZCE A;  5IYB O;  5CA0 A;  3M7M X;  4MTX A;  1EZJ A;  3JAS B;  3ABL B;  2W0F C;  5KA6 A;  2BTQ B;  4NB5 A;  4JI5 O;  1KP3 A;  2CH7 B;  3H1I H;  3OUF A;  2QEX V;  1K4D C;  5LMN B;  1YI2 V;  5LP6 B;  1OCC B;  4DR7 B;  4AI8 A;  2EBO A;  1Y76 A;  1N33 B;  1JJ2 U;  1QR8 A;  2DQ3 A;  1M9N A;  5JH7 A;  3ABM B;  4JPR A;  1Q82 W;  2WLL B;  2EIL B;  2IW5 A;  3HKC A;  2GUZ B;  3ZHV A;  2IJK A;  3JD3 A;  2XOK G;  3OM3 B;  1VEW A;  3AG3 B;  2BOC C;  1FXH A;  1QLE C;  1ZWI C;  3CCV V;  1TUE B;  2P7T C;  4BW9 A;  4JI2 B;  3JAT B;  1MAB G;  2CTQ A;  4JTD B;  2C2A A;  4JI4 B;  1PKX A;  3CME V;  3UT5 B;  5EBL C;  1EN4 A;  1VQO V;  4I55 B;  1LUV A;  5KAI Z;  1ZX3 A;  1BQ0 A;  1XMO B;  2KKW A;  1VQ9 V;  1AR4 A;  3E8G A;  2Z0A A;  1Q43 A;  3CPW U;  1RSO B;  3K58 A;  4J7J A;  3CB2 A;  2EJR A;  1JFF A;  3CP1 A;  3LUT B;  3PN1 A;  5H2F Z;  4QPK A;  3FB6 C;  2DMX A;  5CA0 B;  2EUL A;  1GN6 A;  3CRR A;  4IT5 A;  5LHG A;  4MVU A;  4Q6G A;  2BTQ A;  1N0J A;  2UUC B;  2PI4 A;  3WB2 A;  2XAJ A;  1AI7 A;  4J9Z B;  2IM9 A;  1N34 O;  1OCO C;  3OT7 A;  5J2T A;  4GX2 A;  4WF9 V;  2FML A;  1XUQ A;  4GT1 A;  3E8F A;  2Q8V A;  4F6R A;  5JQG B;  5D5P A;  2VQF B;  2DN9 A;  3AG2 C;  1RP3 B;  3ICX A;  3A0H Z;  4X8A A;  3CCJ V;  1IBL B;  3M99 B;  4TSF G;  2DWE C;  2HP8 A;  3FB7 C;  3W7T A;  1H2L A;  1MNG A;  1SQP H;  1PNL A;  4WFB V;  2GUZ A;  4QE9 A;  5HFL A;  3LSU A;  4DRX B;  1JCH A;  1W59 A;  3PJS K;  5EBM C;  3HR0 A;  3TK1 A;  1Z2G A;  1VQ4 V;  4NTW A;  2PZS A;  3BRC A;  3JAW B;  5EZY A;  4AIL C;  4J42 A;  3L70 H;  3B2E E;  3IC7 A;  1BQZ A;  2DYR B;  3VOU A;  3OEH G;  2JJ1 G;  1Q8I A;  2IJI A;  2R72 A;  2JDI G;  1ROP A;  3OAA G;  3N2G A;  3AG3 C;  2A7W A;  2AGA A;  2YI9 A;  5KHG A;  3K57 A;  1GM9 A;  3UO3 A;  1UPG A;  5B1A C;  3D3I A;  4R8C A;  3IFX A;  1P7B A;  1ZAU A;  2P90 A;  1W2B U;  1SS3 A;  4PHZ A;  2EIN B;  1I0H A;  2VWK A;  3BFR A;  4LF7 O;  3HKD A;  1Y6X A;  4DR6 B;  4CH6 A;  2FTK A;  1BZK A;  1PL0 A;  5AG2 A;  1KP2 A;  1YJW V;  4DUZ B;  3SPC A;  2LP7 A;  3CJH A;  3RYH A;  2UXC B;  2QM7 A;  2B5U A;  1FJG B;  1OCZ B;  3L73 H;  1H2K A;  3OE7 G;  3JSL A;  3E2E A;  1M56 B;  2PY5 A;  3J7A U;  2RN9 A;  1L1F A;  3RWR D;  4LF6 O;  3CCS V;  4GZR B;  3T1C A;  4DV0 B;  4ZI7 A;  5TIS Z;  3P3N A;  3E86 A;  3QVN A;  1BT8 A;  5JJJ B;  3AG7 A;  2HJF C;  3SYA A;  4X1Y A;  5EBW C;  2G38 A;  3DSQ A;  2CTR A;  3Q4H A;  4FM0 A;  1QLN A;  4KHP B;  2DE0 X;  4JI8 B;  4I50 B;  3BA9 A;  1S5L Z;  2QSA A;  3JAK B;  5LGT A;  3G71 V;  2UUA B;  4O4H A;  3MDS A;  2Y69 C;  4GX0 A;  3ZJZ A;  4DR7 O;  3A0B Z;  2QKS A;  2OYQ A;  3JAL B;  4YJ3 A;  2F95 B;  1R3L C;  3N2G B;  1JFF B;  4LNU B;  4FZ1 A;  4B7K A;  2QE7 G;  3CRQ A;  3DTU B;  4J10 A;  2UXX A;  4CBC A;  2WWW A;  5F2V O;  1N34 B;  2IH1 C;  3UO2 A;  4Z1V A;  1K92 A;  3CCM V;  1N8R W;  3JAR B;  4I9W A;  1ZTE A;  1V55 B;  2RCV A;  1PL4 A;  2BSK A;  2WLN A;  3ZRW A;  1M1K W;  2AZ2 A;  1CXZ B;  4Q20 A;  2Q7H A;  5BZB A;  1GTO A;  3BHP A;  4UB6 Z;  4NXN O;  4BW5 A;  4GYC B;  2NN4 A;  4O2B B;  5BR8 O;  2BCC H;  3VQX A;  4ZHQ B;  3CX5 F;  3CD6 V;  2CGO A;  2F66 C;  1YIT V;  3OMI B;  4EFB A;  5CN0 A;  3I55 V;  1ZUQ A;  4DR1 O;  2E76 B;  2WLM A;  4GKK O;  1V54 B;  2YIB A;  4JI6 B;  4PDV A;  3E22 A;  2EIK C;  2DJV A;  4IIJ A;  3X2Q C;  4YHH O;  5CBH A;  5EK0 A;  3G4S V;  1M5I A;  3AG4 B;  3FYE B;  2ZNJ A;  1J5E B;  1J5E O;  1GN3 A;  4JZ2 A;  3ZX6 A;  3W7W A;  1FAF A;  2NLJ C;  2QA4 V;  4LFC O;  4DV5 O;  1WA8 B;  2KQX A;  3HKB A;  4OX9 B;  3UKM A;  1Q6I A;  1RM1 C;  4OX9 O;  2QM8 A;  3TGU H;  3DC6 A;  4I4T B;  1H2S B;  2QKC A;  2B9Z A;  5LP6 A;  3CSX A;  5LP6 C;  4NVP A;  3HKD B;  1NVP B;  5L3B A;  4KUM A;  3CMA V;  1SA0 A;  3LDE A;  3W7S A;  3CCL V;  5GTI Z;  4DV1 O;  3ABL C;  3A0R A;  4FMT A;  1BMF G;  1Z5W A;  1I08 A;  1NT2 B;  4IYI A;  4MVS A;  4DW0 A;  4RUF A;  1NS1 A;  2DYS C;  2H3O A;  1ARO P;  3IGA C;  4PEL A;  4MT8 A;  3ZRW B;  2MW2 B;  4G2K A;  5K1X A;  4UCT A;  1Y66 A;  5IYZ B;  3W7U A;  4F4L A;  3ZRV A;  2ODM A;  1SQB H;  1Y4M A;  2GSM B;  4MTG A;  1VQL V;  1HP8 A;  4JI8 O;  2Q6A A;  4O4J B;  5JVD A;  1IVS A;  3CC7 V;  3E83 A;  3I5D A;  2HKO A;  1OHH G;  1Q5O A;  2YXY A;  3OUS A;  1TVK B;  1XOU A;  3WG7 B;  1DK1 A;  1YDX A;  2JS5 A;  2ZM6 O;  3ABK B;  3K5N A;  1RPO A;  2M7W A;  2AZ0 A;  3E8B A;  5FPR A;  4DV4 B;  1SER A;  2M6Y A;  4DV4 O;  3EHB B;  5CMU A;  4O4L B;  4LF9 B;  1HDJ A;  3APO A;  1BGY H;  2Y0P A;  4AQY O;  2F1M A;  1V9P A;  4UCR A;  1SF9 A;  2QR4 A;  1URF A;  4JTA B;  1DF5 A;  3CRA A;  2YEV B;  4Z1M G;  1N0N A;  4DV3 O;  3QO7 A;  1NR7 A;  2VWJ A;  1PV0 A;  2R9R B;  4ZIB A;  3P32 A;  4F6R B;  4FM2 A;  4P30 A;  2Z3Y A;  1H2G A;  4MVZ A;  1M57 B;  3FD9 A;  1SET A;  2WA4 A;  2NR5 A;  1HNX O;  1XIL A;  2E74 B;  3BVO A;  1SRY A;  5IJ9 A;  1JJO A;  1KMI Z;  3ASO C;  5EC2 C;  3J81 N;  4I9Q A;  1KEC A;  4FLT A;  4P9P A;  1IXM A;  3VBB A;  4LFA B;  3ZHS A;  4YHH B;  4I7Z B;  4DXW A;  2XTA A;  3OW2 U;  4FZ0 A;  2HEP A;  4RO2 A;  2XUM A;  4HNA A;  3K3W A;  5J2U B;  1FPO A;  4K35 A;  2ITD C;  3E8H A;  3H1L H;  2X7R B;  4FJC C;  4I50 A;  4WFH A;  4CS2 A;  2PGG A;  3QTC A;  4LF5 B;  5DN6 G;  4D6T H;  3RYF A;  1VQ7 V;  4U7N A;  4DO2 A;  3MHS C;  4DW1 A;  1P7G A;  1O9G A;  5B1N A;  5LA6 B;  5EYP B;  3RT3 C;  1XNR B;  1JX9 A;  1M90 W;  3JAS A;  1DTO A;  4IYH A;  5JJN B;  1Y74 A;  4KP4 A;  3K9S A;  1GO3 F;  3CXH F;  3QF7 A;  3B40 A;  1ZLZ A;  1R6K A;  1YTF D;  4X1K A;  4JV5 B;  1EFR G;  5H9C A;  4UCU A;  1K97 A;  1QR9 A;  4B3M O;  3W7X A;  4RUE A;  4HBN A;  4O2B A;  3X2Q B;  1G4Y B;  3U0Z A;  3SPG A;  1P4R A;  2V4D A;  4NYK A;  1IXB A;  2ATK C;  4B3S B;  1NI8 A;  1IBM B;  2F4V O;  5LHH A;  4XDJ A;  5LGU A;  3QO5 A;  3AG1 B;  4CH5 A;  1SES A;  3H1K H;  4FK5 C;  3K5O A;  4R6Z A;  2Q7E A;  3JAT A;  4ICG A;  3TET A;  4I0X A;  3ZN1 A;  5KHH A;  4HNA B;  4NTX A;  1VAR A;  4HZ3 A;  5LHI A;  1KC8 W;  2OT5 A;  1V55 C;  3RYC B;  1VIB A;  1XL4 A;  5KA5 A;  4YY3 O;  1WA8 A;  1SZX A;  2UXB B;  4TUY A;  3D36 A;  3B4S A;  2ZIO A;  3O9O A;  1N32 O;  1K33 A;  2YUA A;  1RSO A;  1XHZ A;  3DXR B;  1WAZ A;  3HPL C;  2YC0 A;  4R7C A;  4DV7 O;  5DM6 V;  4GKJ B;  2QJ1 A;  4H0L B;  2VS0 A;  2HVJ C;  5BR8 B;  1XRE A;  4NXM O;  3F5W C;  1XMQ B;  1HNX B;  2Y69 B;  1PNM A;  2BTO A;  2YDE A;  4D7T A;  2DYR C;  2R9I A;  1NBM G;  2PUS A;  1AR5 A;  2ZIN A;  5JQG A;  4PA7 A;  2JGD A;  4UV9 A;  3FB8 C;  1YHQ V;  1SKV A;  2A06 H;  3BY6 A;  1VQ8 V;  4TV8 B;  2D3O W;  4MVQ A;  3AEI A;  1K34 A;  5IYD O;  1Y67 A;  5JVD B;  1HNZ B;  1BL8 A;  5KHJ A;  2XAF A;  3CCE V;  2QWN B;  1S77 D;  4WFE A;  1HW7 A;  2DQ0 A;  3ZCC A;  4LF7 B;  2HHH O;  2ETN A;  2RNB A;  2YID A;  1OCZ C;  3RBZ A;  2HR3 A;  4DYL A;  3K04 A;  4DUY O;  4C7U A;  2KG7 B;  2QM4 A;  1Q90 D;  5GON A;  2P4V A;  4DR5 B;  4JYY A;  1AIL A;  2Z5U A;  3HKE A;  1MG1 A;  4YIO A;  1OZ0 A;  4H44 B;  3MD0 A;  4JI5 B;  5B1A B;  4LF8 O;  4K0K B;  4TQD A;  3D8C A;  1F23 A;  2ITC C;  5EC1 C;  5B66 Z;  1NVP D;  3CHX A;  1AJN A;  3JSN A;  1FFX A;  2E5L O;  1PNK A;  3AG1 C;  3K0G A;  4WFG A;  3H1H H;  1COW G;  1NU1 H;  2GBO A;  2CDY A;  3L75 H;  4GX5 A;  5BMV B;  3CC4 V;  4LFB B;  3ASN C;  3RVY A;  4B3S O;  1ZL8 A;  1IBM O;  1E1Q G;  2UUA O;  3E35 A;  4YIP A;  5KX5 B;  4G28 B;  1MSD A;  3ETE A;  4X64 O;  2JGD B;  4KL1 A;  1I5X A;  2GHY A;  5IWA O;  1NTK H;  2JS3 A;  1HNW O;  5JWP A;  1SQX H;  2ZD9 A;  2LJ2 A;  4OGQ B;  1M93 A;  3ZS8 C;  2QTS A;  1WP8 A;  5EZY B;  2EZP A;  3H9V A;  3B77 A;  5BXZ A;  1VQ6 V;  3K5M A;  3SPH A;  1N32 B;  5CBF A;  5IT9 N;  3FKS G;  5JCO C;  1OCO B;  1NQT A;  3ETD A;  4QJF B;  1SQG A;  3JAK A;  1JA8 A;  2X6A A;  1D2D A;  1QBZ A;  2Y48 A;  1QVF U;  2LFR A;  1KKC A;  1IUR A;  4DR4 B;  3T1Y B;  2OTJ V;  1B6Q A;  1B04 A;  1N33 O;  4JI3 B;  4X1I B;  3FB5 C;  3TCU A;  4AHC A;  5IE9 A;  4LNU A;  4P9O A;  2VQE O;  1HR0 O;  1EM1 A;  1H38 A;  2ZIM A;  2VQE B;  1IZ3 A;  4CH3 A;  5JH7 B;  4CZZ A;  2ZNI A;  3DGE A;  4BAY A;  2P5O A;  4WCE V;  2YIA A;  3T2M A;  4X62 O;  3CCQ V;  2IJH A;  1AJP A;  2OCH A;  1R6N A;  2BSK B;  1W0J G;  1NH2 D;  1Q81 W;  4UCO A;  4CS3 A;  2XAS A;  1JVM A;  1HNZ O;  2ZXW C;  4JI1 B;  2IJJ A;  5GW7 A;  4YY3 B;  1K4C C;  1PPJ H;  4W4L A;  3VQY A;  2HHH B;  4FVM A;  2O57 A;  2XAG A;  2XND G;  3ETQ A;  1IBL O;  4I55 A;  3K5L A;  3EVK A;  2X6B A;  4Z2W A;  2RMK B;  4BIO A;  4JYA O;  2UU9 O;  1GK9 A;  3KCY A;  3ZMT A;  1VQN V;  4O4H B;  1MZE A;  4LP8 A;  1IBK B;  4UUJ C;  4XBF A;  4TV9 A;  1VMG A;  3GVM A;  1TUB A;  3ZRS A;  3BEH A;  2KG7 A;  4K3A A;  3RYI B;  2P06 A;  1EN5 A;  3LSS A;  4DV2 B;  4J80 A;  4LF5 O;  4DV2 O;  4FIP C;  1YZB A;  3HKE B;  5B1B C;  1JQ0 A;  2Q7G A;  5J2T B;  4CC5 A;  3JD4 A;  4PI2 A;  4XDL A;  1XNQ B;  5L3E A;  1XL6 A;  2ZE7 A;  3ZMV A;  1RPR A;  3K59 A;  1QNM A;  1XEQ A;  5J9P C;  3SJB C;  1MA1 A;  1FJG O;  5IJ0 A;  3ABT A;  4OPH A;  1TA8 A;  3KZI Z;  1YF2 A;  3OD4 A;  2WLI B;  4X64 B;  4TQF A;  4YXW G;  3R66 A;  3BAA A;  2EIJ C;  1ZL8 B;  4DR6 O;  3D3Q A;  4BIZ A;  3C3T A;  4LF6 B;  4GCZ A;  5IWA B;  5CBG A;  4TV8 A;  4FFK A;  3U10 A;  3J80 N;  5LBQ A;  4X1Y B;  2ZE5 A;  1YVW A;  3THO A;  2JVD A;  4B3M B;  4AQY B;  5CA1 B;  3FX7 A;  5LYJ A;  2VQF O;  5ITZ B;  1P49 A;  4DV1 B;  3A2F A;  3JD0 A;  1SQQ H;  4MW3 A;  4PJ0 Z;  3KG2 A;  5KHI A;  4DV0 O;  3B8M A;  2K1E A;  1OJH A;  2B1G A;  3K03 A;  2P67 A;  4NXN B;  3T1Y O;  4MS2 A;  3G67 A;  2UUB O;  2P6J A;  2UUB B;  3LDC A;  2OCC B;  4PA6 A;  4HAM A;  4PA4 A;  5FNV B;  2A3Q A;  2FL4 A;  1MSW D;  5L3C A;  3K9A A;  4QE7 A;  3G6B A;  4X66 B;  3ZRX A;  5H6R A;  3T4Z A;  3SR2 C;  1QHT A;  2A0L A;  3UQ8 A;  2A79 B;  3BPZ A;  3OTF A;  1FFX B;  1M4U A;  4A5U B;  4JI7 O;  2JJ2 G;  1XQ8 A;  5D5Q A;  5B1O A;  4L87 A;  5EIB D;  2CGN A;  2YS8 A;  4ZBM A;  2PF4 E;  3K06 A;  3F5T A;  4LFC B;  4I5S A;  2OCC C;  2UXB O;  2YSU B;  4UB8 Z;  3N2K A;  2WLL A;  3NR7 A;  4JGS A;  1WPB A;  3TXS A;  3SGI A;  1Q7Y W;  1SQV H;  3CYO A;  1GKF A;  3E22 B;  3Q4H B;  4FPP A;  4ASU G;  4P2Z A;  1KB9 F;  2QKA A;  3UM7 A;  3LNN A;  1I5Y A;  3FYI B;  2LGW A;  5BY1 A;  3F7Y C;  1EBO A;  1KUQ A;  5CA1 A;  1F51 A;  1KBH A;  5LMU B;  2LQT A;  1WN7 A;  5GTH Z;  4MTF A;  3UT5 A;  3WG7 C;  1NZ6 A;  4GLX A;  4YJ3 B;  4LF4 B;  4LH7 A;  5LMN O;  1YJ9 V;  1VF7 A;  2HFE C;  1Q6U A;  3CS5 A;  4DV5 B;  3OR7 C;  3CXC U;  3HKB B;  3VQV A;  5L3G A;  1GN2 A;  1A32 A;  1B3Q A;  1P84 F;  1CPY A;  3ABK C;  4X1I A;  4UV8 A;  1PD3 A;  2HG5 C;  3CWB H;  1R6T A;  4WFA V;  1D5A A;  4YJ2 B;  4MW8 A;  2CTW A;  2WPD G;  2AXT Z;  3NXS A;  4H33 A;  5E1A C;  2UXN A;  1S72 V;  5BMV A;  1GN4 A;  2HLD G;  1Q3E A;  2YIB D;  3P30 A;  3G80 A;  4FM1 A;  2RJZ A;  2Q9L A;  2JK5 C;  1X4T A;  2UUC O;  4ZOL A;  2IH3 C;  4LWS B;  3C3S A;  1WB7 A;  3SDL A;  2ZDI A;  4UFZ A;  4J9Y B;  1YJN V;  4JI4 O;  1PM9 A;  5KHK A;  4PV1 B;  2E5L B;  1G8M A;  2ZKO A;  2QTO A;  4WBN B;  2Y4U A;  1GH6 A;  1HWY A;  1UFI A;  2KSD A;  5B1B B;  1FS0 G;  3FAV B;  2LO1 A;  2BOB C;  2H94 A;  4BWA A;  4CH4 A;  4DK1 A;  1KYO F;  1FD9 A;  1BSM A;  3ZBH A;  4MTO A;  2AW9 A;  4PDL A;  4H37 A;  1TVK A;  5ITZ A;  1YCI A;  4DV6 B;  3CRC A;  2PTM A;  2V7Q G;  3ZHQ A;  3B09 A;  4I0X B;  3ZMU A;  4LC1 A;  4LR3 A;  4DR3 O;  2E3C A;  2L35 A;  2ZXW B;  5LXT B;  4O4I B;  3MAQ A;  2WA3 A;  3ZED A;  3U11 A;  3RYC A;  4LBE C;  4LF9 O;  3OMA B;  1K5S A;  2Q0A A;  3IJ4 A;  1PP9 H;  1XHX A;  2IBZ H;  2ZR3 A;  3BCC H;  4EB6 A;  5KLV H;  4B3R O; 
#chains in the Genus database with same CATH homology
 2OIG A;  2OIE A;  2GTA A;  2Q4P A;  3CRA A;  3CRC A;  1YXB A;  2Q73 A;  1Y6X A;  2A3Q A;  2Q5Z A;  3C90 A;  4QGP A;  2A7W A;  2YXH A;  5IE9 A;  2Q9L A;  1YVW A;  2P06 A;  1VMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...