2OIZD

Crystal structure of the tryptamine-derived (indol-3-acetamide)-ttq adduct of aromatic amine dehydrogenase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
110
structure length
109
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase, small subunit
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 30
structure length 109
sequence length 110
chains with identical sequence H
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2oizD00
2AGYD 3SLEC 2H47B 2IUPD 3C75L 4K3IC 3RN0C 2I0TD 3RN1C 3L4OC 1MAEL 4L3GC 2BBKL 4FA5C 2J55L 1MAFL 2AH0D 2I0SD 2IAAB 2MADL 2MTAL 2HKRD 1MG2B 4Y5RC 2OIZD 3SXTC 1MG3B 3PXSC 2HXCD 2AH1D 4FB1C 2GC4B 4FAVC 2HJBD 2Q7QD 2H3XB 4L3HC 1MDAL 2OJYD 2J57K 2IURD 4FANC 2AGLD 2AGWD 2OK6D 3PXWC 4O1QC 4FA9C 2AGXD 2J56L 2OK4D 2HJ4D 3SVWC 2AGZD 2IUVD 4L1QC 3ORVC 3RLMC 4FA4C 3PXTC 2HKMD 3L4MC 3SWSC 2I0RD 2IUQD 4FA1C 2GC7B 3SJLC 3RMZC
chains in the Genus database with same CATH superfamily
2AGYD 3SLEC 2H47B 2IUPD 3C75L 4K3IC 3RN0C 2I0TD 3RN1C 3L4OC 1MAEL 4L3GC 2BBKL 4FA5C 2J55L 1MAFL 2AH0D 2I0SD 2IAAB 2MADL 2MTAL 2HKRD 1MG2B 4Y5RC 2OIZD 3SXTC 1MG3B 3PXSC 2HXCD 2AH1D 4FB1C 2GC4B 4FAVC 2HJBD 2Q7QD 2H3XB 4L3HC 1MDAL 2OJYD 2J57K 2IURD 4FANC 2AGLD 2AGWD 2OK6D 3PXWC 4O1QC 4FA9C 2AGXD 2J56L 2OK4D 2HJ4D 3SVWC 2AGZD 2IUVD 4L1QC 3ORVC 3RLMC 4FA4C 3PXTC 2HKMD 3L4MC 3SWSC 2I0RD 2IUQD 4FA1C 2GC7B 3SJLC 3RMZC
chains in the Genus database with same CATH topology
2AGYD 3SLEC 2H47B 2IUPD 3C75L 4K3IC 3RN0C 2I0TD 3RN1C 3L4OC 1MAEL 4L3GC 2BBKL 4FA5C 2J55L 1MAFL 2AH0D 2I0SD 2IAAB 2MADL 2MTAL 2HKRD 1MG2B 4Y5RC 2OIZD 3SXTC 1MG3B 3PXSC 2HXCD 2AH1D 4FB1C 2GC4B 4FAVC 2HJBD 2Q7QD 2H3XB 4L3HC 1MDAL 2OJYD 2J57K 2IURD 4FANC 2AGLD 2AGWD 2OK6D 3PXWC 4O1QC 4FA9C 2AGXD 2J56L 2OK4D 2HJ4D 3SVWC 2AGZD 2IUVD 4L1QC 3ORVC 3RLMC 4FA4C 3PXTC 2HKMD 3L4MC 3SWSC 2I0RD 2IUQD 4FA1C 2GC7B 3SJLC 3RMZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGY D;  3SLE C;  2H47 B;  2IUP D;  3C75 L;  4K3I C;  3RN0 C;  2I0T D;  3RN1 C;  3L4O C;  1MAE L;  4L3G C;  2BBK L;  4FA5 C;  2J55 L;  1MAF L;  2AH0 D;  2I0S D;  2IAA B;  2MAD L;  2MTA L;  2HKR D;  1MG2 B;  4Y5R C;  2OIZ D;  3SXT C;  1MG3 B;  3PXS C;  2HXC D;  2AH1 D;  4FB1 C;  2GC4 B;  4FAV C;  2HJB D;  2Q7Q D;  2H3X B;  4L3H C;  1MDA L;  2OJY D;  2J57 K;  2IUR D;  4FAN C;  2AGL D;  2AGW D;  2OK6 D;  3PXW C;  4O1Q C;  4FA9 C;  2AGX D;  2J56 L;  2OK4 D;  2HJ4 D;  3SVW C;  2AGZ D;  2IUV D;  4L1Q C;  3ORV C;  3RLM C;  4FA4 C;  3PXT C;  2HKM D;  3L4M C;  3SWS C;  2I0R D;  2IUQ D;  4FA1 C;  2GC7 B;  3SJL C;  3RMZ C; 
#chains in the Genus database with same CATH topology
 2AGY D;  3SLE C;  2H47 B;  2IUP D;  3C75 L;  4K3I C;  3RN0 C;  2I0T D;  3RN1 C;  3L4O C;  1MAE L;  4L3G C;  2BBK L;  4FA5 C;  2J55 L;  1MAF L;  2AH0 D;  2I0S D;  2IAA B;  2MAD L;  2MTA L;  2HKR D;  1MG2 B;  4Y5R C;  2OIZ D;  3SXT C;  1MG3 B;  3PXS C;  2HXC D;  2AH1 D;  4FB1 C;  2GC4 B;  4FAV C;  2HJB D;  2Q7Q D;  2H3X B;  4L3H C;  1MDA L;  2OJY D;  2J57 K;  2IUR D;  4FAN C;  2AGL D;  2AGW D;  2OK6 D;  3PXW C;  4O1Q C;  4FA9 C;  2AGX D;  2J56 L;  2OK4 D;  2HJ4 D;  3SVW C;  2AGZ D;  2IUV D;  4L1Q C;  3ORV C;  3RLM C;  4FA4 C;  3PXT C;  2HKM D;  3L4M C;  3SWS C;  2I0R D;  2IUQ D;  4FA1 C;  2GC7 B;  3SJL C;  3RMZ C; 
#chains in the Genus database with same CATH homology
 2AGY D;  3SLE C;  2H47 B;  2IUP D;  3C75 L;  4K3I C;  3RN0 C;  2I0T D;  3RN1 C;  3L4O C;  1MAE L;  4L3G C;  2BBK L;  4FA5 C;  2J55 L;  1MAF L;  2AH0 D;  2I0S D;  2IAA B;  2MAD L;  2MTA L;  2HKR D;  1MG2 B;  4Y5R C;  2OIZ D;  3SXT C;  1MG3 B;  3PXS C;  2HXC D;  2AH1 D;  4FB1 C;  2GC4 B;  4FAV C;  2HJB D;  2Q7Q D;  2H3X B;  4L3H C;  1MDA L;  2OJY D;  2J57 K;  2IUR D;  4FAN C;  2AGL D;  2AGW D;  2OK6 D;  3PXW C;  4O1Q C;  4FA9 C;  2AGX D;  2J56 L;  2OK4 D;  2HJ4 D;  3SVW C;  2AGZ D;  2IUV D;  4L1Q C;  3ORV C;  3RLM C;  4FA4 C;  3PXT C;  2HKM D;  3L4M C;  3SWS C;  2I0R D;  2IUQ D;  4FA1 C;  2GC7 B;  3SJL C;  3RMZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...