2OJ3A

Hepatitis delta virus ribozyme precursor structure, with c75u mutation, bound to tl+ and cobalt hexammine (co(nh3)63+)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HDV RIBOZYME
publication title Structural roles of monovalent cations in the HDV ribozyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/rna
total genus 24
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oj3A00
2KH9A 1SJQA 2FHOB 1SXLA 2XSFA 2NLWA 1VC6A 2NZ4A 3CCQS 1KOOA 1WI8A 1H2TZ 2D9PA 2KYXA 1O0PA 2MPUA 2B0GA 5IM0B 2RUGA 3CCJS 4PR6A 1X5SA 3CUNA 3US5A 4J5OA 1WHWA 2G0CA 1PO6A 3UD4P 3R1LA 1S72S 2MQMA 2X1BA 2CPHA 3BO4A 3SXLA 1RK8A 1WHXA 2M9KA 5DDOC 1WEYA 5EN1A 4IOAQ 4CIOA 2KU7A 1WI6A 1VQ6S 2MSTA 3CCVS 2MHNA 1D9AA 1JMTA 2MB0B 2LYVA 2VOPA 2J0QD 1RKJA 1WEZA 2YKAA 2DIVA 3K0JA 1G2EA 4ED5A 1JJ4A 2XS5A 5FJ4A 3VAMA 3UWTA 1VQ8S 1U1LA 1VQKS 2CPEA 1X5OA 1OWXA 1IQTA 1YITS 2DNRA 3MUTP 1FXLA 2E44A 2KXHA 1WELA 4F02A 5DM7Q 1M5KC 2QA4S 3NNAA 2DB1A 3UCZP 3NS5A 3VAJA 2OJ3A 2RNEA 3G9CA 2DGOA 1VQ7S 2GHPA 2MJUA 3G6ES 2QFJA 2CQ1A 3ZZYA 3TYTA 2AYMA 5GAHU 1WHVA 2CQCA 2LQ5A 4WCEQ 2DNMA 5D77A 1PGZA 2DNHA 4YB1P 4TU7A 2I2YA 1UP1A 2ADCA 1HD0A 3S6EA 2CPXA 1AUDA 2AYGA 4UQTA 4C4WA 2DK2A 5GAEU 1YI2S 1S79A 2PE8A 3CCSS 1Q81T 3EGZA 1VBXA 2F9JA 4CQ1A 3VAIA 5GVQA 1FJ7A 2WBRA 2V94A 2RVJA 2MJNA 1UFWA 2DGVA 3SMZA 2RQCA 3MDFA 2EK6A 5DETA 5CYJA 3VF0B 3FEYB 3CPWR 2MZTA 1QVFR 4W90B 2G1DA 5JVGQ 1M5PC 3CC4S 1WTBA 2SXLA 1WF1A 1X5TA 2DHAA 2OTJS 1N54B 3MUMP 3G71S 2AD9A 3DLLQ 3TO8A 1H2VZ 2L41A 4WF9Q 2G4BA 2E5HA 3L3CA 1DRZA 2XNQA 3ZZZA 2O3DA 1M1KT 3MD1A 2E5GA 1U1QA 5HL7Q 2FC9A 1HL6A 3VAFA 4Y00A 2MQLA 2ADBA 1ZH5A 3CC7S 1KC8T 2RS2A 2CQIA 2DGSA 5LSOA 2OTLS 2XB2D 3P49B 4BS2A 2LECA 4U67Q 2HZCA 3CCMS 1YHQS 2DO0A 1VQNS 2DO4A 2HGLA 3NMRA 3LQVA 2MXYA 2CQDA 5IQQA 2JVOA 2RRBA 4FXVA 2OSRA 2MZJA 3CCES 2LKZA 1DHMA 1NJIT 2RQ4A 3IRWP 2CPYA 1U1RA 2K3KA 4V19X 2JRSA 4WFNQ 3G96A 4FXWA 1H2UX 2EVZA 1VQ4S 2F3JA 2HGNA 1K8AT 2DGXA 2L08A 1P27B 4YOEA 2MKKA 4A8XA 3J7YU 3IWNC 2DGUA 1KD1T 2DH9A 2MQOA 2M52A 4TU9A 1U2FA 2KRRA 2HGMA 2AYEA 2CQPA 2HVZA 2CPDA 2YH1A 4YUDA 1SJ4P 5CA5A 1Q7YT 2UP1A 5LXYA 2KRBA 1VBZA 1X0FA 1FJEB 2DNLA 3P6YC 2ZJPQ 5MLCV 2RU3A 2KM8B 2VODA 2U2FA 3SDEA 2J8AA 3BO3A 2BOPA 5CXTA 1UW4A 1X4DA 1VBYA 2CPZA 1U1PA 3HI9A 2MGZA 2BZ2A 1Q86T 3ULHA 2MKSA 1NU4A 1M5VC 2MY8A 1DZ5A 3MUVP 3MOJB 2KT5A 2KI2A 2LEBA 2CQBA 1YJ9S 2MZQA 3FEXB 2OSQA 2KXFA 3V4MA 2MQQA 2E5IA 1CVJA 1NO8A 4LJMA 2RRAA 1QM9A 3CCUS 2M8DB 4EGLA 1U6BA 2N7CA 3RW6A 4QPTA 1A7GE 2CPJA 2CPIA 3OW2R 1N8RT 2VOOA 5IFMA 1X4BA 2DHXA 2MY7A 3Q2SC 3NNCA 1WWHA 1F9FA 3B4MA 3H2VE 1M5OC 2DITA 3EGNA 5LSLA 2MGZB 2KFYA 4M5DB 3VAHA 2GO9A 5BJRA 4UY8T 3P5TL 3CMAS 5GMKa 2X1AA 2LCWA 3H2UB 1XN9A 1Q82T 3CC2S 2DNPA 1HA1A 3MI7X 3THTA 2M70A 1YJWS 2AYBA 5GADU 2CQ3A 2DNKA 4C0OC 3S01A 3UCUP 2X1GA 3VAKA 2MKIA 1FJCA 1N88A 2DH7A 5DDPC 4F26A 1D8ZA 1WG4A 1X4FA 1ZZFA 2LXUA 3R27A 1M90T 1JJ2R 2CQ4A 2HYIB 2MSSA 1X4GA 4PKDB 2J0SD 1VQMS 3Q2TC 3CCRS 1WF0A 4WFAQ 2MKJA 2CJKA 1W2BR 1VC0A 1U1KA 4OZ1A 1N52B 3EX7B 2CQGA 2MMYA 4TU8A 2U1AA 3MD3A 1URNA 1VQOS 2CQ2A 2DH8A 3BO2A 3CF5Q 1VQ9S 1JJHA 5IM0A 2KVIA 5DDRC 2RS8A 5ITHA 1KQSR 2FY1A 2M88A 2E5JA 3DXBA 2KG1A 1VC5A 4CH1A 1WF2A 4TLQA 2L9WA 2M2BA 2MKCA 1SJ3P 1WHYA 2DNOA 2DNQA 2D9OA 2N3OA 1A9NB 2DIUA 1FO1A 1U1OA 2DGWA 5H1SV 4W92B 1YTYA 2DNZA 1QVGR 3I56S 1HD1A 3PIPQ 2K8GA 1FT8A 1FHTA 2DGTA 2JX2A 1H6KX 4OZ0A 4IO9Q 2XS7A 4C7QA 5JVHQ 2Q79A 1R8PA 3CCLS 3G8TA 1X4EA 5HO4A 2N82B 1L3KA 4ERDA 3TP2A 5GAGU 2LA6A 1P1TA 1WEXA 2ERRA 5LXRA 3VAGA 2LA4A 2EK1A 2A3JA 2LMIA 2I38A 2MZSA 2MZ1A 2M4MA 3RW7A 1U1NA 3BS9A 1YJNS 3PIOQ 2XNRA 1VQPS 2FC8A 3NS6A 3NNHA 2YTCA 3JB9k 2JWNA 4LMZA 5DM6Q 2RT3A 3HHNB 3CULA 4F25A 3P3DA 3VALA 1OPIA 3N9UC 3UE2A 3B4DA 1DBDA 3BEGB 2DNYA 1SJFA 1BY9A 3I55S 2YWKA 1SJRA 1X4CA 1X4AA 2MYFA 1B7FA 1X4HA 3THPA 2J76E 2VONA 2FPHX 3SDEB 2DGQA 3G4SS 3MXHP 2M8HA 3U1LA 1YIJS 2M7SA 4IOCQ 3S8SA 4IUFA 4RU2A 1KOHA 1OO0B 1U1MA 2ZJQQ 3G8SA 4PRFA 3CD6S 2JVRA 4QQBA 1R8HA 5LJ5Y 1WG5A 1VQ5S 3CMES 4ZKAA 1K9MT 2D3OR 1ZZNA 4WIIA 2KXNB 2KM8C 2F9DA 1YWXA 2ZJRQ 2DHGA 1K73T 3CTRA 4QU6A 2DHSA 4CH0S 3R1HA 5LJ3Y 2MZRA 2OIHA 2KN4A 1FNXH 1UAWA 2LXIA 2CQHA 2CPFA 3UCGA 4WFBQ 2N3LA 3J7ZT 2YH0A 2X1FA 2KHCA 4WKRA 5DDQC 3LPYA 1VQLS 1X5PA 4Z2XA 2PEHA 3S7RA 2MKHA 2DNNA 2KG0A 2QEXS 1U6FA 2LEAA 3U1MA 2MQPA 2DNGA 4Y0FA 3D2WA 2CQ0A 1WG1A 1OIAA 4QU7A 3UD3P 3MURP 5D78A 2DISA 2MQNA 4P6QA 3CXCR 2XS2A 2M0GB 4LIRA
chains in the Genus database with same CATH superfamily
1V3SA 1M5HA 1SXLA 4FF4A 1JLAA 2MPUA 3CJ8A 1NHKL 4HDGA 4DJBA 2EEYA 2HWTA 3W7BA 4HVZA 2PA8D 3D1QA 2YKOA 4NCGB 2OEJA 2HVHA 1S9EB 2MSTA 2AEMA 3JTPA 1HNZJ 5LT5A 2J0QD 2D74B 3VR1A 2DBBA 2P9CA 5T41A 3QSYB 5AXNA 1NAQA 1VDHA 1S6PA 1TKZB 2XLIA 4DL2A 1FK9A 4I67A 3RZAA 2KXHA 1RTZA 3TVYA 1N4LA 1IBLF 4D3HA 4DPOA 1ULRA 3GIKA 2DGOA 2XZTB 5E5NA 3TYTA 2ZUAA 4GMKA 3QWPA 4RW7B 4FPIA 3EDQB 2ZNZA 2VQFF 1IWAA 1F2GA 5HBMB 3V6KA 4CLTA 3H5UA 3V6HA 1Y4ZB 4UQTA 3MHYA 1QSYA 3CCTA 2V94A 5JMNA 2RQCA 5A8RB 4NOHA 1D3WA 1R6YA 2CRLA 2GJ2A 2BBEA 5A2QY 4W90B 4NWBA 2NYHA 2W8LA 5EX3A 2M5YA 5F8GA 1TL1A 4YDXA 3M6XA 1NJZA 4AL7A 2DEIA 1KDNA 4JI8F 4YN3B 2DRBA 4GVBB 1HL6A 3AT1B 2OELA 2MQLA 1C0TA 2GGPB 4ELVA 5EDWA 1NUEA 4OYWA 1EP4B 1YHQS 2DO4A 2BE2A 1K0VA 5IWAF 3TWZA 1VMBA 4ER8A 2ZH5A 4ES1A 3SSRA 3CE8A 3MPYA 3G96A 1PYSB 3D6TB 1P27B 1RHUB 1S4FA 3R8YA 4YHHJ 3HHLC 4K2XA 4KGKA 2LDYA 2Q3PA 2JL9A 4I7FB 2J7WA 5ETQA 3I87A 5E3CA 3POTB 5HLFB 2CZ4A 3E2EA 4USUA 2JLGA 5B0FA 5D0HA 4ZHRB 4DR6F 2HVIA 4YS2A 4DCPB 1NU4A 3CO0P 2W25A 4JBCA 4N41A 1O8BA 3C19A 3FEXB 4R8UB 4LF5F 4DSJA 4EMDA 1X4BA 1TVRA 3EXCX 4QR0A 3UW1A 2OI2A 3P5TL 4B3OB 3H2UB 4DL7A 2EXUA 1YJWS 4P7TA 3FFIB 2RMLA 2RJZA 1CJVB 1CJKB 3R5BA 2VC0A 2J6UA 1BHNA 1TP7A 2UUAJ 1WOPA 1HNIA 1WF0A 4LQ3A 3UFCX 2ALZA 1F0XA 4N77A 1C2PA 3CCWA 1S1VB 4NCBA 1B64A 4CH1A 3N28A 5AXKA 1LK7A 1R0AA 1SJ3P 4NASA 2GV1A 1B0TA 2DNZA 2EKYA 1HBMB 3PIPQ 1S1XB 2PDAA 2MLZA 3BH6B 1IUJA 3TEGA 4ZCKA 4RKUC 3QFWA 1X7VA 3K5PA 3EE3A 3T41A 3AJ2A 4FVMA 4NPOA 1SIWB 3IAS9 1E6VB 1UCNA 1SC4B 3THVA 1LWCB 4O44B 4F4XA 2FJXA 5ETSA 1PYTA 4H4KC 1Q8KA 1KHVA 3KHHA 4X65J 2QL7B 4DFJA 4QYRA 4USTA 4KV8B 3IGVA 2LFVA 1XMOJ 4F3OA 5KT5A 1NKBA 4XPEA 5JUMA 2V9KA 1NK7A 1VQ5S 1HQEA 5HMXA 1FF2A 3VGTA 2VFUA 3JTOA 4LF7F 2QSWA 3LUYA 2OGUA 3MGJA 4X66F 2X1FA 5L1KA 3A8KA 2JFKA 4ED7A 2IVFB 1VQLS 2JDJA 3V6DB 2A18A 4NEYA 4HHUA 1QLNA 4I6YA 1EETA 2UZAA 4DU8A 5K8MA 2RKIB 4RNNA 3MR6A 4LIRA 2R7QA 3CJKA 4UT4A 5D0GA 4FKXA 5K14B 3O44A 2V50A 3N6MA 2BJ1A 2FHKA 3TA2A 1LFPA 5C24B 1WORA 3W5YA 4ZP8A 4OYOA 4RX6A 1VI7A 5KFZA 4DQSA 1VK3A 2V2VA 2IM2A 4JV5F 2MDAA 3HLUA 4OL8A 3W3SA 3MWBA 5BR8J 2HFSA 2W2MP 4ITSA 1OWXA 1Y7PA 1A6LA 2V69A 3QWUA 4DLEA 4FDFA 2ROPA 3QGIA 1FEEA 1VQ7S 3PY8A 5GAHU 4FBUA 5CYMB 1NPPA 3AXMA 4J91A 5FD1A 4G65A 3HT0A 4F4AA 2CPXA 2QX0A 1SH0A 4QYZJ 3DRRB 4L75A 2PT0A 2ALYB 2OD6A 3VAIA 3OPKA 4ZVUB 3M1VA 3UI3A 2IHR1 1RT3A 3V4IB 3MFIA 3ETMA 4RNOA 4NLRA 2XBPA 1X5TA 1V3ZA 4DFPA 5GAEI 4ZK7M 4DV3F 3D1OA 1U26A 2IY5B 2BJDA 3MTKA 1IR2A 4P74A 4O3QA 1MW7A 4KE5A 1Y3JA 2W24A 4NA2A 4HH1A 1UWBA 4KRWA 5IOLA 2HK3A 5EWGA 3M30B 3MPDA 2BM1A 2I5JB 2IBOA 1IBLJ 3OTBA 4LBIA 1LK5A 1QTNB 4HYKA 3T9NA 3R6LB 3GV8B 2RU9A 4DG1A 1SUQB 2VFVA 4YUDA 2DEJA 1JNZB 5CCMA 1X0FA 2VQFJ 2V2ZA 2EI5A 1PBUA 3SCJE 4NE9C 4CM2A 2WZ1A 2BZ2A 4AL5A 4B9VA 4FS1A 1HFEL 2LEBA 3BKUA 2VG6B 3OW2R 3M7VA 3DFEA 4NCAA 4CO0A 4HL9A 3KLHA 2VD3A 2KFYA 2HIYA 2Y8WA 2GHWA 3EPGA 2HHWA 4JI8J 3NGTA 1W25A 3DN9A 4TN2A 2FZGB 1RAEB 2M70A 2KJVA 1IKXA 1HBOB 4PUOB 4CI0B 4EEYA 4IO1A 1FJCA 3BSNA 2C2DA 3I0RA 1SH2A 4OI0A 4ZPVR 4IG3A 4RNMA 2OO4A 2KJWA 4F67A 4DU7A 1N52B 4J9OA 1X9MA 4PEOA 3IG1A 1U8SA 3WQPA 1CLFA 3KTQA 3MM8B 3NKYA 2E5JA 4YB6A 3C16B 4DR7F 3PW0A 4MKBA 4RL1A 2IYGA 2DGWA 2W2QP 5H1SV 3I56S 2E9RX 3NOCA 3GQCA 4IO9Q 1MU2A 3ZC4A 5HJXA 3CCLS 5GAGU 2UUCJ 3O3LA 3A8IA 5CYQA 1D9FA 1LOUA 1NK8A 4LF5J 4WYLA 1XNQJ 2XNRA 2PMHA 5AJ3F 1YQHA 2BABA 4EZ9A 4WE1B 4OI1A 2ZZTA 1QY7A 2XCPA 3BBCA 3BEGB 1XBWA 2FPHX 4BC7A 3G4SS 3O1LA 4QJVA 3LGHA 1TK0A 4ED2A 3DMJB 2OFGX 3TJ8A 2KXNB 3W9JA 1UJ6A 2P6SA 3DM2B 4QU6A 4CH0S 4OYZA 4F0MA 3H42A 1HPZA 1T9VA 2CQHA 2N7YA 1UKUA 3M8WA 1HMVB 2BKPA 5A76A 1YVFA 3L9ZA 2Q66A 2H1YA 3GYNA 1CC7A 5A8WB 1Q7LB 3CDEA 5DGAA 1IKYB 3K59A 1LXNA 2GJIA 3PHEA 1G3OA 3DRSB 4EUVA 1HWIA 4O4GB 3M6VA 4WIQA 4U7UD 2FHOB 5L9NA 1WSVA 1P9YA 2D9PA 1RT5B 3JS9A 1C1BA 4I1TA 1LW2A 2KYZA 2MKYA 5KG3A 3T6JA 3D0HE 2W9CB 1DTTA 3BDPA 1CJUB 5KFIA 2NXJA 3MEEA 5D4NA 1DQ8A 2HHHF 3OBIA 2IJRA 4CT8A 4B9SA 1R43A 2FLLA 1JJ4A 1EQMA 2XMTA 2IA0A 4QW9A 3GLJA 4O3RA 4U7UK 4LF7J 3GSDA 2OJ3A 4DX8H 1BD6A 1JXLA 2QL5B 2YNHB 3S1TA 2K1RB 5I3PA 1EZZB 1Y9OA 4X66J 2HNDB 4C48A 5DJBA 2BOAA 4KGVB 1WHVA 2Q1LA 3OVAA 1T9XA 5D77A 4XK8C 4X4RA 4Y6IA 2ADCA 2ZZMA 3H5XA 1Q95G 3GCXP 2HHTA 1Y5IB 1Q81T 2PE8A 3NGDA 2ATCB 3KJVA 1BQMB 5GVQA 1FJ7A 3DLKA 1OSCA 3ILIA 2MZTA 3EUNA 4JI2F 2BJ9A 3E01B 1N54B 3OJSA 4FPRA 1S4EA 2G4BA 4QW8A 1G7CB 3DYAB 2IBKA 1VIXA 3BBFA 1HBUB 1M1KT 1RWWB 4JV5J 5HL7Q 1FVQA 2H5EA 1V9OA 4DL4A 5LSOA 2BX6A 3KXDA 4X84A 3IS9B 4IQXA 2COLA 5IQQA 4OI3A 4C3LA 2VG5B 3MPUB 1U1RA 2R42A 2L08A 2HIQA 3HHDA 4A8XA 4U95A 1MMDA 4ID8A 2HNZB 2MQOA 2CG8A 3KNAA 4DS4A 3LALA 3B8HA 4URGA 4CWBA 4ZVEA 2AEFA 3OSNA 4Q0BA 2VODA 3P8BB 3HM9A 2U2FA 4OZNA 1IQZA 1GAOA 2JSXA 4CLLA 1I6JA 3TA0A 4ZPWR 2H4WB 3V4MA 1FKPA 1C0UB 4RW8A 2R8KA 1TL7A 5J1EB 1TU0B 3QT8A 3MMCB 2FGCA 2XEXA 1TL4A 3TAMB 2AMCB 4DV3J 3T5KA 5M2PA 2ZD1B 5ETKA 2MGZB 4WP9A 5GMKa 1X60A 1AA1B 5I3UB 2OPSA 4NLQA 4NEZA 4OFZA 5BYSA 2B6AA 4LVNP 1ZZFA 4OI2A 3BGRA 3DOMB 1JJ2R 1OQ6A 3Q2TC 2F40A 1K1SA 1APSA 2FJEB 4BHQA 1S49A 3BO2A 1KQSR 1IR0A 2XQCA 3M2VB 2MKCA 3MM6A 1WACA 2V2KA 2QSFA 1YRUA 4NLYA 3G82B 1R8BA 1H6KX 4OZ0A 3IAM9 1JLEB 2W7OA 2OPQA 4Q2MA 2QMXA 4JI7F 3GR0A 4GVLA 5JJBA 5DLGA 1VLYA 4F0KA 1FCAA 1LKZA 2UV8A 4KBIA 2M4MA 2DR9A 4TY8A 2WONA 2B3TB 1GX5A 3HSJA 3N9UC 1RAAB 3B4DA 1DBDA 2ZBCA 2NCKL 1UVJA 1X4HA 3THPA 2E7WA 4ATNA 5D4PA 1YIJS 4N7TA 4IUFA 1S0NA 3FQKA 4EO6A 1FRIA 4DF8A 4ETXA 2ZJQQ 4IOBA 3CD6S 1YJUA 2J9EA 1S1UB 2WCXA 3O5TB 8ATCB 2VKRA 2CADA 1F6TA 1PIEA 1ZZNA 2ILYA 3NWGA 2C1EB 1YBUA 1F60B 5SUHA 1K73T 2DHSA 3OR1B 2CJXB 2M3DA 2KN4A 4MFBA 4ED4A 2E1MC 2FTRA 4MIBA 4NI2A 1KVIA 3W2WB 1LWEA 1VR6A 2MKHA 2XZWA 3ISZA 1S5ZA 3QJLA 1BQNB 4Y0FA 3W61A 9RUBA 4KR0B 2B5JB 1NDLA 3NCQA 5C25B 5KFQA 1E6YB 3HDSA 3PFOA 4F0HA 4ZITA 3EPIA 2NS1B 3TJAA 5K20B 2KFZA 3QGHA 2HQFA 1D0EA 5KFLA 3UD4P 3ITHA 4J9VA 4B3RF 3B6BA 1KQKA 3KJQB 1WEYA 2EFVA 5EN1A 4H4OA 1WI6A 4G1QB 1HI8A 3MTJA 1RTJA 4DV0F 3W2VB 2J7UA 1QDUB 1RE1B 4ED5A 4DQQA 3J80U 3RJMB 5CZVA 3QJJA 5F3ZA 5GAGI 3RB6A 1VQ8S 4X4VA 2FQQB 3AOAA 1X5OA 3FDSA 1QAJA 5E3PA 3P45B 2HWIA 4DBQA 2GVZA 2EC2A 3UCZP 3EVWA 2AJ2A 4KPCA 3LP0A 1R6VA 3M2RB 3KJNB 4O0IA 4F2RA 5J2QB 2O1PA 4EU0A 4TY9A 3VQSA 2BQUA 2H48B 4HEA9 1PC4A 2XSJB 1EHWA 2I2YA 1UP1A 4DN9A 4NLWA 1HHSA 1TK8A 2HHPA 2DR8A 2F4FA 5KFVA 3C66A 4PXBA 2XG8A 1F9EB 2YXLA 4DX6A 1CS4B 1N32F 3W1YC 4M95A 4L3NA 2RIJA 3DI6B 1RCXB 1JJCB 4EYHB 4F04B 3CMQA 1U45A 2MQ8A 4EK2A 4WBFA 1SV5A 1T05A 1JLQA 2HHHJ 2HBYB 1RWVB 1PKUA 4I2PB 5DG8A 3DRPB 5D6GA 2R2TA 3OTDA 4L72B 1JK9B 1D1UA 4KKOA 3CC7S 2XB2D 3RR8A 3AHPA 2EKNA 2DO0A 2C2MB 3QLHB 4AL6A 2HZVA 3HVWA 3DU6A 1S9GA 2ROEA 3LP2B 2CPYA 2JRSA 4CO5A 4BDPA 2JH3A 4OZLA 1U4BA 2DGUA 1EIYB 1JLAB 4LBHA 2HS3A 1UVNA 4NXMF 6FDRA 5LXYA 3DLGA 1LWFA 4PWUA 1J27A 2GQQA 2VIHA 3TARA 1M5VC 3KLFA 1S6PB 2WVEA 4FYDA 4JI2J 3CCZA 2LEPA 1FK9B 3IBWA 4F7VA 3Q2SC 3CDBA 5D0EA 5FDLA 4UY8T 3MCOA 4NA1A 2DXDA 3UPFA 5GADU 1TUGB 4L3KA 2YNGA 2Z2YB 3WIUA 1EQ0A 1N88A 1WG4A 2WK4A 1WC1A 4KGMA 1RU1A 3CT9A 2MKJA 2YKNA 4I0WA 1QE1A 1VBKA 2JZ5A 3OD2A 4JI3F 4A8FA 1U2CA 3JSYA 2PSZA 3GMGA 2M2BA 1T03A 1TL1B 3J80Y 2HRTA 4MKAA 4QIEA 2D9OA 4Q8FA 4KPYA 2XWYA 2YQ0A 3FVYA 2NXCA 3MF5A 3KYLA 3KK1A 3BJYA 1ZM2A 2HSEB 3ELHA 4OV6A 3K89A 2OMOA 1C0TB 1OYEA 1UEUA 2BE2B 3C6UA 1RXOB 2R2RA 4NLTA 2ZH8A 3J7AN 3MEGA 2EG1A 2XI2A 3UE2A 5CAAA 4C97A 2FLPA 1JIHA 3PM9A 4USHA 4FZVA 3R5JB 2FJWA 5HMWA 3KLGB 2ZHBA 2YWGA 4PWWA 3QAEA 3GJQB 3EZUA 1H3DA 3LGMA 5KFOA 1K9MT 3TX8A 3PTWA 4KIAA 4P2XA 5J2MA 2BRKA 3Q8YA 4Z7CA 3R1HA 2MZRA 1TVRB 2PD1A 4M63A 4O23A 3BN7A 5DDQC 3CDAA 3FQLA 2UVUA 2RD5C 4RWXA 3ISNC 3IA0A 1JXEA 1DQAA 1HQ2A 3GJTB 4OX8A 1IWGA 3HHKA 1UA0A 1NDCA 3FZ2A 1HNIB 2DYAA 1RT1A 2OMLA 2C3MA 1BMQB 2BRLA 2XYGB 3SCLE 4UOHA 1XK8A 4URQU 5E0OA 2XWXA 1X5SA 4ZJLA 1VLOA 3D7SB 3R1LA 2MQMA 1R0AB 2CPHA 1XR7A 3OFFA 2NQPA 1I5OB 4QBUA 2AZ1A 4PZVA 3H4BA 4YR0A 2R2SA 1NDKA 3CJ3A 3K58A 3G8QA 3K0JA 5LOQA 1O5JA 1JLBB 5FJ4A 4CZCA 3VAMA 3D67A 2OEKA 2BE9B 3GIIA 3V2UC 3Q83A 1KKHA 1HNXF 2XGQA 4N76A 1IKVA 4UZCA 2RNEA 2DR7A 2WVBA 3NAIA 3EVMA 1TELA 2A2DA 5KFDA 1JLFA 3LGNA 5KFNA 2IM1A 3AD7C 2BVZA 1VJQA 4RBUA 4CNZA 4KTQA 4TU7A 2H4YB 4BC9A 1FDBA 4LREA 1HD0A 3CD7A 4OLPA 1R7IA 3KDOA 1NJYA 3ENVA 1RHMB 3I4HX 2NSCA 1KQGB 2HRYA 4CQ1A 3I9ZA 3K5OA 1CPZA 1PJ5A 3H98A 1HQEB 1N33F 3KMQA 2DTJA 2Y0BB 2C3YA 2ASJA 3A3OB 1PYOB 4B3RJ 2XMVA 4LF8F 4ZVQB 1AYEA 2E5GA 5A0YA 2AV5A 1ZH5A 2GX8A 1NPRA 2BXJA 3PKMA 1EETB 5B0CA 5EWFA 7AT1B 2VH7A 4OX9F 2PFFB 1UEKA 4H4MA 2W8KA 2A6OA 1K8AT 1UFLA 1H72C 2OPPA 2XZDB 4P73A 2A10A 2E66A 2DNLA 1OS5A 4QWAA 1KQFB 4NLDA 4CLSA 2V8HA 4GKKF 3FMBA 3OL8A 2DRAA 2FLNA 3I31A 1N32J 2KT5A 4CO2A 3C2PA 3QRRA 3JQKA 2Z2ZA 1ZBTA 4DV5F 3EZOA 3NWRA 5LSLA 2D3O1 2RDJA 4Q7AA 3PX6A 3MI7X 2UVVA 1S1WB 3FSYA 1SI9A 1SQFA 3PW2A 1FE4A 4DSLA 4WKYA 4F26A 3DU5A 2CQ4A 1VQMS 3KLEA 4PQUA 1VHIA 3R5CA 4USWA 3EX7B 3RAXA 4ZVFA 4ECWA 1IXKA 5F9NA 1NMEB 5A6WA 2ZOMA 4A48A 3DXBA 4NXMJ 1J2VA 4J9UE 4NLOA 2VICA 2D41A 3HO1A 4MMOA 4ZVGA 4ECYA 3LP1A 1ZYQA 4KGXB 1A9NB 3PJWA 3V81A 3D54A 4WK3A 2Z0GA 3PYDA 4DQRA 4WK1A 5LMNF 3D68A 3NS7B 1FTRA 3NMAA 3OFHA 2QGFB 1Q1KA 2LXFA 3QT7A 1UWBB 2X51A 3RBXA 4WXWA 4HHJA 2KKHA 2I38A 3RGIA 4V1Ak 2ZHAA 1RTIA 4K5SA 2NXUA 1S7HA 4DG1B 5G0RA 1FRKA 2VDIA 3LANA 4ANDA 4J90A 1GMWA 2HRUA 2UUBF 1RUSA 4A8OA 1T0TV 5E3AA 5KT6A 2M8HA 1XJWB 2L9DA 1VQSA 2I9SA 4MIAA 3OT9A 2HAIA 3UNGC 2BKNA 4X4NA 3TZXA 1MROA 4OYMA 2ROGA 4JI3J 4WIIA 1CBKA 4FS2A 4JV1A 3EGWB 4C8KA 2FGOA 5HQLA 2OIHA 3KLHB 1UAWA 2IM0A 3SIPB 4ECQA 4LF9F 3IO1A 1NDPA 2KG0A 2E5LJ 2I8EA 1IKXB 2ZDPA 4PG6A 4OZJA 2DNGA 2V68A 1WNEA 3I0RB 1LXJA 4IG3B 4PCQA 1SJQA 1A0OB 1TV6A 3ISND 5DRKA 4LVOP 3IG1B 1UVIA 5LMUF 3FSIA 3CUNA 1W26A 2HLUA 3MM7B 3HMJG 1YLXA 1YGYA 1CQMA 1NH7A 1TMMA 2R8JA 2NUHA 3CJ2A 1H98A 1T9YA 1MU2B 2FB0A 4G6VB 4K50A 2CXEA 3LW5C 3T1HF 1SKWA 2LU2A 1VQKS 4BBYA 3QJPA 5CYQB 3A3NB 3FCWA 1M5KC 3LA0A 2EFNA 2NUUG 3PDNA 4M5DA 3NAHA 2QFJA 1KTQA 2O66A 3KUGA 4CP5A 2XYHB 4FN5A 1H7WA 4C0BA 3NL0A 3T1YF 5DG7A 1YX2A 2AYGA 3KLIA 1S6QA 1GMVA 1K44A 1VBXA 5D3GA 4PQAA 3MR5A 1N48A 2C2ZB 3DRYA 2R7OA 2FJVA 3DRXA 1QVFR 2MLXA 2WSCC 2DHAA 4AQYF 3SYZA 1HPZB 3ZXWA 5L39A 5BXIA 2E5HA 3OTEA 4USJC 5BYQA 3J81U 3VAFA 1N0VC 2ZKTA 5E3RA 3PO4A 4DPTA 1SH3A 1GTEA 1MWQA 1ZPWX 1T94A 3EWGA 3HZGA 3PXGa 3L95X 2FZKB 1RLDA 2MZJA 4KQZA 1NK0A 2K3KA 3NEKA 1XMQF 1HNXJ 3SFUA 4NYPA 4RBVA 2GMLA 3SFGA 1LW2B 2YX1A 2HGMA 1Y00A 3OLBA 2YH1A 2C22A 3HK2A 3VZIA 2ZKUA 3KDNA 3DHXA 5CA5A 3JSRA 3NLCA 2KRBA 1DTTB 4C0HA 1FDNA 3MEEB 4LIWA 3F56A 3J7YI 2R9LA 2RDDA 1JLCB 2IMWP 2IA6A 1Q86T 5D4LA 3QPIA 1FD2A 3OR2A 2OSQA 5DZ6A 1CVJA 1HHTP 2FIUA 2W2OP 2VL1A 1N33J 2W2NP 4NZ6A 5F41A 1UVLA 4ANEA 4KH1B 5AT1B 3PEJA 3IRXA 1NSKL 1B4SA 1U48A 4LF8J 1FNMA 3BSCA 1XN9A 2IRYA 2PA3A 2BM0A 5J2PA 5F8JA 1K1QA 2VPZB 2JEIA 1ZPVA 3IXQA 2W4DA 1M90T 4CO4A 4OX9J 3GV5B 1VHFA 3KG0A 4NXNJ 3AJ1A 3CIZA 1VC0A 3KJVB 4OZ1A 3IR7B 1RSCA 1NK6A 4TU8A 3PR5B 1S9FA 5IZHA 1BXNA 2CQ2A 2DH8A 3DLKB 1VQ9S 1JJHA 3PW5A 1RT7A 1L3VA 2DNQA 2N3OA 5ETLA 2AHOB 4E98A 3HD2A 4MJKA 2V8VA 2DHHA 1YG0A 1TKTA 1MWYA 3GFZA 4B9LA 3VHQA 3ILLA 1GMUA 2G9OA 4DSEA 4GKJJ 2DKOB 4J7CA 1Q4RA 3GB0A 3HSZA 1X4EA 4ECRA 2LA6A 4QYZK 5KG6A 2H9ZA 1NJXA 1ZA2B 4ZJQA 1TL3A 4DV5J 2HQDA 1U1NA 3R2DJ 1MN9A 1R27B 1HARA 5HQ8A 5B0BA 2HZAA 4NYZA 3KK2A 5I42A 3KUHA 4NLPA 3FUYA 1UMJA 2G2ZA 1SJFA 2ZE2A 4OJ1A 5B09A 1SJRA 4Q0BB 2J76E 4YHHF 2XTJP 3FCVA 4U8VA 2F8HA 3W63A 4HT5A 1FKPB 4QIFA 3C3LA 4DV6F 4RW8B 2W7AA 1TL7B 2ZJRQ 4CLPA 4WZQA 2KZZA 4IG0A 4USIA 3RB3A 3PNIA 2GW8A 3TUZC 1FA0A 1KS2A 5D0RA 2YH0A 1C1CA 2CZVC 5IT4A 1SKRA 3PVXA 1PBAA 2MQPA 4OHXA 1T7PA 2GC8A 2OPSB 1P1LA 1U2RA 4M94A 2B6AB 3BGRB 3IMQJ 4RBTA 2KH9A 3MM9B 5LL6d 3H5YA 1S9EA 3AB4B 4OYAA 4C8MA 1KOOA 1H2TZ 1O0PA 4DL6A 1KP6A 3DXSX 3PG9A 4A8KA 4FBTA 2XY7A 3G2XA 1S7IA 5KFJA 2UUAF 3PRBA 4WYWA 3BO4A 4GC6A 2BANA 3MM6B 2UUBJ 1JMTA 3PACA 5FIIA 5FLXY 4WP8A 2UU9F 1MMLA 4P9SA 2QMUB 3AXKA 2DCUB 2OPQB 1B99A 4ZLNA 3I9V9 5RUBA 1ELOA 2OUGA 3Q0AA 4TLRA 3VTIA 3PW4A 3NS5A 4RW4A 4TY8B 3MCMA 5L46A 3W5ZA 1L3TA 4K4UA 2BKOA 1RT6B 1KN6A 4QWDA 2AYMA 4O4RA 1D09B 2LQ5A 4WWSA 3HXMA 4OX7A 1KWMA 2Z2MA 5CZXA 1TAQA 1NB2A 3ZTRA 3RAMA 4N8OA 5A6PA 2DCLA 1LEOA 3DGVA 3CJSA 1JLGA 2RVJA 2AJ4A 4DUYF 3HHLA 1C4AA 2HFUA 3M8YA 5DETA 4DR5F 3FEYB 2B8PA 4X65F 3C14A 4HLBA 2DR5A 5F8HA 3OFEA 4Y34A 2D7SA 2IC3A 3DLLQ 2KDOA 3R5AA 1ZAVA 2EFPA 1DRZA 3OL7A 5B7WA 1RJJA 4MFBB 4F4KA 3W9HA 2HEKA 8AT1B 8RUCA 3LTOA 5G4DA 2EW9A 4Y00A 1LWEB 1S0VA 1M0SA 1VRUA 3CSKA 1JXVA 4C8ZA 2LECA 5EHHA 3AODA 2D1CA 1B0PA 2MXYA 3CJQA 1PCAA 4FXVA 2OPRA 2XMMA 4OX6A 5HLFA 3A8EA 5A2QU 2EVZA 4L6V3 4XO0A 2G2OA 4DZ6A 6AT1B 3OLAA 2AGOA 2KRRA 4YEAA 3SCKE 1FKOB 1RWPB 4RNFA 3T3FA 4M5HA 2QA4G 5D8HB 5IC4B 1L3SA 2YNIA 3T1YJ 1NK4A 4H4OB 3IFEA 2B4VA 1RTJB 1RYSA 4P2MA 3QRQA 3VQTA 2V63A 4B3OA 3HKWA 3GG1A 1SB6A 2KXFA 3FBBA 4AD6A 4IRKA 2CJ9A 3IM9A 4LJMA 1YZ6A 2QFIA 3FFIA 2RRAA 1QM9A 5F8IA 5E41A 1K0TA 4QPTA 5CH7B 2GVZB 5I3QA 5K8PA 4IH7A 4A8YA 1M5OC 3SSSA 5B0EA 3LP0B 1FESA 3G6YA 3IM8A 5BR8F 3ZTQA 4ED1A 2EBGA 2KT2A 1IJFB 2DNKA 3HFKA 2GFFA 3CJ4A 3J81j 2PC6A 1PG5B 2J0SD 5CABA 1XMQJ 2RQMA 1U1KA 2CQGA 2HBZB 5KFSA 4V19J 1HBMA 3CF5Q 2J7KA 2KVIA 5AE3A 4F50A 4FNHA 3DGPA 2IDEA 4H4KA 2VJVA 1J5EF 4ED3A 4PYDA 4NRTA 1T05B 1JLQB 2YKQA 4P75A 2DIUA 3CD0A 4EZ6A 3TUIC 1Z1ZA 2H51B 1GMWD 1QD1A 3WHIA 1FT8A 2AW0A 1IR1A 4KKOB 3UQSA 2XS7A 4RUAA 2F7VA 1S59A 2Z57B 1HW8A 3ONQA 1FKAF 1S9GB 3OQ2A 2Q6CA 4K4ZA 1T02A 3BSOA 3D6HB 1NM2A 4ZLJA 3KKFA 3C6TA 3EJMA 5H9EJ 4B08A 3I0SA 4KO0B 3TA1A 3P3DA 1RP5A 5KFUA 2C3OA 3BKFA 4I64A 1LWFB 1BY9A 2BQ3A 1U8WA 3Q86A 2VONA 1AXQA 4RWWA 3TRGA 3S8SA 2R7WA 1NK5A 1SJ1A 1U1MA 2W2PP 2DY9A 4QWCA 1IM6A 3BV8A 5LJ5Y 3KLFB 2F9DA 2V8PA 4UOFA 2DHGA 3Q8RB 1ACMB 4JOUA 2FJAB 2LXIA 2N3LA 5FDLB 4OHYA 1G4CA 1G1XA 1JQGA 4J9LA 2YNGB 4G3IA 5K5MA 1RB0A 2V67A 1JWWA 2DISA 3HX9A 5IS2A 4P6QA 4EBCA 5GMDA 3CJ0A 2XSFA 1VC6A 2YKNB 1RAIB 1QE1B 3JAMY 3EZ5A 4KGZB 2G0CA 2GQCA 2KT3A 1PO6A 3HJVA 3M8QA 3D9BA 3OXGA 3JYTA 2AWZA 5H9FJ 3LWMA 4RO0A 1IKWA 3KK1B 5B08A 2MB0B 4ZPAA 3UDEA 2R7UA 3UWTA 4DV6J 4X4SA 3C6UB 2DNRA 4F02A 2QA4S 3CVKA 3IN5A 2GMJA 4WXOA 2IIHA 3DLEA 4RW6A 3EXYA 3UR0A 1DARA 3QFHA 2CJYB 3ZZYA 3RRKA 2UUCF 4U7CA 3UDLA 1AW0A 4IQMA 1N0UA 3HPOA 4P2FA 3G6XA 1XNQF 1HBNA 4M5NA 1D8YA 4GO5X 3M6WA 4C4WA 4JI4F 1JX4A 2WOMA 1UFWA 4DR3F 4F3QA 1J5OA 2CWKA 2EK6A 2LP4A 3AQOA 1HNVA 2HNYA 2ZC3A 5J2MB 3PYGA 2OHDA 3AB2B 4WF9Q 5J2NA 3I5AA 4FF2A 3MD1A 2W01A 2BQRA 2J5AA 1RTDA 1Q5YA 3K2YA 1XC9A 3KJFB 2UU9J 3GJRB 2UVRA 1RKIA 3ZFVA 2FVQA 1NXIA 2HHUA 2GNKA 2MHEA 3SQGA 2HGNA 2IM3A 1MWZA 1XTZA 3BR8A 4TYAA 3GV7B 5KFHA 2GCFA 3MAAA 3IWLA 1VBZA 3BPSP 2VBYA 3PHTA 1FJEB 4OYBA 4ZLLA 3BO3A 3PZPA 4NLVA 2KFNA 2WTFA 3ZZRA 1V5IB 3ZNJ1 1IVZA 2J8SA 1NLKL 4DS5A 4KSEB 1CJTB 4LFAJ 4L76A 4DQIA 1Y11A 4DUYJ 1IBMF 2E5IA 4DR5J 2XYPB 3DDNA 2N7CA 2WBMA 3KWMA 4DUZF 1IKVB 4J9NA 3I4PA 3MMJA 2GO9A 7FD1A 2P9EA 1JLFB 1NNDA 2HBRB 3CC2S 2K7JA 1VGYA 3W64A 5ETMA 5E3QA 4C8OA 1Q53A 1HR0F 1HQUB 1X4GA 3M2UA 4N8NA 4QPXA 1OQ3A 2WW8A 3B54A 1XNRF 2DPJA 4KT0C 4MIWA 3CWJA 4A8SA 4DR4F 2YWFA 2L9WA 4MYUA 5F9LA 3RTVA 4LR9A 2YX4A 2V2QA 4ZVSB 4Y65A 1UTAA 1U49A 3N4WA 4TQRA 5A0YB 2K8GA 1N36F 4B3MF 1B3TA 3EGVA 3MECB 3J7Z5 5KG4A 1L3KA 4LFBJ 1RHJB 2VA2A 2LA4A 3FKBA 3OXFA 2A3JA 3NBPA 4XIUA 2JJ4D 4H4MB 5L9XA 2Z8QA 2JWNA 3ET6A 4JI6F 2OPPB 2LQBA 2V8DA 3V5RA 4F25A 3VALA 3AQPA 3QATA 2DNYA 4DF4A 1X4CA 2ZH6A 1RLCL 1CULA 2KO1A 2L3MA 1PAEX 3JXOA 4LR8A 4TVAB 1GT8A 1S97A 3FC9A 2JVRA 1HMVA 4UZBA 4ZPDA 1QUVA 3CMES 4ZOSA 1NKEA 3MM5A 3K7RA 4WJBA 3T5HA 2HAFA 3B78A 2CYYA 1J5EJ 1IJEB 1YJTA 2XY6A 4P52A 1UVMA 1FNXH 1KTVA 4CLYA 1N56A 2XMJA 5DLFA 3LF0A 4GRSA 3HKZD 4JI1J 2ZM6F 1KONA 2DPIA 3S7RA 2K06A 1S99A 4LUBA 4UF4A 2QEXS 4NA3A 4KHPF 2ZBQA 4DV7F 4LT6A 4RUCA 1UZDA 1RACB 1YJRA 1RI7A 1TFWA 3TZZA 2XS2A 2PO4A 3NGKA 2Z58B 4OYXA 1RHRB 2BJ8A 2ZVSA 3KLEB 4IFYA 1WI8A 2B0GA 3CCJS 4EO8A 3M4XA 3QSIA 4PR6A 3US5A 2JLEA 1WKKA 2X1BA 3LP1B 3KHLA 4ZPCA 3PJ9A 4IOAQ 2AX1A 1YK9A 1VQ6S 2NPFA 3FMWA 3V81B 1D9AA 4ZP9A 2DIVA 2YBVA 5AXLA 2HNDA 3K57A 1Q0NA 1XR6A 3T9ZA 3MUTP 5AE1A 5DS7A 3A13A 3IP0A 4E0DA 3NNAA 5KFBA 3HHLD 2OEMA 3UDCA 2XMAA 1SKUB 2GA7A 4NX9A 2CQ1A 4ES2A 1BQMA 5G0RB 2CQCA 1AZSA 1T9WA 4DV4F 3OVBA 1PGZA 5KOWA 2HKEA 4YB1P 1XMBA 4MK7A 5HVGA 1HIYA 2E29A 3FBFA 4HKQA 3SMZA 1MROB 1T11A 1FWPA 3AA8A 2UXCF 2UUWA 4YQWA 3KFWX 3A8JA 4K4SA 3CD5A 4ELTA 3L3CA 4LSZB 2XNQA 1YBTA 4NL5A 1FTCA 2E1CA 4HTIA 3QBCA 5L1LA 4UQGA 4OZ2A 4ZVRB 2ADBA 3N5FA 1RHKB 2OTLS 3P49B 5ETPA 4BS2A 4C8LA 1FFSB 3R5DA 4KYZA 4WTYA 2CQDA 2RRBA 3GG0A 3T19A 1FWKA 1DHMA 4IYQA 4UTGA 1RTHA 1Y5NB 2HQIA 4LF2A 4YMEA 2C2RA 2F3JA 1TV6B 4B3TF 4KAIA 5SZTA 2APOA 2GMHA 4R5PA 1DFDA 2ZH7A 1W7WA 2ZH4A 3K5NA 3D0GE 2F5GA 2FVRA 3RAQA 5HROA 3FCHA 2R7VA 4X2BA 3SDEA 5CXTA 3TAMA 4Z7YA 1FFGB 4JI4J 3HI9A 1RA7A 2MGZA 1T95A 4FXDA 2MY8A 4DLGA 4DR3J 2CQBA 3AOBA 1UJ5A 2PI4A 2ILZA 1RA6A 2QLXA 2QT7A 4C3MA 5HSPA 2CPIA 2VOOA 1S76D 3LPEA 5ETTA 1IBKF 3D3BJ 2MY7A 3DOMA 4M5DB 4OZ3A 4M5KA 3HP6A 1N5TA 4CCHA 4HACA 1Q82T 2WSEC 5KG2A 1X9WA 2X1GA 4BLGA 3BYRA 1SL0A 2DH7A 4U9RA 2VBWA 2R7XA 3NGRA 1S6OA 4BCAA 3M2VA 3D3CJ 3RU0A 4JI0J 3KLIB 1S6QB 4TQSA 5C5JA 5D3GB 2DVIA 3AA9A 3DOLA 4J9SA 1VQOS 3MMAA 2BE7D 2IAJA 4EWTA 2GZOA 1TTHB 1N6QA 2ZBPA 4TLQA 2ASLA 3TVZA 2I0XA 2EFQA 4W92B 2GHVC 1YTYA 1HHQA 4ILRA 1R8PA 3CDUA 5HO4A 1IBMJ 4YR2A 1HWLA 3SSQA 1WEXA 2F65A 1LNQA 1REVA 4DUZJ 2HG4A 3PIOQ 2DXFA 4F3MA 2QLWA 3KUEA 3JSMA 2V5HG 4WU3A 3NOGA 1KEKA 5HATA 2NR0A 1S1UA 4C6AA 1XERA 3WC2A 2OKQA 4YFUA 2Z56B 5F8NA 2HMIA 2E7VA 2MYFA 2J6SA 1TUWA 2FLOA 3QIPA 1HR0J 3OR1A 3TX0A 3N5BA 4LSLA 4X64F 5E7OB 2WW4A 3P5BP 3G8SA 1XNRJ 5IV3A 4QQBA 3W2WA 4M5MA 3OR2B 2AJ1A 2XY5A 4DSIA 1S1TB 1BWVA 2W4CA 3FBEA 1YWXA 4JB8B 1BQNA 4ECVA 4X62F 1W2IA 4DR4J 2NXNA 3O8WA 5L38A 4NMLA 2R3VA 3IRXB 2CPFA 1K47A 1OY8A 1E6YA 4CT9A 1WKJA 2L9NA 4Z2XA 1N36J 2DNNA 4B3MJ 3M8PA 3PFEA 1IN0A 1TMJA 2XULA 2AU0A 2V0NA 2WRMA 4M5GA 1DURA 1MMNA 3OHBA 4K4XA 3QAUA 1FE0A 2IPOB 4I69A 4JI6J 5HK4A 2A0FB 2WSFC 3M8SA 1OMSA 4LFCF 2HVEA 3VGUA 3D6MB 5HANA 1RT7B 3H0PA 4RUBA 1WHXA 2JC0A 4OI4A 3L4BC 3X1LB 2HW3A 3DOKA 5IV4A 3QRPA 4X4OA 1SKSA 1TKTB 3NCPA 3ENWA 4N47A 2YPZA 1JKHA 3M2RA 1UEVA 5HVHA 1M5SA 3KK3A 5CHCB 1G2EA 2GVDA 2OLWA 2H54B 2E1RA 2EC0A 2YX7A 2FHJA 1ZA1B 1AROP 1YITS 1FXLA 2YVSA 4MK8A 3MAQA 1TL3B 1LFWA 4LBPA 2CNLB 4ZA1A 2VV5A 4AUKA 4FP9A 2PMZD 2R8IA 3KK2B 5I42B 3GIMA 2IVYA 2GIQA 2QIFA 2ZM6J 5ETRA 2WVDA 2ZE2B 4KHPJ 4DV7J 2V4JA 3DCAA 4WFXA 3QMQA 3OXLA 5GAEU 1S79A 5KT7A 3CNQP 4ZP7A 5GAHI 2AZ3A 3VF0B 3MMBB 3M8ZA 2I1RA 1M5PC 4UOCA 3QLHA 1V6HA 3I5BA 2L41A 4IG0B 3T1AA 1QSLA 4WTOB 1C1CB 1RT2A 2CQIA 3IGNA 1NEEA 2C2OB 4OMFG 1NKCA 2R8HA 3HFVA 2RF2A 2F4VJ 4DSKA 2RQ4A 2VB6A 3PR4A 4ENOA 3PJXA 4KJIA 4CTAA 3RYLA 3K8VA 4YOEA 3IWNC 1Y3KA 4UW2A 3A12A 2BYCA 2CPDA 1DLOA 2HQ3A 4LRCA 3HVTB 3BDEA 2MEWA 4I6AA 2J9CA 4DV4J 2X3GA 2RU3A 1L5UA 2BANB 4X4TA 1KSPA 3BREA 3R9LA 3OUYA 1Q8IA 4N5SA 3MOJB 2ZH3A 5A8KA 1U6BA 1C4CA 3OVSA 2UXCJ 4XDCA 2CPJA 3DDKA 3IC1A 4RW4B 1PJ7A 2DITA 4LRAA 1SC3B 2DXEA 3JTNA 1S57A 3PRDA 3D66A 1Q8LA 3AD8C 5EX0A 3K8WA 3S01A 4OHWA 3UCUP 1KVKA 3E3XA 2ZWPA 1URRA 1P8GA 3RB4A 2LXUA 4PKDB 2AP6A 2BA9A 1NB7A 4B3TJ 2BJ3A 1F5BA 4ELUA 1JLGB 2CZ9A 1Q5VA 3HHLB 4GC7A 3C14B 2VZ9A 1WF2A 2IC3B 1IBCB 2DNOA 4QZVB 1NHVA 5C7PA 4Q43A 4I2QA 1HD1A 2HS0A 2W1BA 3T5JA 1VRUB 1JB0C 4F4ZA 5KT3A 4K0KJ 3AOCA 2ERRA 1XR5A 2OPRB 5CQGA 3ZO7A 2ZBIA 1IBKJ 3WX8A 5KFPA 3KLGA 2VBXA 4A8QA 4OI6A 3Q8SB 2OD4A 3GONA 2UUTA 5F3TA 3SV3A 3GCWP 1FI4A 2XLJA 3LOUA 5T14A 3QZ7A 4ID5B 3WIVA 4I6WA 1HYSA 4YP3A 3SV4A 2YNIB 1QAXA 3PV8A 3P4UB 3MXHP 4WPAA 2P5VA 3W8PA 1DTQA 4PRFA 4W98A 2LU1A 2D3OR 4PABA 5EUHA 1WOSA 2B4PA 1FERA 3CJRA 2V8GA 2VG7A 4HR2A 4WZMA 1YKWA 3HZEA 4FF1A 4JUZA 1LW0A 2QC3A 3U1MA 4C98A 3Q22A 3M32A 4I56A 2MQNA 5K9FA 2AKWB 2VUGA 2QJ3A 5DO2A 4RLEA 3ZTPA 2VQEF 1RWUA 2EG2A 1GK8A 2AF6A 3OV7A 2PFDA 1TZ0A 2VC1A 4K59A 2VPWB 3DGPB 1JLBA 1SCJB 2UXDF 2H65B 4ECZA 4A4JA 1WC4A 3TZYA 4DV2J 4JYAF 4CLZA 4KC5A 2OH2A 4TKTA 3MR7A 3K5LA 2IYIA 2VOPA 1RKJA 4Y2KA 4X64J 3D4JA 5J1PA 4LF6F 1TQLA 4K4TA 3TQEA 4XAKA 2CPEA 2Q43A 3GU0A 4X62J 7FDRA 3TI0A 3MR2A 3KMSA 2BR0A 4DV1F 2V4RA 4RJVA 4ZIVA 2YKPA 3C6TB 4ILMA 3VGSA 1RGVA 1HWJA 3I0SB 2A1BA 4P71A 4PAAA 2BJ7A 3GFXA 1FNOA 1R31A 2JFDA 3Q8VA 2DNHA 2NXEA 4DMZA 3MEDA 3ETOA 4CLFA 1R8CA 2DK2A 2JC1A 1XWLA 2VF3A 3NY0A 4Q2LA 4PWDA 2WBRA 4NRUA 2DGVA 1VOMA 4WFZA 4ZVPB 3CPWR 4LFCJ 4C8NA 2BW7A 4H54A 2A6MA 3CJTA 4QWEA 1M1GA 3PYEA 5AXMA 1U09A 4ECTA 1KC8T 4P7VA 1REGX 4K8RA 3LQVA 2OSRA 1RBOB 4CYUA 2B9XA 1R0BG 3ZTSA 4WFNQ 1KBRA 2E5LF 2XLKA 2ZNYA 2AYEA 2IDLA 1HW9A 1RAFB 4GO7X 2IMOA 3M8QB 2ZH1A 5MLCV 2ACMA 3JYTB 3N01A 3ILOA 1IKWB 1F5CA 3GP9A 3QT6A 1YRTA 4P10A 9ATCB 1TL5A 3VVUA 2XCAA 3FBCA 1CC8A 2HLTA 3BPDA 1S1WA 1GNKA 2CNOB 3QT5A 4A8WA 1ZAWA 2O5DA 1S48A 3C15A 3NNCA 3Q89A 3DLEB 3EGNA 1RAOA 4RW6B 3ENQA 4AE5A 1KFDA 2J6TA 2RHSB 2OAUA 2YKMA 5I4MA 1H73A 3PX4A 3FRZA 5HN0A 1HBNB 1FXDA 1SL1A 3M05A 5M2UA 2HYIB 2NPIA 2FZCB 2B9EA 4DOZA 2WOMB 1PJ6A 1S0MA 2U1AA 2J9DE 1EKSA 2DD8S 1BUXA 2KZMA 1J5OB 1HNVB 4DPWA 2HNYB 2B51A 2XM3A 1S10A 4ZVOB 4CO3A 3Q24A 3W5XA 5J2NB 1WD6A 1GXLA 4OLOA 2CDQA 1YJ7A 1RTDB 2JX2A 3ZZTA 2R7RA 2QLBB 3D0IE 1HWKA 1UZHA 4ERDA 2J0XA 4J9KA 2D69A 5LXRA 2QA2A 1VQYA 2BACA 1SC6A 2LMIA 1DY3A 4ZP6A 3TANA 3F41A 3SQGB 3FRYA 4USMA 3BS9A 3JB9k 5DM6Q 2QL9B 2C2NA 2P6TA 3MAAB 4UUWA 3PRVA 4PG8A 4QIVA 4DN0A 4DUTA 1RT4A 2GAGC 4FYXB 2ACYA 3JQMA 2K3IA 5KFWA 4KHRA 4ZCMA 3N79A 1KOHA 1FXRA 5HJYA 4MKYA 1AFJA 1UL3A 2B43A 4Y2AA 4XPCA 3CTRA 5LJ3Y 5IWAJ 3W65A 2BV3A 1SVDA 4B02A 4XDDA 1RAGB 1X5PA 2HFZA 2KVQE 2PEHA 3UNYA 1U6FA 5KG0A 2LEAA 3OFGA 3IR5B 2X7IA 2CQ0A 1GFWB 3MM7A 4YB5A 5D78A 3D5MA 2M0GB 4FYYB 3MCNA 3CO9A 3VVTA 4ZIWA 1S77D 2BMBA 4IDKA 3M2UB 4ED8A 5KAKA 3RBDA 2FHJD 2V34A 4PYAA 4DR6J 2ASDA 2H5IB 1UVKA 2Y1IA 1WHWA 4B9NA 2HQCA 3UO0A 1S72S 5D4OA 4NXNF 3CJKB 4ED0A 1ZTTA 2MHNA 2N4CA 1WEZA 4DL3A 1FRLA 4IFVA 1V3RA 4ECSA 3PKYA 3GILA 3PEHA 3QGPA 1N5YA 2Y0SD 3NBPB 5IT9U 2G0IA 4W4MA 4QOTA 4NYOA 1LWXA 3G9CA 1S12A 5KT4A 3G6ES 3ET6B 4ZN3A 4GKJF 3OTOF 4BWMA 4O3PA 5F8LA 2DY1A 2HURA 3R7NB 1B0VA 3L7OA 3OTCA 1EARA 1ICEB 4TXSA 1HWUA 3MOZA 4O3SA 1WKLA 1OSDA 1CULB 3KHGA 1AUDA 3HJFA 3BM7A 1WUUA 4OYIA 4Q8EA 3HSGA 4EFAC 2VQEJ 3DDIA 3CJ5A 3G86A 3NGSA 1BQXA 3MM5B 4B9UA 1X8DA 2UXDJ 1VIOA 3MUMP 5KFTA 2ZUGA 4JYAJ 1H2VZ 2PGCA 2ZZNA 5H9EK 5B0AA 3ZZZA 2VKZG 1U1QA 3R7SB 2FC9A 3M1VB 4EI2A 1RT3B 2E1PA 3VZHA 4LF6J 2G1HA 4U67Q 2FDNA 2W9BA 1DAXA 2QO3A 3CCES 2JHEA 1NJWA 3RBEA 2JNJA 1VQ4S 2HHXA 4DV1J 2DGXA 1JLCA 4IFYB 1KD1T 3UD5A 2HVZA 2IJFA 4PXEA 2POKA 4CLKA 2UP1A 4RU9A 1WJ9A 2F1FA 3P6YC 4L74A 3H20A 2J8AA 5F0UA 3H40A 2LQJA 5E33A 2XC9A 2FYXA 2XMKA 1X4DA 3QO9A 3U02A 2A2CA 4U6PA 2MZQA 2CA9A 4EBEA 1HI1A 1BC6A 2DJWA 2ZITA 3TR5A 4Z37A 3RW6A 3RUBL 4QR1A 3VAHA 5BJRA 4F4YA 2L48A 4DCJB 2XMUA 2CQ3A 1AZSB 3UN5A 3SBMA 5H9FK 3UVJA 5JXSA 1D8ZA 2UVWA 1R0CB 2BJEA 1EAYC 3OSPA 2CJKA 1VRTA 1W2BR 5GADI 4K4WA 4DX7A 5IM0A 5C42A 1UETA 1FDDA 2H5JB 4FF3A 3MCSA 4E8UA 3RRHA 1KLMA 2WVFA 4C3KA 3PCOB 1FO1A 2EFGA 3AY0A 3GIJA 5KFAA 3F0NA 5IT9Y 1TFYA 1PAUB 4X4QA 4FKYA 3G8TA 2N82B 1B7YB 1O6XA 1RTHB 4KFBA 4C11A 2LQ9A 1TAUA 1ZTWA 3DLHA 2AIRB 3OJUA 1P9QC 2RT3A 4R5PB 2VASA 1NRKA 4DCOB 4E2FB 5K8OA 4LQ9A 2V4QA 2W7PA 2JEFA 1X4AA 5HROB 4AXJA 4MYTA 5IXUA 3SDEB 4I68A 3U1LA 3NRBA 3FNNA 4HHHA 2YNFA 4B9TA 4FVCA 1T9UA 1R8HA 4ICLA 4ZKAA 2KM8C 4X4UA 4Y3CA 4CO1A 4USKA 1RYRA 1SQEA 3LAKA 4QIGA 4LSNA 1U7LA 3MM9A 2HFOA 1NSQA 4HACB 3N6LA 4RW9A 3SEOA 5T7LA 2QN6B 1WG1A 4Y2CA 2E7XA 4LRDA 5THWA 1EKRA 4PG5A 2XI3A 2WB4A 4CRJA 3DOLB 3MMAB 2IAJB 2RUGA 2QTWA 1N6QB 3SCIE 2YWWA 2XHCA 2N4DA 1TK5A 1KHWA 2VBZA 1U0HA 1U24A 1C1BB 2YKAA 2LVWA 4Q44A 1RT6A 5L8RC 2ZDOA 3FZBA 4USVA 3KOAA 3BQ2A 4CNYA 3W60A 2Y8YA 1WSRA 5KFMA 3ZZ0A 2DB1A 4IKAA 1REVB 2Y9HA 3VAJA 3H8YA 4WFYA 3ILJA 5KG7A 2NSBA 5D15A 3JSMB 2QMWA 1YSJA 2DR6A 4J9QA 1N5VA 4S0MA 2HMIB 2AJFE 2XGPA 2B8QA 5FLXU 1NCLA 4DR7J 3QIPB 5HQMA 2ZWOA 3AJDA 2WAQD 3CCSS 5F8MA 4LSLB 5GMEA 1R89A 1Q16B 2HBQB 2MJNA 1WTFA 4I4BA 3NGUA 3WBZA 4J9RA 2SXLA 1T9TA 6FD1A 1RWKB 1HNWF 4F36A 3M9NB 3DHWC 3R7BB 5AJ3J 3SQOP 2VFRA 2C3UA 3BN4A 1FKOA 3M8PB 4MT1A 5K8NA 4IH6A 2QLJB 4N56A 4V19X 3Q8PB 2VFTA 2GQ2A 2P2CB 1MNEA 5EGYA 2FD2A 2YWHA 2CQPA 3OTOJ 4ZPTR 2VFSA 2XO7A 1Q7YT 1TKXA 1T8EA 3BKTA 1NK9A 3CGIA 4IR1A 4J9MA 5HP1A 5HMZA 3MR3A 3BF4A 3NXZA 3DOKB 2IFXA 2CPZA 1TUVA 1U1PA 2ASYA 2PN6A 1QTMA 1JKHB 2MKSA 5M2RA 3KK3B 5IT0A 2GVDB 1OPZA 2G0JA 3KLVA 3M6UA 4NZ7A 2R2UA 4DR2F 4P72A 1SBRA 2M8DB 1FDAA 3C8YA 5L1JA 4DHVA 3I96A 4OIXA 4ZPBA 1RZMA 1N8RT 3TOQA 2Z30B 3D28A 3CMAS 1GX6A 2X1AA 3O2IA 2ZH9A 3THTA 1RWOB 4QIWD 3OL6A 5HVFA 4PG4A 3I32A 2HPUA 5DZ7A 2VA3A 2V4JB 4ZDNA 5DDPC 1N34F 1VCTA 4C8YA 4Y2IA 5CCLA 4CDIA 2R7TA 5U47A 4PXDA 2RUSA 3MD3A 4ANCA 1NSAA 1URNA 3DKDA 2CKWA 3JSBA 1CSJA 2BUNA 5DDRC 2M88A 1F2HA 1KNZA 4ZCIA 4NCGA 1WHYA 5HMYA 3DLJA 4ZCLA 5LM7E 1QVGR 2Q6BA 1RT2B 3Q23A 4FYVB 3TUPA 5JVHQ 4KO0A 1TKZA 3RG6A 3WZ0A 1BLUA 2RF2B 3BYPA 5E2QA 2EK1A 2XMWA 2QV6A 4CTAB 1ZM3A 3U1NA 5DGBA 2QE5A 2O01C 3NNHA 3UDVA 1LV5A 2QYCA 3E51A 3ZZPA 3DC2A 5DQGA 2C2KB 1YZ7A 4ZVHA 3TAQA 1DLOB 4RW7A 1GXUA 3I55S 4MAKA 4J9PA 3IR6B 2NREA 3T5LA 5HBMA 4DPUA 3MZIA 4PG7A 4ECUA 2ZHOA 2WONB 4RUHA 3NG8A 4A8MP 2J9DA 4IOCQ 3OUYB 2YPYA 2PEBA 3EICA 1MLAA 2ABYA 5A8RA 5A8KB 3ICLA 2FJBB 5EWEA 2G13A 3H7HB 1CEZA 4JI5F 3W9IA 1RBLA 3U27A 4ECXA 3QZ8A 4LFAF 4O0NA 3J7ZT 1EB0A 1RAJA 2D3UA 3LPYA 4GVBA 1WDTA 2GGPA 2FHMA 3RR7A 2QLFB 3BGUA 1EP4A 1OIAA 3EVOA 2BDPA 3OHAA 4QR2A 1F3FA 3PW7A 2VPYB 4OQJA 4NI2B 1CG2A 1SPBP 4RNHA 1U02A 2CDRB 3M9MB 5DQIA 1IM4A 4I7FA 1OY9A 1X9SA 2CAJA 1NZ8A 1M1HA 3POTA 1RK8A 1ZM4A 1ZETA 2M9KA 1ZS6A 2KU7A 4OYPA 3CCVS 3X3UA 3CEDA 3I6PA 4I2QB 4ZHRA 4DSFA 5KOXA 2IJNA 1U47A 1FX2A 3ITHB 3OL9A 3GFYA 3FGVA 4DI6A 4R8UA 1WELA 3JAMU 3LO3A 3ENAA 2ZBRA 1S6UA 1WDDA 2HVDA 2MJUA 4NLSA 1HKAA 2AJ0A 5KFCA 4MH8A 3DNCA 4LFBF 3MEKA 5KFRA 4EBDA 1CJVA 1CJKA 2HFVA 1NHUA 1HYSB 3R6GB 4DPYA 1GH8A 3EGZA 1H0HB 4LRBA 1DTQB 2P8IA 4DZDA 1KLNA 3CDWA 4PPZA 4LF4F 2FJDB 4IH5A 1S1VA 3FSXA 3R3TA 2G1DA 1VS3A 1RISA 1YDLA 4JI7J 2HHQA 4EYIB 2VG7B 5KT2A 4K5RA 2LQ8A 1S1XA 4DXLA 4F4WA 2RS2A 1LW0B 2AGPA 1I94F 4B3SF 1WC3A 2V9WA 3M32B 3ZZOA 1OY6A 3NMRA 1SV5B 1X0PA 2B9YA 2LKZA 1NJIT 3GJSB 1FWLA 3EMTA 4M8LA 3N0VA 2E9TA 1L3UA 1H2UX 1E6VA 4JI1F 2F8EX 2WHOA 3J7YU 1BWEA 1LWCA 3TZWA 3HD1A 1T3NA 4O44A 1FX4A 1CJTA 1RU2A 1GXTA 1SJ4P 4IR9A 4LR7A 2PMWA 2MTLA 2GJFA 3W62A 4OJHA 4KV8A 1I51B 2OP5A 4HI1A 2GO8A 3ULHA 1WOOA 2XHWA 4DFKA 3AAWB 3DLGB 2KHDA 4NZ0A 2RQKA 2I6WA 4QCLA 4DR1F 3CIMA 4O3NA 2AEJA 1ZM9A 2DHXA 2GAHC 3F44A 1F9FA 1HNWJ 1HQUA 1FEHA 4OHVA 2LCWA 3V6DA 2MLYA 1UFKA 4ZVTB 3SI8A 4RZRA 1F5AA 4ALZA 2IRXA 3MEDB 1MN7A 2B9WA 1X4FA 3TJ9A 2RKIA 3R27A 1X31C 3CCRS 3W66A 1FRXA 5KFKA 1F9HA 4HTJA 4DV0J 4PWDB 4OZ5A 5K14A 4FNIA 1XIQA 2FY1A 5C24A 1VC5A 3MECA 3MPWA 5HAOA 4K7QA 4JV2A 4HT7A 2Y1JA 1D9DA 1FRMA 3BB5A 5ETOA 4DPXA 2GS8A 3B82A 3DLBA 3LWLA 1RABB 5B0GA 1AB8A 2JOQA 4DEZA 1T03B 4DR2J 4DL5A 4ZS6A 4CYUB 4OJ3A 3BR9A 4OV1A 5KG1A 2FC8A 4HDHA 4A47A 3NS6A 2YTCA 4ZN1A 3QQCD 4M5IA 4KY3A 5CYMA 3QYYA 1P6TA 4YR3A 2YWKA 3H59A 3N6NA 1N34J 1KRPA 2HHSA 3DRRA 1QJHA 5J1NA 3BGOP 4RU2A 3TNVA 4DL0C 3MEGB 3R5GA 2HFNA 3KNGA 1S0OA 2QZ8A 1RWMB 4WU2A 3V4IA 3O6QA 1YBAA 1XQIA 3D6FB 3ZTOA 4ES3A 4NMXA 3V6JA 3C15B 4F2SA 4WKRA 2UXBF 4RPFA 1U25A 2JEGA 2YKMB 3K5MA 5L1IA 3UD3P 3MURP 3M30A 2I5JA 4M5LA 4PPDA 1AUSL 2KYXA 5KFXA 1SUQA 1Y5LB 1QSSA 4M1KA 1RADB 1Z4UA 1U6ZA 4JI0F 1NSPA 5DDOC 2CJAA 1FJGF 4CIOA 1RT1B 2LYVA 2OFHX 3H5SA 2RE1A 1OYDA 3HFZB 1VRQC 1G6BA 3UN3A 5AE2A 2C42A 1U1LA 2HWHA 4K2JA 2VG6A 2E44A 5MAOA 2J0WA 4R0JA 5DM7Q 2CIMA 3Q8UA 4JI5J 2CNNB 1SL2A 2B4OA 3F73A 2QRRA 1FRJA 2EWHA 4OHZA 4WCEQ 1HBOA 4PUOA 1YJVA 2D3ZA 2CFXA 3PYFA 2RRNA 1RT4B 5KFFA 2ZH2A 3S6EA 5IC6B 3H90A 1MG7A 2B7BB 2F9JA 4CM0A 3L7PA 3TAPA 1KVJA 3MDFA 4L73A 3MM8A 2GIRA 5CYJA 1N5QA 4DFMA 1QAIA 2UV8G 1I1GA 5JVGQ 3CC4S 3C16A 1WF1A 3GZ7A 3SZ2A 2OTJS 1H38A 2AD9A 3VV2B 4PXCA 4K4VA 4B9MA 2FVCA 3D1HA 4D3GA 5KFGA 3KHRA 2V6AA 3BGLA 2P9GA 5KFYA 2R4FA 3HULA 2DGSA 1BGXT 3M8RA 5CD4A 1UA1A 2AQ4A 4UY85 5KFEA 1VQNS 2HGLA 2VHGA 2JVOA 4AXIA 3IRWP 4URSA 3FEZA 4IDKB 2W4PA 3A1YG 3VWSA 2M52A 1V5VA 4WE1A 3PO5A 2VPXB 1U2FA 2F8MA 3BQ1A 4U8YA 3EYZA 2KM8B 2JEJA 2BOPA 1UW4A 4NLGA 2VU5A 4HH0A 1FFWB 5IQ6A 3H4DA 3PX0A 4IFVB 1DZ5A 3MUVP 3EM1A 1YJ9S 1EX8A 2QA1A 4LF4J 1XEZA 3DMJA 1NO8A 2AX0A 3BQ0A 1HLWA 3DM2A 3CCUS 4EGLA 1HI0P 4DDFA 1N5YB 1F1BB 2LDIA 2Z2LA 1UWAA 4TNOA 1WWHA 2AJQA 3B4MA 4Y2MA 3HHEA 1NZAA 3E8OA 2Y1LB 4YDDB 2O67A 3GIRA 1DJ0A 2K7KA 1RHQB 4C0OC 5A8WA 3GPAA 1I94J 4B3SJ 4C2MA 2MKIA 3Q8QB 1IKYA 3GYXB 1QUPA 3DRSA 3G6VA 4O4GA 4A46A 4DX5A 2HS4A 2Y3YA 3RB0A 3A4TA 3UR3C 2MMYA 1RT5A 3VGVA 3GSIA 2W9CA 2RAQA 1CJUA 1BE4A 1KFSA 4R0EA 2B4UA 2RB7A 5B0DA 4CLUA 2BW2A 3LAMA 4PQUB 1U1OA 3FJ2A 2QYGA 2C3PA 3LH2S 2RH3A 4ED6A 4KH0B 4YY3F 3H2LA 4ZMMA 1FHTA 2YY3A 2Q79A 2DRDA 2WB1D 2VJUA 4OJGA 3TP2A 2KTQA 1H7XA 2W9BB 3VAGA 4C9DA 2MZSA 1AFIA 3RW7A 4DR1J 1U0SA 1YJNS 3GYGA 4P2SA 2YNHA 1AT1B 2K1RA 3JQJA 1VFJA 1DQ9A 5ADZA 3BGFA 3R97A 3HHNB 1OPIA 2LLZA 2F4VF 4DQPA 4NLUA 1TR0A 1FD8A 1KR4A 1S1TA 2CG4A 1B7FA 4Q45A 1N5SA 1VJWA 3W8GA 2CVEA 3QIDA 5F0WA 4UUXA 1HNZF 1R8AA 1RTIB 2PIIA 3BZQA 3QO9B 1OO0B 2NYIA 1GTHA 2JLFA 5ETNA 3MFHA 1WG5A 3GFHA 3AD9C 1SC1B 2VDHA 3E01A 3I5CA 3K17A 3TEHB 3L7UA 4RR5A 4FYWB 3ZZUA 2ZFHA 3DYAA 3BH7B 3HVAA 3UCGA 4WFBQ 1NBEB 1HBUA 2KHCA 1Q79A 1VK8A 2E9ZA 3IS9A 2CJBA 3UVJB 4QU7A 4ILLA 3TQ1A 1Z2LA 3A3PB 3CXCR 2VG5A 3H25A 1ZOTA 4ZJOA 3IBCB 1VRTB 1UJ4A 2NLWA 1PC5A 4GKKJ 3CCQS 2NZ4A 2HNZA 4KB7A 1VYAA 5IM0B 5C42B 2WVCA 3ZNUA 4J5OA 3HSDA 1Q78A 3C46A 1PILA 3SXLA 2CWXA 1WC5A 1RQ0A 2EBEA 1KLMB 2HQGA 2CNKB 2ZOGA 1GEHA 1FRHA 3RBZA 2AT1B 2IVMA 5KG5A 2KB2A 1JNRB 2DT9A 2XS5A 4G1IA 5ETVA 1C0UA 1I3OB 2Y1RI 5J1EA 1IQTA 4LRFA 4G1PA 3MMCA 4KFBB 4C11B 3VCDA 2ZD1A 4MTPA 2GHPA 4K4YA 2F63A 4K0KF 2UXBJ 1RCOB 5I3UA 2C28A 1T3OA 2DNMA 2R8GA 2B56A 3MMBA 3KG4A 3J81Y 1WC6A 4LF1A 4J37A 1YI2S 3I82A 2YNFB 2XO6A 5LMNJ 2EFOA 3NCRA 4ICLB 2K2PA 4MK9A 1OJ4A 5DG9A 2ZVIA 2E1AA 2KL8A 1RAHB 1Y10A 1WTBA 1O51A 3G71S 3T6BA 3TO8A 3L09A 3NP5A 4LSNB 1FJGJ 5HI7A 2O3DA 3MPVA 3G82A 2CJQA 4RW9B 5T7LB 4JP8A 1JLEA 4IRCA 3GTYX 2HZCA 5DQHA 3CCMS 1Q8BA 3HVTA 4ZLPA 2YQ3A 1VISA 2FVPA 4AYBD 3WDOA 2CVIA 4FXWA 1TKDA 3CW2C 3TVKA 4ETZA 3J7A1 2MKKA 1Z2ZA 2DH9A 5C2GA 4TU9A 4F8RA 3RRGA 2G2YA 3WX4A 2QG9B 1UPPA 5CD4H 2ZJPQ 2RDIA 4Y28C 3QGGA 2X3DA 2ZEJA 3IWXA 1U0HB 3G87A 1VBYA 3UN2A 2RSQA 2FY8A 4LF9J 2KI2A 5C2CA 2MQQA 2NZCA 4DV2F 2B7CB 2AGQA 2ZOFA 3FK4A 2W9AA 1ITPA 1A7GE 3CB4A 4JV0A 4R25A 5IFMA 3AFGA 4XTTA 3HCXA 3H2VE 2DNPA 1HA1A 3HVRA 2AYBA 2YQ1A 5LMUJ 2YWEA 3VAKA 3TW0A 4X4PA 1QAYA 2B5JA 2HK2A 4YB7A 1XMOF 1LQ9A 2MSSA 5C25A 4WFAQ 2FVSA 1WC0A 4Q5VA 1R3NA 1CQNA 2CUYA 3R2CJ 5J2PB 2Z4PA 3EDRB 2RS8A 5ITHA 3HT3A 1RBAA 3U7JA 2KG1A 1UW9A 4U96A 4B17A 3T1HJ 1RDRA 4DWIA 3MAHA 2EPIA 4G1QA 1GQEA 3BBBA 3W2VA 1UPMB 4AT1B 3P96A 2DGTA 3IBFB 2PI5A 2C2EA 3GR1A 2BEFA 4C7QA 2ZC4A 5BYRA 2HHVA 2RILA 1P1TA 2FUG9 3BSAA 4ID5A 2RHQB 2IRUA 3ADAC 2MZ1A 4NLXA 1VQPS 1RWNB 4LMZA 4UOGA 5J2QA 3CULA 3M9OB 1TKXB 4QWBA 2GIFA 1Y0HA 1MSWD 2XSJA 1PSDA 5HP1B 4WP3A 4M5JA 2DGQA 3GE9A 4AQYJ 1SQGA 1FVSA 5KTQA 3GWCA 2M7SA 3WC0A 1B70B 1YRXA 1NH8A 1CS4A 1SIZA 2R7SA 3AH6A 3DI6A 4MKVA 1RWXB 2H3EB 3QNWB 4TYBA 1ZAXA 4IRDA 3KG1A 2ATLA 5LSRA 4I2PA 3DRPA 1F3VA 4CH7A 4BWJA 4CLWA 1H74A 4YY3J 1EJ7L 3D2WA 4HI2A 4O3OA 3TUJC 1ROFA 3LP2A 1NPKA 4KHMA 3HF5A 4AFFA
chains in the Genus database with same CATH topology
1HNIB 1V3SA 1M5HA 1RT1A 2ZVSA 1SXLA 2OMLA 2C3MA 3KLEB 4PG5A 2XI3A 2WB4A 4FF4A 4IFYA 2BRLA 1WI8A 1JLAA 3DOLB 2MPUA 3MMAB 3SCLE 2B0GA 2IAJB 4HDGA 1XK8A 2RUGA 4URQU 4DJBA 5E0OA 4EO8A 2XWXA 3M4XA 3CCJS 4PR6A 1X5SA 3US5A 2HWTA 2JLEA 1N6QB 3SCIE 3W7BA 1N5YB 3R1LA 2N4DA 4HVZA 2MQMA 2PA8D 3D1QA 2X1BA 1R0AB 1TK5A 2CPHA 1XR7A 3OFFA 2YKOA 4NCGB 2NQPA 1KHWA 3LP1B 4QBUA 3KHLA 4ZPCA 2HVHA 2VBZA 4IOAQ 2AX1A 1VQ6S 2NPFA 3FMWA 3V81B 1S9EB 2MSTA 3JTPA 1D9AA 4YR0A 1U24A 3H4BA 4ZP9A 1C1BB 5LT5A 2R2SA 2J0QD 2D74B 2YKAA 2LVWA 2DIVA 3CJ3A 3K58A 3G8QA 5AXLA 3K0JA 2HNDA 3VR1A 4Q44A 2DBBA 2P9CA 1RT6A 5L8RC 5T41A 1O5JA 5AXNA 1JLBB 5FJ4A 1NAQA 4CZCA 3K57A 3VAMA 2ZDOA 1S6PA 3FZBA 1XR6A 1TKZB 3T9ZA 3KOAA 3BQ2A 2XLIA 4DL2A 4CNYA 1FK9A 3GIIA 4I67A 3RZAA 3MUTP 5AE1A 3V2UC 2KXHA 5KFMA 3TVYA 5DS7A 3ZZ0A 1N4LA 1IBLF 4D3HA 4E0DA 1HNXF 2DB1A 3HHLD 5KFBA 2XGQA 4DPOA 4N76A 1ULRA 3NNAA 4IKAA 1IKVA 1REVB 3VAJA 3H8YA 3UDCA 3GIKA 2RNEA 2DR7A 2GA7A 4NX9A 4WFYA 2DGOA 3NAIA 5KG7A 2A2DA 2NSBA 3JSMB 5KFDA 5E5NA 1JLFA 2CQ1A 2QMWA 3LGNA 4ES2A 5KFNA 1BQMA 2IM1A 3TYTA 5G0RB 1YSJA 2BVZA 2CQCA 4GMKA 3QWPA 4RBUA 4RW7B 2ZNZA 4CNZA 4DV4F 1PGZA 3OVBA 2VQFF 4J9QA 1N5VA 4KTQA 5KOWA 2HMIB 2AJFE 4YB1P 4TU7A 2XGPA 1XMBA 1FDBA 4BC9A 1F2GA 4OLPA 1HD0A 3CD7A 5HBMB 3V6KA 1R7IA 3H5UA 3V6HA 3QIPB 4MK7A 1Y4ZB 4UQTA 2E29A 1NJYA 2WAQD 3ENVA 3MHYA 3CCSS 5F8MA 3I4HX 2NSCA 4LSLB 1KQGB 2HRYA 1R89A 4CQ1A 1QSYA 3I9ZA 1Q16B 3K5OA 3CCTA 1CPZA 2V94A 2MJNA 1WTFA 4HKQA 3SMZA 3H98A 2RQCA 5A8RB 4I4BA 3WBZA 1MROB 4NOHA 1D3WA 1R6YA 4J9RA 2CRLA 2GJ2A 3AA8A 2BBEA 1HQEB 5A2QY 4W90B 4NWBA 2UXCF 2UUWA 4YQWA 3KFWX 1N33F 2SXLA 2W8LA 3KMQA 4K4SA 2DTJA 5EX3A 2M5YA 3CD5A 2C3YA 5F8GA 2ASJA 6FD1A 1TL1A 4ELTA 4YDXA 1HNWF 3M9NB 3M6XA 2XNQA 2XMVA 3L3CA 1NJZA 3DHWC 4NL5A 4LF8F 1FTCA 4AL7A 2E1CA 4JI8F 4HTIA 2E5GA 5A0YA 2DRBA 5L1LA 1HL6A 4UQGA 2AV5A 2MQLA 2ADBA 1ZH5A 2GX8A 1C0TA 2VFRA 3N5FA 2OTLS 2GGPB 2C3UA 3BN4A 3P49B 4BS2A 4ELVA 2BXJA 4C8LA 1FKOA 5EDWA 3PKMA 3M8PB 3R5DA 1EETB 4WTYA 1EP4B 1YHQS 5B0CA 2DO4A 5EWFA 2BE2A 2CQDA 2RRBA 1K0VA 5IWAF 5K8NA 3GG0A 3T19A 1VMBA 1DHMA 2VH7A 4IH6A 4OX9F 2ZH5A 4ES1A 4IYQA 4N56A 3SSRA 3CE8A 4V19X 2PFFB 1RTHA 3MPYA 4H4MA 3Q8PB 2W8KA 1Y5NB 2HQIA 3G96A 2VFTA 2GQ2A 4YMEA 2C2RA 2F3JA 1TV6B 1K8AT 1MNEA 1P27B 4KAIA 4B3TF 5EGYA 1S4FA 2FD2A 2YWHA 1UFLA 5SZTA 2APOA 2GMHA 3HHLC 4K2XA 2OPPA 4R5PA 2CQPA 1DFDA 2ZH7A 4KGKA 4ZPTR 2ZH4A 2VFSA 2XO7A 2LDYA 1TKXA 2A10A 1Q7YT 2Q3PA 3K5NA 2JL9A 4I7FB 2E66A 3D0GE 1T8EA 2FVRA 2J7WA 3RAQA 1NK9A 2DNLA 3CGIA 4IR1A 3I87A 1OS5A 5HROA 4J9MA 5E3CA 3FCHA 4QWAA 2R7VA 1KQFB 3POTB 5HP1A 5HMZA 3MR3A 5HLFB 4NLDA 4X2BA 2CZ4A 3SDEA 3E2EA 2JLGA 5CXTA 2V8HA 3TAMA 3BF4A 4GKKF 3FMBA 3DOKB 3OL8A 5B0FA 2DRAA 2IFXA 2CPZA 1TUVA 1U1PA 2ASYA 3HI9A 4ZHRB 1RA7A 3I31A 2PN6A 2MGZA 2FLNA 1QTMA 1JKHB 2HVIA 2MKSA 1T95A 5M2RA 1NU4A 3KK3B 4FXDA 5IT0A 2W25A 2MY8A 4JBCA 1OPZA 3KLVA 4DLGA 2KT5A 3M6UA 4N41A 1O8BA 2CQBA 3FEXB 4CO2A 4NZ7A 1UJ5A 3C2PA 2R2UA 2PI4A 2ILZA 4DR2F 1SBRA 2M8DB 1RA6A 2QLXA 2QT7A 4C3MA 1FDAA 3C8YA 5L1JA 4R8UB 4LF5F 4DSJA 1ZBTA 4DHVA 2CPIA 3I96A 4DV5F 4OIXA 4ZPBA 1N8RT 1S76D 2VOOA 1IBKF 1X4BA 2MY7A 1TVRA 3DOMA 3EXCX 4QR0A 3TOQA 5LSLA 3UW1A 3D28A 4M5DB 3P5TL 3CMAS 3HP6A 4B3OB 2RDJA 1GX6A 1N5TA 2X1AA 4CCHA 3O2IA 3H2UB 4DL7A 4Q7AA 3PX6A 1Q82T 2ZH9A 2WSEC 3MI7X 3THTA 5KG2A 2UVVA 4QIWD 3OL6A 1YJWS 4P7TA 1S1WB 4PG4A 3I32A 3FSYA 3FFIB 2HPUA 2RMLA 1SI9A 1X9WA 2X1GA 2VA3A 2RJZA 3R5BA 2V4JB 4ZDNA 3PW2A 1FE4A 2DH7A 1SL0A 4DSLA 4U9RA 2VBWA 5DDPC 2R7XA 2VC0A 4WKYA 4F26A 1N34F 1S6OA 4BCAA 3DU5A 3M2VA 2J6UA 3RU0A 1TP7A 4C8YA 2CQ4A 4Y2IA 5CCLA 3KLIB 1VQMS 1S6QB 1HNIA 2R7TA 1WF0A 4TQSA 3KLEA 5C5JA 4PQUA 5D3GB 4LQ3A 3R5CA 3EX7B 5U47A 3UFCX 2ALZA 4PXDA 3RAXA 1F0XA 4N77A 2DVIA 4ZVFA 3AA9A 3MD3A 3DOLA 1C2PA 4J9SA 4ECWA 1URNA 1VQOS 3MMAA 3CCWA 2CKWA 2IAJA 3JSBA 1CSJA 1IXKA 4EWTA 5F9NA 1S1VB 4NCBA 2BUNA 5A6WA 5DDRC 2ZOMA 4A48A 2M88A 1N6QA 3DXBA 1J2VA 1B64A 4CH1A 4NLOA 3N28A 5AXKA 1KNZA 1LK7A 2D41A 4ZCIA 1R0AA 4TLQA 3HO1A 4NCGA 1SJ3P 1WHYA 4MMOA 4ZVGA 4ECYA 3LP1A 1ZYQA 2GV1A 2ASLA 5HMYA 3DLJA 1A9NB 3TVZA 4ZCLA 3PJWA 3V81A 2I0XA 3D54A 4WK3A 1B0TA 2Z0GA 4DQRA 4WK1A 5LMNF 2EFQA 4W92B 2GHVC 1YTYA 2DNZA 1QVGR 2EKYA 1HBMB 2Q6BA 1RT2B 1S1XB 3PIPQ 3Q23A 2PDAA 1FTRA 3NMAA 3OFHA 4ILRA 5JVHQ 1R8PA 1IUJA 4KO0A 1Q1KA 4ZCKA 2LXFA 3CDUA 5HO4A 4YR2A 1TKZA 1HWLA 3WZ0A 1BLUA 1UWBB 2RF2B 2X51A 1WEXA 3SSQA 5E2QA 4RKUC 4WXWA 1X7VA 2EK1A 3K5PA 4HHJA 2KKHA 2I38A 2XMWA 2QV6A 4CTAB 1REVA 1ZM3A 3AJ2A 4FVMA 3U1NA 4NPOA 1SIWB 2HG4A 3PIOQ 3IAS9 5DGBA 1E6VB 4F3MA 2QE5A 2O01C 3THVA 2ZHAA 1RTIA 3NNHA 4K5SA 2QLWA 1LWCB 3JSMA 1LV5A 2V5HG 2QYCA 4WU3A 2NXUA 3E51A 3ZZPA 1S7HA 4DG1B 3DC2A