2OJ3A

Hepatitis delta virus ribozyme precursor structure, with c75u mutation, bound to tl+ and cobalt hexammine (co(nh3)63+)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
95
structure length
95
Chain Sequence
b'PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HDV RIBOZYME
publication title Structural roles of monovalent cations in the HDV ribozyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/rna
total genus 24
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oj3A00
2OJ3A 3G6ES 4UQTA 5BJRA 1YJWS 1O0PA 1SJ3P 3VAGA 1YJNS 1VBYA 3VAMA 3CULA 2DGQA 2EK6A 3VF0B 3NS5A 3NNCA 3SMZA 5LJ3Y 3IRWP 2D9PA 2RRBA 3CCUS 2AYBA 3CMAS 2ZJPQ 5EN1A 2PEHA 2KM8C 2D9OA 2KU7A 4WKRA 1X4BA 1ZZNA 2X1FA 1U6FA 2MKSA 5D78A 2KG0A 1BY9A 4FXWA 1DRZA 3CCMS 3S8SA 2MY7A 1K73T 2U2FA 1WF0A 1N8RT 2QA4S 1X4HA 1S79A 3G9CA 1SJQA 4LJMA 3VAKA 3FEYB 2YH1A 2DGXA 2F3JA 4TU9A 2MKIA 2MQOA 2DGSA 2CPXA 4F02A 1HL6A 1U2FA 5LXYA 5GAEU 1DZ5A 4OZ1A 1A7GE 1WI6A 2M0GB 1H2VZ 4ZKAA 2MMYA 2NLWA 3G4SS 2RS8A 1M5VC 1X5OA 5CXTA 2E5HA 1QVFR 1H2UX 4YB1P 1U6BA 2QFJA 1PO6A 1YI2S 2EVZA 3Q2SC 3U1MA 1KC8T 2KM8B 1R8PA 2MZTA 5DDQC 1VQNS 1X4AA 1SXLA 1X4GA 3EX7B 3J7YU 2F9JA 3MUMP 3S7RA 3BO3A 1JJ4A 3P6YC 2L9WA 2DISA 2MJUA 2MPUA 1U1RA 1IQTA 2KRRA 1UW4A 1OIAA 5DDRC 1X4FA 4IOCQ 3J7ZT 2VOPA 3P5TL 1VQPS 2NZ4A 1WWHA 2I38A 1QVGR 2MKHA 5D77A 2KN4A 2AD9A 4PKDB 2DGWA 4ED5A 3I55S 3BO4A 4V19X 2FPHX 2KXNB 3G8TA 3TO8A 3THTA 2YKAA 4U67Q 1K9MT 2CPDA 3PIOQ 2E5JA 3UE2A 2MSTA 1S72S 2HGLA 1JJHA 3B4MA 2MB0B 4W90B 3NS6A 2CPZA 1D8ZA 2KXHA 3DLLQ 1AUDA 2DNRA 2RQ4A 3BO2A 2EK1A 2E5GA 3ULHA 4PR6A 2U1AA 4Z2XA 3MD3A 1WI8A 1FT8A 2MGZB 1VQMS 1VC5A 1M5KC 1RK8A 2AYEA 2CQ0A 4TU8A 2FY1A 2MY8A 5MLCV 2CPEA 2KG1A 1X0FA 1A9NB 3LQVA 5CA5A 2MZSA 3BEGB 3CC4S 3VAIA 3NNAA 4M5DB 2G0CA 4ERDA 4EGLA 2DH8A 2DH9A 3G8SA 4OZ0A 1VQOS 2CQDA 5LXRA 5DDOC 1NJIT 2B0GA 5HL7Q 2N7CA 3CCLS 2MKCA 5DM7Q 3VALA 1WEYA 4YOEA 2GO9A 2VONA 3IWNC 1VC6A 2CPFA 2N82B 2LA4A 1D9AA 1Q81T 1WHYA 1YWXA 4CIOA 2XS5A 1H2TZ 2RS2A 2ERRA 1VBZA 1NO8A 1VQ5S 2G4BA 1WG4A 3MURP 2JVRA 4F26A 3CD6S 3P49B 2MSSA 4FXVA 5DETA 3BS9A 1JJ2R 5HO4A 1OWXA 2JWNA 1U1PA 2DHGA 2DNZA 2CQ2A 2RQCA 3CUNA 5LSLA 1WHWA 2M8DB 3EGZA 2LEBA 3MI7X 1YHQS 2XNQA 4IUFA 2V94A 3MOJB 1WF2A 1Q86T 1X5TA 3PIPQ 2M7SA 2MQMA 3ZZZA 2ZJRQ 2CPYA 4WF9Q 1N52B 2HGMA 2FC9A 3MUVP 4Y00A 2RT3A 1FJEB 1JMTA 1FJCA 1R8HA 4QU7A 1HD1A 2CQ3A 2AYGA 1M5PC 2RU3A 2X1BA 1L3KA 3CCRS 2HGNA 3U1LA 2OIHA 1CVJA 1DBDA 2YTCA 1QM9A 2MKJA 2RRAA 2KH9A 5JVGQ 3LPYA 4CQ1A 2CQPA 2CQBA 3CF5Q 1VQLS 3CCVS 2J0QD 2FHOB 1PGZA 1RKJA 2M70A 4LIRA 2E5IA 2HVZA 1U1OA 4WFAQ 3CCES 2HYIB 2F9DA 1XN9A 3MD1A 1WEZA 3OW2R 5DM6Q 2RVJA 3JB9k 2DGVA 1VQ8S 2XS2A 1YJ9S 2MGZA 3L3CA 3UD3P 2M88A 2LKZA 3N9UC 2LXIA 3VAFA 1B7FA 4UY8T 4WCEQ 3THPA 1VQ4S 1WELA 1UAWA 5IM0B 3D2WA 2L08A 2JVOA 3CXCR 2MZQA 2LQ5A 5H1SV 2YWKA 1UFWA 1YITS 2M4MA 5CYJA 2XSFA 2HZCA 2LCWA 2KRBA 3G96A 2CQGA 1SJFA 2O3DA 4W92B 1K8AT 4IOAQ 2G1DA 2MQQA 2DITA 1HD0A 2LA6A 2DNLA 1YIJS 4TU7A 3TYTA 1X4EA 2MHNA 2X1AA 1NU4A 3CCQS 2J76E 2K3KA 2KYXA 2LYVA 5JVHQ 2DNPA 1UP1A 3FEXB 4QQBA 3R1HA 1W2BR 2VOOA 2KHCA 1VQKS 3MUTP 1KOOA 3UD4P 3S01A 5LSOA 3H2UB 3VAHA 2JX2A 2LMIA 4CH1A 2DB1A 2DK2A 3P3DA 2MQNA 2ADCA 2Q79A 2DHAA 3CPWR 2OSRA 2DH7A 2MYFA 1DHMA 3H2VE 2N3OA 1KD1T 2OTLS 5FJ4A 1U1NA 1WF1A 1VQ6S 4WIIA 2MQLA 4TLQA 2ZJQQ 3G71S 4WFBQ 2CQIA 1HA1A 2RUGA 1U1QA 2DNMA 3SXLA 3SDEB 2SXLA 5GAGU 2MZ1A 2DIVA 3RW6A 2MXYA 1X4DA 3EGNA 1Q7YT 3B4DA 3CCJS 3UCZP 1SJ4P 1ZZFA 1KOHA 2CPHA 1WHXA 3MDFA 2CJKA 1VBXA 4C7QA 2DIUA 2FC8A 2M2BA 2BZ2A 4P6QA 2RNEA 3US5A 2DNHA 1X5SA 2DHXA 2DNOA 5GAHU 2DO4A 4BS2A 1M5OC 3K0JA 2M9KA 1FJ7A 5GVQA 4J5OA 2DGOA 1FNXH 3CMES 2N3LA 1X4CA 3R1LA 1VQ9S 1YTYA 5IM0A 2BOPA 1F9FA 3VAJA 2LXUA 2DGTA 2MZRA 2MKKA 4Y0FA 2A3JA 3S6EA 2CQHA 2KXFA 4C4WA 2KT5A 1VC0A 1P27B 2MJNA 2DHSA 1OO0B 2J0SD 3MXHP 3DXBA 1M1KT 2KVIA 3HI9A 4QPTA 2YH0A 1URNA 4RU2A 3NMRA 1SJRA 2CQ1A 2DNQA 3UCGA 3R27A 1WEXA 4A8XA 1ZH5A 3CCSS 3HHNB 2KI2A 2DNGA 4QU6A 2J8AA 3CC7S 1U1KA 2I2YA 1WTBA 4WFNQ 1FHTA 1U1MA 4F25A 4CH0S 1OPIA 2LECA 5LJ5Y 2DGUA 4C0OC 1P1TA 1G2EA 4PRFA 1KQSR 1N54B 3TP2A 5IQQA 2D3OR 2X1GA 1U1LA 2DNNA 2PE8A 1WHVA 3NNHA 2JRSA 1N88A 1M90T 2DNYA 2AYMA 2M8HA 2OTJS 3ZZYA 1X5PA 3V4MA 3RW7A 2CPJA 3SDEA 1FO1A 5GADU 2E44A 5ITHA 2DO0A 2UP1A 2XB2D 2LEAA 1Q82T 5DDPC 2ADBA 1FXLA 2VODA 2L41A 2K8GA 3UCUP 5GMKa 2DNKA 2KFYA 4LMZA 2WBRA 2M52A 3UWTA 3CC2S 2QEXS 2OSQA 2CQCA 3I56S 4IO9Q 2XS7A 2GHPA 1WG1A 3CTRA 2MQPA 3Q2TC 1WG5A 2CQ4A 1VQ7S 2CPIA 2XNRA 1H6KX 5IFMA 4YUDA 2MZJA
chains in the Genus database with same CATH superfamily
1KN6A 4LF6J 1Q5VA 2XI2A 4ZLLA 3NNCA 1RTIB 1JKHA 3KLGA 4LF8F 5CCMA 1I94J 2CDRB 1C4CA 3CJTA 3D6HB 1YVFA 3MGJA 1T03B 3S8SA 5KFTA 3VTIA 4M8LA 2AQ4A 1S9EA 5HK4A 3R6LB 3FMWA 5LL6d 1WI6A 4MIAA 1EHWA 2BRLA 3W61A 5A8KB 5L1KA 1UA0A 4WPAA 2AJ0A 1H2UX 4WZQA 1UJ6A 1ZETA 4YN3B 3Q2SC 2KM8B 5GAEI 1TK5A 3KLEA 1UA1A 2ALYB 2O67A 2XMTA 2HIQA 2G0JA 5GMEA 4UTGA 4ZVRB 3RG6A 1OS5A 3JQKA 4GO5X 1CEZA 4LVNP 1AXQA 1HBMA 3NBPA 2MB0B 1UFLA 3CJ8A 3UO0A 1Z1ZA 2HQGA 4X4RA 1U47A 4ZLJA 1EB0A 3IC1A 3PJWA 2J9EA 4Z2XA 1WACA 3BKUA 3OPKA 4MFBB 3H40A 1VQMS 1A9NB 1FFGB 4USTA 3DDKA 3KLVA 2J6TA 2WB1D 3HVRA 3IN5A 3DMJB 1JNRB 2CPFA 1DFDA 2B8PA 1RT3B 1S10A 5D3GA 2LLZA 2OH2A 1TK0A 1IKVB 3PW5A 1NO8A 3NXZA 4B3RJ 3EVMA 5KFSA 5DQGA 3CD6S 2MSSA 4FXVA 1OWXA 1N48A 4JOUA 4ZVGA 4CP5A 2V94A 4DZDA 4ZVQB 1U49A 8ATCB 3OLBA 1N5YA 1N52B 2HLUA 1GTHA 1H73A 3H5SA 3BGLA 4ZK7M 2G9OA 1YRTA 1HQEB 2VL1A 5ETOA 2J0QD 4DUZF 3ZTQA 3FZ2A 1NRKA 1FERA 1R6YA 1S1XB 4JI4J 4ECRA 1HQUA 2GO8A 3CJKA 4RLEA 3ILOA 5KFZA 2HIYA 3MM7A 4I6AA 3GV7B 4YY3F 3P8BB 2DBBA 4QIWD 4DU7A 3GPAA 3WBZA 4ED1A 4B9UA 1Y7PA 2LCWA 2OPSB 4FBTA 5LMNF 3CJ0A 1YIJS 4LBHA 2BJ1A 2ZD1A 4NLRA 5BXIA 3DOLA 2KHCA 3B54A 3OT9A 3UI3A 2B5JA 4JUZA 5IT0A 1GXTA 2DHAA 1WOSA 1U0HB 1UEVA 3C14A 1J2VA 1U4BA 3BBCA 2E66A 2EBGA 2GW8A 1S1WA 4IDKB 5IZHA 3LOUA 4ZVEA 2GGPB 1JK9B 2F4FA 1UPMB 2W7OA 3MR3A 3MEDA 3NGRA 3TWZA 4DV5J 1SH2A 2MZ1A 1MLAA 4OHXA 2HVIA 2MXYA 1VCTA 2FC8A 2GNKA 4G1PA 2KZMA 3O1LA 1MW7A 4J5OA 4OYAA 1Y9OA 1S4FA 1SB6A 5F8LA 2DGTA 4DL7A 3FC9A 3PEHA 1QY7A 4NE9C 1XMQJ 4M95A 3QGIA 3BQ1A 1RKIA 2E5LF 4CLWA 2VC0A 1R6VA 1URNA 4Q5VA 4DV7J 1JLFA 2QZ8A 1KTVA 2J6UA 3NCRA 1G2EA 4X62F 3TVYA 4K4YA 4J9OA 2XO7A 2PMZD 1IM4A 1NCLA 1HPZB 1EP4A 4DUZJ 3JSMA 3O2IA 1UETA 1YBTA 1B0TA 5HLFB 4BC7A 2Z4PA 3WC2A 1X5PA 3V4MA 2HFOA 2YKMB 3CWJA 1ULRA 1QSSA 1AT1B 2ADBA 3H5UA 2VODA 4DR1F 1FE0A 1RAGB 2QMUB 3DRXA 1U0SA 2DHHA 4I7FB 3UWTA 1BC6A 4PXCA 5HSPA 3I56S 1RT2B 1YDLA 2HEKA 1F2HA 2LU2A 4AT1B 1S59A 3HXMA 4QWAA 2OJ3A 4ITSA 1VBYA 1NKCA 1RLCL 1DLOA 1QE1A 2XHWA 4OIXA 2AYBA 1YJUA 2PEHA 3BPSP 3QFWA 4LUBA 3OL7A 2C2RA 4RBVA 4CLYA 1JQGA 3AT1B 4S0MA 1IBLF 3LGMA 3GIKA 5J2PB 2CPXA 2ATCB 4KGMA 2C2EA 2MMYA 3S1TA 4DLEA 5L8RC 1SXLA 2J0XA 2YWGA 3D0HE 3DRRA 4DV1J 4LRFA 3KLHB 2PI4A 2JJ4D 1IR2A 2MPUA 1R8BA 4CYUA 3EDRB 1GMUA 1ZA1B 2MKHA 4OHZA 4PKDB 1EIYB 3HPOA 1T02A 4A47A 2IRYA 3LP2B 1FA0A 1HNVA 4WKYA 3CDAA 2B4UA 3H20A 3T1YF 2CPZA 4C3LA 5LSRA 2ZBPA 4LF2A 1HBOB 5DGBA 1U2CA 2JEGA 1T9YA 1FFSB 2OEKA 4KJIA 1GMWA 4GVLA 5K14B 3BSNA 1T03A 1UFKA 3FRYA 2Y8WA 3MWBA 3N6LA 2DR9A 2EWHA 5KFEA 4FDFA 1VGYA 5A8KA 3VQSA 2G0CA 1OSCA 2JLEA 3GFHA 3AQPA 3A12A 3H90A 4CNZA 1HBNB 4U95A 1WHYA 2XLJA 4OJHA 3HM9A 1GXUA 1PYTA 3OBIA 4DSFA 2PC6A 3M8WA 4O3QA 3PZPA 4J9LA 1LOUA 4X4SA 4DV6J 3FCVA 5HQLA 2W7AA 2MQMA 2ZJRQ 3QJPA 2RILA 4KE5A 3SZ2A 3ENQA 4L73A 2P8IA 4ECYA 4DV0J 4LFBF 1KONA 4EK2A 4UOHA 1KR4A 4LFCF 2HYIB 2F9DA 1XN9A 1SVDA 4MFBA 4K59A 1KWMA 2LKZA 1N5QA 3JTPA 1U25A 2IM1A 2JH3A 2R2SA 2EG2A 2L08A 5KT5A 2YY3A 4LR9A 3NGTA 3VHQA 1ZBTA 1SJFA 1B64A 3DMJA 3MTJA 3J81j 2MQQA 1LWCB 2QLWA 1PKUA 1RT3A 2OELA 1M5SA 1X4EA 2A6OA 4QYZJ 4RUCA 3W2VB 2XMVA 3IWXA 5KFCA 2GJ2A 1CJUB 3DM2B 2A18A 3Q8SB 2FHJD 5B0AA 1S0MA 2ZITA 4IRDA 5LT5A 3IGNA 3HZGA 5D0HA 1REVB 2QTWA 4M5GA 3T6BA 3LP0B 3M7VA 4DQQA 2XZTB 3M6WA 1HQEA 2ZJQQ 3LF0A 2MEWA 3HFVA 3CT9A 2OP5A 4P10A 4DXLA 3RW6A 4DFPA 3ZTRA 2Z8QA 3N28A 3HP6A 1S1XA 1D9FA 4EBEA 3MDFA 2MTLA 3UD5A 4ZDNA 3US5A 5AE2A 5A0YB 3K0JA 1YGYA 2DGOA 3CMES 3NGKA 5F3ZA 3H59A 1S5ZA 2E9TA 2O66A 4J9SA 2KYZA 3NOGA 2KXFA 1VC0A 2EFPA 2IM3A 3MZIA 5DZ6A 4ZA1A 1LWXA 4UOFA 4FYXB 2UVWA 3NMRA 3HJVA 4CM0A 2EI5A 2DR7A 1DTQB 2C2OB 5CYMB 3D6TB 3DXSX 3UDVA 4MYUA 1U0HA 4C8YA 3TP2A 1T0TV 1XMOJ 3CD0A 1WHVA 3VQTA 2ZH7A 5I3UB 3DLGB 4IDKA 3D28A 1WUUA 3HULA 4RW7B 2GGPA 2Y1LB 2OTJS 1HHTP 4ED0A 4LFCJ 4IOBA 4DSIA 4O3SA 2FD2A 4D3GA 2YPYA 3KK1B 1IQZA 4K50A 4FKYA 3N4WA 5GADI 1XNRF 2QEXS 4RKUC 4CLPA 1ZAWA 4IO9Q 1SC6A 2OI2A 3DU6A 4KAIA 2GHPA 2F7VA 2PMWA 5D0GA 1VQ7S 2H5JB 4UQTA 1O0PA 3C16B 2DGQA 2RRBA 5EHHA 1O51A 5DZ7A 4CH7A 1LEOA 1FKOB 3BH6B 1IWAA 4N41A 1K73T 3NOCA 5J1PA 1HPZA 2VPXB 1S7HA 2NXCA 2MQOA 3DOKB 4RUBA 1VRUB 4WE1B 4DPYA 4OZ1A 2M0GB 3SSSA 1G6BA 3I0RB 5HLFA 4WZMA 3PRVA 2P6TA 4JI2F 4OYWA 2YKMA 1PYSB 1R8PA 1NSKL 1X4GA 3CJSA 3L95X 2YNFB 1R89A 2RMLA 3KLFB 2MLZA 4I7FA 4CWBA 2WCXA 1IQTA 1UW4A 4F7VA 1RT2A 4NXMF 1KQGB 4ANCA 2WRMA 5IQ6A 2C3MA 3D1OA 1K9MT 3PIOQ 1FDBA 2YWHA 3AHPA 3T9NA 1YJVA 3QATA 2KXHA 2UV8G 3QJJA 1N32F 2OPQB 3RBXA 3MM6B 1LW2B 4X84A 3M8ZA 4ID8A 2J9DA 5J2PA 4YDDB 1DTTB 3AODA 2BUNA 2PI5A 5K8MA 3CJ2A 5DM7Q 2Q6CA 4DV2J 4DV3J 3EGVA 4QWEA 2DCLA 3KLHA 3P49B 2XGQA 4J9RA 4A8YA 2CJQA 5LSLA 3QAUA 3PIPQ 2HGMA 2FC9A 3LP2A 2CQ3A 2AYGA 2UUAF 2X1BA 1NK0A 2CZVC 2YKQA 4NLPA 2VICA 1NM2A 3CCVS 1HBOA 3TUPA 1RKJA 3M2VB 1APSA 3IR7B 3J7Z5 3HMJG 2DJWA 1SIZA 2HW3A 5K14A 1WEZA 4RL1A 1B4SA 5DM6Q 4MMOA 1MWYA 2QA1A 4ETXA 1ICEB 2FUG9 2KL8A 2XMUA 1W7WA 6FDRA 2IYIA 4XK8C 1UAWA 3CMQA 2JVOA 2LU1A 3BR8A 4U7UK 4MKBA 5KG2A 4PXBA 2WW4A 2K1RB 2XM3A 2XSFA 2XY5A 1OJ4A 2AEMA 1HBNA 1UWBB 3W9JA 3VZIA 3BV8A 3R5DA 1I5OB 2KZZA 3EJMA 3R1HA 1VQKS 3HT0A 4NLQA 3MCOA 5F41A 1JWWA 5F8MA 1U45A 3DRPB 4RJVA 2ZBQA 4JV5J 5KT2A 1CJKA 2DRAA 5A8RB 3T5LA 3FMBA 1N32J 4DFKA 3GG0A 2ZFHA 5BYSA 3TA0A 2EC2A 2Y0SD 5K8OA 5E3QA 5MAOA 3OXGA 1WHXA 4TY8B 2RNEA 3FQKA 3POTB 1K0VA 4FS1A 1B7YB 4D3HA 3RAMA 3DYAB 3JAMY 4DHVA 2VQFJ 4NCBA 3RZAA 3UDCA 1P27B 2MJNA 4MAKA 3GJTB 2FVCA 2KVIA 2BQ3A 3ELHA 4USJC 1UVJA 4C0BA 3W2VA 1NHKL 3GR1A 3NS7B 1CJUA 3DM2A 3UW1A 2ZVSA 4M5KA 4RW6B 1TL4A 3GV8B 1REVA 2AJ2A 1SUQB 2UUBF 1S99A 3EXCX 3R7NB 2AX0A 3LP0A 4OYPA 1NZ8A 1NB7A 1XQIA 3EVWA 1Q95G 4F4XA 4BBYA 1N34F 4X64J 4ZITA 2D3O1 4MIWA 2AHOB 3T1HF 2HK3A 1HNWF 1R8AA 5A0YA 4JI6J 3DLEB 2MLXA 4PZVA 3VGTA 2E1CA 2DR6A 1WG5A 1KVKA 1UEUA 3HKWA 1R31A 3GTYX 2X3DA 5BJRA 1YJWS 2ZM6F 4FBUA 3AAWB 1Q16B 2B9EA 5AXNA 2KU7A 4WKRA 2CZ9A 1TL7B 3J81U 5CYMA 3ISND 3OUYB 4EEYA 3W66A 1TL3A 2MY7A 4OZJA 2VJUA 2ZZMA 2E1AA 2P9CA 4KIAA 1H3DA 5I3UA 1KBRA 3DLGA 4FVMA 3VCDA 4RW7A 1M5HA 4DR7J 5U47A 3N79A 1V5IB 1HNIB 3KK1A 2HBQB 3LGHA 3J7YU 4F4AA 1XNQF 5EWGA 2XCPA 1GX5A 3MUMP 2WOMB 3S7RA 2I0XA 4DOZA 3NP5A 5KG3A 2B7CB 2HZVA 1X4FA 4X4PA 1GQEA 1VHIA 2VOPA 1SQFA 2HAIA 4PWWA 4F0KA 1RLDA 4U67Q 3QGGA 2BW2A 1E6YA 3EXYA 3NLCA 3C16A 4W90B 2DEIA 1D8ZA 4Z7YA 3T5KA 1FKOA 4P2SA 1S9GB 5KG0A 5T7LB 1XERA 3RAXA 3M9OB 4J9VA 1TL1B 1PAUB 2EFOA 5D4PA 2ZH9A 2VDHA 3W9HA 4YR0A 1M5KC 4TU8A 1TUGB 3DOKA 5IT9Y 1XEZA 4WJBA 1HR0F 3BEGB 1VRUA 3AY0A 4WE1A 2XCAA 3IO1A 4KV8B 3I0RA 1S1UB 3FSYA 3DOMB 1PC4A 4F04B 3LO3A 3OR1B 4OYXA 2R7OA 3IWNC 2BRKA 1H2TZ 3SI8A 3KLFA 2DRBA 1G1XA 1S1VB 4XIUA 2CQ2A 2QRRA 2RQCA 4PYDA 1LKZA 4GC7A 1WHWA 3QT6A 4P2FA 3MI7X 4LQ9A 1XJWB 1WSRA 5E7OB 5G4DA 2CPYA 3FBCA 4YR3A 1RCOB 2WSEC 3A3OB 4NCGB 1HD1A 2ZDPA 2Q6BA 2P5VA 1CVJA 1SC4B 2B9WA 4RU9A 4CQ1A 3FCWA 4LRBA 3AD8C 4M94A 2RHSB 3OJSA 4RBUA 2DEJA 3BREA 1Y10A 3QQCD 1LW0A 2VZ9A 4JI3J 2OPQA 4QIGA 2V2QA 3CJ5A 2BJ7A 3MM6A 1J27A 1LW2A 4RW8B 3BM7A 3FK4A 2CJBA 4OZLA 1B7FA 1B0VA 3EDQB 1DTTA 4AXIA 5ETKA 1SC1B 2V8DA 1F2GA 1NJZA 4FP9A 3JTNA 3T5JA 3ET6B 2EBEA 3BSOA 4DR4J 1WKKA 4DL5A 3RB4A 1WKLA 2KYXA 3CE8A 4Y2IA 2Y1RI 3VAHA 5E3CA 2JX2A 2LMIA 7AT1B 3OHAA 4DL6A 1R0BG 3OSNA 2V8HA 5KT4A 5EGYA 2D1CA 4ZPAA 2R7QA 2RDJA 4WIIA 4DN9A 1RYSA 4TLQA 5DQIA 3VZHA 4NEZA 1FTRA 3M2VA 4UF4A 1KOHA 2LQ9A 2PFDA 4C7QA 3AJ2A 2ZH6A 4JYAJ 4ZCKA 5GAGI 1N0UA 1RWNB 3MEGB 4RUAA 2I1RA 3QZ7A 3VAJA 1JLEB 2Q43A 2HK2A 1ZM3A 1N5TA 1CG2A 1OO0B 3FGVA 5EWEA 1NMEB 1UWBA 4A8KA 4JI5F 1QTNB 2R7WA 3KJFB 3J80Y 2NXJA 4CH0S 1HQ2A 5LJ5Y 4QW9A 4ZLNA 4Q45A 3M6XA 3DRPA 4DQPA 1OPZA 5IQQA 2HQ3A 5L39A 3GV5B 3BSAA 3CIZA 1RB0A 4J91A 5A8RA 2J9CA 4MKVA 1HNZJ 1LWFB 3RBEA 1ROFA 2BBEA 1V3ZA 4IR1A 5AJ3J 4TY8A 4KYZA 3TUIC 2KFYA 2M52A 2ZBCA 2YWWA 1NHVA 2KKHA 1VIXA 3T5HA 4RNNA 3DYAA 2UUWA 4PPDA 4L3KA 4HL9A 4G3IA 4CLKA 2XNRA 2IMWP 2JDJA 3C3LA 4I4BA 3G6XA 3HSDA 5KFKA 4ZIVA 2RQMA 1S77D 2AIRB 2BKPA 5HMZA 2R9LA 2BM0A 4U7UD 2OFGX 2RD5C 2ZZNA 4RW6A 5I4MA 1SIWB 2QA4S 1S79A 1SUQA 4Q2LA 3FEYB 2DGXA 5IT9U 1AFJA 1H2VZ 4GO7X 2V8PA 4IFVA 1GAOA 1EQ0A 3CDWA 2JEJA 5AT1B 3JTOA 4K5SA 3LAKA 3SQOP 1BWEA 1CQMA 3GU0A 4OV6A 2F9JA 2GMLA 3RYLA 1SKRA 1NBEB 1T3OA 2H4YB 3MCMA 2R8IA 2JL9A 3DLEA 1V9OA 3M8QB 2QA2A 3IM8A 2NZ4A 4NLSA 2W4PA 4U9RA 4B08A 2FLLA 4DPOA 5CZVA 1VDHA 3PW7A 3NS6A 1HMVB 1AUDA 2IY5B 1TL7A 2E1RA 1TUWA 3OUYA 4YR2A 5A76A 2BE7D 3MR5A 3LA0A 2HHWA 3A8KA 2N4CA 1RI7A 4DR5F 1WD6A 4DR3F 3MFIA 4ED3A 2IJNA 2JLFA 2R8GA 3SSQA 3G8SA 1HBUB 2MKCA 4CT9A 1HNIA 2B4VA 4LQ3A 1B99A 1CLFA 3KLIB 1WG4A 4F36A 2R2TA 4U6PA 5DETA 4OYOA 5HO4A 2JWNA 1AFIA 3CUNA 3D6MB 1SKSA 3MOJB 3PG9A 2QLFB 4WF9Q 4Y00A 2V2VA 4YMEA 4PWUA 3TZXA 3GP9A 5HBMB 3SIPB 2QL9B 3NGUA 1S9GA 4C8ZA 3C6UB 2C22A 4MK7A 5DG9A 2HHHF 3MMJA 1TL1A 3TZZA 3OV7A 2KDOA 2HHQA 3HK2A 4P74A 1RTZA 3UQSA 4N77A 1S1UA 3DOMA 2M4MA 1YLXA 3OR1A 3R8YA 2WW8A 3HSGA 2L48A 3Q8YA 1VMBA 3K5OA 3LH2S 5KT7A 1S1VA 1E6VB 1S6UA 4OZ5A 1HHQA 2RHQB 3GIMA 3PR4A 1FRXA 1HYSB 3NL0A 1RTDB 2FLPA 4CO1A 4NCGA 4W4MA 1MN9A 1SQEA 1JXLA 4NPOA 4ED2A 1VQ6S 4NWBA 2W9AA 3PX4A 2HMIA 2CPHA 5F8IA 2LFVA 4RW8A 1I6JA 5HAOA 5GAHU 2QA4G 3HZEA 1DARA 4IRKA 3R1LA 4WIQA 2F4VF 1Z2LA 1EKSA 4WFZA 4Q0BB 4ZN3A 2NSCA 3ET6A 1UVLA 4NLUA 3B78A 2UV8A 5LMUJ 1HKAA 2BJ9A 3R5BA 4AQYF 1T9UA 1RBOB 1IXKA 4G6VB 1NEEA 3GFXA 3H98A 3KJNB 2J8AA 1D3WA 1RAHB 1XR7A 1WJ9A 4RBTA 2LECA 1YJTA 4C97A 5H9FK 2GX8A 3F73A 3TUZC 3D6FB 2XSJB 4I68A 3TAMB 1M90T 3NGDA 3KMQA 4CO2A 1UJ5A 5B0EA 4DR2F 1XR5A 4JBCA 2DRDA 1UPPA 2OAUA 1Y4ZB 2UP1A 3BPDA 5L1JA 2UU9F 4KPCA 5B08A 2YX4A 2K8GA 1C1BB 2DNKA 3M2UB 4QIVA 1RHKB 2W8LA 3W9IA 2KJWA 1LK5A 3MEGA 2DR5A 1UCNA 3HFKA 4DU8A 4J9QA 1JLEA 1OYDA 5IS2A 2R8KA 1H38A 4K4ZA 3QWUA 1WNEA 2G2YA 1S6PB 3H42A 1F1BB 1HW8A 2YPZA 3VAGA 4WWSA 1RWUA 1PYOB 4DFJA 3NS5A 2H4WB 3SMZA 3TR5A 2NYHA 2ZJPQ 2N4DA 3RGIA 2E29A 4TXSA 2NS1B 3FBBA 3EZ5A 4CLUA 2B6AA 3N5BA 3ZZRA 4ECZA 3SSRA 1SJQA 4LJMA 5EUHA 2CNOB 2V8GA 4YEAA 5GAEU 2FYXA 3HHLA 3KDOA 1RWMB 1QSLA 1JLGB 4DR6F 1FRMA 2JLGA 4QZVB 3M4XA 3PKMA 2ASLA 1NK9A 4PQUB 3AOAA 3BDPA 3I32A 2VPYB 2R7VA 4RZRA 2KTQA 1IKYB 3RRKA 4CDIA 2WVBA 4ED5A 5HJXA 3M6UA 3THTA 2R7TA 4OLOA 1RWOB 2OGUA 3HSZA 2PA3A 4ECXA 3D68A 4PCQA 1LV5A 3SFUA 4LF9F 2QFIA 4B9TA 3CW2C 3ENAA 3H4BA 3M8SA 1VC5A 2KG1A 2AP6A 5HANA 4QOTA 3CC4S 4DR2J 4ED6A 5KFXA 5F8GA 3OL8A 2N7CA 3LP1B 2AEJA 1PAEX 1F5BA 5D8HB 1WORA 1IR0A 1F6TA 3A8EA 2RS2A 1OY9A 2V0NA 2XY7A 1V3RA 4XTTA 3M8QA 2M8DB 1TV6B 4N47A 2R2UA 1WDTA 4WK3A 1JLCB 3L09A 1IBCB 3UFCX 4NRTA 2YNGA 1HMVA 1IBKF 3QNWB 2PEBA 2AKWB 3TZWA 4AFFA 4TKTA 3HHLC 2EFGA 5KOXA 3JB9k 2UUTA 1P1LA 3SCJE 3L3CA 3M05A 1L3VA 1S4EA 4WCEQ 2QV6A 4ES2A 1YX2A 4R25A 2PFFB 1TK8A 1HBUA 4WTYA 1NUEA 3MAHA 3M6VA 2B4OA 2OHDA 3KLIA 2GVZB 4AL7A 3FEXB 3OJUA 1KOOA 4JI7F 4C9DA 1MMDA 5KFVA 1UZHA 1UWAA 1T7PA 1F0XA 1OQ3A 1IJEB 5BR8J 2MQ8A 2G13A 1W2IA 2ZBRA 3TJ8A 3UR3C 4ZVSB 5HBMA 4Q2MA 4U8VA 2W9BB 3C6UA 4OI2A 4EFAC 1U26A 2XTJP 3ZFVA 1XK8A 2VF3A 5M2UA 2JHEA 2AT1B 4L6V3 2M9KA 3DLBA 4K4UA 2V9KA 4XDDA 2GAGC 2GS8A 3RB3A 2UXCF 2G1HA 1NK4A 4F4ZA 1NKEA 2C2MB 1WSVA 3V6HA 1IWGA 1M1KT 2ZH4A 1N5SA 3DLKB 1A0OB 4L3NA 3D4JA 3K5MA 1HWJA 4NLOA 1E6VA 5CYQA 3C19A 2R7UA 3DLJA 1FXDA 1FEEA 2RQKA 3BB5A 2DGUA 4C0OC 1U09A 2DTJA 1KQSR 3AH6A 1NDPA 1HYSA 1RTDA 3QLHB 3W5ZA 3Q8VA 2ZUAA 2ZKUA 3GZ7A 2W4CA 4DUYF 2AYMA 2BACA 5FLXU 4GRSA 2ZOMA 3BF4A 1FRHA 5ETRA 2LEAA 2Y3YA 3HHDA 3KDNA 4M5IA 1B70B 1N33J 4E0DA 3BGOP 5L46A 1HFEL 2RF2B 4JI1F 2ASJA 2IMOA 1F5AA 1LWEB 2OSQA 3C6TA 4M63A 1GMWD 5F9NA 2UUCJ 4LT6A 1N4LA 2XS7A 3OTBA 4Q0BA 2FTRA 4PXEA 2HFUA 5F8NA 1FNOA 3VF0B 3BN4A 2EPIA 1BGXT 1Z4UA 4IR9A 3PYGA 3OTDA 3V5RA 4J9UE 4B3SJ 3UVJB 5HI7A 3M8YA 1U6FA 3VWSA 2W01A 1T8EA 2BW7A 3CCMS 2ACYA 2OMLA 3D0GE 1EQMA 3QRRA 2BV3A 2VBYA 1RT5B 1UEKA 2G2ZA 2XSJA 2MHEA 2ZHBA 4NEYA 1QUVA 3TAMA 3I87A 2D3UA 3C14B 4WP8A 4NA3A 5L9XA 1XWLA 3R9LA 3C15B 4IRCA 2AW0A 4DQIA 3O6QA 1C1BA 3C46A 1ACMB 3M2UA 3IFEA 2BOAA 1YJ7A 2Z0GA 4J90A 4FF1A 3LTOA 1Q53A 2KN4A 3QWPA 2W8KA 2EKNA 2FZCB 1PCAA 1S6PA 1IM6A 3A8IA 1ZAVA 3E8OA 2FJVA 1SL2A 3BN7A 3QGPA 2DNRA 2RQ4A 2L9NA 3MPWA 2U1AA 4DCPB 4H4OB 4JI0J 4LF6F 3CD7A 4YQWA 3BYRA 1P6TA 3MM9B 3MF5A 2LEPA 5CD4A 1X0FA 2PGCA 2WB4A 1I94F 5CA5A 1F9EB 3DI6B 4YP3A 3KOAA 1R0AB 1L5UA 4DSEA 4K7QA 4ECTA 4WXWA 1JLGA 3VALA 1WEYA 2PN6A 1SJ1A 1NH8A 2GJIA 4CIOA 2IBKA 4JI1J 2OLWA 1T05B 1HWKA 4DN0A 3FBFA 1IKYA 3IA0A 4CO4A 1HWIA 3HD2A 4YHHJ 4KBIA 3QMQA 4EBCA 2GQCA 4E2FB 2ZKTA 4LF1A 2RAQA 2KJVA 1Y11A 1XBWA 3D54A 3R5JB 3F44A 3CVKA 3QSYB 3UDEA 5H9EK 2M70A 2E1MC 1MN7A 2K7JA 4NLGA 1K0TA 4CO0A 4IQMA 1K1QA 5AXKA 2BABA 4I64A 4ZCMA 5I3PA 2RE1A 3K5NA 3THPA 1ELOA 3EVOA 4GKKF 4JV2A 2YBVA 1RWWB 1KFSA 1RTHB 5KG4A 2NUHA 1KTQA 4QQBA 4C8NA 2VOOA 2L3MA 5IWAF 4UZBA 3UD4P 2WONB 1Q8KA 1UKUA 3HD1A 2DK2A 2QLJB 3Q83A 4C6AA 1TV6A 5HMYA 5DRKA 4B3RF 1KD1T 4F4KA 2B4PA 1JLCA 2R4FA 1WF1A 3DRYA 4K4TA 3VV2B 2ZH2A 2L9DA 2NSBA 1TMMA 1HNVB 1SV5B 2XO6A 3EGNA 1Q7YT 2A2DA 4BDPA 2CJKA 2DCUB 2X51A 2DNHA 1L3TA 3SQGA 3SCKE 4ZJLA 4IG3B 5T41A 3PVXA 4KHRA 1O6XA 2Y8YA 2N3LA 1YBAA 4WP9A 1CPZA 3CDBA 4LSNB 4LRAA 4JI4F 5E0OA 3E3XA 5F3TA 5K9FA 3ZZTA 4LF7J 2O1PA 4EI2A 4P73A 2E7WA 5KAKA 3W64A 5HMWA 2GVZA 4UY85 4QU6A 5B0FA 2QLXA 2QG9B 4MH8A 3ILJA 1JX4A 5B0DA 3O3LA 4OX9J 3L7OA 5KFQA 4KTQA 2POKA 3SEOA 4NYOA 4Z37A 4DS4A 3KHGA 3TEHB 1PILA 3VGVA 4Q43A 4A8SA 2KO1A 1RHUB 5DG7A 4RW9B 5GADU 4V1Ak 2W9BA 2E44A 3MAAA 2VA3A 3WX4A 4JI8J 5KFRA 5D0EA 3EZOA 5E3RA 2XLIA 3QO9B 3PM9A 1KLMB 4DV5F 4HDGA 3T19A 4GKKJ 1TKDA 3CCWA 1HI8A 2XWYA 3NEKA 3V6JA 2CIMA 3DLKA 2CAJA 1SJ3P 1YJNS 2EK6A 2ZC3A 5LJ3Y 4X66J 5IWAJ 2IJFA 2C2NA 5EN1A 4DPTA 2D9OA 4FVCA 3THVA 1XMQF 4FNIA 4DV7F 2C3OA 3QLHA 4PXDA 1P9QC 4AXJA 5LXYA 5J2QA 2BM1A 5IOLA 4LF4J 3KHHA 3PDNA 1X5OA 3GG1A 2WSCC 3OXLA 4DSLA 5L1LA 3AA9A 4YS2A 4OQJA 1RADB 4WU3A 2A6MA 2LQJA 3K7RA 2RF2A 2DISA 2D7SA 1LWEA 2VFVA 2IAJB 4FF3A 5D77A 2VG5B 3GFYA 2HHVA 1DAXA 3GR0A 3MMCB 3HFZB 4ZP8A 3GYGA 3R2DJ 3RBZA 1QDUB 2GIRA 4NLTA 5K5MA 4DF4A 2WVCA 5D0RA 4N8OA 3UVJA 4PR6A 1J5EJ 3GJQB 3X3UA 4N7TA 2OKQA 2BA9A 5A2QU 4X2BA 3LANA 4TNOA 1RT5A 4OZ3A 2E7XA 5BYRA 1CSJA 4GMKA 2HRYA 4NL5A 3PYDA 3NNAA 3KHLA 5HP1B 2XQCA 3BBBA 4OZ0A 4YB5A 3K59A 3C15A 1CC8A 1MWQA 4DMZA 3QIPB 3CCZA 2XLKA 2VH7A 3FZBA 3K17A 2B8QA 2XNQA 4FZVA 4DEZA 3PRBA 2HS3A 2J7KA 1K47A 2HQFA 2VKZG 4DV1F 4GC6A 3SV4A 3CCRS 2HGNA 2D41A 3U1LA 4TQRA 3G2XA 2CQPA 1RAFB 3R6GB 3V6DB 2UXDJ 4QIEA 4CLSA 4IKAA 4F0HA 3T3FA 4H4OA 3IWLA 4Y6IA 3KG0A 3MM9A 3VAFA 3Q23A 3KTQA 1RBAA 3DI6A 8RUCA 3R97A 4O23A 4KRWA 3T6JA 1JXVA 2C3YA 1R0AA 1SL0A 1RHJB 1IKWB 2KRBA 4OX7A 3IG1B 1S97A 4IOAQ 4C8OA 2GCFA 4OL8A 1NU4A 3CCQS 2LYVA 4ZMMA 1Y3JA 3S01A 3DDIA 1T05A 4I2PB 3AJDA 5I42B 4B02A 1UZDA 3I9V9 4O4RA 1EKRA 2BQUA 1RXOB 4LF5J 3H25A 3G8QA 4LR7A 3KHRA 3TJAA 2N3OA 2RJZA 3I6PA 3ENVA 4EYHB 4Q44A 2DKOB 4OJGA 5JJBA 1YKWA 4DV6F 1U8WA 2GQ2A 1AB8A 2V50A 3G86A 4DPUA 1KP6A 2ZVIA 3SXLA 2WVFA 4NLXA 1X4DA 4DV0F 3B4DA 1MNEA 1S6OA 2CNNB 2Z2ZA 4AYBD 4CM2A 2BZ2A 1X5SA 2YWFA 1FJ7A 2VDIA 2CVEA 4K5RA 1YTYA 3K2YA 5KFMA 1XR6A 2YQ3A 1FK9B 4PYAA 2FJAB 4Y0FA 3J7A1 2CQHA 4RW4B 3W2WB 1BD6A 1TKZB 1JLAB 3AOBA 5KG6A 4OLPA 1QJHA 1RTHA 5ETNA 4RU2A 2CQ1A 2VPWB 3RBDA 2FJBB 5H9FJ 2QIFA 2IVYA 3IGVA 2GIQA 4A8WA 2EC0A 4HT5A 5E41A 5C7PA 3RR7A 2WONA 3PY8A 3CD5A 4YDXA 4E98A 4PG5A 4USMA 2VBXA 3IR6B 3D66A 2D3OR 1U1LA 2AGOA 4HH1A 3IAM9 2HRTA 2JRSA 2XBPA 2C2DA 1RDRA 5ETLA 1QAYA 1BQXA 1FJGF 1H7XA 1SV5A 2DO0A 4NZ6A 2FJEB 3PHEA 3A3NB 3UNGC 1YRUA 3PW0A 2Z2YB 4IG3A 5EX0A 3TVKA 4KSEB 1XIQA 5DGAA 3OTCA 2VG6B 1Q1KA 2RKIB 4UZCA 4LSNA 3WQPA 1WG1A 1RQ0A 3CTRA 1NSPA 4CLFA 4QWBA 2MZJA 2Q1LA 1RHQB 2HHUA 4Z7CA 4MKAA 3CMAS 5F0UA 2YNIB 1CBKA 1N0VC 4CTAB 1ZZNA 1N56A 2ROPA 2DVIA 5L1IA 3PO4A 1KSPA 2PO4A 1KS2A 4R5PB 2EFQA 3M30B 1WF0A 1FTCA 2I5JB 3T1AA 1RABB 4ZCLA 4C0HA 3VAKA 3H8YA 5I3QA 1PC5A 2OPRB 3NWRA 4R0EA 4PEOA 3N0VA 2XULA 4G65A 2CFXA 3WC0A 3GONA 3FEZA 4RW9A 3QPIA 2EVZA 4DJBA 1CJKB 4BLGA 1XMOF 1RAJA 5DDQC 1NDLA 1OMSA 4WTOB 2C1EB 1R8CA 4URQU 1YZ7A 3QO9A 4U8YA 1GK8A 2L9WA 1KLMA 3VGSA 1Q5YA 2UXBJ 3BH7B 2AD9A 3OL9A 2ILYA 2DGWA 4QR2A 3I55S 3BO4A 4O3OA 3KK3B 3V81B 3MMAB 5THWA 3DGPB 2J6SA 3BKFA 3SCIE 2V4JB 3HT3A 3QFHA 2GJFA 5DJBA 2BDPA 2XWXA 4WU2A 4QPXA 4X65J 3G6YA 1PBAA 3BGRA 4OHWA 1RT1B 1MROB 4AL6A 1FKPA 3AA8A 1RK8A 4NA1A 3T41A 4OYMA 1QAJA 3TEGA 1FJGJ 3MR2A 2XG8A 5HQMA 4PQAA 4M5JA 2Q3PA 3X1LB 2FGOA 2DH8A 4NA2A 2CQDA 4IO1A 2C2ZB 4OHVA 1D9DA 3RJMB 1Q81T 2VG7B 2QC3A 1Q78A 1FD2A 4ZHRB 2HFZA 3BS9A 3CGIA 4F67A 2IAJA 4NI2B 2DT9A 2VG5A 4J37A 4DX5A 3BQ2A 1FDDA 4DX8H 3MMCA 1ZPVA 4ICLB 3CB4A 2YTCA 1QM9A 1FE4A 4I1TA 1S9FA 5K8PA 1NJXA 2F1FA 2RDIA 2HFNA 2MKYA 2XYHB 3TAPA 1S6QB 4DQSA 2VFSA 3OR2B 3EPIA 1VQ8S 2PMHA 3UD3P 1RWVB 2HBRB 4I67A 5JXSA 1H98A 1TL3B 3M9MB 3LWLA 4UUWA 5HP1A 2YWKA 2WVDA 4USHA 1WC4A 2ZNYA 4ZPVR 2AZ3A 2ATLA 4NOHA 2JC1A 3QIPA 1RHRB 2FHMA 3MR6A 3V4IB 3H2UB 1VQSA 5KFPA 4DDFA 3P96A 2VBZA 3TX8A 3RU0A 2PDAA 4DV2F 3FSXA 1SL1A 4DV3F 1TQLA 4HVZA 1FWLA 2HPUA 4KH1B 5KFGA 1PJ5A 3K58A 4LRDA 3G71S 5K20B 1C2PA 3SDEB 1E6YB 1WC5A 5GAGU 3V6DA 1IKXB 4OI6A 3TUJC 1RGVA 4MJKA 2QLBB 1ZZFA 3U7JA 1VIOA 2DHXA 1N36J 5KG7A 2DNOA 2F63A 2E9RX 2K7KA 4OV1A 1TFWA 3NCPA 3S6EA 5HN0A 5IC4B 4DUTA 1IKWA 5ETSA 5HVFA 3IG1A 4ZVPB 2NUUG 3HI9A 4QW8A 2HHPA 2I2YA 2B9YA 4WFNQ 4F25A 4I2PA 3PNIA 5I42A 2HBYB 1RISA 5DS7A 1C0UB 4NXNF 3UR0A 4B9NA 1NPPA 1YZ6A 3C2PA 4K4SA 2Z57B 1RWKB 1UVMA 2HFVA 4ZOSA 3L7PA 1L3SA 2ZC4A 4URGA 3TVZA 2FHKA 1KNZA 3QT7A 4LFAJ 2BKNA 4JV5F 2FLNA 3PHTA 2NXEA 1LW0B 3M8PB 2FVSA 2PT0A 3PXGa 1Y5LB 3R3TA 3DNCA 1FK9A 2ZZTA 1CJVB 4EU0A 5EX3A 4B3TJ 4RW4A 2LXFA 3W2WA 2CPIA 1TKZA 1JLAA 4BWJA 2FJWA 1FD8A 4ZPWR 4O0NA 3N6MA 5D6GA 2VQFF 1X4BA 3RUBL 4ZVHA 1BY9A 1DRZA 2HWTA 3VVTA 4J9NA 4PUOB 3I31A 3MEKA 2D3ZA 3Q89A 3OVBA 4K4WA 3AD7C 3JXOA 1VRTA 3W60A 1DZ5A 1A7GE 2NXUA 5E5NA 1VJWA 4FNHA 4OYZA 5CXTA 4ES3A 3D7SB 1TU0B 3I82A 4B3MJ 3FRZA 2YQ1A 1YRXA 2W2MP 3DFEA 3A8JA 2ZUGA 2VV5A 3H0PA 1U1RA 2KRRA 4X64F 5E33A 3ETOA 5DLGA 2VG6A 5CAAA 5B0CA 2BQRA 2RKIA 1S49A 2GMJA 3VGUA 4ILLA 2HFSA 2AV5A 2FPHX 1OY6A 4W98A 1IR1A 3W1YC 4JI6F 3UE2A 5KFUA 5KFIA 4EO6A 1JJHA 2IVFB 2GA7A 2IBOA 3RB0A 3DGVA 2YNIA 4CTAA 3M1VB 1RUSA 4NXNJ 2OEJA 3GJSB 3PJXA 5B0GA 4R5PA 1EETB 2BJEA 3M30A 1RTJB 4DV4J 2I5JA 3ITHB 3I4PA 2MY8A 2OPRA 1NDKA 3D5MA 4YB6A 3HVAA 1VQOS 1IUJA 3BKTA 2OPPB 3UN2A 2N82B 2IC3B 5AXMA 2XS5A 1KVIA 1H7WA 1UVKA 1C1CB 2VASA 1JJ2R 4DR7F 3N5FA 1RA6A 4BCAA 4ER8A 3KK2A 4RWXA 3G6VA 3KK3A 3V81A 2A10A 1FJEB 3MMAA 1CJTB 3TZYA 5H9EJ 1JMTA 3RRHA 2E7VA 4MK9A 3DGPA 3PCOB 1NPKA 4KT0C 2MKJA 2V4JA 3CF5Q 1VQLS 3RRGA 4LIRA 2HS4A 4DSKA 1TKTB 1RT1A 5DLFA 4FN5A 1MROA 2DPIA 4F3OA 2LXIA 3PR5B 2HSEB 2AX1A 2ALZA 1FWKA 4IH5A 5F8JA 2MZQA 4A8FA 1F3VA 2YKPA 2HZCA 3OFGA 3G96A 2BE9B 5AE1A 2G1DA 3JSBA 2DNLA 2IDEA 2VG7A 4IFVB 1JJCB 4X4UA 3B6BA 4L75A 1UP1A 4ZHRA 3SYZA 3EE3A 5KG5A 2C3PA 4TYAA 4CH1A 2BE2A 4NI2A 4JV0A 5DG8A 2H54B 2FQQB 5G0RB 2Q79A 4EO8A 4DF8A 2GMHA 2F8EX 3H2VE 4BHQA 4R8UB 4FS2A 3OTEA 2RB7A 4ILRA 4ICLA 1WOPA 3C66A 1RAOA 2AJ4A 2R3VA 5AXLA 2DNMA 3KG4A 5ADZA 4ANEA 2SXLA 2AF6A 2VFRA 4L76A 3R7BB 1I1GA 3CCJS 3B8HA 1SJ4P 1S6QA 4A4JA 3OR2A 4ZP9A 2RH3A 2CNLB 2F5GA 1RT7B 4LF8J 3RB6A 2K3IA 1R7IA 1PJ7A 4JI3F 1HI1A 4ED4A 3MXHP 5FIIA 3C8YA 5ETPA 1R43A 2PA8D 4IH6A 3ZNJ1 1YJRA 4ENOA 2XGPA 1SJRA 4NMXA 2C42A 2HQIA 3HHLD 2DNGA 4QWCA 3FFIA 1NK7A 3PACA 5IT4A 3V4IA 5SUHA 4RX6A 4EBDA 4DR4F 2DNNA 1J5OB 3OLAA 1MWZA 1P8GA 1RU1A 3ZZYA 4C48A 2XC9A 2CPJA 1QTMA 3CSKA 3SDEA 4O0IA 1IKXA 3NKYA 2EG1A 2FY8A 5IV3A 5KFLA 3UCUP 2GVDA 1HI0P 5JMNA 4O4GB 1FESA 3QBCA 4WBFA 2WSFC 2JEIA 4NCAA 2Q66A 1Y00A 4PG7A 3N6NA 3ETMA 3IXQA 3Q2TC 3RAQA 2CQ4A 4HTIA 4USVA 4JYAF 3U02A 3ZTSA 3LWMA 1PSDA 1T94A 3G87A 3CULA 4P75A 4M5NA 1UVNA 2CYYA 1MMLA 1TP7A 3PKYA 2KG0A 2UVVA 1FXRA 1KLNA 1C0UA 3H2LA 2CUYA 3MECB 2F3JA 2MKIA 4F02A 5M2PA 4BC9A 4URSA 3NAHA 2HZAA 1NPRA 2B43A 4TN2A 1U6BA 3SBMA 3FBEA 1VQNS 1S12A 1MG7A 2VHGA 3QIDA 4M5HA 1KDNA 4FF4A 4F2SA 2F8HA 4HYKA 3V2UC 3M8PA 3MPUB 5DDRC 2HMIB 1HNZF 4IOCQ 1KEKA 1CJVA 4DFMA 6AT1B 2LDIA 1AA1B 5AJ3F 4LSZB 4V19X 4OMFG 2KXNB 3KMSA 2YKAA 4ZCIA 3JAMU 3A1YG 2MSTA 2V4RA 3O8WA 2YVSA 1S0OA 4OFZA 4YY3J 3BO2A 4BWMA 5CCLA 1DQAA 4FXDA 1YQHA 4PUOA 3MD3A 4U96A 2AYEA 2JEFA 3PFEA 5LMNJ 2FY1A 4JP8A 2IRUA 1GH8A 2LQBA 1CS4A 4M5DB 4ZVOB 4FF2A 4ERDA 2B0GA 1H72C 4F3MA 1SKWA 2ZH8A 1TELA 1VC6A 4KHMA 2AJFE 4XPCA 5HVHA 4RNFA 1DY3A 2CZ4A 1GTEA 4ZVUB 2NQPA 4LR8A 1FF2A 3ZZZA 2ROEA 3LUYA 4FKXA 2COLA 1RT4B 2RU3A 1M5PC 5A6PA 4K0KF 2CJXB 2XMKA 3HHEA 2YNHB 4ED7A 2YQ0A 3M1VA 2XYPB 2A2CA 2E5IA 3CCES 4KFBA 1TVRB 1EETA 3KKFA 1RTJA 3QYYA 3OTOF 2E5LJ 3ITHA 2FZGB 2M88A 2OO4A 3TX0A 1OY8A 2B6AB 2QL7B 2LP4A 2HVEA 1FEHA 2ZH5A 1R3NA 1RTIA 4KGVB 4ZJOA 2V4QA 4KGZB 3DN9A 2OPPA 4I2QB 3HX9A 4W92B 4DWIA 2DITA 2IC3A 4X62J 3HHLB 4TU7A 2APOA 2KHDA 3GIIA 2DNPA 2F8MA 1Q8LA 1C1CA 2HG4A 2KFZA 4NASA 1NHUA 3LW5C 4UT4A 1DHMA 2H51B 4DG1B 1CJTA 5KG1A 2OTLS 1SCJB 1U1NA 5CHCB 4DR1J 4PG8A 5HVGA 1BHNA 4L72B 4QBUA 5C25B 2RUGA 5KFHA 1SQGA 2ZWPA 3KYLA 3O5TB 3GYNA 2R7XA 4N56A 2B3TB 3GB0A 2G2OA 1TKTA 4HEA9 3TARA 8AT1B 4ALZA 5B09A 2IYGA 3IP0A 5L38A 1JB0C 4LBIA 3K89A 3R5GA 4LIWA 3KNAA 4ZS6A 1IBLJ 4TY9A 1UL3A 3TA2A 2LDYA 1WTBA 4K2XA 1IJFB 2RDDA 3ZTPA 4RNMA 1VHFA 2WBMA 3MR7A 2ASYA 5G0RA 1N54B 5CABA 1S7IA 4ZPDA 1T11A 3R5AA 3TRGA 4K0KJ 1LK7A 4R8UA 3W63A 2ZHAA 4N8NA 3GYXB 4HR2A 1SH3A 2DNYA 2PD1A 4LSLB 2K2PA 2FDNA 1IKVA 3W5XA 2HQDA 3R7SB 2PIIA 5HMXA 4USUA 3OTOJ 1K44A 2YNGB 2XB2D 1NK6A 4DL4A 3PW4A 3QAEA 4OJ1A 2FJDB 4ETZA 2BJDA 3JSYA 2YX1A 3CC2S 1VQYA 1RT7A 2VUGA 5KFJA 2CQCA 5JUMA 3T1YJ 4QR0A 1AROP 1YBUA 4WP3A 1GXLA 5IFMA 4YUDA 4UOCA 3G6ES 4IG0B 3VAMA 4F2RA 1T9VA 4KY3A 3MFHA 2KT3A 4C8LA 4LBPA 3ZZPA 2KM8C 3FSIA 3WX8A 4P7VA 4HH0A 2V2ZA 4ED8A 4FYWB 5LMUF 4FXWA 1HNXF 4ES1A 5CD4H 1AW0A 1J5OA 2Z58B 4ZLPA 3OHBA 1HL6A 2OPSA 3B82A 2W1BA 3KG1A 1EZZB 3R5CA 5C2GA 4HKQA 5KFNA 3NAIA 3AB4B 2V8VA 3DRSB 3BO3A 1JJ4A 1TZ0A 4O4GA 4LFBJ 2RU9A 4RUHA 4ELUA 4ZVTB 3J7ZT 1VQPS 4MYTA 3DDNA 3K57A 5IC6B 1FVSA 1U02A 4ZP6A 3G8TA 1RT6B 3OQ2A 2A1BA 3H4DA 3KNGA 4MK8A 4OZNA 2ZHOA 4HACB 2QGFB 2CJAA 1RWPB 2E5GA 2QYGA 1Q79A 1LFWA 2ZH3A 3I5BA 2CXEA 3CJ3A 4WXOA 1FT8A 5CYQB 3J80U 3W65A 3UN3A 1OQ6A 4HLBA 3MECA 1QSYA 1M1GA 5KTQA 4ELTA 1VRQC 1WC1A 4EGLA 5LXRA 2EFNA 3PEJA 2P2CB 2VD3A 1T9WA 4UW2A 2JZ5A 2QX0A 4ECWA 1V6HA 1BE4A 1D9AA 2HS0A 1YWXA 4AL5A 1BXNA 1BQNB 2ERRA 2G4BA 3MURP 2VU5A 5D4OA 5J2MB 1WKJA 2DHGA 2DNZA 2XY6A 3HSJA 4DCJB 2QO3A 3MM5B 1X5TA 4NYZA 3WDOA 2Z30B 1NH7A 4E8UA 3TQ1A 3C6TB 1FJCA 3HF5A 1HWLA 2W2PP 3W8PA 2RRAA 1F3FA 2CG4A 3TI0A 1HNXJ 3FJ2A 3IBWA 1TAQA 1YSJA 1RBLA 1QAIA 2HVZA 4WFAQ 4HI1A 4OYIA 3M9NB 2V6AA 3OW2R 3GSDA 3TJ9A 4IH7A 1WC0A 3FKBA 4I56A 4A8OA 3H7HB 2YWEA 1WELA 5IM0B 3CXCR 2FVPA 4M5DA 4WYWA 4N5SA 3GCXP 1RSCA 3J81Y 5EDWA 1FI4A 1UTAA 3CO0P 2K3KA 4OI0A 1TAUA 4EMDA 5JVHQ 3VVUA 2KT2A 2JNJA 4Y2MA 3CPWR 3D67A 3MTKA 2MYFA 1U2RA 2R8HA 3IRXB 1Q8IA 1RT4A 3T9ZA 2AJQA 4Y3CA 3CEDA 2XZDB 1XNRJ 4HT7A 1KHVA 2YNHA 1UJ4A 2NREA 4OI1A 4DZ6A 4XPEA 1BQMB 5RUBA 4KGKA 2BR0A 3A3PB 1TVRA 2NPFA 1TUVA 2M2BA 4P6QA 4QCLA 2DO4A 4BS2A 2BX6A 1D0EA 3ZTOA 5KFBA 5J1EB 4JV1A 3DHWC 4CLZA 4B3OB 1WTFA 2MZRA 2DPJA 4WFXA 4I2QA 4OZ2A 1TMJA 2XMJA 4RNOA 2N7YA 2VFTA 3JYTB 1WEXA 4ECQA 3AJ1A 3Q8QB 1TKXB 1U1KA 1HWUA 4J9MA 1N6QB 5F0WA 4PRFA 1BWVA 3KJQB 4EZ6A 4JI2J 1PG5B 4DG1A 2NR0A 4EWTA 2RIJA 2XEXA 1RE1B 2XMAA 5C25A 4GKJF 1D09B 3D1QA 6FD1A 4NXMJ 5BR8F 1G3OA 2H65B 4F50A 2ZH1A 1Z2ZA 3I9ZA 2H48B 3WIUA 3P5BP 5GMKa 5B0BA 2WAQD 4LMZA 3DKDA 1Q0NA 4FYDA 2DR8A 2HQCA 1GT8A 3BDEA 1A6LA 2BYCA 4C11B 1H6KX 1G7CB 2ROGA 3CCUS 5CZXA 2R7SA 3O44A 2X1FA 2BXJA 1T9TA 4PWDB 2JFKA 2WZ1A 1NDCA 3Q22A 2VA2A 4RWWA 2YH1A 4P52A 3Q24A 1FRIA 3LALA 4GVBB 4B9MA 1PBUA 1RAIB 3UN5A 1LWCA 4LSLA 3G4SS 1M5VC 4YB1P 1MMNA 1X31C 2JSXA 2XHCA 1WOOA 2MZTA 1X4AA 1WC3A 3P6YC 2UUAJ 1FVQA 1QLNA 2CRLA 2ZE2B 2AZ1A 3SQGB 2I38A 5F8HA 2C3UA 2HVHA 1N33F 3TO8A 1XMBA 4IG0A 1KQKA 2V34A 2KVQE 3K8WA 2UUCF 1JLQB 3DLLQ 4CO5A 2EK1A 2DY9A 2VPZB 4FYYB 1LNQA 1I51B 2QMXA 3WIVA 2FGCA 3MPDA 2MGZB 4DI6A 4P71A 4CRJA 4B3SF 2XZWA 2MZSA 1S0VA 1X8DA 3HJFA 4GKJJ 3VAIA 4A48A 1NK5A 1X0PA 2IA0A 4C3KA 3CCLS 1VFJA 3ILLA 2VONA 2LA4A 1DTQA 5HJYA 1RACB 3CJ4A 3DRSA 3QSIA 2JVRA 4F26A 4AE5A 3L4BC 3MAAB 1TL5A 2X3GA 4F4WA 3IMQJ 4QWDA 5EWFA 3V6KA 5HQ8A 4EUVA 2VFUA 1XC9A 2HNZB 3NG8A 1NLKL 1L3UA 3JS9A 1RT6A 1CC7A 3OD2A 4HACA 3GCWP 5JVGQ 3DC2A 1FNMA 3CNQP 1Y5NB 1U1OA 1AZSB 1X9WA 5IV4A 3N9UC 1XTZA 5D4NA 2B56A 2W24A 1JIHA 2CKWA 5M2RA 3CJRA 2ZNZA 1LFPA 2M5YA 4I69A 5ETMA 3A13A 2R2RA 4JI0F 1K1SA 3EUNA 5J2QB 4I6YA 2X7IA 1EARA 2LA6A 3NGSA 3NY0A 2J76E 2UUBJ 3CO9A 1BQNA 1KRPA 4G1IA 1W2BR 3P45B 1FX2A 5J2MA 4NMLA 4AUKA 2JFDA 2VIHA 2WK4A 2MQNA 1N34J 5ETTA 3W62A 3MM5A 2OSRA 2E1PA 4PAAA 4KPYA 5FD1A 3BZQA 4P2MA 3T1HJ 1HNWJ 3DU5A 2HNDB 4WFBQ 3Q8PB 2YNFA 3BGFA 4YHHF 3ZZ0A 4DLGA 3EYZA 4ZN1A 4PABA 3L9ZA 2J7WA 2ZWOA 1M5OC 2ZM6J 5BYQA 3ZZUA 1FNXH 2H5EA 1X4CA 3K5PA 5IM0A 3AD9C 3E51A 2I9SA 4CZCA 2A3JA 1X9SA 4I6WA 3VR1A 5J2NB 1OSDA 3K8VA 2DNQA 1DQ8A 3GQCA 3HHNB 3QZ8A 1N5VA 4DL3A 3BSCA 1KQFB 4CI0B 3CCTA 5DQHA 1ZYQA 1VK8A 1NAQA 3CDEA 1P1TA 4TYBA 3BBFA 2P9GA 1NZAA 1U48A 2YX7A 3IRXA 1XNQJ 2AGPA 3W7BA 3NNHA 2R7RA 3GWCA 3EWGA 3PX6A 4X4QA 5HROB 2HWHA 2GZOA 1BQMA 5ITHA 1X7VA 1FKAF 4N76A 2VQEF 5DDPC 1Q7LB 2FHJA 2L41A 2C2KB 2OFHX 1MSWD 1KVJA 3I5CA 3GILA 3MCSA 5J1EA 1X9MA 2Z2MA 1LXJA 3M32B 4B3OA 2CWXA 4R0JA 4MT1A 3PYFA 2W9CB 2Z2LA 4OJ3A 2IDLA 1BMQB 1ITPA 1Y3KA 4RPFA 3AQOA 4C98A 3JYTA 1TKXA 1KKHA 4MIBA 2Y0BB 1HR0J 1NXIA 5D78A 5C42B 4YB7A 4LF7F 4DQRA 3PTWA 1B3TA 2ZDOA 9ATCB 1S0NA 1N6QA 1JLBB 3ICLA 2U2FA 1N8RT 1S76D 2UVUA 1X4HA 2IIHA 2W2NP 4NLYA 2K1RA 1SC3B 1JXEA 1EX8A 1SKUB 2OUGA 1DQ9A 3JSRA 4J7CA 4ZKAA 2FLOA 2W25A 3FVYA 5SZTA 3NCQA 2Y1IA 2KFNA 2RS8A 3KWMA 5D4LA 3GMGA 7FD1A 1PO6A 3D0IE 4OX9F 3U1MA 1W25A 3ONQA 3GJRB 1YK9A 3L7UA 2UZAA 1AYEA 5B7WA 2AEFA 4H4KA 4CCHA 4XAKA 3MHYA 4F4YA 4TLRA 3AXKA 2WTFA 5KT6A 1CULB 2Z56B 2J8SA 4NRUA 4JI8F 1WWHA 4NLVA 2JOQA 4KGXB 4C11A 1ZM2A 5ETVA 2E5JA 1NSAA 4ECVA 3ZNUA 3B4MA 4DCOB 4K4VA 2XMWA 1U24A 3POTA 2V67A 4PWDA 4Q8FA 2B7BB 4A46A 2OD4A 4X66F 1ZS6A 3PRDA 3PV8A 2W7PA 4X4OA 4GVBA 2VBWA 3LGNA 3M8RA 3F0NA 3AXMA 3M2RB 4CNYA 2DH9A 1NJIT 1OYEA 2VQEJ 1X60A 4YOEA 2GO9A 4ZPTR 1PIEA 1IVZA 1FCAA 2HLTA 4P9SA 1TFYA 2A0FB 1ZM9A 1VBZA 3UDLA 4LF4F 1T95A 2GV1A 3HHKA 1S1TB 4CLLA 2ZE2A 1UMJA 4Y2KA 2CVIA 2V68A 2HHTA 1GFWB 3PW2A 1FFWB 2RT3A 3OSPA 5DO2A 2NZCA 4FPRA 2E9ZA 3TOQA 1FRKA 3ILIA 4B9VA 1C0TB 2CQBA 2IM0A 4IQXA 1JLQA 4DL0C 2BJ8A 3NMAA 1FDAA 4QYRA 2YKNB 3MD1A 3TA1A 3MOZA 5KOWA 2DGVA 3I0SB 1YJ9S 2MGZA 4B9SA 1BLUA 3OL6A 4HHHA 2LQ8A 2I6WA 2AGQA 3GE9A 3CJQA 2VJVA 4H4KC 4JI5J 2LVWA 2ZOGA 2HHSA 1J5EF 3PX0A 4RO0A 1NJYA 1REGX 2FZKB 2DXEA 4G1QB 1ZTWA 3BJYA 3E01B 3RTVA 3D9BA 1ZM4A 5FDLB 2BANB 4ZVFA 1RU2A 2NYIA 5KFOA 1H0HB 3ADAC 4CO3A 2IM2A 4OX8A 2HVDA 4ZP7A 5C2CA 2HNZA 1FRLA 3EM1A 1SBRA 2F65A 2HHXA 3MPYA 4O3NA 4NZ0A 4OHYA 4IFYB 2CQIA 2DXFA 5IXUA 4XO0A 1U1QA 4UUXA 5HATA 2YXLA 2WOMA 2H3EB 2DIVA 2ZBIA 3HLUA 2DY1A 2OMOA 3D3BJ 1AZSA 2EXUA 1VBXA 1ZOTA 2DIUA 2W2OP 2HWIA 2CWKA 3BGRB 1HHSA 2BOPA 1F9FA 1FKPB 2LXUA 3HO1A 2UXDF 3QRPA 1Q4RA 4C4WA 2IPOB 3IM9A 1NNDA 2DHSA 3KJVB 2J0SD 2WVEA 5T7LA 3UCGA 4P2XA 2K06A 1ZH5A 4Y34A 4KB7A 2FVRA 4DS5A 4KV8A 4RNHA 2NXNA 3E2EA 1N88A 1HLWA 4DX6A 1ZAXA 2HNDA 5KFYA 4LF5F 1FO1A 2W2QP 1LXNA 1WC6A 4MTPA 2CNKB 4TVAB 2CDQA 2PSZA 4C2MA 2NPIA 2HAFA 3SFGA 1HARA 1T3NA 1MU2B 1QD1A 4J9PA 5CQGA 2J9DE 5J2NA 3G82B 3MCNA 3IS9B 3OXFA 5T14A 2P9EA 3IRWP 2BEFA 2D9PA 4F3QA 1RAEB 1RCXB 3GIJA 4DR5J 4DR3J 3RR8A 3IR5B 3EICA 2CA9A 4ECSA 1RP5A 3NWGA 5E3PA 3PYEA 2HRUA 2AWZA 3G9CA 2RSQA 4TU9A 2VB6A 3ZO7A 4HTJA 2IHR1 1KHWA 2NLWA 4DL2A 3QT8A 5HROA 2QFJA 3H5XA 1YI2S 2AMCB 4ELVA 3W8GA 2V9WA 4M5LA 3BYPA 3EX7B 3FDSA 5LOQA 4ILMA 5E3AA 3TAQA 1VR6A 1OIAA 3HKZD 4KKOB 3K5LA 3M32A 3J7YI 5L9NA 2BKOA 4L74A 1QVGR 2R8JA 4NLWA 4LRCA 2W9CA 2CADA 3QRQA 4B9LA 2HHHJ 2V63A 2BMBA 4C8MA 1VLOA 2HNYB 2HGLA 2DXDA 3IAS9 2XYGB 2DYAA 7FDRA 3MEEB 3ULHA 5C42A 1O8BA 3HCXA 4OX6A 1U6ZA 4K8RA 4P7TA 1JLBA 5AE3A 4ZIWA 5MLCV 4TQSA 1R0CB 2CPEA 3LQVA 2J5AA 1V5VA 5C24B 1NKBA 1VBKA 1W26A 2O01C 2BJ3A 5HL7Q 3LAMA 4KHPF 2D69A 1VQ5S 1LQ9A 1NSQA 3PJ9A 1VJQA 1CULA 3QGHA 2GIFA 1YHQS 3Q0AA 1WF2A 4A8QA 1Q86T 4KH0B 4Y65A 2P6SA 1FRJA 4OI4A 1M0SA 3ZZOA 4QU7A 1DURA 5FLXY 4OI3A 2IFXA 2Y1JA 1LWFA 1L3KA 2H1YA 3AB2B 2OIHA 3H5YA 2UXBF 4O44B 3LPYA 2RUSA 2FHOB 1PGZA 4KR0B 2F4VJ 3MM8B 4X4NA 3Q8UA 4QIFA 3EZUA 3I5AA 4USKA 2V2KA 4HI2A 4Q7AA 5K8NA 1RHMB 2V69A 2EEYA 4AQYJ 3MMBB 1VQ4S 2QL5B 4H4MB 1TTHB 3Q86A 3M2RA 4KO0B 4EZ9A 2LQ5A 5C5JA 4X65F 2FJXA 2GHVC 1UFWA 5CYJA 2QE5A 1M1HA 2CQGA 4ECUA 2O3DA 1VRTB 1K8AT 2QSWA 2QJ3A 3KUGA 2ACMA 4HHJA 2I8EA 4V19J 4ID5B 3U1NA 2HKEA 1P9YA 2R42A 5A8WB 3MUTP 4PG6A 5LSOA 1FDNA 1S1TA 2DB1A 1UW9A 2J7UA 2AU0A 2ADCA 4Y2AA 4QYZK 4M5MA 1QAXA 3BGUA 3OVSA 3HVTB 1RA7A 5FJ4A 2IJRA 3GIRA 2UU9J 2HBZB 1C0TA 3DHXA 3EMTA 4HDHA 2YKNA 1VI7A 1Y5IB 3I0SA 4UQGA 3ISNC 4ANDA 3GSIA 2QSFA 3FUYA 4OYBA 4KHPJ 2MKKA 2XMMA 2KT5A 4O3PA 4G1QA 2BVZA 3E01A 1V3SA 1VYAA 3DXBA 4CT8A 1AUSL 3N01A 4QPTA 1NB2A 2YH0A 1JKHB 3KLGB 3MAQA 3R27A 3IBFB 3OFEA 4A8XA 5FDLA 2KI2A 4O3RA 2BANA 3OVAA 2C28A 4ZPBA 4F0MA 1FHTA 2V5HG 2MLYA 2QT7A 4X4VA 4DR6J 1VOMA 2X1GA 5J1NA 1S9EB 4QR1A 3KXDA 3GLJA 3KK2B 2M8HA 1SH0A 5KFAA 4IFYA 2RRNA 3RW7A 1VISA 4XDCA 2GFFA 4FYVB 1GNKA 4RR5A 3KLEB 4HHUA 1O5JA 3W5YA 4AD6A 3WHIA 3KFWX 1U8SA 2OD6A 9RUBA 2D74B 1S57A 2MQPA 4CLTA 4LF9J 3KJVA 1N36F 3TANA 4PPZA 1HBMB 3NBPB 2G0IA 1ZPWX 2MKSA 5D15A 3WZ0A 3EGWB 1EAYC 1C4AA 1GEHA 3UPFA 4KC5A 2BE2B 4M1KA 2DGSA 3TW0A 1U2FA 3U27A 5E2QA 2E5HA 1QVFR 1S48A 4WK1A 3DLHA 1KC8T 2IVMA 2W4DA 1RJJA 4I0WA 5D3GB 1YG0A 2Y9HA 2B9XA 2M3DA 5KFDA 4EYIB 4USIA 3I4HX 3JQMA 1SPBP 4ATNA 2MJUA 2H9ZA 3UNYA 1RAAB 3P4UB 2WHOA 1U7LA 1IBKJ 1VS3A 3P5TL 1MU2A 4NYPA 1N5YB 4LFAF 3J7AN 3FNNA 1IBMF 1CQNA 3G82A 3IS9A 3JQJA 2CPDA 4NX9A 4J9KA 1S72S 3Q8RB 3QJLA 4B17A 4Q8EA 1RZMA 3CIMA 5KFFA 5CH7B 1RWXB 1VLYA 3QT5A 4B3TF 2GC8A 4C8KA 4X4TA 2AJ1A 1HQUB 3CJKB 2KB2A 4UOGA 3FFIB 1WI8A 2CQ0A 4WYLA 3MM7B 3KUHA 1VK3A 3AFGA 2HURA 1FWPA 2OEMA 4FPIA 3D1HA 4C3MA 3FCHA 1Y0HA 1F5CA 4JI7J 3HDSA 5DDOC 4IYQA 3D3CJ 3GFZA 1ZA2B 2FB0A 3ZC4A 4K2JA 4H54A 2ZD1B 3DOLB 2ZEJA 4KQZA 2IRXA 4KKOA 1U1PA 2B5JB 3SV3A 3EGZA 2LEBA 2GVDB 4IUFA 3R2CJ 4B3MF 3ENWA 2M7SA 3MUVP 5A6WA 4ZPCA 4QJVA 2ILZA 1R8HA 2FIUA 1TR0A 1S1WB 2XI3A 2HNYA 4DSJA 1DBDA 2KH9A 3MEDB 4NLDA 1WDDA 5LM7E 5F9LA 4F8RA 3MEEA 1T9XA 1H74A 2UXCJ 2RVJA 2GQQA 2XS2A 5GMDA 4UY8T 1GX6A 5C24A 1F60B 4USWA 1G4CA 2ABYA 1DJ0A 2NCKL 2H5IB 2ZOFA 3D2WA 2GHWA 3KUEA 1FX4A 5H1SV 1YITS 4DV4F 1HD0A 4WFYA 3TYTA 2MHNA 4Y2CA 2X1AA 1HW9A 2CG8A 4NZ7A 4LREA 2EW9A 1JLFB 1JNZB 2QYCA 1PJ6A 3TNVA 4DUYJ 1IBMJ 3P3DA 1NK8A 3F56A 4PG4A 4LVOP 1RYRA 4DX7A 4A8MP 1NJWA 2DH7A 3HVWA 1I3OB 3LPEA 3TQEA 1EP4B 1Q8BA 2JC0A 2EFVA 3I96A 2FVQA 2QN6B 3JSMB 2MQLA 4JB8B 4O44A 4Y28C 1HA1A 4PQUA 2UVRA 3MM8A 3UCZP 3PFOA 2CJYB 1HIYA 4P72A 5KT3A 1SI9A 1D1UA 2MDAA 3AOCA 5KFWA 5GVQA 3MMBA 1IN0A 3W3SA 1VQ9S 1F9HA 3CDUA 3OFHA 4H4MA 3FQLA 3ISZA 2B51A 2EKYA 1BUXA 2IA6A 4U7CA 4KO0A 4DPXA 5GAHI 2QMWA 3MPVA 3EPGA 4ZJQA 1CS4B 3NRBA 2O5DA 2ASDA 1URRA 4ID5A 1DLOB 1QE1B 3CCSS 5A2QY 3SCLE 5A8WA 3CC7S 1U1MA 1OPIA 1D8YA 2F40A 4YFUA 3A4TA 2CJ9A 1ZTTA 1UVIA 3OFFA 2PE8A 2VKRA 1KFDA 3HVTA 3LP1A 4DPWA 1GMVA 3IBCB 1EJ7L 3BR9A 1B0PA 4MKYA 5ETQA 2YKOA 2VC1A 1Q82T 3BQ0A 2GAHC 1FXLA 1QUPA 3DRRB 3PO5A 2WBRA 4KFBB 3F41A 4K4XA 4CYUB 4DBQA 3DCAA 3ZXWA 2DD8S 2J0WA 1R27B
chains in the Genus database with same CATH topology
2IMWP 1KN6A 2Q1LA 2JDJA 3C3LA 4I4BA 3G6XA 2ROGA 2XI2A 3NNCA 1RTIB 1JKHA 2HHUA 3KLGA 5KFKA 4MKAA 4LF8F 2RQMA 3CCUS 3CMAS 1S77D 5CZXA 2R7SA 5CCMA 5F0UA 3O44A 2YNIB 1N0VC 4CTAB 5HMZA 2R9LA 1C4CA 2BM0A 2BXJA 1ZZNA 1N56A 2X1FA 1YVFA 4PWDB 2ROPA 2DVIA 2JFKA 2OFGX 2RD5C 5L1IA 3PO4A 1KSPA 2ZZNA 4RW6A 2PO4A 1KS2A 4R5PB 2EFQA 5I4MA 3MGJA 1T03B 3S8SA 5KFTA 3VTIA 1SIWB 3M30B 3Q22A 4M8LA 1WF0A 1FTCA 2I5JB 2QA4S 1S79A 1SUQA 3T1AA 4Q2LA 4ZCLA 2VA2A 4C0HA 2AQ4A 3VAKA 3FEYB 4RWWA 2YH1A 3H8YA 2DGXA 3Q24A 1S9EA 5I3QA 1FRIA 1PC5A 2OPRB 3LALA 1AFJA 4R0EA 3N0VA 3FMWA 4B9MA 5LL6d 1WI6A 4MIAA 1H2VZ 4GO7X 2BRLA 5A8KB 1LWCA 4LSLA 5L1KA 2XULA 3G4SS 1UA0A 4IFVA 1M5VC 1GAOA 2CFXA 2AJ0A 3WC0A 1H2UX 3CDWA 3FEZA 4YB1P 2JEJA 4WZQA 3JTOA 1UJ6A 1MMNA 4K5SA 4RW9A 3QPIA 3LAKA 1ZETA 2EVZA 3Q2SC 4DJBA 2KM8B 2JSXA 5GAEI 1RAJA 2MZTA 5DDQC 1CQMA 1X4AA 1XMOF 1BWEA 1R8CA 1TK5A 2F9JA 4URQU 2GMLA 3RYLA 3KLEA 1SKRA 1UA1A 3QO9A 1T3OA 2O67A 3P6YC 2L9WA 2R8IA 1FVQA 2JL9A 3DLEA 1QLNA 2CRLA 2XMTA 1KLMA 2HIQA 1V9OA 2ZE2B 3M8QB 2QA2A 3SQGB 2NZ4A 1OS5A 2I38A 2AD9A 3OL9A 2ILYA 2DGWA 4NLSA 4QR2A 3I55S 3BO4A 4O3OA 3KK3B 4GO5X 5F8HA 3V81B 2C3UA 2HVHA 3MMAB 1CEZA 1N33F 2W4PA 3TO8A 4U9RA 4B08A 5THWA 1XMBA 4LVNP 2FLLA 4DPOA 4IG0A 1KQKA 1AXQA 5CZVA 2J6SA 1HBMA 3NBPA 3PW7A 2MB0B 3NS6A 1UFLA 1HMVB 2V4JB 3K8WA 3SCIE 3HT3A 2UUCF 1JLQB 3DLLQ 1AUDA 4CO5A 5DJBA 1Z1ZA 2EK1A 2BDPA 4X4RA 1U47A 2XWXA 4WU2A 2E1RA 3IC1A 2VPZB 3PJWA 4QPXA 2J9EA 3G6YA 4Z2XA 3OUYA 3BGRA 1WACA 4OHWA 3OPKA 1RT1B 4MFBB 1MROB 4AL6A 2QMXA 3H40A 1FKPA 3AA8A 2FGCA 4YR2A 2MGZB 1VQMS 1RK8A 4NA1A 3MR5A 2HHWA 2N4CA 1A9NB 1RI7A 1QAJA 4B3SF 2XZWA 4DR5F 2MZSA 1WD6A 4DR3F 3MFIA 1S0VA 4ED3A 1X8DA 2IJNA 3HJFA 3MR2A 3DDKA 2XG8A 3KLVA 3VAIA 2J6TA 2JLFA 4A48A 1NK5A 4PQAA 2Q3PA 2R8GA 3X1LB 1X0PA 2FGOA 2WB1D 2DH8A 3SSQA 3G8SA 4NA2A 2CQDA 1HBUB 2IA0A 4C3KA 3CCLS 3HVRA 2MKCA 4CT9A 1VFJA 1HNIA 2B4VA 4IO1A 3IN5A 3DMJB 4LQ3A 2VONA 1JNRB 2CPFA 4OHVA 1D9DA 2LA4A 1DTQA 1DFDA 1Q81T 1RT3B 2VG7B 1S10A 5D3GA 2LLZA 1Q78A 3CJ4A 2OH2A 1TK0A 1IKVB 1FD2A 1CLFA 3DRSA 3PW5A 3KLIB 1NO8A 1WG4A 4ZHRB 5KFSA 2HFZA 2JVRA 4F26A 4AE5A 2MSSA 4FXVA 5DQGA 4U6PA 5DETA 2R2TA 3CD6S 3BS9A 1TL5A 5HO4A 1OWXA 2X3GA 4F4WA 3CGIA 4QWDA 4F67A 2JWNA 1AFIA 2IAJA 1N48A 3CUNA 4JOUA 5EWFA 4ZVGA 3V6KA 2DT9A 2V94A 1SKSA 3MOJB 5HQ8A 1U49A 4EUVA 2VFUA 1XC9A 1N5YA 3OLBA 2VG5A 2HNZB 3NG8A 4J37A 4WF9Q 1N52B 2HLUA 4Y00A 1L3UA 1GTHA 3BQ2A 3H5SA 4YMEA 1FDDA 4PWUA 1RT6A 3BGLA 4DX8H 1CC7A 3MMCA 1ZPVA 4ICLB 3CB4A 2G9OA 4ZK7M 1YRTA 2YTCA 1QM9A 1HQEB 1FE4A 5JVGQ 4I1TA 1S9FA 5HBMB 2VL1A 2J0QD 3DC2A 5K8PA 1FNMA 4DUZF 1NJXA 1S9GA 4C8ZA 2F1FA 2RDIA 2HFNA 3C6UB 1Y5NB 3FZ2A 2C22A 1NRKA 1FERA 1R6YA 4MK7A 3TAPA 1U1OA 5DG9A 2HHHF 1S1XB 1S6QB 4DQSA 3MMJA 1TL1A 1HQUA 2GO8A 2VFSA 4ECRA 3CJKA 1X9WA 3OR2B 4RLEA 3EPIA 1VQ8S 2PMHA 5KFZA 3OV7A 3UD3P 2KDOA 3N9UC 1XTZA 3MM7A 2HHQA 5D4NA 4I67A 4I6AA 5JXSA 4YY3F 1H98A 3GV7B 3HK2A 2W24A 2B56A 1JIHA 2DBBA 2CKWA 5M2RA 4QIWD 3UQSA 1TL3B 4N77A 3M9MB 2ZNZA 3WBZA 3LWLA 1S1UA 4UUWA 1LFPA 2M5YA 3DOMA 4ED1A 5HP1A 4I69A 2R2RA 2YWKA 4B9UA 4JI0F 2M4MA 3OR1A 1Y7PA 4USHA 2LCWA 2OPSB 4FBTA 1K1SA 3EUNA 5J2QB 2WW8A 4I6YA 5LMNF 2L48A 3CJ0A 2LA6A 1YIJS 1VMBA 2ZNYA 2J76E 4ZPVR 3CO9A 1BQNA 2ZD1A 4NLRA 4NOHA 2ATLA 1KRPA 3K5OA 3LH2S 4G1IA 3DOLA 1W2BR 2JC1A 2KHCA 3QIPA 5KT7A 1S1VA 5J2MA 4NMLA 2FHMA 4AUKA 1E6VB 1S6UA 3MR6A 3V4IB 3H2UB 2JFDA 4OZ5A 1VQSA 3UI3A 2WK4A 2B5JA 5KFPA 4JUZA 2MQNA 4DDFA 5IT0A 3P96A 2VBZA 3TX8A 3RU0A 2PDAA 4DV2F 3FSXA 1SL1A 3MM5A 4DV3F 1GXTA 1TQLA 3GIMA 2DHAA 4HVZA 2OSRA 3PR4A 1FRXA 1UEVA 1HYSB 3NL0A 1RTDB 1J2VA 1U4BA 2FLPA 4CO1A 2HPUA 2E66A 2EBGA 2GW8A 4NCGA 4KPYA 5FD1A 5KFGA 1SQEA 1JXLA 3BZQA 3K58A 4NPOA 4ED2A 1S1WA 1VQ6S 4IDKB 5IZHA 4NWBA 3LOUA 3DU5A 4ZVEA 2GGPB 1JK9B 2W7OA 2HNDB 3G71S 4WFBQ 3Q8PB 3MR3A 1C2PA 2YNFA 3MEDA 3SDEB 1E6YB 3BGFA 4YHHF 1SH2A 5GAGU 2MZ1A 4OHXA 2W9AA 3V6DA 1IKXB 2HVIA 3PX4A 2MXYA 4OI6A 3TUJC 1RGVA 3ZZ0A 4DLGA 4MJKA 3EYZA 1ZZFA 2HMIA 2CPHA 3U7JA 5F8IA 1VIOA 2FC8A 2GNKA 4RW8A 1I6JA 4G1PA 2J7WA 2DHXA 2KZMA 5KG7A 2DNOA 5GAHU 1M5OC 2QA4G 3O1LA 3HZEA 5BYQA 3ZZUA 1DARA 1MW7A 4J5OA 2E9RX 1FNXH 4IRKA 2H5EA 3R1LA 1X4CA 2K7KA 3K5PA 1Y9OA 4OV1A 5IM0A 1S4FA 1TFWA 2F4VF 1SB6A 5F8LA 1Z2LA 3E51A 2DGTA 4DL7A 2I9SA 4CZCA 4WFZA 3NCPA 4Q0BB 2A3JA 1X9SA 4I6WA 3S6EA 3PEHA 3VR1A 1QY7A 2NSCA 1UVLA 4NLUA 5HN0A 4M95A 3QGIA 3B78A 1IKWA 2UV8A 5J2NB 3BQ1A 1RKIA 3IG1A 2E5LF 2VC0A 1OSDA 2NUUG 3R5BA 3HI9A 3K8VA 4AQYF 1URNA 4G6VB 1IXKA 2DNQA 1NEEA 4Q5VA 3GFXA 1DQ8A 3H98A 3GQCA 4QW8A 3HHNB 1JLFA 3QZ8A 1N5VA 2QZ8A 2J8AA 1KTVA 4DL3A 2J6UA 2HHPA 1D3WA 2I2YA 2B9YA 3BSCA 1KQFB 3NCRA 4CI0B 4WFNQ 3CCTA 1XR7A 5DQHA 4F25A 4I2PA 1ZYQA