2OJ3A

Hepatitis delta virus ribozyme precursor structure, with c75u mutation, bound to tl+ and cobalt hexammine (co(nh3)63+)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural roles of monovalent cations in the HDV ribozyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/rna
molecule keywords HDV RIBOZYME
total genus 24
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oj3A00
1Q81T 2RRBA 2WBRA 2N7CA 3J7YU 3VAKA 3I56S 2CPJA 1OO0B 2MQNA 1M5KC 3CCMS 3L3CA 2ERRA 2AYEA 1FHTA 2DGOA 2CQ0A 1N8RT 1JMTA 5LXYA 5GVQA 2MKKA 2HYIB 5DDRC 1VQKS 3NS5A 2KM8C 4C0OC 3MURP 2VOOA 2MQLA 2DGSA 3B4DA 1SJFA 2CPHA 1FJ7A 2DNQA 2MGZB 3UCUP 3P6YC 2E5IA 3I55S 4WF9Q 4WFAQ 1SJ3P 3MXHP 5FJ4A 1WEYA 3CCUS 4IOAQ 5CA5A 3S01A 3VAHA 2M4MA 2MJUA 1HD1A 1X4FA 3CCVS 2F9JA 5DM7Q 3ZZYA 2DO4A 1VBXA 1KOHA 1A9NB 1WG4A 3NMRA 4YB1P 2MXYA 2MZ1A 3OW2R 1VC5A 2MHNA 2KG1A 3G71S 2BZ2A 2ZJPQ 3CUNA 1SJRA 3CC2S 2MZTA 1N52B 1WHVA 1VBZA 2BOPA 3RW6A 2DHAA 2LEAA 2DO0A 2HZCA 3HI9A 5GAGU 3CD6S 2M2BA 3CC7S 2DGVA 2ADCA 1M5VC 2QA4S 1WEXA 2MGZA 1F9FA 3R27A 2F9DA 4ZKAA 3G6ES 1KOOA 2L08A 2KXFA 1NJIT 2FHOB 1BY9A 3D2WA 1WHWA 1X5PA 3NNAA 2DNKA 1HL6A 2MSSA 1M90T 1B7FA 1VQLS 1PGZA 1DRZA 2LMIA 2E5JA 1S72S 1QM9A 2KFYA 1Q86T 2DNPA 5HO4A 2CPIA 3UWTA 2DH9A 2MKSA 1P27B 5ITHA 4QQBA 2J0SD 3UE2A 4QU7A 2HGLA 2XNQA 5D77A 4TLQA 1WWHA 2MSTA 2DIUA 2RQ4A 4YOEA 3K0JA 3BEGB 2LQ5A 1HA1A 3FEXB 2KHCA 3NNCA 2MQMA 5LXRA 2MQPA 4P6QA 2J76E 2LECA 4BS2A 1WG1A 2CQDA 2KYXA 4TU7A 2DH8A 3VAGA 1WI8A 1VBYA 4LIRA 3P3DA 2MJNA 1CVJA 2KH9A 2ZJRQ 1XN9A 4F26A 2GHPA 2RVJA 1L3KA 2KRBA 1YI2S 2M7SA 1JJHA 2MB0B 1FNXH 2LXIA 3V4MA 3VF0B 5JVHQ 2HGNA 2O3DA 3MD1A 4CH0S 1DBDA 2D9OA 1KC8T 4QPTA 1YHQS 4WIIA 1ZZFA 5H1SV 2CQIA 2QEXS 2CQGA 2VOPA 2XB2D 2U2FA 2DNHA 2CQHA 2MZRA 4V19X 2CQPA 2LA6A 2XNRA 2RUGA 1G2EA 2FC9A 2LXUA 3CULA 1Q7YT 1QVFR 4W90B 2CQ3A 1O0PA 1X4DA 1SJQA 4IUFA 2NLWA 3MUVP 1SJ4P 2XS2A 3G8SA 3CCLS 2J8AA 1VQ8S 1D9AA 1X0FA 2CQ4A 1H2UX 2M70A 3MD3A 1WEZA 1FJEB 2CQCA 3RW7A 1VQ6S 2KVIA 2K3KA 3VAFA 4LMZA 1U1NA 2PE8A 2I38A 3JB9k 1WTBA 2MKHA 4Y00A 5IFMA 5GAHU 2OSQA 1VQ9S 2LEBA 3MUTP 3S6EA 2OJ3A 2YKAA 3THPA 1X5TA 5LJ5Y 2EK1A 2MQOA 1X5SA 3P5TL 3NS6A 2L9WA 2KM8B 3SMZA 1FJCA 1NU4A 3TP2A 2PEHA 2DGTA 3HHNB 1SXLA 2DNLA 3G96A 1VQPS 4C7QA 2JVRA 2YWKA 2KXNB 3UCZP 2FY1A 3THTA 3UCGA 3N9UC 3R1LA 2RS8A 4WFNQ 1D8ZA 2DNZA 3IWNC 5D78A 3BO3A 2YH0A 3G8TA 3U1MA 2DNOA 2NZ4A 2MQQA 1U1QA 5DDPC 3J7ZT 2M52A 5GMKa 2X1AA 2CPEA 5LSLA 2D9PA 2RU3A 2QFJA 2OIHA 1Q82T 3H2VE 5GAEU 2LKZA 1WHYA 4M5DB 4ED5A 2E44A 2AYBA 3SDEA 4J5OA 2YTCA 2KG0A 2CPZA 2AYMA 1U6FA 2F3JA 1WF1A 3BS9A 2DNMA 2ADBA 2M8HA 2DISA 1K73T 3TYTA 1IQTA 1JJ2R 1OPIA 2KN4A 2D3OR 2MZJA 3PIPQ 3VAJA 3CMES 5CYJA 1WF2A 2CQBA 3ZZZA 2X1FA 3TO8A 3NNHA 2MY8A 2DITA 2J0QD 1X4CA 2MKIA 3CTRA 1YITS 1H2TZ 3SDEB 4IOCQ 1R8HA 4C4WA 2DGXA 3UD3P 1FO1A 4CQ1A 1ZZNA 2ZJQQ 2X1GA 4W92B 1VQNS 2SXLA 1WHXA 4PKDB 2G0CA 5IM0A 3H2UB 2DNYA 1RK8A 3VAMA 1VQMS 2XS5A 4IO9Q 2LCWA 3G4SS 4CIOA 4LJMA 1U1RA 2I2YA 2XSFA 4EGLA 4FXVA 1JJ4A 1QVGR 1KQSR 2KI2A 3MUMP 1DZ5A 2YH1A 4A8XA 3BO4A 4Z2XA 2L41A 2MY7A 1UFWA 1WELA 3MI7X 1U1KA 3EGZA 5DETA 1U1MA 4Y0FA 1M5PC 3CCSS 3LPYA 4F02A 3S8SA 2DHSA 4F25A 2MMYA 1KD1T 1M1KT 3MDFA 2KT5A 2DHGA 2V94A 3EGNA 2DNRA 5BJRA 4WCEQ 2G1DA 3DLLQ 3P49B 2A3JA 3EX7B 1UW4A 1VQ5S 2MZSA 2VONA 1YWXA 1FT8A 2U1AA 4FXWA 3VAIA 3Q2SC 5IM0B 2CQ1A 1H2VZ 2FC8A 3G9CA 1VC0A 4OZ0A 2K8GA 2VODA 2M8DB 2MPUA 1X5OA 1URNA 2DIVA 2JX2A 2JVOA 2KRRA 2RQCA 1VC6A 2X1BA 2OTLS 1AUDA 2N3LA 1WF0A 2MZQA 2DGQA 2E5GA 4UY8T 5IQQA 2RNEA 1P1TA 5HL7Q 2UP1A 3MOJB 2G4BA 5LJ3Y 4U67Q 1X4GA 1UAWA 1ZH5A 3CPWR 2CPYA 1YJNS 4QU6A 5EN1A 2DNGA 2EVZA 1DHMA 4OZ1A 1FXLA 4YUDA 3CC4S 1HD0A 1X4BA 1YIJS 1VQOS 3BO2A 2RRAA 2DB1A 4PR6A 3DXBA 1RKJA 1H6KX 4PRFA 5DM6Q 2LYVA 3CCES 4RU2A 1X4AA 2DHXA 2HVZA 1N88A 3IRWP 1VQ4S 1K8AT 2DGUA 2N82B 2KU7A 1YTYA 2B0GA 2DH7A 3Q2TC 3S7RA 1U1PA 5DDQC 2RT3A 5JVGQ 5LSOA 5DDOC 3R1HA 3U1LA 1YJ9S 2MKJA 3SXLA 2JRSA 3US5A 2XS7A 2DNNA 2N3OA 2OTJS 1X4EA 2MKCA 3B4MA 4TU8A 2GO9A 4TU9A 3CCJS 1U2FA 2FPHX 2M0GB 2Q79A 2M88A 3UD4P 2AD9A 4CH1A 1YJWS 2RS2A 1NO8A 2M9KA 1W2BR 1VQ7S 1K9MT 2CPFA 3ULHA 2DK2A 2CQ2A 3CXCR 4ERDA 3FEYB 3LQVA 4WFBQ 3CMAS 3CF5Q 1WI6A 4WKRA 1U1LA 1U6BA 2KXHA 2CPXA 1N54B 1A7GE 1X4HA 3VALA 1OIAA 1OWXA 5MLCV 2OSRA 2HGMA 2DGWA 2CPDA 4UQTA 2LA4A 2EK6A 2JWNA 1U1OA 5GADU 1UP1A 3PIOQ 3CCQS 1S79A 2E5HA 1PO6A 5CXTA 2MYFA 3CCRS 1WG5A 1M5OC 2CJKA 2AYGA 1R8PA
chains in the Genus database with same CATH superfamily
1Z4UA 2N7CA 4JI1F 1S6QA 2ZBPA 2ZZNA 3I5BA 4DFKA 2EI5A 3IBCB 3VWSA 1IVZA 3EUNA 4F36A 4LF9F 1M5KC 2HLUA 3PYGA 4AUKA 2AJ1A 4DUTA 3IC1A 3BDEA 2DGOA 1SB6A 4BLGA 2CQ0A 4ED2A 2KT3A 1VRUA 2K1RA 4AYBD 1XMOF 1QAIA 1KS2A 5GVQA 1QD1A 2MKKA 3OHAA 4C8NA 4Z37A 1YBAA 1PYOB 2KM8C 4IFVA 1FA0A 1F0XA 2DGSA 4ZLLA 5I3QA 1SJFA 2XMVA 3ZNUA 2ZEJA 5D0RA 3ZTPA 2W7PA 3LP1B 4H4OB 4IG3A 3UCUP 4LF4J 2E1RA 4TXSA 3EZUA 2PFDA 5KFKA 2NR0A 1SQFA 3MXHP 1V3SA 5FJ4A 4EZ9A 3W2WB 1MROA 4M5GA 3DU6A 4LR9A 2ZH3A 2XCAA 4FS1A 1R27B 4DSIA 3M2RA 2F5GA 5CA5A 1K47A 5KT2A 4U7CA 3VAHA 4ILMA 5CCLA 4PQAA 2UUAJ 1WKLA 3UDCA 2J0WA 1SUQB 2XBPA 2Y3YA 5DM7Q 1RI7A 3HT3A 4DL5A 3TNVA 1VBXA 1KOHA 1N5TA 4A8WA 3BSOA 2VV5A 2DCUB 1RLCL 3RRGA 4YB1P 3NMRA 4LF8J 3OW2R 1FRJA 3JSMA 4RR5A 1SH0A 2HS4A 2JH3A 2BZ2A 3QT6A 4AT1B 1SJRA 5L9XA 3LANA 3TAQA 3RW6A 2HHVA 5F8LA 2L9NA 2PC6A 3MM9B 4JI0J 1HIYA 1ZAVA 5GAGU 1Y10A 4CRJA 1YRTA 3AAWB 3V4IB 1XMQF 3CC7S 5KFGA 3A4TA 2BQ3A 1UJ4A 4O4GB 3AOBA 2HHHF 3H40A 1I51B 3AXMA 3G86A 3TW0A 4YR2A 3BJYA 5LMNF 2YNIB 4ZVQB 3ILIA 4M5LA 3FQKA 1KFDA 3QYYA 4DQRA 3GIMA 1IN0A 2HQGA 4OI4A 3WIUA 3DRYA 2K3IA 2ZC3A 3HKWA 4RKUC 3G6ES 2KXFA 4ZPCA 2LLZA 1RQ0A 2HK2A 1OY9A 2VF3A 5C24A 3D2WA 1WHWA 3CDEA 1QDUB 5I3PA 3OTOF 2YQ1A 1ZTTA 1V3ZA 1K0TA 4K7QA 4X64F 2KJWA 2B9WA 1VQLS 1DRZA 1S9FA 2E5JA 1HHTP 2B7BB 4HI2A 4M5IA 2J0XA 2W25A 2A6MA 2V4JB 3NBPB 1HNZJ 2X3DA 1N33J 1RAGB 4MH8A 4L75A 1RAEB 2CPIA 3O1LA 4FZVA 3UWTA 2HNDB 3DHWC 5HO4A 4N8NA 4USWA 2J0SD 5HMWA 2W9BA 1YZ6A 1D9DA 3DDKA 2OEKA 5E2QA 5EWGA 3UE2A 1NJXA 2HGLA 4Y3CA 4JV0A 4WYLA 1IXKA 3GFHA 4TLQA 2UVVA 2JC0A 2XYGB 2DIUA 2HKEA 5KG5A 3K0JA 2W2QP 2HW3A 1YBTA 3FK4A 4MMOA 4C3KA 2G2ZA 3MECB 2P9EA 3NNCA 3BYRA 1P8GA 2CFXA 5LXRA 4P6QA 1O51A 1EHWA 2FYXA 2J76E 2H4WB 2O66A 1XMQJ 2FB0A 2WVBA 4ZVFA 2XC9A 5M2UA 2FVQA 1TV6A 2KYXA 4OHWA 4TU7A 2WVEA 3HD1A 4NASA 3H5XA 4LIRA 3P3DA 4HACB 4EU0A 1ULRA 1CJTA 1FESA 2W2MP 4MKVA 2KH9A 3ICLA 1CVJA 5A8WA 4A8QA 1TUGB 3OD2A 4FP9A 2AV5A 4ED0A 2OGUA 2RVJA 3C6UB 4NZ7A 1L3KA 2ROGA 2BKNA 4KKOA 4TYBA 1G6BA 1SCJB 3K58A 4ES2A 2W9CB 2M7SA 1AZSB 3OXGA 4I69A 4P10A 4Q8EA 3CNQP 1SV5A 2ZVIA 4X64J 4OV1A 2HGNA 3GCWP 4KO0B 2AW0A 5DQHA 3ILJA 3ELHA 4RX6A 2O5DA 2VU5A 4LT6A 2ASJA 3ZZRA 3EDQB 1JJCB 2CJBA 3Q8QB 1CC8A 1MW7A 4NPOA 2D9OA 2LU1A 3AD8C 4ITSA 4QPTA 2HFSA 1KC8T 1NJZA 3N5FA 2ZUGA 4OJ3A 2ZC4A 3PV8A 3LAKA 3W63A 4X4VA 3CJ3A 1KTVA 3HULA 1XR5A 3AD9C 1QE1A 3CO0P 5KG0A 1P1LA 1S9EA 5DLFA 4EYHB 1QSLA 2U2FA 2KVQE 4DSLA 2KL8A 3Q83A 4V19X 2CQPA 1QY7A 5A8RA 4NLDA 1S1VA 3U7JA 1G2EA 2EC2A 1EP4A 4KKOB 2Y1LB 3TA0A 8AT1B 3RZAA 1Q7YT 3SZ2A 3OV7A 4X4RA 4GKJF 2E7WA 5K8OA 1PCAA 2HWHA 2ZDPA 2HS3A 4K2XA 4KYZA 2C2NA 4NLTA 1SJQA 5ETQA 4JI2J 3W5YA 3MM6A 4IG3B 2N4CA 1CPZA 3G6XA 4DHVA 2VIHA 2FZGB 3CJ0A 5HN0A 1RACB 3MUVP 3BH7B 4C11A 1HNIB 2HIQA 3CDBA 3N5BA 4NLXA 5KFWA 3C15A 2JDJA 4DV7F 1SJ4P 1TK8A 4DQIA 4B9TA 4LUBA 2YNHB 3SFUA 3MOZA 3ET6B 3QRPA 3W9IA 1CS4B 4RL1A 4JI5F 2J9CA 4DPYA 2FLNA 1IBCB 1R8AA 2YX4A 2YKOA 1WEZA 1FJEB 3RW7A 4AXIA 3H5SA 5AE3A 2R7VA 5KT4A 3IBFB 3T6BA 5KFZA 2HSEB 2UUCF 4KHPJ 2XWYA 3QGIA 1U26A 3P96A 1GX6A 3W62A 3I0SB 1OY6A 3I0RA 1MSWD 1CSJA 2ROPA 4BC7A 4PYDA 1G1XA 1SIZA 1KR4A 4F4WA 3SSSA 3NGDA 3PCOB 1WTBA 2AIRB 5K5MA 3BGLA 3DI6A 4YMEA 2H48B 1TK0A 2IDLA 3BBFA 4BBYA 1WSVA 4P2MA 2VPWB 1H7WA 1NKEA 1VQSA 2E1AA 3S6EA 4UZBA 2OJ3A 1LWXA 1LWFA 2RIJA 2IVMA 3ISNC 1X5TA 4NA3A 3THPA 4X4SA 2J7UA 1U47A 1BLUA 3ETOA 3HD2A 2YKNB 4F4KA 3M9OB 1X5SA 1G4CA 5GADI 2UUWA 3OSPA 2R8GA 3NS6A 3UW1A 2FJVA 1T9XA 3KMQA 3JTPA 1VS3A 3PM9A 2Q6CA 1KQFB 2FHMA 5K8MA 2PEHA 2DGTA 4NLRA 4GVLA 1XR6A 2DNLA 3I0SA 4G6VB 4KIAA 1E6YB 2GMJA 1LEOA 1J2VA 4DEZA 5F8GA 3NCRA 2UVWA 4KE5A 2CG8A 1ZS6A 2YQ3A 1NRKA 3UCGA 1B99A 2F8MA 4ANEA 1VR6A 4LIWA 1RHRB 4NWBA 3DLBA 3LP0A 4ELTA 2R7UA 2MEWA 1E6VB 3O44A 4M5JA 4J9UE 4N7TA 4WFNQ 4B02A 1IJFB 1AXQA 4NOHA 4USIA 2WTFA 3OPKA 3JS9A 4DLGA 1B0PA 4HDGA 3BO3A 2W9BB 2ILZA 4ZLNA 4C3LA 3CJTA 2X7IA 3FCWA 5DO2A 2ZFHA 2V2QA 3HSJA 3ADAC 1U1QA 1WC1A 2VD3A 4AFFA 4NXMJ 1OMSA 4KT0C 3R8YA 5J2NB 1NHUA 4CO0A 2DT9A 2RB7A 4ANCA 3LWLA 4PQUA 2CPEA 3J81j 2QFJA 2D9PA 1KVIA 4RUBA 2VG7A 1TMJA 4B3RF 1HQUB 1JQGA 4ZIWA 1JLCB 2FUG9 1IKVA 1JB0C 3T1YF 1SC3B 1Q82T 2OIHA 4IDKB 2XZDB 1Q5VA 1WOSA 4O23A 4PXDA 5IT4A 5I3UA 1SKRA 2NS1B 4YB6A 3ZTOA 3KG0A 2HNYA 2AHOB 4EFAC 4QW9A 2C1EB 2JEFA 2E66A 3CB4A 4R0EA 3DCAA 4ZCLA 1OSDA 2YTCA 1YJ7A 1VJQA 2CPZA 4L3KA 4UF4A 4LSLA 4AE5A 3DLHA 1TFWA 4KGKA 4DV5J 4W4MA 1UZHA 3M8YA 1CBKA 2HHUA 2DNMA 4JI7F 2KTQA 1RHJB 1RT7A 4DZ6A 1FRHA 3AFGA 4IFYA 4F2SA 4OI0A 2XULA 1AZSA 4I6YA 2MZJA 4B9NA 3PIPQ 1RT6A 2KJVA 3AQPA 4X66F 5CYJA 5KG7A 2IBKA 3CMES 1WF2A 4G1QB 3TR5A 1R7IA 2XLIA 1NMEB 1RWUA 1N34F 2LQ8A 4IQMA 4KGXB 3RUBL 3PTWA 4L73A 4M63A 4RNHA 4M5MA 3TO8A 3NNHA 2QLWA 2A0FB 4QR1A 4YEAA 1LK7A 1F9HA 1W2IA 1FEEA 1MG7A 3HVTA 4ZCMA 1PG5B 2DXDA 1BQMB 4O3PA 2AZ3A 4DSFA 2GAHC 4ZVHA 5C42A 1XWLA 2MKIA 3CTRA 3T19A 5ADZA 3CCSS 5LMUJ 1OSCA 1ZAWA 2HAFA 4C4WA 3DRXA 3VVUA 4LSLB 3NOCA 1HWLA 1ZZNA 4H4MA 3RJMB 1WJ9A 2E1PA 2VBZA 2X1GA 3R5JB 4JP8A 3TZWA 1SL0A 2BABA 1Q4RA 2SXLA 4O3OA 4CLFA 1WHXA 8RUCA 3GWCA 4CLWA 1U48A 4M5NA 3PX4A 2GMLA 1CJUB 4CO4A 1R6YA 1SC1B 4RJVA 4DL0C 4ZJLA 1IM6A 2RDIA 5EX3A 1X0PA 4OLOA 3TAMA 2V63A 1IWAA 4G1QA 5HATA 5K8NA 4K4TA 1I3OB 1S99A 3IR5B 3MM6B 2VC1A 3IBWA 1U1RA 4Q44A 1XNQJ 1FK9A 4HEA9 2XSFA 3C2PA 2JEIA 1MU2B 1R0AB 9ATCB 4JV5F 1U8WA 4WZMA 2ZVSA 2ROEA 2JLEA 3RYLA 1AFIA 3LH2S 2KI2A 4R0JA 1JLBB 2DCLA 1NDKA 4DV4J 4JI7J 1OYEA 2DEIA 3BYPA 1WORA 4Y28C 4A8XA 5FDLA 3RAQA 1FRKA 1WKJA 1YZ7A 4KGVB 4ANDA 4UUWA 1LWCA 1FRMA 3K17A 5B08A 4DCOB 1U1KA 3EGZA 3BPSP 5DETA 1S6UA 3LPYA 4F02A 5B0CA 3S8SA 4LBIA 4DPXA 2DHSA 1EKSA 3W9HA 2G2OA 2R7QA 2YWGA 1FE4A 4UW2A 3GG1A 3EGNA 2DHGA 2VH7A 5EWFA 1C2PA 1H38A 2G1DA 1X8DA 4DL7A 2JEJA 2HIYA 3PEJA 5IV3A 1S1UA 1B64A 4ELVA 2A3JA 4PABA 4DN9A 4EI2A 1NSQA 2V4JA 3NBPA 1VQ5S 1YWXA 2U1AA 2VB6A 2CVEA 3LTOA 4BCAA 3VAIA 2VA3A 2F4VJ 2HHXA 2NPIA 1ZYQA 3GQCA 1WOOA 3EZ5A 3RBXA 2P9CA 3G9CA 5KFTA 3MMBA 4OZ0A 4YY3F 4J9VA 2RMLA 4EZ6A 2ZE2A 1URNA 2A18A 2JX2A 1J5OA 2JVOA 2O01C 1VC6A 4HH0A 2C2OB 1Q8BA 1AUDA 2LXFA 5HQ8A 2MKYA 1RHMB 2N3LA 3DLKA 2MZQA 1C4CA 2V34A 3FUYA 1YX2A 2E5GA 2DR6A 3H0PA 1Y5IB 3DU5A 4ICLB 3GCXP 3QT7A 2RNEA 4ZP9A 1HYSA 1GAOA 5HAOA 5EWEA 4O3QA 4KBIA 5LJ3Y 1ITPA 5HVFA 2IVFB 1HMVA 5A6WA 4QIFA 2CPYA 2P6SA 4WIQA 3LP2B 4LVNP 1U0HB 4MFBA 4OYOA 2BOAA 2Z8QA 2J7WA 3TUIC 2XMAA 3BQ0A 3HJFA 5EN1A 2DNGA 2CDRB 2DYAA 5E3CA 4JI4F 1HBUB 3IM9A 4FF2A 2Q66A 2HHWA 1HD0A 4JV1A 4LBHA 1ELOA 4K4VA 5IC6B 2YVSA 4LRCA 4RNOA 2JHEA 3LA0A 4GKKJ 4RWWA 3D0IE 1B3TA 5K20B 1ZAXA 2B9XA 5KFSA 1RKJA 4LF8F 3RB3A 4KPYA 3OBIA 2W4PA 2ZBQA 3E2EA 1UJ5A 5DM6Q 2LYVA 4R5PB 3KLGA 1J5EJ 2QMXA 2DHXA 1N88A 3FBFA 4J9RA 1R43A 2HBZB 4OYIA 2UXBJ 3QWUA 4NE9C 3OTEA 2F4VF 1YTYA 5J1PA 1VJWA 2DH7A 2HFNA 1DTQB 3PW5A 2HBQB 4QR0A 2HHHJ 2RT3A 5KFPA 4DU8A 3T1AA 3PYDA 5JVGQ 1OQ6A 4MKYA 3J7AN 3TQEA 5DDOC 4PPDA 4CO3A 2BRLA 3ZZTA 3BR8A 3C14A 2HK3A 1KLMA 2EXUA 3K7RA 2YNGA 2MKJA 4IG0B 1GNKA 1RT2B 4DDFA 2JRSA 3MEKA 1RAHB 3A1YG 1YGYA 5KFHA 2EFOA 3NRBA 4LSNA 1UFLA 2D7SA 2Q43A 3TVZA 2OD4A 3BN7A 2R7RA 2YX7A 4TU9A 3CCJS 5F8NA 2GGPB 2BACA 2UXCF 1D3WA 4HT5A 5D0HA 5F3TA 1BWVA 4RBVA 4U8YA 2KT2A 2RJZA 1GXTA 2H5IB 3VQSA 2OI2A 3KHRA 2QL5B 2RS2A 1U02A 1TU0B 2XQCA 1WC5A 4OIXA 3MR5A 5F8JA 3MEGB 3UR0A 4MK9A 1K9MT 3MCMA 5LL6d 3L9ZA 1ZM3A 2KDOA 3M6WA 1Z2LA 4PCQA 3CXCR 3FEYB 2JSXA 4J9MA 4C8KA 2BBEA 3CEDA 4FKXA 4U7UD 4CO1A 1WI6A 1U1LA 1RWMB 1S1TA 3OT9A 4XO0A 1S6PB 4TY8A 1NAQA 4G65A 1U6BA 3M6XA 4MKBA 5ETMA 1APSA 5KFVA 3I0RB 1YJUA 2I1RA 3TJAA 1JX4A 5A6PA 1PJ7A 3RRKA 3M8PA 1K0VA 3MR2A 5DG9A 1NK7A 3W7BA 2GGPA 4E98A 4HHUA 4RZRA 1TKZA 1U1OA 3FBBA 1K1SA 3KG4A 1SH3A 1TL7A 2VFRA 2VL1A 1NLKL 1FVSA 3HF5A 3PIOQ 4P7TA 1YJVA 4OX9F 2ZKUA 4LSZB 1T3NA 2E7VA 4ATNA 2E5HA 1EQMA 5HLFA 3OJSA 2AJQA 1JLFA 1XJWB 4IR9A 3MEGA 4J9NA 2JC1A 3ZFVA 1RISA 2ZKTA 1A0OB 5EGYA 4QWDA 2CJKA 3DDIA 2WVDA 3W2WA 1FEHA 2JZ5A 2XO7A 4ZCKA 4YN3B 2K7JA 4DR6F 4OJGA 1RAAB 1CEZA 2B7CB 1R8PA 2ASYA 3QT8A 1F3VA 4EO6A 1FDAA 1LWCB 4IYQA 3A3NB 5CYQB 1NB7A 1B4SA 1XTZA 3VAKA 3MWBA 4ZPVR 4DSJA 3I56S 1RA7A 1S1TB 2J9DE 3X3UA 1OO0B 1U0SA 1HNVB 2CRLA 2F65A 2MQNA 3WZ0A 3CCMS 2WBMA 1B70B 4A47A 1FFGB 3D6TB 4CLZA 1FHTA 3RGIA 5KG6A 1N8RT 1FRLA 1Q5YA 2OPRB 3EVMA 4ED3A 3MM9A 2CVIA 3EICA 5HMYA 1OQ3A 2HYIB 2R8IA 2V4QA 2XMTA 3SCKE 4ALZA 4DFJA 3NGSA 3MURP 2VOOA 1XERA 4ZN3A 1H98A 1C0TA 4LQ3A 2BE2A 1T03B 2MGZB 3OVBA 1UW9A 1WC4A 2BE9B 3C6TB 4I6WA 4MIAA 5DLGA 4WFAQ 4DFMA 4WF9Q 3M8RA 1NPKA 2KFNA 2A2CA 5KFAA 1WEYA 4USJC 3N6MA 3VTIA 4DPUA 4U6PA 2ZBCA 3PZPA 1JIHA 4QIGA 3T1HF 2DVIA 1HD1A 1PJ5A 2ZWPA 1JXVA 1KBRA 5D0EA 2MLYA 1RAIB 2YY3A 3BSCA 1UVMA 2PIIA 1F60B 3CJSA 4AL6A 1HARA 1U25A 2PT0A 5KT7A 4MFBB 1FKOA 2EG2A 4DV1J 2MHNA 4HL9A 4N76A 4DI6A 3HVWA 2ZJPQ 2BOPA 2Z56B 2K1RB 5E3PA 2DHAA 3F0NA 5E5NA 3C66A 2HWIA 2R7TA 3D6MB 5FLXU 1Q78A 2DO0A 3DGPA 4NLQA 1AW0A 5LOQA 1RWWB 2ADCA 3ENVA 5BR8J 3H42A 4ZVOB 3Q22A 2UUCJ 1UCNA 1TUWA 1UEKA 4IRDA 2J6SA 4KV8B 2CZVC 3AH6A 1Y5LB 4DZDA 4F4YA 4ZKAA 1NK8A 1RXOB 2L08A 2HHQA 1PIEA 2IPOB 2F7VA 4YFUA 1WC6A 1VHIA 1X5PA 4JB8B 3PO5A 3PY8A 3HSDA 5B0AA 1XNRJ 1TV6B 2IM0A 3IRXA 2IDEA 4D3HA 3BGOP 4AL7A 2FVRA 3KKFA 4NLSA 1S72S 4M1KA 3KLFA 4DR5F 2LDIA 1WACA 2OPSA 4CWBA 5L1IA 1SKSA 3ZC4A 3KUEA 2CWKA 3E01B 2XCPA 5L1JA 5A0YA 3W1YC 2XY7A 5D15A 2B51A 2KFYA 1Q86T 2J6TA 2R7SA 3MMJA 2DNPA 3D1QA 3CWJA 1DQ8A 4KGMA 2HFVA 5DG7A 2DH9A 4DPOA 1FVQA 4PWWA 4WYWA 3FKBA 4C8OA 2VUGA 3KK3B 3KJQB 1QAXA 3GP9A 1DJ0A 3OR2B 4F7VA 2PO4A 5CYMA 4P2SA 3J81Y 2BVZA 4I4BA 4J9QA 3UR3C 3MPYA 1S10A 1GMVA 3M05A 3ILOA 3PYFA 2B56A 2HPUA 1IKYA 2H9ZA 4PG4A 3ZZOA 3NGUA 2LQ5A 1HA1A 3KYLA 1K44A 2V9WA 2E9TA 2MQPA 3CT9A 3N79A 3UVJA 4FS2A 3NL0A 5KOWA 2MLZA 1RAOA 3P8BB 3IRXB 1S57A 3BV8A 4HDHA 4OJ1A 5D3GA 5BR8F 4NXNJ 3KJVA 1WG1A 3RB4A 2OPSB 2OEMA 1VQYA 5M2PA 2W01A 3QGPA 1Y5NB 3MEDA 3JTOA 4NYZA 3U1NA 4Y6IA 4GMKA 4A48A 3VAGA 1VBYA 2R3VA 2MJNA 3BQ2A 3DOLB 3ETMA 2ZJRQ 2H1YA 4F26A 4JV2A 3OL8A 1T05A 4HH1A 3MCNA 1S0VA 3B78A 3TARA 2QRRA 1RT1B 1YBUA 1Q1KA 5HLFB 3C8YA 3FBEA 4RU9A 3TVYA 1M1HA 4L3NA 1F6TA 1TQLA 2LXIA 5D0GA 4NI2A 5D4LA 3V4MA 2BYCA 2XSJA 3JQMA 2O3DA 3C15B 4TNOA 4URQU 2A2DA 3SYZA 1B0VA 4UOFA 4PUOA 3QJLA 2O1PA 5AXKA 3AJ1A 3L7UA 3TA1A 4A8KA 3SV3A 3PW7A 1UVIA 1YVFA 4LF6F 1RKIA 4QPXA 1YHQS 1IQZA 2Y8WA 3Q8RB 3M2VA 2IRUA 1ZZFA 3PJ9A 4ZP8A 2QEXS 2CQGA 1SBRA 4X66J 3RAMA 3BGRB 4JI6F 3SSRA 2UXDF 1HYSB 1UJ6A 1TFYA 3QJJA 3R97A 3N01A 2WW8A 5BYQA 4CLKA 4ZN1A 3T3FA 2QG9B 3RB0A 2LA6A 1RT4A 1CJVA 1LWEB 2WB1D 1FRXA 2GJ2A 3QLHA 2XNRA 2FC9A 4J9LA 3V6DB 2LXUA 5A8WB 4XDCA 1I5OB 3AY0A 4W90B 3V5RA 2DY1A 4C0BA 5K8PA 1WC3A 4G1PA 2UUAF 1ZPWX 4OLPA 1X4DA 4CM0A 2QYGA 5ETSA 4KHRA 2OEJA 4ED1A 2DR8A 2JL9A 2Z2LA 4YP3A 2QGFB 4NX9A 1S7IA 5THWA 3N6NA 2XMWA 3CO9A 2ZH9A 3L7OA 1EAYC 4U7UK 4X2BA 2J5AA 5C7PA 1T9TA 5A76A 3TVKA 2QLXA 3DOKB 3G8SA 3EJMA 3Q0AA 4DR3J 2AEFA 4ECUA 1HNXF 2J8AA 4HHHA 3N4WA 3NWRA 2CQ4A 1JK9B 1RWOB 2BEFA 4WFYA 2M5YA 4H54A 1BGXT 2BJ7A 3QIPA 4YDDB 1VQ6S 4CLTA 1DTQA 1DY3A 2LQJA 4U96A 1KQGB 2C3YA 3VR1A 2QTWA 1H0HB 4J9KA 2DRAA 1F5CA 3D4JA 4CM2A 3J7Z5 3GR1A 2ZHAA 3KTQA 3M8WA 3PO4A 1RADB 2K3KA 2VDIA 3VAFA 1KLMB 2WVFA 3H5YA 1U1NA 4KAIA 3CIMA 2I38A 4ID8A 3V6KA 3E3XA 1PBAA 2WK4A 1JKHB 2XWXA 4DR2F 4PXEA 1RGVA 4CZCA 5IFMA 5HP1B 1RBOB 1HW9A 1KKHA 4NEYA 1TZ0A 1RWPB 4NEZA 2MLXA 2HHSA 2UXDJ 4O3NA 1FD2A 4K0KF 2B43A 1AB8A 1P9YA 1Q16B 2ACYA 3CJ8A 4OYPA 4USVA 3G8QA 5L8RC 3UDLA 4CP5A 4YR0A 2AWZA 3HFZB 3S1TA 4UOGA 1LV5A 1AA1B 2IYIA 2H3EB 4FYDA 2APOA 2HMIA 2LVWA 2AJ0A 2P5VA 4IDKA 5I3UB 1LXJA 1HNZF 2HVIA 4HI1A 1IBMF 3THVA 1S0NA 2B6AA 3K5MA 4QIEA 4Q7AA 4XTTA 1JLGB 1N6QA 3HHNB 4DV3J 5L46A 4GC6A 1HQEA 1LQ9A 2UV8A 3QMQA 4I1TA 3WX8A 2MQ8A 1VQPS 2AEJA 2OLWA 3QSIA 2JVRA 2FJEB 4RW4B 4TY8B 2R2SA 1RT7B 1PJ6A 1QTMA 1IKXA 1XQIA 3OVAA 3N9UC 4DX6A 2RS8A 2AX0A 3T6JA 1JKHA 5IWAJ 1XBWA 1D8ZA 3D0GE 3GYGA 4E2FB 2DNZA 3O2IA 5H9EK 3HT0A 3MM5B 2WONA 5KT6A 2LU2A 3EPIA 2YH0A 3RU0A 3RRHA 3AB2B 3JAMU 3GIJA 2GCFA 3U1MA 2B5JB 1ROFA 1T8EA 1JNZB 4LF7J 2XGQA 1KNZA 3GIKA 5E3AA 1VK3A 2EBEA 1JLAB 2WSFC 1RBLA 3VGUA 4F4AA 4UT4A 4KH1B 2X1AA 3L09A 4DQSA 1FNOA 3CJKA 2DXEA 3K89A 3KK1B 1QTNB 4M8LA 1Y4ZB 3G71S 1BC6A 5KFJA 1JLQA 3VHQA 1JLGA 2LKZA 1WHYA 3M8SA 4LFCF 3K5PA 4ED5A 5B0BA 5ETOA 3TANA 2AYBA 1S1XB 1SL2A 2HWTA 2ZOFA 3D7SB 2BXJA 2BRKA 4OZ2A 4RW7B 4J5OA 5BYSA 2ATLA 1HNVA 4H4KA 4YDXA 4IQXA 4P7VA 4U9RA 4DUZF 2BA9A 1DAXA 1E6YA 1WTFA 1WF1A 2NXEA 3H5UA 3SFGA 4RW9B 4URSA 1NB2A 1K73T 4F0HA 5L9NA 1VIXA 2KFZA 4RW6A 2QA2A 1C1BB 3SCIE 3BDPA 4NMXA 1MU2A 1UPMB 4ZVPB 1JXLA 1X60A 2VZ9A 2CQBA 3IXQA 4F3MA 7FD1A 1LXNA 4ECZA 2Z0GA 2X1FA 4PRFA 5L1KA 3PDNA 5KFOA 4DJBA 3HXMA 1FE0A 3BB5A 3NP5A 2FY8A 2RRNA 2V50A 4HTIA 2YNFA 2DITA 3PR5B 3PACA 4I64A 3EE3A 4DXLA 3QQCD 1SKUB 2BKOA 2GJFA 1X4CA 2RU9A 2V8GA 2WVCA 2GHWA 5IT0A 1YITS 2XMMA 2VFTA 1MWQA 4IOCQ 1R8HA 2HNZA 2RAQA 4MT1A 3TWZA 2DGXA 2Y1RI 1NJYA 4JI3F 1FO1A 3IAM9 1WD6A 4CQ1A 3HX9A 1RSCA 3GJSB 1KHWA 2DEJA 4I7FB 1U2CA 4Q2LA 2ZM6F 1IWGA 4DV7J 2KZZA 3P45B 3HPOA 2IBOA 4PKDB 3H4DA 2MHEA 3CGIA 3PRVA 2G0CA 5IM0A 4DS5A 1ZM2A 2IC3B 3DM2B 2DBBA 1RK8A 2AGOA 5HVGA 1VQMS 4R25A 1GTHA 2RD5C 2UV8G 2XLJA 4IO9Q 2LCWA 3R7NB 2XS5A 4CIOA 4LJMA 4FXVA 2L9DA 1UVKA 4DUZJ 2V2KA 2LFVA 4RNFA 5H9FK 3DOMA 1NBEB 3UDEA 3FSYA 2BR0A 4F04B 2JLGA 3BO4A 2QV6A 2CNOB 1X9SA 1NKBA 3JSYA 1S9GA 1IBLJ 2HQ3A 1RCXB 2MY7A 1UFWA 3PW4A 3MI7X 4UOHA 2W8LA 2VG6A 3SQGA 3BZQA 2V68A 2AU0A 3GFXA 2BANB 3BQ1A 1RHUB 2BJDA 3VGSA 5T41A 1Y3KA 1NZAA 1M1KT 5B7WA 4NA1A 3DC2A 3KLFB 3DLLQ 3P49B 2DNRA 4UZCA 1A6LA 3KHGA 4ECWA 2HEKA 4HKQA 2K7KA 3E01A 3PHEA 4R8UB 3GV5B 1DURA 1UW4A 4F67A 1TL1A 2VG5B 2MZSA 5DGBA 1FKAF 1FT8A 3FCVA 5F8MA 3Q2SC 3QPIA 2W9CA 4AXJA 2Z57B 1T02A 2VQEJ 3MHYA 4G3IA 4C8YA 4ES1A 5CHCB 2PA3A 1N36J 2FC8A 4DQPA 4OX7A 3PW0A 4UUXA 4B9LA 1HHSA 3MEEB 4X65F 1S1WB 1VC0A 3DOMB 4OQJA 2VHGA 4Q2MA 3R5BA 4HLBA 3HHEA 1SC6A 1R0AA 4TY9A 1ZPVA 5KG4A 4CI0B 4DBQA 4ZLJA 3W2VB 1YLXA 3I9ZA 2Z2MA 3A8IA 4QIWD 4USTA 2QX0A 3VVTA 1MROB 4YB5A 4CO2A 5CD4A 3KLHA 4A4JA 5H9EJ 1WNEA 5HQLA 2BX6A 2BQRA 2DGQA 2BANA 4OHXA 2BJ8A 2VBWA 4OYAA 2BV3A 4DV0J 1BMQB 1U49A 4PG7A 3CJRA 3OTBA 1QE1B 2DHHA 1RTDB 1S9EB 3FGVA 3QZ8A 1KWMA 3ZO7A 3GZ7A 2ZOGA 3OTCA 4E0DA 1ZH5A 3ZZ0A 3MEDB 5HBMA 1RE1B 5U47A 3SBMA 4EYIB 4QU6A 2AJ4A 2YBVA 3A8JA 4LSNB 5J1NA 3PR4A 2EVZA 3TEGA 3M8QA 2WOMB 1NUEA 3W8GA 1I6JA 2E9RX 5ETVA 4PXBA 3CC4S 2C28A 1X4BA 3TRGA 3V4IA 4NLOA 4NLPA 5K14A 1VQOS 2B5JA 4JBCA 2C2KB 4USMA 2GS8A 1W26A 1V9OA 2J9EA 2YNIA 3VCDA 3MFIA 3W2VA 3B6BA 1HWKA 1SL1A 2ZE2B 4N8OA 4DU7A 1YRUA 1C1CA 3CJKB 2BKPA 2ZHBA 3CCES 4RU2A 2H5JB 4ID5B 1X4AA 5A2QY 3IRWP 3PNIA 1VQ4S 1JLQB 1U8SA 3L95X 3EWGA 3KFWX 2DGUA 4ZVUB 2N82B 2KU7A 2I5JB 2BUNA 1S1XA 2YXLA 3NLCA 4I6AA 1U1PA 3VF0B 5B0DA 4ETXA 4YQWA 1KN6A 4B9VA 4YB7A 1FXRA 1RTJA 2FLLA 2HHPA 2QL9B 4WXOA 3U1LA 4CLLA 2N4DA 1ZTWA 2QIFA 2CWXA 2XGPA 1NK4A 1Q0NA 3RG6A 3M30A 3TOQA 1CULA 4KHMA 5HSPA 2N3OA 1X4EA 4HYKA 4F8RA 2OTJS 2I0XA 3B4MA 4TU8A 2A6OA 1CC7A 3CDWA 2GV1A 2BM0A 2M0GB 1RWKB 1R31A 3DLEA 3IMQJ 1SC4B 1VISA 4CH1A 2NXCA 3BSNA 1YJWS 1VGYA 1XNRF 3R2DJ 4CH7A 4K4ZA 1GK8A 2M9KA 1W2BR 2RDDA 4DR5J 2YKQA 1VQ7S 3PRDA 2RILA 5AXNA 1MWYA 1N5YA 2YPYA 1XMOJ 4ED6A 3TUJC 2A1BA 3DKDA 2EFVA 2CQ2A 3LGNA 3KLGB 4H4KC 5CD4H 4ERDA 1RA6A 1B7YB 1FKPB 5T14A 4QBUA 4I2PB 1TL3B 1FX4A 3GIIA 3LQVA 4B3TF 3FQLA 2EC0A 3CMAS 2XMJA 3Q8SB 1XNQF 2QT7A 1ZM4A 1AFJA 2H51B 3M8ZA 1WDDA 1U6ZA 1N54B 1IR2A 3Q8PB 3VALA 1OIAA 4C8MA 2A10A 3QGGA 1PBUA 2DGWA 2MDAA 4USKA 1SKWA 3O5TB 3A3OB 2ZNYA 2J7KA 3I4HX 4UQTA 1RWVB 3DLEB 5C2GA 3PJWA 2MTLA 2WAQD 2Y0BB 3M4XA 5HVHA 5HP1A 4LFBJ 1RYRA 4CYUB 2YQ0A 2YKMB 1D9FA 3A8EA 2MYFA 4KFBB 4ZPBA 3AJ2A 3QAEA 3PW2A 3GSDA 1U45A 1HQUA 5GMDA 3LO3A 2AYGA 3N6LA 2GIFA 2V2ZA 1EARA 3HJVA 5GAHU 3IWXA 1Q81T 2Q1LA 1UPPA 2RRBA 4JI0F 4DV2J 3IS9A 4WPAA 3SQGB 4Q45A 4P71A 2CJQA 3J7YU 1S48A 4ILLA 3C46A 3OQ2A 4OI2A 2CPJA 3SEOA 1MN9A 4U8VA 3R2CJ 1HLWA 4DL6A 4WE1A 2Y0SD 3L3CA 3TQ1A 1X9WA 2NXNA 2ERRA 4PWDB 1F9EB 2BW7A 3LF0A 1S6PA 3CCWA 3H25A 1RABB 4DR7F 2HAIA 2AT1B 5M2RA 3OUYB 4FNHA 1PILA 4P9SA 1TL1B 2RKIB 2FTRA 3E51A 5F3ZA 3PHTA 5LXYA 1XEZA 1S1VB 2XG8A 3DGPB 4IO1A 5KFXA 8ATCB 1DQ9A 4RNMA 2XY5A 1VQKS 1ZOTA 2F63A 4DR4F 1JNRB 2GFFA 3I5AA 3CCTA 4DPTA 2OAUA 2MQLA 2NXJA 2IM3A 3D9BA 1F5AA 3ISZA 2DR9A 4JI6J 1FJ7A 3PXGa 1RHKB 1M1GA 1YJTA 1H3DA 2HFZA 4LREA 3I55S 3HVRA 1N5QA 2V67A 1REVA 4EBEA 3GONA 1UTAA 5L1LA 1UA1A 1SJ3P 4N41A 3T41A 5AXLA 3CCUS 4IOAQ 4OFZA 1FNMA 2GVZA 2KO1A 3LGHA 4FKYA 1SH2A 1DTTB 2GMHA 2M4MA 2FHJA 2MJUA 2JNJA 1X4FA 5D6GA 4OYXA 2F9JA 3JYTA 4GO7X 2KHDA 4LFBF 4OL8A 2DO4A 3GB0A 3BH6B 2CUYA 4GKKF 4LFAJ 3IWNC 1NPPA 3T9NA 5C2CA 1VK8A 1VC5A 4KB7A 4PG8A 4ZDNA 1N5VA 5GAGI 2Y8YA 3CC2S 1BQXA 2MZTA 1WHVA 1O5JA 2IM2A 2RHSB 2WOMA 3LALA 4LRAA 1VBZA 4FF1A 4LF1A 5AJ3F 3JTNA 3ZTSA 2HZCA 3HI9A 3KK3A 4C9DA 1IKWA 1T11A 3F41A 2M2BA 3KHHA 3FZ2A 4DCPB 1M5VC 4MIWA 5KFCA 4A8YA 1S0OA 1WEXA 4F3OA 5C25A 5KT3A 2MGZA 4AQYF 1F9FA 2CNNB 5KFNA 2R8KA 1C1CB 2W2OP 2QC3A 3R27A 2F9DA 3M2RB 3NGKA 5ETRA 1KOOA 4A8FA 2VFVA 1NJIT 2FHOB 4L6V3 1BY9A 4C48A 4RUAA 4B3MJ 3JYTB 5F9LA 4DR2J 2DNKA 5D3GB 2ZNZA 3NNAA 1UVLA 2UXCJ 4F2RA 2RE1A 5ETPA 2V2VA 5AXMA 3J7A1 1B7FA 2B9EA 1RTJB 2HFOA 1TK5A 5AT1B 4K0KJ 2DKOB 3R6LB 3OHBA 2LMIA 4LF4F 3PVXA 4PG6A 2Q3PA 1NK9A 1QM9A 1FWPA 3Q8VA 3EXCX 1NHVA 1E6VA 3NCQA 4EUVA 1RT1A 1JJ4A 1TL5A 4USUA 4K2JA 1P27B 2BQUA 4ILRA 3H2LA 1FF2A 2VFUA 1Y00A 5IV4A 7AT1B 1T94A 3WQPA 3ONQA 4QU7A 1SV5B 1SJ1A 2I9SA 1HQ2A 3MPDA 2XNQA 1BQNB 1K1QA 3DLGB 4PZVA 5D77A 3QRRA 2B4PA 1L3SA 1WWHA 2MSTA 4LBPA 4YOEA 5J2PB 2C22A 2FQQB 2V0NA 3BEGB 4KV8A 4NYPA 3CE8A 1TAQA 2KHCA 1NEEA 1AT1B 2MQMA 3D67A 3MF5A 2HFUA 1KDNA 3BBBA 5DGAA 2GVDA 3FNNA 4CTAA 4XPEA 3MZIA 2LECA 3I87A 2B4UA 1MWZA 2IFXA 4RW8A 1FERA 1KLNA 5E0OA 3OLBA 2D3ZA 2F1FA 2I8EA 3H90A 4J90A 2CQDA 4LF7F 3HFVA 2IA6A 2DH8A 1LOUA 1RT5A 1WI8A 1CJVB 4ZVSB 4DR6J 2FVSA 4Z7YA 3I31A 3T5KA 3TX8A 1YSJA 1XN9A 2OUGA 2R42A 3GMGA 4NLWA 2GHPA 4IFYB 4LFCJ 2KRBA 3GE9A 4FBUA 4CLSA 2NUHA 1UETA 2GJIA 1FNXH 3DRPB 3W61A 4BWMA 5E41A 2R8HA 1BQNA 3DLGA 2ZH5A 1IUJA 5JVHQ 4ECYA 4KHPF 2VASA 1O6XA 4CH0S 4OMFG 3MGJA 3VQTA 5CYMB 5HQMA 3MECA 3N0VA 3X1LB 4FPRA 5B09A 1BHNA 1RAJA 4JYAF 3SIPB 3CJQA 3JQKA 2FZKB 3R6GB 1BQMA 1DQAA 1Q79A 3IGVA 3SCJE 2YNHA 3QIPB 3KDNA 2CADA 2YWFA 4X84A 1VIOA 5JUMA 2XYHB 4Y2MA 4WE1B 3UN2A 4PWUA 1KEKA 2RUSA 2YWEA 4HR2A 4UOCA 3PRBA 4URGA 2UUTA 4PWDA 4HACA 2DNHA 2FVCA 2QJ3A 4H4MB 4NZ0A 2GAGC 1DLOB 2MZRA 4BHQA 3BREA 1CG2A 4OHZA 5CZXA 3HHLC 4DQQA 4RBUA 4UY85 2RUGA 2XM3A 1Y9OA 1G3OA 1UVNA 3TZZA 2E5LF 3FDSA 4AL5A 2GW8A 3G82B 1D1UA 2CQ3A 1O0PA 4QZVB 5B0GA 3Q24A 3KLEB 4TLRA 2VKRA 3LP1A 2PDAA 2OMOA 4H4OA 4ZP7A 4K4SA 2XMUA 2NLWA 3DLJA 1HI8A 2OMLA 4A8MP 1RP5A 1UWBA 2CZ4A 1PC5A 5A8KA 3GV7B 2ZM6J 1O8BA 2NQPA 4MTPA 1MN7A 1S5ZA 3CDUA 2XS2A 1VI7A 3LUYA 2OPQB 2P2CB 3GPAA 2W7AA 2ZITA 3JSRA 3AXKA 3M9NB 2R2UA 1DTTA 1NDLA 1RB0A 2QSWA 3TX0A 5DQGA 1NJWA 1KRPA 1B0TA 1H2UX 2DY9A 2IM1A 1CQNA 4CLYA 3MD3A 2EFGA 2P8IA 2PD1A 4N77A 4KRWA 2W2NP 3IWLA 3CDAA 1DLOA 3UI3A 3HO1A 3EMTA 1GEHA 3DFEA 5RUBA 4M5KA 2XY6A 4M5HA 2G13A 5AE2A 4OYBA 2V8VA 4B9MA 4LMZA 3DYAB 4JYAJ 3T1YJ 4N47A 1Q95G 1LWEA 2PE8A 1IR0A 3QLHB 2ZH2A 3JB9k 1NHKL 1RLDA 1PC4A 1TL7B 3R5AA 2UZAA 3KLEA 4Q0BB 4IOBA 2HBRB 2OSQA 2X3GA 1AYEA 1KQKA 4WZQA 2H4YB 2LEBA 4NLVA 3MUTP 1TKXA 3WC0A 4NRUA 2QSFA 3MMBB 4OYZA 2YKAA 3B54A 5E33A 2EK1A 2MQOA 3MR3A 2J9DA 3VZHA 3IN5A 4ED8A 5J2NA 2Y1IA 5DZ7A 1N32J 1ZETA 2L9WA 2XEXA 4I68A 2KM8B 5IZHA 1IKVB 2IYGA 4ZCIA 4GKJJ 1FKPA 1NU4A 3TP2A 3FSIA 3ZZUA 4ECTA 4RW7A 3L7PA 3WC2A 1SXLA 4P2XA 1HWJA 5KFMA 3G96A 4EWTA 1L3UA 5D4OA 4C7QA 5J2MA 1S0MA 1OYDA 3ILLA 1HFEL 2KXNB 3W65A 2DD8S 3R7BB 3J80Y 3OVSA 4NA2A 2FY1A 3THTA 4M94A 2E9ZA 1Y3JA 1FTCA 2LEPA 2VDHA 3M1VB 3W9JA 4C8ZA 5CAAA 3EZOA 3DI6B 4KY3A 1IM4A 1Q53A 2OD6A 4ZITA 3GILA 3HLUA 3FMBA 2COLA 1YJRA 3LAMA 3A3PB 5D78A 5F0UA 2P9GA 4NCGA 5B0FA 3OSNA 1QAYA 2R2RA 2ZH7A 2RDJA 2FLPA 2R2TA 4LRDA 2CZ9A 4K59A 4GC7A 2CYYA 2E1MC 5HMZA 3D6FB 2B8PA 4NXNF 4JI8J 2NZ4A 1LWFB 4Y2CA 2NPFA 1H7XA 2FD2A 4EK2A 2V69A 4WU2A 2V4RA 1LKZA 2M52A 5GMKa 2XHWA 2QMWA 4KFBA 5LSLA 2RU3A 1H73A 4X62F 3DRSB 1FRIA 5HJXA 5BYRA 1CLFA 2WB4A 3H2VE 4M5DB 1X9MA 5C42B 4Y2IA 1T9VA 3CVKA 2E44A 4FXDA 3CD0A 1IBKF 4ZPWR 3IO1A 2XZTB 1F2HA 4NLUA 5JJBA 1N6QB 3GFYA 4QCLA 2PMWA 1HI0P 1HBNA 4WFZA 2AYMA 1U6FA 2F3JA 2AGPA 3BS9A 4IG0A 3F56A 2YNGB 2ADBA 2DR5A 2IVYA 3DM2A 3GU0A 2DRDA 1JJ2R 1OPIA 4B3SJ 1IQTA 1HWIA 1NK6A 2BJ9A 2PMZD 4Y34A 2KN4A 3QZ7A 4DUYJ 3C3LA 2H54B 4OHYA 3DRPA 2GQQA 3VAJA 2ZD1B 2QA1A 3IA0A 2CDQA 3MMAA 2FDNA 3ZZZA 3NMAA 2R4FA 2QZ8A 1NXIA 3MAAA 4JOUA 3DRSA 1REVB 2OP5A 4LF5F 1N0UA 4FYXB 3UN5A 5E3RA 2MY8A 3PG9A 1HR0J 2C2DA 5B0EA 3WBZA 3GJQB 3LWMA 2JOQA 2WRMA 3A12A 1WC0A 1LFWA 2HNYB 2K2PA 1HPZA 1C4AA 3KXDA 4DG1B 2F8EX 4RUCA 1H2TZ 2IHR1 1J27A 3NEKA 3Q23A 2QMUB 2EWHA 2H5EA 3I82A 2VJVA 3W8PA 3UD3P 2W7OA 1NDPA 1L3VA 1VQNS 3GR0A 2ZH1A 4NXMF 4W92B 4FYYB 4FNIA 1TR0A 4P75A 4Y2KA 2NREA 3JSMB 5KFLA 4B3RJ 1WOPA 3H2UB 1NSPA 1GXLA 3KDOA 4LRFA 5KG2A 2HZVA 4FVCA 3D6HB 2D3UA 2Z2ZA 2ZD1A 5LSRA 5HK4A 1IKWB 3G4SS 2EEYA 4K4XA 2KYZA 2VFSA 3K8WA 3OFEA 4ZVTB 4WP9A 3UNYA 2I2YA 3DXSX 1RT3A 2F40A 3BR9A 2C3MA 1JLEB 1H72C 3MPVA 3FFIB 5E7OB 1JLFB 3RBZA 3HVTB 4ZLPA 3OR1B 5HROB 1QVGR 1KQSR 3MUMP 2Z58B 1FFSB 1IKYB 1UWAA 4P52A 3VGTA 3KLHB 2YH1A 1S97A 3PX6A 1J5OB 3ET6A 1TKTA 3R5DA 4OYWA 1W25A 1JWWA 4B3SF 2L41A 3TA2A 4MYTA 4ENOA 3DMJB 1WELA 3HFKA 4F50A 3JSBA 5C24B 2VC0A 5CYQA 3QJPA 3UO0A 2OKQA 4A46A 4ED7A 5I4MA 1U1MA 1PAUB 4Y0FA 3DRRA 4OZJA 1EX8A 1QUPA 2G0JA 2NYHA 3AQOA 3R3TA 4ZVRB 4F25A 5HJYA 4B3OA 1X31C 2W2PP 2XTJP 1SQGA 5HBMB 3OFFA 4N5SA 2HS0A 2KT5A 2V94A 3MDFA 4MK8A 3W64A 3FJ2A 4WCEQ 1HMVB 2DXFA 3AA9A 3M32A 4RNNA 3AOAA 3BSAA 4X4OA 3EX7B 1RUSA 3K5NA 4E8UA 2F4FA 1VRTA 2VONA 5EX0A 4FF4A 4QJVA 4Q0BA 5IM0B 3TEHB 4NL5A 1U09A 2XLKA 1RZMA 1PYTA 1TKXB 1RT3B 3AT1B 2D69A 4NI2B 1C0TB 1JXEA 5KFBA 1X5OA 2DIVA 2QLBB 3FZBA 5F0WA 4WP3A 6FD1A 2KRRA 4O3RA 2QN6B 2CG4A 2B4VA 1HBMA 2HBYB 2BJ3A 4OHVA 1WUUA 4R5PA 3DMJA 3HHDA 2Y1JA 1WF0A 3QO9B 2B3TB 5IC4B 3V2UC 1UFKA 3AHPA 3GIRA 3M7VA 2IJFA 4ZJOA 4UY8T 5CZVA 1UVJA 4IH5A 4Q8FA 3CJ2A 4P2FA 4WKYA 2UP1A 2Z30B 3JQJA 3KJNB 2YPZA 6AT1B 2KG1A 3MOJB 1YQHA 3OLAA 2AMCB 1UAWA 4ZP6A 2AZ1A 2FHJD 2IJNA 5LT5A 4PPZA 1HI1A 2IRYA 3GV8B 4DV4F 1Y11A 2B4OA 3K5OA 4HVZA 1DHMA 3KK1A 1YDLA 2AX1A 1GX5A 4WP8A 2Q6BA 4ETZA 1VBKA 4FDFA 3H59A 4L74A 1FXLA 4RLEA 1HBOA 1VRQC 2JEGA 1HNWJ 4WK3A 1RAFB 3BO2A 2RRAA 3AODA 4DN0A 2CA9A 2ZZTA 2DB1A 4GVBB 4PR6A 2XMKA 3DXBA 3KLIA 3T5JA 3EVWA 3KK2A 2C42A 3EGVA 3KG1A 4LVOP 1VYAA 2CJ9A 2GIQA 5HI7A 3PFOA 2YWHA 2WW4A 1QSSA 1QJHA 3IGNA 3KUGA 3D0HE 2ZBRA 3Q2TC 4XDDA 1GH8A 4LF2A 3R9LA 3LGMA 1S4EA 3LOUA 3R7SB 2AQ4A 1HBNB 4ECSA 1KVKA 3NAIA 5LSOA 2GC8A 1NM2A 4YY3J 3R1HA 3QAUA 4YR3A 4AQYJ 4RBTA 5JXSA 1U0HA 4B9UA 1OJ4A 1VOMA 2GNKA 3HZGA 3D68A 4MKAA 3SXLA 3ENAA 3US5A 3EVOA 1M0SA 3DDNA 3HHLD 4DMZA 4OZLA 1EZZB 3MCSA 4B3MF 2MKCA 5SZTA 2GO9A 2VQFF 2FVPA 5KTQA 2FPHX 4DR1F 1KP6A 3ITHA 2M88A 7FDRA 2YKMA 2NXUA 1RHQB 3KLIB 5KFYA 1R89A 2W8KA 5K14B 4KGZB 3KHLA 1LFPA 4ECRA 3IR7B 4K4UA 1BXNA 3E8OA 1HNIA 2AKWB 3ULHA 2DK2A 4CT9A 5KG1A 1N33F 3W3SA 2BM1A 5DRKA 2B6AB 2WHOA 1GQEA 1G7CB 5ETNA 4O3SA 4IH6A 3HCXA 4USHA 3P5BP 1TVRB 2V9KA 2EFQA 1NNDA 3KNGA 1Y7PA 3QGHA 4DCJB 4K4YA 2VBXA 2AEMA 4CLUA 1RJJA 4KR0B 4KSEB 4NRTA 3RB6A 4X4UA 2D41A 5J1EB 3OUYA 1ICEB 4KH0B 2AGQA 1TELA 2KB2A 1H74A 2ASDA 1OWXA 4J37A 5MLCV 3NS7B 2OSRA 2CJYB 2GIRA 1YG0A 2HGMA 2OH2A 2CPDA 3DYAA 3HVAA 2UXBF 3NOGA 4XIUA 3BN4A 4OV6A 2CKWA 2OHDA 2JWNA 1GMUA 1TP7A 3TZYA 1UP1A 3DN9A 3C16A 3CCQS 2XI3A 1T05B 1DFDA 1S79A 2CAJA 1FK9B 3QT5A 2ZBIA 1R8BA 2OO4A 1PO6A 2GZOA 2BE2B 3U02A 3CCRS 1WG5A 4TVAB 2FJDB 1Z1ZA 2VJUA 1M5OC 2DR7A 2PN6A 5EHHA 4ZS6A 3D5MA 4DPWA 1FXDA 1TKTB 4LRBA 2OFGX 4F3QA 3KMSA 2YKNA 3H98A 3N28A 4JI4J 4UQGA 2R7WA 2RSQA 2WBRA 4YHHF 2VQFJ 1TVRA 2ILYA 2QA4G 1C0UB 2FGCA 4DLEA 4I2PA 1F3FA 1TL3A 3JAMY 1KTQA 2GX8A 4NZ6A 4ZHRA 4Q5VA 4QYZJ 1IR1A 5J1EA 2ZH4A 3GG0A 2AYEA 1NH7A 2FHKA 3M32B 4QWAA 4RW9A 1S1UB 3I32A 1VFJA 3M8PB 4RWXA 1RCOB 2UU9J 1JMTA 3MR7A 4PAAA 1AROP 2NCKL 2K06A 4RW6B 5HMXA 1P9QC 1XMBA 4C98A 5DDRC 3NS5A 2HVEA 1VLOA 2B9YA 3Q89A 2IJRA 2EKNA 4C0OC 2DPJA 1NDCA 2EBGA 1BUXA 3MMCB 3UPFA 3B4DA 2G1HA 2CPHA 4CT8A 2DNQA 3P6YC 4ER8A 2G9OA 2E5IA 3W60A 3G2XA 2GHVC 3I6PA 4FN5A 3KNAA 3WIVA 2EG1A 3RTVA 3NG8A 3HMJG 1BD6A 1D0EA 3HKZD 2NSBA 4EBDA 3QWPA 2VG7B 3QO9A 2EKYA 1NK5A 2C2EA 3FEZA 3OXFA 4L72B 2LQBA 3S01A 1W7WA 2RQMA 4X4TA 1MLAA 3K2YA 4ZHRB 3HDSA 3CCVS 4P72A 3BPDA 1GTEA 4OX9J 3FRYA 3SCLE 3ZZYA 3PYEA 1A9NB 1N56A 4IKAA 4O44B 3OFGA 1WG4A 3KLVA 4C6AA 4DX5A 1V5VA 3BM7A 2MXYA 2MZ1A 2ZWOA 2EPIA 3U27A 3K59A 3CUNA 1N52B 5DS7A 1VHFA 4WTYA 4DF8A 1HBUA 3SI8A 2J6UA 2LEAA 3HSZA 4JI5J 5IS2A 3MMCA 4YHHJ 1S12A 2VPZB 3CD6S 1BWEA 3R5CA 1VCTA 2DGVA 4HTJA 5KFEA 2VICA 4M95A 1RT6B 1EB0A 1XIQA 3C6TA 2QA4S 2BW2A 1FDBA 2XHCA 1Z2ZA 2V8DA 3NGTA 1MNEA 3HZEA 1FI4A 1I94J 4I2QB 3OR2A 3PJXA 3D28A 3MAAB 4KTQA 4IH7A 3PKMA 4DR7J 2HLTA 4J9OA 1NSKL 2W4DA 3MM8B 4BC9A 4OZNA 1MMNA 3KUHA 3UVJB 1HL6A 2MSSA 1R3NA 5G4DA 5CCMA 2RHQB 1M90T 4DV6J 4ED4A 1RT5B 3J80U 1PGZA 3P4UB 3QIDA 4XAKA 3HHKA 2C3UA 1CJTB 3G6VA 4TN2A 1FTRA 2XI2A 1FFWB 1IKXB 3VAMA 2C3OA 2VG5A 3FSXA 4OZ3A 5ETKA 3V6JA 5L38A 1FDDA 3ZZPA 3FCHA 4F4XA 2X51A 3DNCA 3A8KA 4IRKA 2G0IA 2YX1A 2AF6A 5KG3A 2MKSA 3CSKA 2HRUA 1NH8A 3TAMB 3M6UA 1UEUA 1HKAA 4QQBA 5ITHA 5F8HA 4LQ9A 4CNZA 3IG1A 3POTB 4RO0A 3NAHA 4O4GA 5KT5A 3GSIA 2R7XA 2FJWA 1UA0A 3FFIA 5C25B 3GJTB 2D74B 4PUOB 1YKWA 2RQ4A 3LW5C 5HROA 3MM8A 1JLBA 4QW8A 5JMNA 2JLFA 3A13A 3FEXB 3R5GA 3UD5A 1TKDA 2RH3A 5FDLB 1QLNA 4BS2A 2BDPA 2IA0A 1ZA2B 3M2VB 4K5SA 1D8YA 1RTDA 4KJIA 2W1BA 2KZMA 1SVDA 3TUPA 1NSAA 3OL6A 4ELUA 2FGOA 3IFEA 2HQCA 4OX8A 4IRCA 2VKZG 2H65B 4B9SA 4B3OB 5G0RA 3UN3A 1FD8A 3NWGA 2D3O1 2C3PA 1M5SA 4X62J 1EP4B 5GAHI 1FJGJ 1VLYA 1YRXA 2I6WA 4U95A 2RF2B 2C2ZB 4F4ZA 4EEYA 1VRTB 3UQSA 4JI1J 3V6DA 4GRSA 1MMDA 5A2QU 1YI2S 1C1BA 1JJHA 2PEBA 1UL3A 2HNDA 1FX2A 1RU2A 2ZDOA 3IG1B 3POTA 3CJ4A 4MYUA 2FJBB 5KFIA 3MD1A 3GLJA 3VZIA 2OPQA 3NY0A 1DBDA 4YS2A 2W4CA 3DGVA 4TQSA 2LDYA 2YNFB 2ABYA 3OXLA 4WJBA 4WIIA 2HQIA 3DLKB 5H1SV 1C0UA 1FDNA 2CQIA 4DR4J 3T9ZA 3WHIA 1EQ0A 4WU3A 1GT8A 3O3LA 2CNLB 4C2MA 4A8SA 2QO3A 4NYOA 1N34J 2VOPA 1S49A 2N7YA 2DTJA 5G0RB 2XB2D 4ZPDA 3MM7A 1Q8KA 2GA7A 5KFDA 5J2QB 4RPFA 1GXUA 2CQHA 2FLOA 3LPEA 2IAJB 5E3QA 4LF5J 1AUSL 3M30B 2AJFE 2P6TA 2RF2A 1HR0F 2VBYA 3NXZA 3PKYA 3CULA 1QVFR 3VGVA 1U24A 2QLFB 2HQFA 4C8LA 4DV6F 2CXEA 3GJRB 5LMUF 4IUFA 4DV3F 1HBOB 2HZAA 4DSKA 3MTJA 3SSQA 1RYSA 4P73A 4LR7A 4LFAF 4DX8H 3FMWA 3V81B 2EFPA 3KK2B 2C2MB 5FD1A 3CCLS 3GYXB 1REGX 1URRA 2AP6A 3MR6A 1FJGF 4WTOB 2E29A 1D9AA 1WKKA 4DL2A 5AJ3J 5EUHA 4W98A 1X0FA 1VQ8S 4EMDA 2M70A 5I42A 2HVHA 3GFZA 1CJKB 2CQCA 2VG6B 3ENQA 1NZ8A 4MJKA 4ZPAA 4F0MA 3MM7B 2OELA 4O44A 5F9NA 5J2MB 2NZCA 2HURA 3QFHA 5LMNJ 2DJWA 4F0KA 4JV5J 3CD5A 5CABA 1HQEB 2KVIA 1FKOB 4J7CA 4ZVEA 1KONA 3OTDA 3CCZA 4BDPA 2PSZA 4RW4A 4ZOSA 1RTHA 1Q7LB 5KFFA 5FLXY 4NCBA 4OJHA 3M6VA 3WX4A 4Y65A 2ZH8A 2HRTA 4J91A 4LF6J 5A8RB 5AE1A 4DWIA 2RQKA 4PYAA 5F41A 2MKHA 3BBCA 3H7HB 1RBAA 3I5CA 5T7LB 4Y00A 4CYUA 3OTOJ 3G82A 3MM5A 3NKYA 2WONB 3EPGA 2NYIA 1L3TA 3ITHB 4QWCA 4O0NA 2GQCA 3OFHA 4I67A 1R0BG 4WKRA 3MEEA 3L4BC 3W5ZA 1HW8A 4I2QA 2FZCB 3TUZC 1WSRA 3HHLA 5LJ5Y 4O4RA 2E1CA 1KSPA 1UWBB 1JLCA 5A8KB 1JLAA 2LP4A 3P5TL 3D1OA 5KFRA 1XR7A 4M5DA 3IS9B 2QFIA 3SMZA 5I42B 2HG4A 1FJCA 3C19A 1T9WA 4TKTA 2XO6A 4UTGA 4L76A 2PA8D 3M9MB 5KFQA 3D66A 4NLGA 5GMEA 4ECXA 1WDTA 5BXIA 2W24A 3AA8A 4DF4A 2YWKA 4KC5A 4DX7A 4N56A 3UCZP 1T3OA 5DQIA 5A0YB 3G6YA 4NCAA 4X4QA 4TQRA 3R1LA 1DZ5A 1LNQA 4DR3F 1HNXJ 1ZBTA 2UUBF 3M8QB 4IFVB 2EFNA 1D09B 1P6TA 1T0TV 1TAUA 1TKZB 5ETLA 4DL4A 3I96A 2ASLA 1YK9A 5FIIA 3MMAB 1OS5A 1V3RA 3G8TA 1HWUA 1EETB 2IMOA 2O67A 4B08A 2DNOA 3EGWB 3QNWB 4P74A 4QIVA 2MQQA 1SPBP 4G1IA 3AOCA 2B8QA 5DDPC 2DRBA 3J7ZT 1CQMA 1VQ9S 2HMIB 1OY8A 5CQGA 1V5IB 5IT9Y 4D3GA 1LK5A 5D8HB 4X4NA 3MFHA 3CJ5A 1HPZB 4MIBA 4WBFA 3IR6B 1BE4A 5KOXA 5GAEU 3RAXA 3MTKA 3EYZA 2R9LA 1LW0B 3W5XA 2CJXB 3I9V9 6FDRA 1IJEB 5GAEI 1HNWF 3QRQA 2KKHA 3SDEA 4HHJA 5IQ6A 5EDWA 2HNZB 2QE5A 2KG0A 2R8JA 4JI8F 1TMMA 4WWSA 3B8HA 3CW2C 3CIZA 2L3MA 1FWLA 3PEHA 3NGRA 4I7FA 3DOLA 2M8HA 1SQEA 2DISA 1VMBA 3GYNA 1J5EF 3KOAA 1KFSA 4K5RA 3UFCX 3DHXA 3TYTA 1CULB 4FF3A 1NPRA 3I4PA 1IBLF 3ZXWA 1PAEX 1IBMJ 2D3OR 3AB4B 3HP6A 2PGCA 9RUBA 2W9AA 4NCGB 3K57A 2IIHA 3W66A 3T5LA 2XSJB 2ZUAA 3CD7A 3TJ9A 4X4PA 2BJ1A 4XPCA 1L5UA 4ZK7M 1U7LA 3BKTA 1NK0A 3Q8UA 1T9UA 5D4NA 3B82A 3FC9A 4PQUB 1F5BA 3MPWA 2QYCA 2ATCB 5KFUA 1Q8IA 5C5JA 1SIWB 5IWAF 3TZXA 2E5LJ 1Q8LA 2J0QD 2UUBJ 3D3CJ 5KAKA 3BGRA 3SDEB 4DR1J 1N36F 3DRRB 3G87A 3UDVA 4FBTA 4JI2F 3PFEA 4C97A 3MAHA 4LR8A 5ETTA 2ZJQQ 5J2QA 1FWKA 2FJXA 1T9YA 2IAJA 4V1Ak 4CDIA 1RT4B 2YWWA 3V6HA 1EIYB 1UEVA 2PFFB 3H8YA 2V8PA 2POKA 5F8IA 2BE7D 2DNYA 4R8UA 1RWNB 3GTYX 3H20A 2WSEC 3AJDA 2AJ2A 2WSCC 2HQDA 2V6AA 4EGLA 2NSCA 4QWEA 1RDRA 1PSDA 1U2RA 3ZTRA 3V81A 1S1WA 2GO8A 3FRZA 1S4FA 1F1BB 2CNKB 4ES3A 4B17A 1U4BA 3QBCA 3KJFB 2E7XA 4Z2XA 1S76D 3TAPA 2JJ4D 2NUUG 4ICLA 1F2GA 4RW8B 1S6QB 1M5HA 4DG1A 1M5PC 4CO5A 3OL9A 2MMYA 3LP2A 3PX0A 4KPCA 3OL7A 1KD1T 3BGUA 5D4PA 5L39A 5BJRA 2UVRA 2QL7B 3F44A 2HVDA 1VDHA 1N32F 4ECVA 4CNYA 4ZVGA 4Z7CA 1DARA 3IM8A 3EXYA 4FXWA 1RWXB 1CJUA 2VPXB 1R0CB 4NMLA 4QR2A 4WK1A 5T7LA 2CQ1A 1NKCA 3VV2B 3SV4A 1H2VZ 1XK8A 1KHVA 2WCXA 3IP0A 2CIMA 2Z2YB 4GVBA 5HANA 2XYPB 1QAJA 1QUVA 2WZ1A 2K8GA 1V6HA 2J8SA 4K8RA 1S7HA 2MPUA 2M8DB 4JI3J 2R7OA 3FBCA 2VODA 3ZTQA 2ALYB 1JLEA 4AD6A 2UU9F 2RQCA 4EO8A 3OR1A 1S9GB 2X1BA 2OTLS 1TUVA 4FYWB 4ID5A 2GVZB 4BWJA 4DSEA 2JFKA 3Q86A 4ECQA 4DFPA 2D1CA 3BKFA 3SQOP 1S6OA 1QSYA 5IQQA 1P1TA 1SUQA 1RTZA 5HL7Q 2ZOMA 4S0MA 2ACMA 3RBDA 1FCAA 2G4BA 1EKRA 3BKUA 3D3BJ 3NCPA 1ZA1B 1X4GA 4OZ5A 4JUZA 4U67Q 3KJVB 3CPWR 4OYMA 1YJNS 1S59A 4A8OA 2PI4A 4Y2AA 4K4WA 3QSYB 2FIUA 3WDOA 4CLPA 4OZ1A 2VA2A 3T1HJ 2FJAB 4PEOA 4YUDA 1SI9A 2IRXA 2XZWA 1HHQA 2L48A 1T7PA 4I56A 1YIJS 1EETA 1GMWD 3RBEA 1IBKJ 1LW2B 4EBCA 3QFWA 4WXWA 4MK7A 4HT7A 5DG8A 1XC9A 2M3DA 3Q8YA 4DS4A 3EM1A 4C11B 2PI5A 4QYZK 1H6KX 4DV5F 1T95A 4DV1F 4DL3A 3O6QA 5IXUA 1PKUA 2HVZA 3K8VA 1CS4A 4FYVB 1HBMB 3BGFA 5IT9U 1K8AT 2BMBA 2CJAA 1LW0A 4ZJQA 4DUYF 1I1GA 2Y9HA 5IOLA 2B0GA 3MAQA 2VQEF 1X7VA 3S7RA 1GFWB 4ZMMA 4ZA1A 1TL4A 5DDQC 1R8CA 2V5HG 3EDRB 3OJUA 3HSGA 3RR7A 4OI1A 2OFHX 4FPIA 4X65J 4CCHA 1RU1A 3BF4A 4XK8C 2MB0B 4OI6A 1I94F 1YJ9S 3HK2A 1ZM9A 2Z4PA 2XS7A 2DNNA 4OX6A 2OPPA 3M2UA 4PXCA 4ZIVA 2GQ2A 3RR8A 4DV2F 4MAKA 3C16B 2QLJB 4NLYA 3D1HA 4QYRA 1N4LA 4K50A 1UKUA 4C0HA 1U2FA 4DV0F 2G2YA 1LW2A 4QOTA 1S77D 2Q79A 2AD9A 3UD4P 3UNGC 4LF9J 2ZHOA 3MCOA 3J81U 5LM7E 2V8HA 1MMLA 1NO8A 5DZ6A 3TJ8A 4DOZA 3H4BA 2C2RA 1KVJA 2UVUA 4J9SA 1TTHB 1N5SA 4TYAA 2HHTA 2CPFA 2LQ9A 1PYSB 2ZH6A 5J2PA 1N48A 3DOKA 3ZNJ1 3KWMA 2I5JA 3K5LA 2IMWP 1RTIA 2EW9A 2GVDB 1N0VC 4C3MA 4CTAB 3CMQA 4WFBQ 2IY5B 3JXOA 1GMWA 1UMJA 3CF5Q 1CJKA 4RUHA 3MPUB 5MAOA 4FVMA 5DJBA 4QWBA 4Q43A 4O0IA 5SUHA 3O8WA 2F8HA 3ISND 4J9PA 2KXHA 2ZZMA 2CPXA 2YKPA 2OPRA 3M1VA 1A7GE 1EJ7L 2OPPB 1X4HA 3C14B 3LP0B 3M2UB 2DPIA 4IR1A 1RTHB 4V19J 1RT2A 2IC3A 3FVYA 1VRUB 4GO5X 4WFXA 2PMHA 1UZDA 1R6VA 2RKIA 2HRYA 2EK6A 2LA4A 5H9FJ 3TI0A 3C6UA 5GADU 1OPZA 1T03A 4PG5A 5CH7B 1Y0HA 1ACMB 2VPYB 2JFDA 4KQZA 5CXTA 3ENWA 3HM9A 3AD7C 1N5YB 5K9FA 4KO0A 4I0WA 4OI3A 4ZPTR 3F73A 3T5HA 4B3TJ 3HHLB 3D54A 3J7YI 3IAS9 3QATA 2ALZA 2BJEA 1NCLA 1RTIB
chains in the Genus database with same CATH topology
1Z4UA 2N7CA 4JI1F 1S6QA 2ZZNA 3I5BA 4DFKA 2EI5A 3VWSA 3EUNA 4LF9F 1M5KC 2HLUA 4AUKA 2AJ1A 3IC1A 3BDEA 2DGOA 1SB6A 2CQ0A 4ED2A 2KT3A 1VRUA 2K1RA 4AYBD 1XMOF 1QAIA 1KS2A 5GVQA 2MKKA 3OHAA 4C8NA 4Z37A 1YBAA 2KM8C 4IFVA 1FA0A 1F0XA 2DGSA 5I3QA 1SJFA 2XMVA 2W7PA 3UCUP 3LP1B 4H4OB 4IG3A 2E1RA 4TXSA 3EZUA 5KFKA 3MXHP 1V3SA 5FJ4A 4EZ9A 3W2WB 1MROA 2ZH3A 3DU6A 4DSIA 2XCAA 4FS1A 1R27B 3M2RA 5CA5A 5KT2A 4U7CA 4ILMA 3VAHA 5CCLA 4PQAA 3UDCA 2J0WA 1SUQB 2XBPA 5DM7Q 1RI7A 3HT3A 4DL5A 3TNVA 1VBXA 1KOHA 1N5TA 4A8WA 3BSOA 2VV5A 2DCUB 3RRGA 3NMRA 4YB1P 3OW2R 1FRJA 3JSMA 2KG1A 1SH0A 2HS4A 2JH3A 2BZ2A 3G71S 3TAQA 1SJRA 5L9XA 3LANA 3RW6A 2HHVA 2L9NA 2PC6A 3MM9B 1ZAVA 5GAGU 3V4IB 1YRTA 3AAWB 1XMQF 3CC7S 5KFGA 2BQ3A 1UJ4A 4O4GB 2HHHF 3H40A 3TW0A 3BJYA 3G86A 4YR2A 5LMNF 2YNIB 3FQKA 1KFDA 3QYYA 4DQRA 3GIMA 1IN0A 4OI4A 3DRYA 2K3IA 2ZC3A 3HKWA 4RKUC 3G6ES 2KXFA 4ZPCA 2LLZA 1RQ0A 5C24A 3D2WA 1WHWA 3CDEA 5I3PA 3OTOF 1ZTTA 1V3ZA 1K0TA 4X64F 2KJWA 2B9WA 1VQLS 1DRZA 1S9FA 2E5JA 1HHTP 2B7BB 4HI2A 2J0XA 2W25A 2V4JB 3NBPB 4MH8A 5HO4A 2CPIA 3O1LA 4FZVA 3UWTA 2HNDB 3DHWC 4N8NA 2J0SD 5HMWA 2W9BA 1D9DA 3DDKA 5E2QA 5EWGA 3UE2A 1NJXA 2HGLA 4Y3CA 4JV0A 4WYLA 1IXKA 3GFHA 4TLQA 2UVVA 2JC0A 2DIUA 5KG5A 3K0JA 2HW3A 4MMOA 4C3KA 3MECB 2P9EA 3NNCA 5LXRA 1P8GA 2CFXA 4P6QA 1O51A 2J76E 2O66A 2FB0A 4ZVFA 2XC9A 5M2UA 2FVQA 1TV6A 2KYXA 4OHWA 4TU7A 3H5XA 4LIRA 3P3DA 4EU0A 1ULRA 1FESA 1CVJA 2KH9A 3ICLA 5A8WA 4A8QA 4ED0A 4FP9A 2AV5A 2RVJA 3C6UB 4NZ7A 1L3KA 2ROGA 4KKOA 4TYBA 1G6BA 3K58A 4ES2A 2W9CB 2M7SA 3OXGA 4I69A 4Q8EA 1SV5A 4OV1A 2HGNA 4KO0B 5DQHA 2AW0A 4RX6A 2ASJA 2O5DA 4LT6A 3ZZRA 2CJBA 3Q8QB 1CC8A 1MW7A 4NPOA 2D9OA 2LU1A 4ITSA 4QPTA 1KC8T 1NJZA 3N5FA 2ZUGA 4OJ3A 2ZC4A 3PV8A 3LAKA 4X4VA 3CJ3A 1KTVA 1XR5A 1QE1A 5KG0A 1P1LA 1S9EA 5DLFA 4EYHB 1QSLA 2U2FA 4DSLA 4V19X 2CQPA 1QY7A 5A8RA 4NLDA 1S1VA 3U7JA 1G2EA 1EP4A 4KKOB 3TA0A 3RZAA 1Q7YT 3SZ2A 3OV7A 4X4RA 4GKJF 2E7WA 5K8OA 2HWHA 2ZDPA 2HS3A 4K2XA 4NLTA 1SJQA 3MM6A 4IG3B 2N4CA 1CPZA 3G6XA 4DHVA 3CJ0A 5HN0A 3MUVP 4C11A 1HNIB 2HIQA 3CDBA 3N5BA 4NLXA 5KFWA 4DV7F 2JDJA 1SJ4P 1TK8A 4DQIA 4B9TA 4LUBA 2YNHB 3SFUA 3MOZA 4JI5F 2J9CA 2FLNA 1R8AA 2YX4A 2YKOA 1WEZA 1FJEB 3RW7A 4AXIA 3H5SA 5AE3A 2R7VA 5KT4A 3T6BA 5KFZA 2UUCF 2XWYA 3QGIA 1U26A 3P96A 1GX6A 3I0SB 3I0RA 1MSWD 1CSJA 2ROPA 4BC7A 1G1XA 1SIZA 1KR4A 4F4WA 3SSSA 3NGDA 1WTBA 5K5MA 3BGLA 3DI6A 4YMEA 1TK0A 4BBYA 2VPWB 1H7WA 1NKEA 1VQSA 2E1AA 3S6EA 2OJ3A 1LWFA 2RIJA 2IVMA 3ISNC 1X5TA 4NA3A 3THPA 4X4SA 2J7UA 1U47A 1BLUA 3ETOA 4F4KA 2YKNB 3M9OB 1X5SA 3OSPA 5GADI 2UUWA 2R8GA 3NS6A 3UW1A 2FJVA 3KMQA 3JTPA 1VS3A 3PM9A 2Q6CA 1KQFB 2FHMA 5K8MA 2PEHA 2DGTA 4NLRA 1XR6A 2DNLA 3I0SA 4G6VB 4KIAA 1E6YB 2GMJA 1J2VA 4DEZA 5F8GA 3NCRA 2UVWA 4KE5A 4N5SA 2YQ3A 1NRKA 3UCGA 2F8MA 4LIWA 4ELTA 4NWBA 3DLBA 3LP0A 2R7UA 1E6VB 3O44A 1S0OA 4WFNQ 4B02A 1IJFB 1AXQA 4NOHA 4USIA 2WTFA 3OPKA 4DLGA 1B0PA 4HDGA 3BO3A 2W9BB 2ILZA 4C3LA 5DO2A 2ZFHA 1U1QA 2VD3A 4AFFA 5J2NB 4KT0C 4CO0A 1NHUA 2DT9A 2RB7A 3LWLA 4PQUA 2CPEA 2QFJA 2D9PA 1KVIA 2VG7A 4B3RF 1HQUB 2OIHA 1JLCB 2FUG9 1IKVA 1JB0C 3T1YF 1Q82T 4IDKB 4PXDA 4O23A 5IT4A 5I3UA 1SKRA 2NS1B 4YB6A 3KG0A 2HNYA 4EFAC 4QW9A 2JEFA 2E66A 3CB4A 4R0EA 3DCAA 4ZCLA 1OSDA 2YTCA 3DLHA 2CPZA 4AE5A 1TFWA 4LSLA 4KGKA 2HHUA 2DNMA 4JI7F 2KTQA 1RT7A 1FRHA 4IFYA 4F2SA 4OI0A 2XULA 4I6YA 4B9NA 2MZJA 3PIPQ 1RT6A 2KJVA 3AQPA 4X66F 5CYJA 5KG7A 2IBKA 3CMES 1WF2A 4G1QB 3TR5A 1R7IA 2XLIA 1RWUA 1N34F 4IQMA 4M63A 4RNHA 3TO8A 3NNHA 2QLWA 4QR1A 4YEAA 1LK7A 3HVTA 1W2IA 1FEEA 4ZCMA 1BQMB 4O3PA 4DSFA 4ZVHA 5C42A 1XWLA 2MKIA 3CTRA 3T19A 5ADZA 1OSCA 1ZAWA 4C4WA 3DRXA 4LSLB 1HWLA 1ZZNA 4H4MA 2X1GA 2VBZA 1SL0A 2BABA 1Q4RA 2SXLA 4O3OA 1WHXA 3GWCA 1U48A 3PX4A 2GMLA 4CO4A 1R6YA 4DL0C 5EX3A 2RDIA 3VAMA 1X0PA 4OLOA 3TAMA 5K8NA 4K4TA 4G1QA 1S99A 3IR5B 3MM6B 2VC1A 3IBWA 1U1RA 4Q44A 2JEIA 1FK9A 4HEA9 2XSFA 3C2PA 1MU2B 1R0AB 4JV5F 4WZMA 2ZVSA 2ROEA 2JLEA 3RYLA 1AFIA 3LH2S 2KI2A 4R0JA 1JLBB 2DCLA 4A8XA 4Y28C 5FDLA 3RAQA 1FRKA 4UUWA 1LWCA 1FRMA 5B08A 1U1KA 3EGZA 5DETA 1S6UA 3LPYA 4F02A 5B0CA 3S8SA 2DHSA 2YWGA 2R7QA 4UW2A 1FE4A 3GG1A 3EGNA 2DHGA 2VH7A 5EWFA 1C2PA 1H38A 2G1DA 1X8DA 2JEJA 1B64A 3PEJA 1S1UA 4ELVA 2A3JA 4DN9A 1VQ5S 2V4JA 3NBPA 2VA3A 1YWXA 2U1AA 2VB6A 2CVEA 4BCAA 3VAIA 2HHXA 2NPIA 1ZYQA 3GQCA 3EZ5A 2P9CA 3G9CA 5KFTA 3MMBA 4OZ0A 4YY3F 2RMLA 4EZ6A 2ZE2A 1URNA 2A18A 2JX2A 1J5OA 2JVOA 2O01C 1VC6A 4HH0A 1Q8BA 1AUDA 2LXFA 5HQ8A 2N3LA 5F8LA 4DF8A 3DLKA 2MZQA 1C4CA 2E5GA 1Y5IB 3DU5A 4ICLB 2RNEA 4ZP9A 1HYSA 1GAOA 5EWEA 4O3QA 4KBIA 5LJ3Y 2IVFB 1HMVA 5A6WA 4QIFA 2CPYA 2P6SA 3LP2B 4LVNP 4MFBA 3TUIC 3HJFA 2Z8QA 2J7WA 5EN1A 3BQ0A 2DNGA 5E3CA 4JI4F 1HBUB 4FF2A 2Q66A 2HHWA 1HD0A 4JV1