2OJ3A

Hepatitis delta virus ribozyme precursor structure, with c75u mutation, bound to tl+ and cobalt hexammine (co(nh3)63+)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural roles of monovalent cations in the HDV ribozyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/rna
molecule keywords HDV RIBOZYME
total genus 24
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oj3A00
3TO8A 4TU8A 2DNZA 3UCZP 4P6QA 1WHVA 1M1KT 2PE8A 1AUDA 3RW7A 1VQ7S 1WTBA 3UCGA 2XS7A 2MY7A 2MY8A 3MURP 2BOPA 1R8PA 1YI2S 1OPIA 2RU3A 1WI8A 2G4BA 2OTJS 2DGXA 1YJNS 2MSTA 3CCES 3JB9k 1DZ5A 1Q7YT 3R1HA 1K73T 1U1RA 2X1FA 2M4MA 3MDFA 1HA1A 2LCWA 2HZCA 2MKHA 3ULHA 2M8HA 2V94A 1IQTA 2ZJQQ 1X4BA 1U1LA 2DGWA 1YJ9S 2SXLA 1KC8T 2J76E 1A7GE 4LMZA 1ZZNA 3G96A 4PRFA 1DRZA 2MKSA 4M5DB 1P27B 4OZ1A 2MZQA 4CIOA 2DNOA 2DNRA 2EVZA 1H6KX 2LA4A 2N3LA 2F3JA 1VQOS 2MKJA 1SJ4P 2I38A 1DHMA 4PR6A 2CQPA 2MJNA 2RQ4A 4IOAQ 2VOPA 4TU7A 2X1GA 2CQ4A 4PKDB 3SMZA 4EGLA 3TP2A 5HO4A 2RUGA 3P6YC 2KG1A 1N54B 2LYVA 1G2EA 2RRBA 1WG4A 2CPYA 2G1DA 1FXLA 4F02A 2B0GA 3VF0B 1UFWA 2DNQA 2LMIA 1FNXH 3UWTA 2LECA 4LJMA 4QU7A 2GO9A 1D8ZA 1HD1A 4FXWA 2NLWA 2CQBA 3MXHP 1WF1A 2FPHX 2VONA 3Q2TC 3G4SS 4W90B 2E44A 2XB2D 3MUTP 4WIIA 2DITA 2PEHA 3DXBA 4YB1P 2DNHA 3MUVP 2ADCA 3D2WA 4C4WA 3IRWP 1SXLA 3U1LA 2CQ1A 1S79A 1WHWA 1YIJS 1U1OA 2AD9A 2XNRA 5GADU 1SJFA 2MQQA 2DGQA 2MQMA 3NNHA 2U2FA 1VQLS 2G0CA 2A3JA 1YTYA 1OIAA 1KD1T 2MQNA 1M5PC 1NJIT 4Y0FA 2LKZA 3MD3A 2LXUA 2HGMA 1VQMS 1U1PA 1W2BR 5DDPC 3J7ZT 5GAEU 2KH9A 2ZJPQ 4ERDA 2CPXA 1H2UX 1X4HA 2N7CA 2CQ2A 3S01A 2N82B 2D3OR 1VQ9S 4WFNQ 2DNMA 2DH8A 2VODA 3EGZA 1K9MT 1U1NA 1PGZA 1JJ2R 2M52A 3NNAA 2J0QD 2YH0A 2FC9A 2MQPA 1BY9A 1FT8A 2MJUA 1ZH5A 2DH9A 1Q86T 3UCUP 3U1MA 2LXIA 3ZZZA 1WI6A 2AYMA 3NS6A 4TLQA 3G6ES 2DHXA 4IOCQ 1WHYA 5GAHU 1FJEB 2MKCA 5HL7Q 2JVOA 2RVJA 1N8RT 1WEXA 2DNYA 2LQ5A 2D9PA 3EGNA 2M7SA 4W92B 2DH7A 1X4EA 3CC2S 3CCRS 3CCMS 3B4DA 3P3DA 2DGTA 5DM6Q 2DNGA 1VQPS 2XS5A 2RT3A 2KU7A 1VQ8S 5CA5A 2DGUA 3LQVA 4A8XA 1VQ4S 1M5KC 2FC8A 4U67Q 3MOJB 1OO0B 2M0GB 4ED5A 2MSSA 3VAFA 3DLLQ 1FHTA 2CQ0A 5DDOC 2ERRA 1U6BA 3BEGB 3CCJS 1WWHA 1X4AA 2LEBA 2MZSA 5LXYA 1JMTA 5JVGQ 2DNLA 1JJHA 2KXHA 2E5HA 4QPTA 2OJ3A 1U1KA 2M2BA 3CXCR 2JX2A 3L3CA 2RRAA 1S72S 5LJ3Y 2ADBA 1X0FA 2RS8A 2KRRA 2CPIA 5IQQA 4CH0S 1U2FA 3VAMA 3PIPQ 5JVHQ 3MI7X 2OTLS 3BO4A 2DO0A 2KRBA 1P1TA 1FJ7A 1YHQS 4Y00A 1NU4A 3CULA 2MZ1A 2E5JA 1Q82T 2F9DA 1WF0A 5LSLA 1HD0A 2JWNA 2L08A 2KG0A 1KQSR 2O3DA 1H2TZ 1H2VZ 2CQCA 3HHNB 5GAGU 2M8DB 1PO6A 3CMES 4CQ1A 2DISA 1O0PA 2MZTA 3US5A 2VOOA 1X5SA 2MKKA 5IM0A 1VBYA 2HGNA 2KHCA 2KYXA 1SJQA 4YUDA 1URNA 3RW6A 2KM8C 1N52B 2FY1A 2KXNB 1ZZFA 3VAGA 5DDQC 2D9OA 2E5IA 3P49B 2M70A 4F26A 3BO3A 1X5PA 4IO9Q 2RQCA 2HVZA 1FJCA 1VBXA 2AYEA 3CPWR 2JVRA 1HL6A 3CC4S 2WBRA 3CCLS 2M9KA 3CF5Q 4WF9Q 1KOHA 1X4CA 3BO2A 2RS2A 5LSOA 2EK1A 1YJWS 3G8SA 2DHAA 3BS9A 2DIUA 2OSQA 5D78A 4RU2A 1SJRA 1X4GA 1QVFR 1L3KA 5D77A 2CPFA 1OWXA 1UAWA 2DNPA 2YWKA 4J5OA 4WFBQ 3FEYB 4OZ0A 2CQDA 1SJ3P 2X1AA 1CVJA 1M5OC 5GMKa 2AYGA 3NMRA 3CTRA 2MHNA 1WF2A 4WCEQ 1F9FA 4UQTA 1U6FA 3VAHA 5FJ4A 1UW4A 1DBDA 4F25A 1NO8A 1QM9A 3OW2R 2X1BA 3Q2SC 3SXLA 1N88A 3NNCA 3CC7S 4CH1A 2CPZA 2DK2A 1X4FA 1WEYA 1X5OA 1X4DA 3LPYA 3I56S 2OSRA 4WFAQ 2YTCA 5DM7Q 1XN9A 2EK6A 3FEXB 3HI9A 2NZ4A 1R8HA 4ZKAA 1QVGR 2MXYA 5DETA 5IFMA 2I2YA 3V4MA 3S6EA 2OIHA 2RNEA 1WEZA 2AYBA 2L9WA 3B4MA 2MQLA 3NS5A 1X5TA 2BZ2A 3CD6S 3SDEA 3J7YU 2DB1A 2MQOA 1D9AA 4YOEA 5H1SV 2XNQA 2GHPA 1WELA 1VQ5S 4IUFA 2XS2A 2J0SD 2DHSA 3THTA 2N3OA 4C0OC 2XSFA 4FXVA 2FHOB 2K8GA 3CCSS 3UD3P 1VQNS 2MGZA 2CPDA 3MUMP 3CCQS 1VC6A 2CQ3A 3R1LA 2HYIB 3K0JA 4BS2A 3IWNC 4Z2XA 2JRSA 3EX7B 3UD4P 4C7QA 3VAKA 5DDRC 1YWXA 2ZJRQ 2KN4A 1VC0A 1U1QA 5GVQA 3G9CA 2L41A 2QEXS 3THPA 1JJ4A 3TYTA 1VC5A 3S7RA 2DHGA 2M88A 1KOOA 2F9JA 2KM8B 5EN1A 1A9NB 1RK8A 3VAIA 4WKRA 1FO1A 2MZJA 3G8TA 5IM0B 3H2UB 1VQ6S 2CPJA 2HGLA 3H2VE 1K8AT 4QU6A 3N9UC 3P5TL 3PIOQ 2MYFA 2MGZB 1WG5A 1U1MA 5CXTA 2QA4S 3VALA 3CCVS 5LXRA 4V19X 2LA6A 2CJKA 4TU9A 2MPUA 2CPHA 2KVIA 3I55S 2CPEA 2CQIA 3MD1A 3S8SA 3CUNA 1WHXA 2Q79A 3R27A 3SDEB 4QQBA 2DGVA 2DO4A 2KT5A 4UY8T 2UP1A 2YKAA 1VBZA 2KI2A 5BJRA 3CCUS 2YH1A 4LIRA 2J8AA 2U1AA 2CQHA 2LEAA 1RKJA 2DNNA 2DIVA 1WG1A 3CMAS 2DGOA 2QFJA 2E5GA 2K3KA 1B7FA 2MZRA 2MMYA 1YITS 2MKIA 5ITHA 1Q81T 2DNKA 3VAJA 2KXFA 3G71S 5LJ5Y 5MLCV 1VQKS 1UP1A 3UE2A 2CQGA 3ZZYA 1M90T 1M5VC 2KFYA 2DGSA 5CYJA 2MB0B
chains in the Genus database with same CATH superfamily
1FNMA 1V9OA 1UETA 4DXLA 2YNIB 3BR8A 3E01B 3UW1A 3MM7A 5BYRA 4DX5A 1T3OA 3IGNA 4ILMA 2XWYA 5I42B 2HS0A 2OKQA 4R0JA 4D3HA 3MAQA 3D67A 5KFCA 4RZRA 1M1KT 2PE8A 4EEYA 3C14B 3T9ZA 1S1TB 4LF9J 3UD5A 4B9TA 2LVWA 3UCGA 1RT6B 2XS7A 3I9ZA 1F5CA 4OFZA 4E2FB 5FLXY 2Q66A 4NLQA 4NA2A 2MY7A 3K5NA 4DSJA 2FTRA 2G13A 2MY8A 4MYUA 3D5MA 2JLEA 3GSDA 4P73A 3HJFA 1R8PA 5D8HB 4OYXA 1WNEA 3BGRB 1WI8A 3ZNJ1 2RU3A 4ER8A 2OTJS 5CZVA 1HWJA 2BEFA 2QE5A 3O5TB 2RD5C 2QLFB 5CH7B 3J7YI 2FLNA 2RKIA 3GJSB 3F73A 2X1FA 2ILYA 1T11A 3MDFA 2J6TA 3U7JA 2RF2A 3DHWC 3ULHA 2X3DA 1W2IA 3FDSA 3UN2A 5ETSA 2GJIA 3A8JA 5KFTA 3RBXA 1FWKA 1S1WB 1TK0A 1YJ9S 4Q2LA 4ZVFA 2GFFA 1KC8T 3LAMA 3VV2B 3M9MB 4DSLA 2Z30B 4M5DB 2YNHB 1P27B 3GYGA 4FN5A 3SFGA 2YX4A 2IRXA 3DHXA 2W7OA 1S10A 1UVJA 2EVZA 2LA4A 2H1YA 3HVWA 4KSEB 4ECUA 2F3JA 1NEEA 2PIIA 4DDFA 4K4VA 3BSOA 2BYCA 1DHMA 4X64J 4CLUA 4FPIA 2CQPA 2F4FA 4C97A 2VOPA 1VRUA 2X1GA 4MFBB 4H54A 3MCNA 3WDOA 5CAAA 3EVMA 1FESA 2YNGB 3SMZA 2PA3A 5C24B 4J7CA 2W24A 2G1HA 1SUQB 3VVTA 2J5AA 2P6SA 3UI3A 3W8PA 2ZM6J 4HI1A 4CO0A 2KG1A 1H38A 2YWEA 2I8EA 2QA2A 4GKJJ 2EKNA 4FS1A 5HMZA 2VJVA 2L48A 3FQKA 4ZN1A 5HP1B 4MKVA 5KAKA 1VS3A 5F8JA 3BBBA 3SQOP 1T8EA 1FXLA 4QR1A 2CZVC 5JXSA 4IR9A 4ZMMA 4NXMF 1SC4B 4F02A 4RNFA 4DV3J 1M0SA 1UFWA 4LR7A 4CO3A 2BDPA 2LMIA 3I87A 1RTDA 1U8SA 2NXJA 4DPUA 4KY3A 2OPSA 2LECA 1CSJA 4HH0A 3K58A 1S1UA 3T5KA 4LF5F 4J91A 1NHUA 4FXWA 2C2KB 1SUQA 4P2XA 4KRWA 1ZAVA 3GTYX 1S99A 5H9FK 3PHTA 2B9YA 4EBCA 2W9BB 4LF6F 2E44A 2ZC3A 3L09A 5HP1A 1HI0P 2PEHA 1XEZA 3L7UA 4HEA9 4OI4A 3C8YA 4YB1P 3MUVP 4C4WA 1WC1A 2IY5B 3GWCA 1U49A 2PGCA 3T5HA 3RRHA 2HFVA 1XQIA 2BABA 5RUBA 3OTOJ 5HROB 1RHUB 2VU5A 1S0OA 3VHQA 2GGPB 5GADU 1F5AA 5EWGA 4QW8A 2RUSA 2MQQA 4AL5A 5AXNA 1QE1A 2D3O1 3NNHA 4W4MA 1KLNA 4DR4F 1SL0A 1GX6A 1PCAA 1QSLA 2G0JA 1RXOB 1TL7A 2C3PA 2U2FA 4AYBD 4DN0A 2G0CA 1IR0A 3J7Z5 1VQLS 2CA9A 1NK9A 2ZH6A 4RO0A 2V6AA 4ECXA 4B17A 4TYBA 1M5PC 2MTLA 2LKZA 3TVKA 2LXUA 5GAEI 2Q6BA 4P10A 1VQMS 4GO7X 1U1PA 1IKXA 1W2BR 4C3KA 2HHHF 4JI7F 5B0FA 4RW4A 5T14A 4ECZA 1T0TV 1Y10A 5KFVA 3OHBA 4N8NA 1RT6A 4OI1A 5KFYA 4F2RA 5KFRA 1H72C 3UDVA 3LP0A 1UWAA 1TQLA 4NZ0A 3KHLA 1RAFB 3V81B 2AJQA 1RWWB 4WFNQ 1UFLA 1Y3KA 3IXQA 2QMUB 2M52A 3AFGA 4OIXA 1YLXA 4MTPA 3MMBB 4GVLA 4EUVA 3TNVA 2UUCJ 1BY9A 2QLXA 1FT8A 1U25A 3C16B 2BOAA 3FCHA 3M8YA 2ASLA 2IM2A 5A8WB 1ZH5A 1SJ1A 1DLOA 3J80U 3ZZZA 4I0WA 9RUBA 1UJ4A 4DCOB 2AYMA 1BWEA 2QA1A 1FF2A 3OXFA 2OPQB 3Q86A 3MMBA 4NLDA 4ZCLA 2AF6A 3OTEA 1U6ZA 2O66A 2RVJA 5HJYA 3QWPA 3TAMA 2ALZA 2LQ5A 1N8RT 4LFBF 5A8RB 1T94A 1D0EA 5KT7A 1NSPA 3HT3A 4DS5A 1HHTP 1U0HA 2NZCA 4W92B 2DH7A 1X4EA 3AA9A 3DDKA 4YB5A 1JLBA 1LFPA 4DHVA 3CCRS 2OPQA 1XMBA 3HVTA 4O3OA 2W2MP 2VV5A 4RW6B 3FUYA 1VLOA 1QAXA 3IR6B 3M8RA 1N4LA 2DPJA 4B9UA 2BANB 1SL1A 3D1OA 1DQAA 2A2CA 4DR5F 5L1IA 2ZD1A 3DI6B 1ACMB 4U95A 4A8MP 2HK2A 4FYWB 3DRPA 5KFOA 2W2QP 2H9ZA 3MOJB 2EPIA 2FHJD 5C2GA 4CLZA 4ED4A 1DURA 1QTNB 2DD8S 3MM9B 4DV4J 2D74B 2CQ0A 5L8RC 4GC6A 1VR6A 2R7VA 3B8HA 4I69A 3FCWA 1K0TA 2JEFA 2V69A 5J1PA 1U8WA 2HNDB 3MM5A 4ID5B 5B0DA 2ZEJA 2LEBA 4MIAA 1RT5A 1HPZB 4HDGA 4DV5F 2RKIB 4DL6A 1IUJA 2GAHC 1S1XA 3LALA 3K57A 1RWMB 3LO3A 4Z37A 4PXCA 2E5HA 3IS9B 4EZ9A 3K5PA 2HVHA 3K2YA 2ATCB 4DL0C 5KFSA 2ZHBA 1L5UA 4B9MA 5HQ8A 5G4DA 3T1HJ 3E8OA 1FEHA 2AJ0A 1S9GB 1BXNA 4RJVA 4ZJQA 2IM1A 3FGVA 5C25A 2RB7A 2RRAA 1T05B 2ZWPA 3HK2A 3O1LA 5HQLA 2BVZA 2ADBA 3QRRA 1RAOA 2KRRA 3A1YG 4A8WA 3KTQA 1CS4A 2OEKA 2FJEB 2R9LA 3NY0A 3PIPQ 2OTLS 3DU6A 1XBWA 4ES3A 2KRBA 1P1TA 4UZCA 1FDNA 1RWOB 3HD1A 3LWMA 4DV2F 2YKQA 2C2DA 4KH0B 3FMBA 2OPPA 4XTTA 1B70B 1ZBTA 4NEYA 3CULA 2WOMB 3QT7A 2IM0A 5K5MA 1SC1B 1CJKB 3PXGa 4DLGA 1WF0A 4LREA 5DG9A 3OR2B 1FKOB 2JWNA 1RLCL 2DCUB 2VG6A 2CUYA 2I5JB 2QMWA 3NAHA 3GG1A 5KG6A 3TVYA 1RAIB 3NBPB 5J2MA 2M8DB 1U02A 4QIGA 3PRBA 5A8KB 2NYIA 4Q0BA 1KS2A 4LRCA 3M4XA 1T03A 3KG1A 1HBOB 2AGOA 4EI2A 2MZTA 3IG1B 4WU3A 3OR1A 1FEEA 1FXRA 2ZZTA 1Q8IA 1X5SA 2VQEJ 2GO8A 1YBTA 2ZNZA 5IM0A 1VBYA 2H5EA 3D3CJ 2KHCA 3DN9A 5L9NA 1RBOB 4YUDA 1URNA 1LWFB 3RW6A 3BSNA 1UVNA 3KK3B 4M5KA 1DTTB 1CJKA 2FHKA 1FRLA 1ZZFA 1LWEA 2V8GA 1PAEX 4WTYA 5HBMB 1YZ6A 5K8MA 4DR5J 4X4NA 1XERA 3ETMA 2HVZA 2RQCA 3FZ2A 2V63A 4K59A 4CO4A 2ZITA 2B5JA 1HBNA 2VIHA 1HL6A 2AGPA 3CC4S 4ZVHA 4USTA 2WZ1A 3QSIA 4YB6A 4DPXA 4NZ7A 3CF5Q 3BDEA 1Q4RA 4F3MA 3N5FA 4ZHRB 1X4CA 2CG4A 2V5HG 3BO2A 1FRXA 1UZDA 5LMUF 4JI5F 2HHTA 1LK7A 4MIBA 1YJWS 3QO9A 1UEUA 2BJDA 2GCFA 3DOKB 4X4OA 2C2MB 1D9FA 4KPYA 4NLYA 2OSQA 2RHSB 3QBCA 4F3QA 1MMNA 1UJ5A 3VGTA 2VC0A 4RW7A 5KFNA 3KK1B 4RU2A 3GILA 1CJUB 4M5MA 3W7BA 1YBUA 4UUXA 3JYTB 5D77A 1ZAWA 3MEEB 2F8MA 3VGVA 2YWKA 3GV7B 1Y00A 4OZ0A 2XC9A 1NK0A 1XR5A 4M5NA 4ZPAA 1SJ3P 5L9XA 1JLFA 4YHHJ 1N0VC 5EHHA 4B3TF 3TUZC 1DFDA 3DDNA 2BQ3A 2HFOA 5KFMA 5KFFA 2HHQA 5FIIA 1K1SA 1Y9OA 4OI3A 1WDTA 4LF5J 3E2EA 2MHNA 2GA7A 5K20B 1RU1A 3UPFA 4WCEQ 2CNNB 4ECVA 2CXEA 4UQTA 3KK1A 7FD1A 2FVPA 4CTAA 3VAHA 4KB7A 4C8YA 4WZMA 2IM3A 1RHMB 2A1BA 4X65J 2QZ8A 3QGGA 4USIA 2BJEA 3MAAA 1O5JA 1JWWA 2WW4A 4WJBA 1FKPA 4DV7J 2QA4G 4F67A 3MFHA 4CH1A 4ATNA 4V19J 1MWQA 2HMIB 2A2DA 2EFOA 4HH1A 2CPZA 4EMDA 1B0TA 5FJ4A 1V5IB 2DK2A 1FTRA 4KV8A 3T1YF 5I42A 1H3DA 2XLIA 1HBNB 3LPYA 4Y3CA 2Y8YA 1SC6A 5HSPA 1N5QA 2PA8D 3JSMB 4LVNP 4F7VA 3W62A 3M1VB 4X2BA 2WRMA 1G7CB 2VFTA 4X62F 3KLEA 1F9EB 1QVGR 2FLLA 2MXYA 1GAOA 4LF6J 2VPYB 1RBAA 1HQEA 5F8MA 2NR0A 1OYDA 2ALYB 2FJWA 4PUOA 1SKWA 3V4MA 1N0UA 4JBCA 1XWLA 2YWFA 4OZ2A 2RNEA 2VA2A 4WK1A 2ZZNA 1NSKL 3IAM9 5DO2A 3B4MA 4F3OA 3ENQA 3NS5A 3SCKE 3MEEA 4ANEA 1N33F 2AW0A 1QE1B 2WB1D 1FERA 2DB1A 5ETPA 1GMWA 3AD9C 5BXIA 5BR8F 3V4IA 4N41A 1XTZA 4J90A 4IQXA 3ENWA 2KO1A 3KUHA 4ELVA 5DZ6A 3PM9A 1VQ5S 3ETOA 1F1BB 5L1LA 1FK9B 1LXNA 3H5XA 1VI7A 3GIRA 3EWGA 3P45B 1JNRB 4X4UA 5EUHA 1S77D 1TKXB 4B3SJ 2K8GA 3FK4A 2IIHA 2OPPB 1RKIA 4CT8A 2ZOMA 1FWLA 5GAHI 2UUCF 2B43A 4LVOP 2E1MC 2XMJA 3RJMB 4MH8A 4FNHA 2CPDA 3CCQS 1U48A 4F8RA 4HLBA 5DGBA 4FPRA 4DR7J 2VG5B 1IQZA 2YKMB 2M3DA 4L76A 1JLGB 4K2JA 1NDKA 1OMSA 4OJ1A 2YVSA 4RW7B 3V6KA 4ZCMA 1R3NA 4GKKF 3LTOA 3T9NA 3IWNC 3A13A 4Z2XA 2QT7A 3FBBA 1S9EB 2JRSA 3UD4P 4C7QA 2HQGA 3ENAA 3M2VA 1S0MA 1KHWA 4ZP7A 1Z1ZA 3U1NA 4HI2A 1S9FA 3TX8A 1H7XA 3EZUA 4ZDNA 3NXZA 2BJ7A 2VHGA 1FNOA 1FRHA 3QLHA 2E7WA 4DX6A 1HARA 5HMWA 3G9CA 1S6PB 5K14A 1U0SA 4I1TA 1F0XA 1S12A 3W2WA 1VC5A 1K47A 3OVBA 5HVHA 1IR2A 1JLEA 2DHGA 2XBPA 4PXEA 3S7RA 2UUAF 3FBEA 2KFZA 3MM6B 4L3NA 1A9NB 3HCXA 4OX9F 3D6FB 2YQ0A 4WKRA 4OYPA 2W1BA 1FO1A 2QGFB 2EBEA 3K59A 1REGX 3M6VA 2YPYA 4ICLB 3H2UB 1VQ6S 4RNHA 3IO1A 3CE8A 3H2VE 4HHHA 1OSDA 4I64A 4ZPCA 3SCIE 1K8AT 1RAHB 2NXNA 3N9UC 4F4ZA 2MYFA 3TZWA 4J9QA 5DRKA 3KJQB 1L3VA 3OJUA 2XMUA 4G1PA 3CCVS 4JI6J 1EP4B 1N34J 3O3LA 4O44B 2GQQA 5J2NB 4M8LA 4AUKA 5KOWA 4G3IA 1HQEB 2UXBJ 3EJMA 2QYCA 2CVIA 2MPUA 2XEXA 1OQ6A 2HLUA 2HIYA 3BB5A 3QMQA 4ZS6A 3MD1A 4CLPA 2WTFA 1TK5A 2ZKTA 2IFXA 3BKFA 5F9LA 4DR2J 1M1HA 4ELTA 1REVA 3R27A 4FF2A 4QW9A 1IKVA 1FXDA 3T41A 2OEJA 4RNNA 3OUYB 1EX8A 3LW5C 3W5ZA 4CLWA 3KK2A 3W3SA 1H73A 4DFMA 3MHYA 3QIPB 5BJRA 3M6WA 2YH1A 2D3UA 2ZBPA 3KWMA 3RBEA 3M2UA 4DCJB 3N79A 4ZP9A 3T5LA 4OL8A 1C2PA 3D0HE 4OYOA 4YHHF 4ZK7M 1Y0HA 5IT9U 3V2UC 4CM2A 4B9LA 2ILZA 4C11A 1LW0A 2QFJA 2XG8A 1QLNA 1AW0A 1VDHA 2AX1A 3RAXA 1PC5A 1WC4A 2MZRA 2QFIA 4DUTA 4R5PB 4DG1A 4UT4A 5DQIA 2MMYA 5C7PA 3QZ8A 5ITHA 1Q81T 2ROGA 2JFKA 3TAQA 2R3VA 2HK3A 3PX0A 2JH3A 3KUEA 2FJVA 3PJ9A 4ZCIA 4KC5A 1XIQA 4DR6F 3H0PA 2PSZA 4QPXA 4MIWA 4F04B 3TARA 3UE2A 1VQKS 1TFYA 1M90T 2HFZA 2QG9B 2KFYA 2DGSA 5CYJA 3MOZA 5HANA 1NJZA 4HKQA 3R7NB 3GFZA 3EVOA 5KFXA 3HMJG 4C6AA 1SKRA 2YY3A 1FDDA 8AT1B 3GFYA 4PWWA 4N76A 3ISZA 1YQHA 3DLHA 1VIOA 2GIQA 2BW7A 4I67A 3JS9A 4DV7F 3HFVA 2DNZA 8RUCA 2QL7B 3UCZP 4IG0B 4QR0A 4ANCA 1I3OB 2FJAB 2GMJA 2RE1A 3HVTB 5F3ZA 2JLFA 5J1NA 3RW7A 3VGUA 4AFFA 5D6GA 1WTBA 1AUDA 5E3RA 4LF8F 2HS3A 4M95A 3BV8A 3AXKA 1CBKA 1C0UA 4GRSA 4PG4A 1DTQB 4YDDB 3IMQJ 1Y11A 2F65A 1T9YA 2UU9F 3MURP 1VRTA 3N28A 2NSCA 2ROPA 4J9RA 2L9DA 2V50A 2G4BA 2PO4A 1RA7A 4ICLA 2B6AB 2LP4A 3KLFB 2R8GA 4LF4J 1IN0A 2VG7B 2AMCB 4OZ5A 3TAPA 4QYRA 2ZUGA 3TUIC 1YJNS 1RT7B 3X1LB 1TL1B 5EX0A 2VG6B 1Q7YT 5EX3A 1U1RA 2HHUA 1MW7A 2WVEA 1HA1A 1T9WA 2LCWA 1F6TA 5KFGA 1ZA1B 2R2RA 4LBIA 2GVDA 4IG3B 4EO8A 1RWPB 4WP8A 1RDRA 2Z0GA 3CCTA 4RKUC 1KQKA 2ATLA 4NYPA 1U1LA 4DQIA 2R7XA 2HSEB 4TN2A 2DRBA 1GT8A 1QTMA 4L3KA 1NPRA 3SZ2A 1LFWA 5A8KA 2UVRA 4DL7A 1A7GE 1S6QB 3LGHA 1ZZNA 3KLFA 2UUBF 2Z2ZA 1IKWB 4LMZA 3HHDA 5M2UA 1IJFB 1DRZA 4LFCF 1Q0NA 2YKOA 2MZQA 3LF0A 4CIOA 4DEZA 4NPOA 4KTQA 2DNOA 2EKYA 3RBZA 2OH2A 1SV5A 2WAQD 2APOA 3I0SB 2A6OA 1SJ4P 2I38A 4OYMA 3TQ1A 4IG3A 2ACMA 4JV5J 2BRLA 3EM1A 3PW7A 2DRAA 4IOAQ 4FKYA 3DLGB 3OFEA 1KEKA 1KRPA 2ZH4A 3Q23A 3TJ9A 1JLGA 4TLRA 4Y28C 1TU0B 1NHKL 3F41A 2YKPA 4MKAA 4NA1A 3TP2A 5HO4A 2VH7A 3PW0A 5HAOA 1IBKJ 1A6LA 1MNEA 2C2ZB 4IFVB 3PRVA 4ED1A 4LRBA 2LYVA 2QLBB 5CABA 3OR2A 2RRBA 2J7WA 3L7OA 1AXQA 2QLJB 2C42A 3R3TA 4NLVA 1WG4A 5CZXA 4JUZA 2DRDA 1SBRA 4MKYA 1D8YA 2COLA 5CYMB 3KNGA 5F0WA 1RAAB 1D09B 3SQGA 5EWEA 3JAMU 3C6TA 1KFSA 1KWMA 2B9XA 1NMEB 1MROA 5F8HA 2RILA 1FNXH 1R0AB 2YQ3A 4QU7A 4LJMA 3OL8A 3DRRA 2GO9A 1D8ZA 1NSAA 3HFZB 2FHMA 2OD4A 4I7FB 4JV1A 3HHLB 4LBPA 2CQBA 3CDBA 2F1FA 2C3YA 3M2RA 3KMSA 1Z2LA 2XYHB 3FVYA 2FPHX 3M6UA 4I2PA 3Q2TC 4JI2J 3A8EA 4N5SA 3DOMB 2W8LA 5H9EK 2XB2D 4WIIA 4DL4A 3DXBA 3IGVA 2ADCA 3D2WA 3EDQB 4QWCA 2ZH1A 2CJBA 3K17A 1SQEA 3CNQP 3MPWA 3U1LA 1S79A 3IS9A 5JJBA 4ZVUB 2D3ZA 3QQCD 3TRGA 3MZIA 3NKYA 3Q8UA 3W1YC 1SI9A 4K4XA 4PZVA 3B6BA 3UN5A 3F56A 4CTAB 2UV8G 3CJRA 3RAQA 1LW0B 2F63A 3PO4A 2XHWA 2H3EB 5LMUJ 4JI5J 2F5GA 3ZTQA 4A46A 4CLSA 2OPRB 3HPOA 2XMMA 1NPPA 3ISND 4K4ZA 4U6PA 3DOMA 1YTYA 4KGMA 1OIAA 3BDPA 4IH6A 4K5SA 1RA6A 1NJIT 1IXKA 1UFKA 3HHLD 4KPCA 4GKJF 4DPTA 4IG0A 2NUUG 4RU9A 4HHUA 2IC3B 3KLIB 5AE1A 3M1VA 1V3SA 2KH9A 2ZJPQ 2BM1A 3UNGC 1Q5YA 4ZOSA 4OHWA 1H2UX 2HVEA 7AT1B 1U09A 2K2PA 3OPKA 3I9V9 4NASA 2OMOA 2YBVA 2N7CA 1HMVA 1U2RA 1WD6A 2H48B 4L72B 3MCSA 3UNYA 2N82B 3AJ1A 2D3OR 1NK5A 3VWSA 2YWGA 4NMXA 1V5VA 4EZ6A 1KR4A 3NNAA 1EAYC 3M6XA 2J0QD 3R5GA 4KHRA 2FC9A 2Y0SD 4D3GA 2MQPA 4AL7A 2CRLA 2MJUA 5E41A 4DL2A 2QJ3A 4QYZJ 2JEJA 2LXIA 1NZAA 3M8PA 3NCRA 1TKTB 1CJUA 2RQKA 5H9EJ 3BZQA 5E3PA 5E3QA 1Q16B 2C2NA 2IBKA 3G6ES 4USHA 4ZLPA 2YKNB 3PY8A 4IOCQ 4F4YA 1XC9A 3ADAC 3QGIA 2MKCA 5HL7Q 4TQSA 2XGQA 2R8JA 2QV6A 4KE5A 3I82A 2JFDA 4LF7F 2M7SA 4CYUB 4CO2A 4F36A 5L38A 2WVBA 1N6QB 3CC2S 5CD4H 4NCGA 1Q79A 2CJQA 2KYZA 5U47A 3ITHA 1RTHA 3AT1B 3BREA 4FDFA 3CCMS 5KG2A 2LDYA 3FCVA 2ZH2A 1VQPS 1RWNB 2KU7A 2R7TA 1U4BA 1BQNB 3BR9A 2DGUA 3LQVA 3DM2B 3GYXB 4ZITA 4J9PA 4YFUA 4J9LA 1RTDB 1BMQB 4Q0BB 2HWTA 3AAWB 1OO0B 3TEHB 2M0GB 5CCLA 1FKOA 4ED5A 4PG6A 1TZ0A 2FZCB 1U6BA 3BEGB 3W2VB 4NX9A 4DLEA 3CJ8A 2BKNA 3CCJS 1WWHA 1T03B 2HFNA 1C1CA 3LA0A 3UDCA 2MZSA 4DU8A 5LXYA 5DLFA 1JMTA 1EKSA 4MK8A 5JVGQ 1S6PA 3V6DA 1RSCA 4J37A 4N8OA 1JJHA 4URQU 1S4FA 3K7RA 2YX7A 2AP6A 2FQQB 2CZ4A 3L3CA 3TUPA 3POTA 2NCKL 4EYHB 5IT0A 5B09A 2IJFA 1R27B 3BSCA 5DQGA 5AXLA 3WX8A 2ZDOA 1TMJA 1HWIA 2HRYA 3M32B 4OLPA 4U9RA 1IKWA 4LBHA 3CJKA 4X4RA 3OL7A 3ZFVA 5KG4A 1MMDA 2FVSA 4F4AA 2V0NA 1S1UB 3AHPA 1JLBB 2QL5B 5D4NA 6AT1B 4JI8J 1AFJA 3VAMA 1MU2B 2VKRA 5KG5A 3CSKA 4KGXB 2OMLA 4DX8H 3PG9A 3OL6A 5A8RA 1FJ7A 2BJ3A 3M32A 4WYLA 3QYYA 4NCGB 3CJKB 4L75A 5KFDA 2RF2B 4ED3A 2F9DA 4DU7A 1JNZB 1VK8A 2HBZB 3BN4A 3ZTSA 4J9MA 3ZC4A 1S1VA 4I4BA 4J9SA 4IO1A 1XNQJ 2KG0A 3HP6A 2IMOA 4ED6A 1TVRA 1KQSR 1H2VZ 2AT1B 2EFNA 3H59A 3PYGA 2LQJA 3RZAA 2CQCA 3MPVA 3QFWA 3TA2A 1FCAA 4CLTA 3Q0AA 3SIPB 4ZA1A 5E5NA 3MM5B 4ID5A 2NSBA 4JI8F 3SCJE 3US5A 2CIMA 3L7PA 2UXDJ 4YP3A 3M30A 1TAQA 5B08A 3LANA 2LQ8A 3A3PB 3RG6A 1T9XA 2W7PA 1XMOJ 4JI2F 1JX4A 1EQMA 2P9CA 4DPYA 3DMJA 3MPUB 3VTIA 5EDWA 5C42A 2N4CA 2KM8C 4C8NA 2FY1A 2J9DE 4RW8B 2CG8A 2HQFA 2ZBQA 3U27A 2D9OA 3IBFB 3IWXA 4DMZA 1FJEB 3P49B 2Y1RI 1GXLA 3PR5B 4F50A 2H4YB 2I9SA 1TL3B 3BGLA 3BGRA 4FXDA 1C4AA 4AXJA 2FLPA 3P8BB 1PKUA 1RCXB 1TMMA 1HNZJ 1R8AA 2HZAA 4KR0B 3UFCX 2B8PA 2F8EX 3ILOA 4GO5X 1UZHA 4I2QA 4DV5J 5KFIA 1N48A 1KOHA 4XIUA 2G2YA 5C25B 1S59A 5HLFA 1URRA 1UEVA 4HACA 5F3TA 4ZJOA 3W61A 4URGA 2RS2A 2Y1JA 3HD2A 4QBUA 2IVFB 3OUYA 3N5BA 3DFEA 2DHAA 2GIRA 2FVQA 4DV4F 7FDRA 1U1NA 3KYLA 4NEZA 3CIMA 3SI8A 4LUBA 1IBLF 4O0NA 3MR7A 4IQMA 5D78A 1APSA 1TL3A 1SPBP 3BQ2A 1SJRA 3H42A 5AT1B 3FJ2A 5CHCB 3R7SB 5LT5A 2XO6A 3RR7A 3M8PB 3TANA 2UVUA 3AODA 1ICEB 5G0RB 1VJWA 1GMUA 5LL6d 4X66J 4C48A 4DR2F 2EC0A 1HPZA 1S6OA 1KLMA 4FYYB 2MDAA 2W9BA 1CULB 3K8VA 2CQDA 2GHVC 4PPZA 5IT9Y 3T19A 2WBMA 4I6AA 4NLXA 1SC3B 2MQ8A 1N32F 1NM2A 1YGYA 1FKPB 1EETB 2OUGA 5LSRA 2B7CB 4CZCA 4C8ZA 4FVCA 4QR2A 4IRDA 3LP0B 4HL9A 5GMKa 3CB4A 3JYTA 1UPMB 5M2PA 1NNDA 3GZ7A 2E9TA 4LRFA 4RPFA 4S0MA 3PW5A 3LP2A 3UDLA 4FBUA 3N6NA 4UZBA 1DBDA 3H5SA 4IRCA 1QM9A 1WOSA 2QIFA 3CDAA 3C46A 4ED7A 3Q2SC 2GW8A 4IDKB 3SXLA 4RW8A 2E1RA 3W2VA 5A8WA 2AU0A 4NXMJ 3NNCA 4OZNA 3AB4B 3HZGA 4KKOB 3CC7S 4JV0A 1JXLA 4JI4F 2VB6A 2BUNA 1B4SA 1JB0C 2MKYA 4X4TA 4DFJA 4OZ3A 2G0IA 5AE3A 4PG8A 1J27A 5KT3A 1TAUA 2BJ1A 4ZVOB 5HMYA 4FKXA 1SCJB 2OSRA 2MLZA 3ZZPA 2YTCA 2PI4A 5D0GA 3SEOA 2W8KA 2I6WA 3WC0A 1XN9A 2AQ4A 3ONQA 4H4KC 2NS1B 4Y6IA 4ZKAA 5F8IA 1FRKA 2Y1LB 3QT8A 1NSQA 3GMGA 2VKZG 4C0HA 3NGSA 4C3MA 5DETA 5L1JA 3KJFB 5CCMA 2I2YA 3ILLA 5LMNF 2GHWA 4NRUA 1MG7A 4B9NA 2H5JB 3HULA 5A76A 3KDNA 2DHHA 4TY8B 3Q8VA 2OIHA 2JEIA 4NCAA 3PVXA 4DI6A 3OJSA 3WC2A 2RIJA 2AJ1A 1S7IA 1MU2A 2QX0A 3AJDA 3ICLA 4RR5A 3RU0A 1X5TA 3MCOA 2BZ2A 3VR1A 4JI6F 4E8UA 3MR2A 4LFBJ 2IRUA 4OYBA 5D0HA 4PCQA 2MQOA 4DR4J 2WSEC 1QUVA 3FFIA 2HLTA 4E98A 1AA1B 3RYLA 1M5SA 1RB0A 2BE9B 2XNQA 2AEJA 4W98A 3CJ5A 1WELA 2GHPA 3EICA 4WKYA 4IUFA 4UF4A 3IRXB 2DHSA 3THTA 1J5OB 2XSFA 1AYEA 1NAQA 1ROFA 1NK4A 2ZKUA 2MEWA 4K50A 4LSLA 5DJBA 4NI2A 1JLQA 1YK9A 1SH0A 1Y5LB 2MGZA 2EXUA 3W9HA 2AJ2A 2ROEA 2YQ1A 2WSFC 4DOZA 3R1LA 4R8UB 3OT9A 4CCHA 2V68A 1Y3JA 5L46A 3DNCA 3T5JA 2AZ1A 2AJ4A 2QO3A 1T9VA 1HNWF 1J5EF 5E0OA 2ASJA 4KGVB 2ZWOA 3O6QA 2F40A 4K7QA 1RBLA 3IA0A 4N77A 1X9SA 2EG2A 1TFWA 2W2PP 1KKHA 3GLJA 3IP0A 3MEGA 3OD2A 3Q8YA 5KG3A 2VPXB 2XY6A 4PABA 4U7UK 4K0KF 4Q5VA 2KKHA 4WFYA 5MAOA 3KDOA 1HW9A 3OVSA 1N5YA 3JSMA 2KN4A 3D54A 1TKZB 2CJXB 3R9LA 2QEXS 3PZPA 3UN3A 4CLYA 3TYTA 1CG2A 3B82A 3KOAA 4DV6J 3CJSA 1C1BB 1Q8BA 3PCOB 4HACB 1Q7LB 4GMKA 4HVZA 1LNQA 1VK3A 3CCWA 3HSDA 4PQUA 4CT9A 2HAIA 4C2MA 1YJUA 3HDSA 1ZTWA 5EN1A 1TP7A 3VAIA 4JI4J 1RABB 2DXFA 2MZJA 1NKEA 1KVKA 1C1BA 3TUJC 2A18A 1Q8LA 3THVA 2BJ9A 1WKLA 1Y5IB 4WZQA 4OHXA 3PX6A 3DYAA 3WX4A 2J9DA 1AZSA 3JQKA 3O44A 3P5TL 3PIOQ 2RDJA 2H4WB 4MMOA 2DR6A 4HHJA 5KFQA 2E1CA 2ZH8A 1N5VA 3HO1A 4OV6A 2QSFA 3DMJB 2IAJB 2J9EA 2CJKA 5HI7A 3QFHA 4USKA 4FYDA 5B0AA 5D4OA 3PKYA 4TU9A 1YZ7A 2ZHAA 1ZPVA 3WIVA 2W2NP 3H98A 3OFHA 3QIPA 2O5DA 2KVIA 5IWAF 2LU1A 5D0RA 2CQIA 1X9MA 1LWCB 4NWBA 4PWDB 1IKYA 1R31A 3G6XA 3FBCA 3CD0A 1I94F 2WHOA 5IV3A 1VOMA 2YNHA 3FNNA 3J80Y 4K0KJ 3IM8A 1BLUA 3QAUA 4EBEA 4QWAA 3KJVA 1R0AA 4FP9A 3A12A 1X7VA 1NJXA 2UXBF 3FRZA 3I0RA 2KHDA 4RWWA 2UP1A 1EB0A 5KFJA 2KI2A 3MMJA 3NCQA 5ETQA 4QOTA 5ADZA 4LIRA 2J8AA 1KTVA 2PMWA 4C3LA 1TELA 3DM2A 1Y7PA 2CQHA 2HQ3A 1RKJA 2E7VA 5HMXA 1HNXF 1V6HA 5GMDA 2DGOA 1Q8KA 3BGOP 1X31C 2V8PA 2D41A 4KJIA 1YDLA 4ZLNA 2NXCA 4ES2A 3GSIA 4ED0A 1YITS 5HROA 2DNKA 1SL2A 1BQMB 4OX9J 2WVCA 4LSZB 1R8BA 2DCLA 1V3ZA 5HVFA 3KLGA 1HR0J 1TL4A 3MPYA 2ZBIA 4NXNJ 1KDNA 2BA9A 2EI5A 5LJ5Y 3DC2A 1SV5B 5KFWA 1QJHA 5MLCV 3OLBA 1UP1A 1PYSB 1YRTA 2CQGA 1M5VC 5J1EA 3AD7C 4BC7A 2MB0B 1VJQA 1E6YA 3C14A 3S1TA 2HNZB 4YMEA 2KZZA 3ZTPA 2CJAA 1FWPA 4ZCKA 1NK6A 2B9WA 4OMFG 3TO8A 2DEJA 3MTJA 1NKCA 4U8YA 3KG4A 4CYUA 1NCLA 1N6QA 5IWAJ 4NXNF 1H74A 1WHVA 2HNYB 2RJZA 2EW9A 2POKA 3DLGA 1N5TA 3G82A 4DX7A 4IRKA 1UJ6A 1JLAB 1AT1B 4L73A 2R7QA 1XNQF 3CJ0A 3KUGA 1XR7A 1AUSL 3M9OB 1FVSA 4NLGA 1WKKA 4PXBA 3BGFA 2HHWA 4OX7A 2BOPA 1YI2S 3R8YA 1M5HA 3GV5B 4QWDA 1OYEA 2WCXA 2AHOB 2B51A 4HTIA 4DR7F 3A8KA 2MSTA 4IYQA 4R0EA 3CCES 4LQ9A 3JB9k 3EGVA 3FSIA 1YJTA 4A8FA 1K73T 2EWHA 3N6LA 4QCLA 1DTQA 5A0YA 2ZZMA 2HZCA 3D7SB 4IKAA 1S6UA 3H40A 2HZVA 3TW0A 2VJUA 1IQTA 1X4BA 3FSXA 2C28A 1K0VA 4A4JA 1NHVA 3RAMA 2HHHJ 2PFFB 2SXLA 1ZM2A 1SKSA 4NZ6A 4R5PA 1HHQA 3NCPA 4KYZA 1WDDA 4JI0F 3D1HA 4Y65A 1BQNA 4PYDA 3BF4A 5K14B 3W2WB 4B3OB 2W9CA 2DR5A 3D0IE 2BBEA 3GIKA 3CIZA 1U1KA 2PT0A 2DNRA 1H6KX 1QUPA 3ZZOA 2QSWA 3D6HB 1F2HA 1R43A 2V34A 4X66F 3FEZA 2MJNA 3LUYA 3R6GB 1WUUA 4F4XA 4TU7A 3CEDA 2DBBA 4C9DA 2W9AA 3MM9A 2ZVIA 1LK5A 4PKDB 1HNWJ 3PYFA 1BD6A 1PAUB 2V2QA 4EGLA 4TY9A 3BQ0A 3LP2B 3KG0A 3R5DA 4P7VA 1K1QA 3V4IB 3ZZUA 3P6YC 2VUGA 2IC3A 2HVIA 1N54B 3LP1A 2XY7A 4B3RF 3TJAA 3IR5B 3MEGB 2GC8A 2NREA 1C0UB 2CPYA 3UQSA 1LXJA 1VBKA 2G1DA 4DUYJ 3I31A 5J2NA 1OJ4A 2HRUA 3NWRA 2B7BB 3KJNB 1TKXA 2B0GA 2Q6CA 4Q7AA 4LF7J 2J6SA 2DNQA 3QT5A 4K4YA 3R2DJ 2J0WA 1ELOA 2OO4A 2UUTA 3Q8SB 4JV5F 3UWTA 2AEFA 3NGTA 2HQCA 4UTGA 1FD2A 1HD1A 4ENOA 3G2XA 4PWDA 1P6TA 2NLWA 2WSCC 3C16A 4OX8A 2HWIA 1TKTA 4QIWD 1XMQJ 3MXHP 1LW2B 2CNOB 4LSNB 5B7WA 3TR5A 3WBZA 2VONA 2HKEA 4UOHA 3QRPA 2R7UA 2VPZB 3MMCB 5LMNJ 2ZBRA 3NEKA 2V4JA 3DU5A 2OPRA 2PEBA 3CGIA 3VVUA 5KT4A 1G3OA 3GIJA 1GTHA 2PFDA 4O4RA 2BW2A 5M2RA 2CQ1A 3VZHA 4I7FA 4PUOB 1YIJS 1U1OA 2KT3A 4WXWA 3GJQB 3OTCA 2OPSB 5HQMA 1R7IA 4BBYA 3KLVA 2JJ4D 1SJFA 5AXMA 4J9NA 2MQMA 4F4WA 1HHSA 1NPKA 3QT6A 3DKDA 1IKXB 3GP9A 1RT1A 3P4UB 3HHKA 4EYIB 1YG0A 1DTTA 2A3JA 2ABYA 1LEOA 3L4BC 3MM6A 5E7OB 3ET6B 3HSJA 1P9YA 1T95A 5IQ6A 4ECQA 4GVBA 1KD1T 4YS2A 1WC5A 3ENVA 3W9JA 4XAKA 3MD3A 2VA3A 5T7LA 4C8OA 4H4MB 3RB6A 2W2OP 5DDPC 4JI1F 4PG5A 1JKHA 2B5JB 3X3UA 1CJTA 1B99A 1I51B 1WTFA 4EO6A 2E66A 2P2CB 1K44A 1RACB 3AB2B 3DDIA 5HBMA 5I3PA 4CLKA 5GAEU 3H4BA 2JL9A 3R5JB 2CPXA 1BE4A 4DL3A 1VLYA 4DR6J 3H5UA 3ZXWA 4ZIWA 2B4PA 3W65A 4OJ3A 2CQ2A 4XPCA 4PPDA 1PILA 2C3OA 3OTDA 5CD4A 1VQ9S 1KTQA 2BACA 2AX0A 2DNMA 2X51A 1S9EA 1LKZA 3AH6A 2ZOFA 3CD5A 3M8ZA 3POTB 4FYVB 4RBUA 2YH0A 3UO0A 3W5YA 3QSYB 1YJRA 2C2EA 4NYZA 3BBCA 2XWXA 2HURA 4FNIA 4IFYA 4LRDA 4ELUA 1QDUB 3SSQA 3DRYA 4JYAF 1Q86T 1S48A 3UCUP 1FJGJ 2R4FA 1H7WA 3FRYA 1JKHB 1WI6A 4KIAA 4CO1A 4XPEA 1RT2A 2KVQE 2XLJA 4TLQA 2XO7A 3T1HF 1WC0A 1RGVA 2XI3A 1RAEB 1T9UA 1NH7A 2DHXA 3BM7A 3WQPA 4ALZA 1WHYA 2MHEA 4NLSA 3AD8C 4WBFA 1BUXA 4OLOA 1P1LA 4DSIA 1KQFB 1WEXA 1HWUA 2VC1A 1FVQA 4DWIA 3KHRA 2R8KA 3Q83A 3PV8A 4XK8C 2PMZD 1G6BA 1UTAA 4F0HA 4DSKA 3IFEA 1HNIB 2C22A 3P3DA 5I3UB 2DNGA 3PNIA 1S1XB 5K8NA 2ASYA 2HHVA 2NXUA 3MM8A 2RT3A 4Y2CA 4BWJA 1IBKF 5CA5A 1WACA 1VQ8S 1M5KC 4P52A 4QWEA 1Q1KA 5DQHA 4AL6A 2FC8A 2BJ8A 1UVLA 4ZPTR 1N34F 1ZOTA 1U45A 2RMLA 2PI5A 3OTOF 3JXOA 2MSSA 3VAFA 2YNGA 1RAGB 3FKBA 4A8YA 3EUNA 4PQAA 4EWTA 1N56A 5DDOC 2HHSA 1CJVA 1FK9A 3M8WA 1FFSB 3MAAB 4LT6A 3SYZA 1TTHB 2JNJA 4PWUA 1WORA 2XZDB 4ILLA 2UXDF 1S97A 2V2VA 3ELHA 2BMBA 2JDJA 5F8NA 1Q95G 2HBYB 2WW8A 4DPOA 4LFCJ 5DG7A 2DNLA 4JI0J 2XQCA 2KXHA 2Z56B 3AA8A 4CNZA 4YQWA 2VFSA 2BV3A 3AOBA 2M2BA 2VFRA 4MYTA 1GX5A 1F9HA 4QPTA 5D15A 4RUCA 4X4SA 1NDPA 3MR6A 4YB7A 2L3MA 3LOUA 2PD1A 2C2RA 2ZFHA 3KK2B 3OXGA 1VQYA 4P71A 3BQ1A 4OHZA 4P7TA 4CRJA 1I6JA 1RYSA 4QYZK 3HX9A 2ZVSA 2IAJA 5KFLA 1S72S 2BKOA 2FJXA 3EGZA 2QL9B 4OYAA 3CJQA 1X0FA 2VODA 1XNRJ 4ILRA 1GNKA 3F44A 3N0VA 2M5YA 2CPIA 2WVDA 1RCOB 1P8GA 2XZTB 1CJTB 2CNLB 1YBAA 5IQQA 2KDOA 4CH0S 2JC0A 3M9NB 1RAJA 3HVRA 3E3XA 3MI7X 3UDEA 1YJVA 2DO0A 1LWCA 4UOCA 1YHQS 2J6UA 2VL1A 1QAIA 2LEPA 2ZBCA 4KQZA 4BLGA 5KT6A 4Q8FA 1EQ0A 2E5JA 2IJRA 5J1EB 5L39A 2V8VA 1KLMB 2RHQB 2RRNA 3GE9A 2J7KA 2JZ5A 1F3VA 2WB4A 3JQJA 2V8DA 1EKRA 3BBFA 3M30B 1WKJA 1HD0A 4P2SA 2OLWA 2IYIA 3MM8B 5GMEA 1LV5A 2ZUAA 3DLKA 1L3UA 1H2TZ 2VDIA 3QZ7A 4A8OA 2DEIA 2ZD1B 3DI6A 4HR2A 4NYOA 5KFHA 5GAGU 4DR3J 5KG1A 3TA0A 1PO6A 2D69A 2X7IA 3N6MA 2R42A 4ECRA 3CMES 3PFEA 4MT1A 4CQ1A 4DUYF 1Y4ZB 1P9QC 1S76D 1U47A 2VOOA 3W9IA 1CJVB 3NRBA 2G2ZA 3PRDA 1MWZA 3ILIA 3JTOA 4KFBA 1FFGB 2OP5A 2HGNA 2P9EA 2A6MA 3B54A 2HNDA 1T02A 2KYXA 3OBIA 3QGPA 3W60A 3CO0P 1GMVA 1EP4A 2OHDA 5KFEA 3QJJA 2QYGA 3CJTA 2KXNB 3VAGA 2R7OA 1RP5A 1F5BA 2E5IA 2FGOA 2M70A 2W01A 4F26A 3IBCB 3CJ3A 2CAJA 4ZP8A 1KONA 2AYEA 4NL5A 3NBPA 4WE1B 4FYXB 1NBEB 4ZPWR 2B4VA 3MCMA 2IPOB 4CP5A 3EZOA 3BSAA 2BANA 2JVRA 2Z58B 3EXCX 1RISA 1REVB 1NLKL 4OQJA 4CLFA 4LQ3A 1LWEB 1F60B 2BE2B 1ZM4A 4G1QA 1EIYB 3OQ2A 2R8IA 4M5GA 3CCLS 4O3RA 1C0TB 4DQSA 4WF9Q 4B9SA 3MMAB 1F2GA 3GCWP 2V4QA 3H8YA 3G8QA 1JLCA 1TV6B 1JLEB 1U24A 5LSOA 2EK1A 5J2MB 4O0IA 2HNYA 4ZVPB 2AEMA 2WK4A 3BS9A 2VG5A 4Y2AA 2DTJA 2RH3A 3U02A 1R6VA 4L74A 1WOOA 2DIUA 3BGUA 3G6YA 2OFGX 5E3CA 2WVFA 1S57A 3W66A 3C66A 2CVEA 3Q8QB 1TVRB 1V3RA 4USMA 9ATCB 1ZM3A 1L3KA 2CPFA 3MF5A 3DOKA 1VFJA 3OXLA 2DNPA 1TUVA 3HFKA 3TOQA 3I5CA 4QWBA 3FEYB 4WFBQ 1SQGA 2CWXA 3KK3A 1XNRF 2ZE2A 4ZHRA 3JSRA 1VRQC 2EFVA 4RUAA 5GADI 4OI0A 3BJYA 4LF1A 4ANDA 1YJ7A 6FD1A 1S0NA 2EBGA 4HT5A 4FF1A 4FS2A 3C6UB 4DJBA 4JI3F 3C3LA 3CTRA 1O8BA 1WF2A 4A8SA 5B0GA 4Q43A 2OFHX 4NLPA 1U6FA 1QAYA 3VQSA 4LF8J 3QJPA 3R6LB 4P75A 4R8UA 4F25A 1NO8A 4DR1J 3NGKA 3P5BP 3BYPA 4CNYA 2EFGA 1NZ8A 2PC6A 3ZZTA 2C1EB 2IA0A 2G9OA 2F7VA 2GIFA 1N88A 3PYDA 4I6YA 1HBUA 3ZNUA 1LWXA 1RWUA 2ZE2B 2HW3A 4WPAA 1NB7A 4ZVTB 1RT4B 1KP6A 1UA0A 1NRKA 1WC6A 3I4PA 1X4DA 5SUHA 4DV6F 4WFAQ 1DAXA 4LR8A 3QIDA 4B3MJ 6FDRA 3DLBA 3I6PA 1NJYA 3OLAA 3HI9A 4RUBA 5ETVA 1R8HA 3W5XA 4BC9A 3J81U 2R2TA 4JI7J 1GK8A 5IFMA 1GEHA 2AWZA 2BKPA 4Z7CA 1S0VA 5HVGA 4DF8A 3GR0A 3D9BA 2GVDB 2PMHA 2E1PA 4UW2A 1B0VA 3BKTA 4DSFA 2KB2A 4QIEA 2HWHA 2L9WA 3EXYA 2MQLA 4OHYA 4H4OA 2IYGA 5E33A 3SDEA 2LDIA 1BGXT 3MTKA 4ZPBA 2IMWP 1D9AA 4BDPA 4YR2A 3AXMA 3EMTA 4YOEA 5H1SV 2HQDA 2DXDA 3TWZA 5J2PB 1S1WA 1UVIA 2XS2A 3GCXP 1NK7A 1JIHA 3DGVA 2N3OA 2VQEF 4C0OC 2C3UA 3RBDA 3PW2A 4M5IA 2JHEA 4B3SF 5B0BA 2FHOB 1JLCB 1TV6A 1CPZA 5CYQB 3KLHA 3UD3P 3N01A 4DV1J 2E7XA 5HJXA 4B3RJ 4I2QB 4DZ6A 5HN0A 1VQNS 3EZ5A 3MUMP 1VC6A 2CQ3A 2GJ2A 1TL1A 1FDAA 3GJRB 4DG1B 1RTIB 5A6WA 3I5BA 3GR1A 3R7BB 1VQSA 4J9UE 4UOGA 4F2SA 4M94A 4BS2A 3DOLA 3K0JA 3NGUA 2RDDA 5CYQA 3KLHB 2Z2YB 3CWJA 3DRSA 1GFWB 5AXKA 4XO0A 3MMCA 1IBCB 2ZC4A 1AFIA 5A2QU 1SB6A 3T6JA 2FIUA 1R0CB 4H4KA 4OYWA 5K8OA 2J0XA 2ZJRQ 4JP8A 1ZM9A 1HI8A 1VC0A 1FA0A 5GVQA 1U1QA 3CJ2A 3JQMA 3THPA 2B56A 3DLEB 1VGYA 4WE1A 2FVRA 4DV0J 3PYEA 2CNKB 2UUAJ 4TYAA 4C98A 4ZPDA 2F9JA 4M1KA 4ZVGA 4WIQA 2GQ2A 3EPGA 1IR1A 5ETRA 3IM9A 3TVZA 2XY5A 1HR0F 3LGNA 2R7SA 4ZVEA 2EFQA 2HS4A 2BX6A 4MJKA 1HNZF 2HHXA 4NRTA 3R5BA 5CQGA 2HGLA 4RW4B 3MEKA 4M5LA 5K8PA 3T3FA 1HWKA 4WXOA 1RLDA 2VQFJ 2E1AA 2V67A 1R8CA 2MGZB 1HNVB 5CXTA 4O3PA 2QA4S 2E9RX 2BM0A 2FDNA 2OI2A 4IH7A 5LXRA 2AJFE 3MWBA 5CYMA 2P5VA 4LSLB 3TEGA 3PEJA 4QIVA 1DJ0A 1FFWB 4LIWA 4LFAF 3CJ4A 3J81j 4RNOA 4ECYA 4TQRA 3MGJA 3MEDB 3I55S 1W7WA 3M05A 4J9KA 2E9ZA 2AGQA 2HIQA 3TJ8A 3CUNA 2N4DA 1S6QA 1ZS6A 4KAIA 1RTZA 2XMTA 1WHXA 1C1CB 1FRIA 2FZGB 4M5JA 3SDEB 2IRYA 3NGRA 1IBMJ 5KFUA 2HPUA 3V6DB 2K3IA 3HKZD 4OZJA 2DGVA 2GVZA 1GQEA 2KT5A 2D7SA 1SIZA 4MFBA 3G6VA 2NPFA 4B02A 3NAIA 4UY8T 2YKAA 2I0XA 2XMKA 3BYRA 4AT1B 1VBZA 1DY3A 3I32A 4KKOA 3QO9B 3SSSA 1BQMA 3EYZA 3HSGA 4JOUA 1Z2ZA 4EU0A 5C42B 5KTQA 1SVDA 2DR7A 3OHAA 2RAQA 2DIVA 5THWA 2GMHA 5F9NA 1WOPA 1CC7A 3CT9A 4RW6A 3MECA 4KO0A 1ULRA 2VBZA 2E5GA 2K3KA 4DPWA 5FDLA 4DZDA 3R5CA 3CDWA 2XLKA 3H7HB 3KFWX 4U8VA 4O3SA 1S7HA 4N7TA 4YY3J 1PIEA 4K8RA 4C8MA 2V4RA 2IBOA 4CLLA 2GX8A 2HFUA 1UVKA 3AQPA 3G71S 1D9DA 2NYHA 2YNFA 4OX6A 4GC7A 5E2QA 4CI0B 3OSPA 2CYYA 3RUBL 3Q8PB 2W4DA 1BHNA 2VBXA 3C15A 4OI2A 1GMWD 2FYXA 2LQ9A 3DYAB 3QPIA 4M5DA 4DFPA 3QNWB 2YWHA 2Y3YA 4QJVA 3FQLA 1W25A 2R2SA 4DFKA 4C11B 4TU8A 3OR1B 5DGAA 4C8LA 5C24A 2NXEA 1U0HB 3SCLE 2EG1A 3AY0A 5J2QB 3IBWA 4P6QA 1FKAF 3EDRB 3IAS9 1VRUB 3V81A 4G6VB 3BPSP 3MEDA 4ITSA 5D4LA 1VQ7S 1T3NA 4NLOA 4ZIVA 1NB2A 2LLZA 2QMXA 3BN7A 3QJLA 4DUZJ 2Z4PA 1ITPA 5C2CA 1HMVB 3OL9A 1IKVB 1ZA2B 3UVJA 1HFEL 1OPIA 3DRPB 1UA1A 4Y2KA 2UZAA 3RRKA 2DGXA 4P2MA 2FLOA 1AROP 3P96A 3KJVB 2OD6A 1VMBA 5FD1A 2FY8A 2XYGB 4UY85 1DZ5A 2YKMA 5BYQA 5EWFA 1WSRA 3R1HA 1RYRA 4A8QA 1H98A 2M4MA 2AIRB 1UCNA 2MKHA 1HKAA 3LPEA 2P8IA 2N7YA 3LWLA 2M8HA 1AB8A 2V94A 2XSJA 2FB0A 1J2VA 2ACYA 4JB8B 2AZ3A 4KGKA 4ZPVR 1VIXA 5ETOA 2B4UA 2Z8QA 2ZJQQ 1IBLJ 5H9FJ 4U96A 1PSDA 2DGWA 1X60A 5JMNA 4FF3A 2W25A 1OSCA 3A3OB 3JTPA 2V9KA 4WYWA 3ZO7A 2O67A 4K4UA 2J76E 3PHEA 4UOFA 3W8GA 2V9WA 3G96A 4PRFA 2MKSA 2QN6B 1HQUA 4E0DA 4OZ1A 3MAHA 2DJWA 3T6BA 1IKYB 1PJ6A 2N3LA 1GXUA 1VQOS 1JLFB 4XDDA 2MKJA 5L1KA 1NDCA 3IWLA 3WZ0A 2XSJB 3OFGA 2RQ4A 1RUSA 4WP3A 3AOAA 2GJFA 4PR6A 4U7CA 2JSXA 1FE4A 2FHJA 2XZWA 1RE1B 3LH2S 1JJCB 3NP5A 4ES1A 4ECSA 2CQ4A 5D0EA 5KFAA 2K7JA 1CC8A 1RTIA 3H90A 4RNMA 1MSWD 2W9CB 2HAFA 3CDEA 3MM7B 5HATA 1DQ8A 3DOLB 3SV4A 4I56A 1N5SA 2RUGA 3SQGB 3MR5A 4JI1J 4TY8A 1G2EA 2FUG9 4P72A 2VD3A 3M2VB 3NGDA 5IC4B 3GFHA 3DGPB 4P74A 3M8QB 2CADA 3LAKA 3VF0B 3D1QA 1UPPA 4HYKA 2HRTA 1UKUA 4WWSA 2F4VF 3K89A 3K5LA 3L9ZA 2Y1IA 3PDNA 2F4VJ 1GH8A 4KGZB 5BR8J 2R2UA 3I5AA 2ZHOA 3NS7B 2YXLA 3GIIA 1RHQB 4AE5A 3K5OA 4X4QA 1QSYA 3QGHA 3AOCA 2W4CA 3FMWA 4OJGA 5D4PA 2GGPA 4RWXA 1WF1A 2B8QA 3CCZA 1RU2A 2VFVA 3CO9A 4DV2J 3G4SS 3PW4A 2BQRA 4W90B 3VGSA 1HIYA 3MUTP 5KFKA 1JQGA 2DITA 2DNHA 3IRWP 2D1CA 4YR0A 4KT0C 4OJHA 1SXLA 3TI0A 1NH8A 3A8IA 3BPDA 4FF4A 2HHPA 1WHWA 4DF4A 2DVIA 1G1XA 2AD9A 4I2PB 2XNRA 2UU9J 5KT5A 2Y9HA 4B3OA 4C8KA 2KT2A 1UW9A 2ZNYA 4Q2MA 1H0HB 2VPWB 4ZJLA 3TA1A 4A48A 5I3UA 2XM3A 3MECB 1RT4A 3ITHB 4ZVSB 2JEGA 1SKUB 2DGQA 1HBMA 3T1YJ 3CD7A 3DXSX 4G65A 3OV7A 4NE9C 5AJ3J 2Y0BB 1TK8A 1NK8A 2DR8A 2DY9A 4AXIA 2KTQA 4O4GA 4QIFA 2I1RA 5I3QA 4K4TA 3KNAA 2CFXA 4NLWA 3NG8A 4F4KA 1RTJB 2MQNA 3FC9A 2KZMA 4X65F 4Y0FA 5A0YB 2F8HA 5LOQA 2HGMA 2PDAA 4CM0A 5J2QA 1L3SA 1BQXA 3NOCA 3GJTB 4X4PA 3J7ZT 2IVMA 1S49A 3VZIA 4UQGA 4IFYB 4ERDA 1J5EJ 2QTWA 4RBVA 1FRJA 4HT7A 2XMWA 3FZBA 4CH7A 4KBIA 3DGPA 1JXEA 4URSA 4N47A 1X4HA 4H4OB 1B3TA 3S01A 1MROB 2FJDB 2XI2A 3M7VA 4RBTA 5AE2A 1D1UA 2DH8A 1K9MT 1PGZA 3QWUA 4DQRA 3HVAA 2XCAA 1T9TA 4LR9A 4PAAA 5BYSA 2YWWA 1E6VB 4J9VA 4C0BA 3SV3A 2GMLA 3DLEA 2DH9A 2ZOGA 4USJC 3U1MA 4WU2A 1VRTB 4DR3F 3T1AA 1HWLA 5SZTA 3NS6A 4B9VA 2B6AA 1U7LA 3QATA 1ZTTA 2UV8A 1E6YB 3KKFA 2K06A 5KG0A 5GAHU 2Q3PA 3HHEA 3NOGA 4ETZA 2V4JB 2JVOA 3IR7B 4A47A 1EHWA 2DNYA 3PX4A 1EETA 2D9PA 3PO5A 3EGNA 2OEMA 1M1GA 3W63A 4NOHA 2DKOB 1CULA 4K2XA 4ZLLA 3G82B 3HXMA 1X9WA 2FGCA 1HW8A 3B4DA 2DY1A 2XGPA 2CWKA 2OAUA 4RX6A 3W64A 1T7PA 2DGTA 3TZXA 5DM6Q 2XS5A 3D6MB 1I5OB 2P6TA 4LF4F 2A10A 1VQ4S 2B4OA 1TR0A 1RT5B 3HJVA 3PACA 5ETKA 1JXVA 4A8XA 4BHQA 2HEKA 4U67Q 3RTVA 1KFDA 2ZDPA 1J5OA 4B3MF 2QRRA 3EVWA 1NDLA 4RW9A 4TKTA 1N36F 2RSQA 2AKWB 4MKBA 1FD8A 2Q1LA 1EJ7L 1RT3B 3BH7B 4YY3F 3H25A 4J9OA 1RHRB 3Q89A 2ERRA 3DLLQ 1FHTA 3CVKA 1LW2A 4LSNA 1QD1A 3CMQA 2V8HA 4DCPB 4PG7A 3SFUA 1KVJA 3G87A 1X4AA 3KLGB 2LXFA 4FBTA 1TUGB 1KQGB 2XCPA 3V6JA 5E3AA 3TZYA 2ZH9A 2K1RB 3E01A 5LM7E 3OVAA 3EPIA 2UXCF 3RB4A 1YKWA 3MR3A 3RR8A 3D68A 3GFXA 4F0KA 3CW2C 5F8LA 1VCTA 1EARA 2JX2A 1R0BG 1ZPWX 3KXDA 4LF2A 4ZN3A 2R8HA 1KN6A 4RW9B 1Q78A 1OQ3A 3RB3A 2CDRB 1GXTA 1RT3A 3D4JA 4M63A 4Y2MA 3I4HX 1X8DA 4TXSA 5LJ3Y 4NLUA 5FDLB 1NXIA 3PR4A 4ZVRB 2RS8A 4K5RA 4KHPJ 2BE2A 4G1QB 3TQEA 1UMJA 2I5JA 1O51A 1U2FA 1XK8A 3F0NA 1TKZA 3D0GE 4WTOB 5EGYA 5IXUA 3HM9A 3BKUA 5JVHQ 3BO4A 4F0MA 3IN5A 1XMQF 3GYNA 3SBMA 4Y00A 1NU4A 2FZKB 4ID8A 1U26A 2VBWA 1G4CA 4NI2B 2IDEA 4O44A 4RL1A 4ETXA 2MZ1A 5AJ3F 1Q82T 2XMVA 4GKKJ 2EFPA 4B08A 2VQFF 4PQUB 4OZLA 1IWAA 2NUHA 3IRXA 5LSLA 4R25A 1VYAA 2L08A 5DG8A 1NJWA 4P9SA 2O3DA 2B9EA 1CEZA 5JUMA 1FJGF 1VHFA 1VHIA 4IOBA 1E6VA 3UR0A 3HHNB 4X84A 1IJEB 2VZ9A 4WK3A 2Z2MA 2DISA 4NLRA 1O0PA 4ZP6A 4CWBA 2YNIA 4ZLJA 2X3GA 2MKKA 2QC3A 2HBRB 4A8KA 1ZYQA 1RTJA 4N56A 2IHR1 2MLXA 1SJQA 2OGUA 2K7KA 2Z57B 2R7RA 3H4DA 4Y34A 1N52B 2XTJP 1RJJA 2EC2A 1RWKB 1UWBB 2KL8A 2NPIA 4O4GB 5DDQC 4OYZA 5IS2A 2NQPA 2FVCA 1R6YA 1HBOA 3BO3A 1X5PA 3NLCA 2IVYA 3QLHB 4IO9Q 3NMAA 4I6WA 1C4CA 1VBXA 3R2CJ 1FJCA 1RADB 1D3WA 3FFIB 1PG5B 3ISNC 2E29A 4V1Ak 3CPWR 2LU2A 3ILJA 2H65B 4DV3F 3C15B 4I68A 4YDXA 4YN3B 3PFOA 1MWYA 1HNIA 1X0PA 2Q43A 2M9KA 2WBRA 3V6HA 2C3MA 3H20A 4KHMA 2YNFB 4OHVA 4ED2A 3HHLC 5IT4A 1CQNA 1OY8A 1QY7A 3I0RB 8ATCB 4DQPA 3HF5A 4FVMA 5ETLA 2RU9A 1MLAA 4LRAA 2ZM6F 3G8SA 3BH6B 1HYSA 1TUWA 3KHGA 2MLYA 1Z4UA 3HZEA 5IZHA 2HFSA 4L6V3 1JJ2R 4U7UD 3ZTRA 5D3GA 1WJ9A 4MAKA 1U2CA 4NCBA 4X4VA 3O2IA 1RT2B 1X4GA 2A0FB 3C6UA 5B0EA 1QVFR 2KFNA 1OWXA 1UAWA 4X64F 4H4MA 3IC1A 1HYSB 4Y2IA 2W4PA 3GV8B 4J5OA 2HBQB 3TAMB 1YX2A 1WC3A 2WONB 1KVIA 2OELA 2CKWA 3VQTA 1HNXJ 2E5LJ 3UR3C 5A2QY 3JTNA 3SSRA 3PJWA 4PYAA 3Q22A 2G2OA 4FZVA 4IDKA 5G0RA 4EK2A 3KLIA 2X1AA 1M5OC 5KFBA 2J7UA 5HK4A 5IOLA 2AYGA 1CVJA 1NUEA 5F0UA 4B3TJ 3NMRA 3B78A 2VG7A 4AD6A 1F9FA 1PC4A 4KV8B 2DYAA 4YR3A 1PJ7A 4OV1A 3I96A 2J9CA 4LF9F 3D66A 1UW4A 3KMQA 1T05A 1MMLA 1RWVB 3R97A 3OW2R 2V2ZA 2X1BA 3FSYA 1UWBA 1UVMA 4DQQA 3M8QA 3GQCA 2FD2A 2CJ9A 1Y5NB 1B0PA 5T41A 1IM4A 1S1TA 3ET6A 5B0CA 4Q44A 3KLEB 4DL5A 4QZVB 2AV5A 1X4FA 1WEYA 1X5OA 3JSYA 2B3TB 1SIWB 3QAEA 3PEHA 3WIUA 1YSJA 2XHCA 3I56S 4DV0F 1SH3A 1L3TA 2YPZA 2YKNA 4Q45A 2VICA 4USWA 5DM7Q 1UEKA 1PYTA 2EK6A 2O1PA 3HSZA 2PN6A 3FEXB 1RI7A 4DUZF 1N5YB 1N33J 5ETNA 1I1GA 1HI1A 3DLKB 2HMIA 3PKMA 2NZ4A 4XDCA 4PEOA 2IDLA 1IVZA 5IC6B 5T7LB 4DBQA 2GV1A 2JOQA 2QLWA 5J2PA 3JSBA 1PBUA 4IFVA 2XULA 3S6EA 4P2FA 2ZH7A 5DLGA 4K4WA 1OPZA 1WEZA 3Q8RB 2XMAA 4KFBB 2AYBA 3RRGA 2IJNA 1RHKB 2UUWA 2UVWA 1IM6A 3CD6S 1DLOB 3J7YU 4USUA 1GTEA 1BC6A 3ZZ0A 1DQ9A 5KFPA 3C6TB 1JLQB 1XJWB 2FJBB 3A4TA 4NLTA 3VCDA 4ECTA 3GB0A 3D6TB 1S1VB 3TZZA 2HVDA 2JLGA 2J0SD 4ZVQB 1Q5VA 1FX2A 3O8WA 4MK9A 5DS7A 1FX4A 3KHHA 1EZZB 1LOUA 2Y8WA 1TL7B 3H2LA 4FXVA 3GG0A 4OI6A 1SH2A 4NA3A 5HLFB 3M2RB 3CCSS 3L95X 2LQBA 1PBAA 3D3BJ 5ETTA 1OY9A 2Z2LA 3DRRB 2K1RA 4ED8A 2YX1A 3RB0A 2EEYA 2BR0A 2HYIB 2DT9A 3HHLA 4MK7A 1SQFA 4WFXA 4EFAC 5KT2A 4DSEA 4O23A 1HBUB 3D28A 1QAJA 5F8GA 3EX7B 1RZMA 3VAKA 3GPAA 2DPIA 2VASA 1FDBA 3JAMY 5DDRC 2ZH5A 1LWFA 2W7AA 4IH5A 1YWXA 1B7YB 2H51B 2LFVA 4M5HA 3AQOA 1HQ2A 3NWGA 2IA6A 2GNKA 1FRMA 3WHIA 3NL0A 3C19A 1TL5A 1FE0A 1A0OB 1UL3A 2J8SA 5FLXU 4HTJA 4X62J 4Z7YA 1F3FA 2UUBJ 2L41A 2OJ3A 2HQIA 5KFZA 1JJ4A 2RQMA 2P9GA 2KJVA 4EBDA 2RDIA 4DN9A 3N4WA 2M88A 3ZZRA 3UVJB 1JLAA 2CZ9A 2C2OB 1BWVA 1KOOA 1WSVA 1C0TA 2O01C 3G86A 3I0SA 3RGIA 3J7AN 5DZ7A 2KM8B 3J7A1 2UXCJ 1RK8A 1S4EA 3IG1A 4KH1B 5A6PA 3OFFA 1RT7A 4JV2A 1VISA 3G8TA 3K5MA 5IM0B 4BWMA 5KOXA 3Q24A 4AQYF 5IV4A 3DRXA 4AQYJ 1R89A 2CPJA 3V5RA 2VF3A 4CDIA 3LP1B 2BXJA 1CS4B 1LQ9A 1DARA 3EGWB 1XR6A 4PXDA 3GIMA 4QU6A 1S9GA 1WG5A 1U1MA 5D3GB 3DLJA 1KHVA 4G1IA 2GQCA 3VALA 1IWGA 4V19X 4JYAJ 2BE7D 2VFUA 2LA6A 2XYPB 4USVA 1QSSA 1OS5A 1JK9B 3EE3A 4WFZA 3OTBA 1ZETA 1Q53A 1PYOB 1YRUA 3FBFA 2E5LF 1RQ0A 4HDHA 4IR1A 2H5IB 3LGMA 5K9FA 2HG4A 1XMOF 5GAGI 1S5ZA 1N36J 1PJ5A 2BRKA 2WONA 1CQMA 2CPHA 3HT0A 1HBMB 3K8WA 4NMLA 2GZOA 2CPEA 1IBMF 3S8SA 3M8SA 4KHPF 3H5YA 2H54B 2GAGC 1HNVA 1FI4A 3PTWA 4OYIA 4CO5A 3OSNA 1I94J 3MPDA 2Q79A 5ETMA 2R7WA 3J81Y 4DS4A 4QQBA 3DCAA 3R5AA 1NKBA 4O3QA 2V2KA 3MFIA 2ZH3A 2ASDA 1O6XA 2DO4A 4KO0B 1RTHB 1RWXB 2DXEA 1HLWA 4LFAJ 1MN7A 1KSPA 1KBRA 4O3NA 4Q8EA 5KG7A 3TX0A 3CCUS 4UUWA 2VDHA 4BCAA 2U1AA 4YEAA 2BQUA 3HLUA 4JI3J 4RUHA 2JC1A 2UVVA 2VBYA 2LEAA 1N32J 2DNNA 3CMAS 1WG1A 1ZAXA 3A3NB 5F41A 3PJXA 3CXCR 2GVZB 1W26A 4ECWA 3CDUA 3QRQA 1B7FA 2CDQA 3AJ2A 4DR1F 4DV1F 2GS8A 2MKIA 1TKDA 5I4MA 1MN9A 2KJWA 3GU0A 3M2UB 1KNZA 1YRXA 2HNZA 3GONA 5C5JA 2DR9A 3VAJA 4GVBB 2KXFA 4RLEA 3MMAA 1CLFA 1RHJB 4WP9A 3HKWA 2CJYB 3ZZYA 3E51A 1YVFA 1RT1B 2WOMA 3C2PA 1B64A 4TNOA 1AZSB 1FTCA 3DRSB 4TVAB 1OY6A 4K4SA 2L9NA 1HQUB 3ZTOA
chains in the Genus database with same CATH topology
1FNMA 1V9OA 1UETA 2YNIB 3BR8A 3E01B 3UW1A 3MM7A 5BYRA 1T3OA 3IGNA 4ILMA 2XWYA 5I42B 2HS0A 2OKQA 4R0JA 4D3HA 3MAQA 4RZRA 5KFCA 1M1KT 2PE8A 4EEYA 3T9ZA 1S1TB 4B9TA 2LVWA 3UCGA 1RT6B 2XS7A 3I9ZA 1F5CA 4OFZA 2Q66A 5FLXY 4NLQA 4NA2A 2MY7A 3K5NA 4DSJA 2FTRA 2G13A 2MY8A 4MYUA 3D5MA 2JLEA 3GSDA 3HJFA 5D8HB 1R8PA 1WNEA 3BGRB 1WI8A 2RU3A 2OTJS 5CZVA 1HWJA 3O5TB 2QE5A 2RD5C 5CH7B 3J7YI 2FLNA 2RKIA 3F73A 2X1FA 2ILYA 3MDFA 2J6TA 3U7JA 2RF2A 3DHWC 3ULHA 1W2IA 3FDSA 2GJIA 5KFTA 1TK0A 1S1WB 1YJ9S 4Q2LA 4ZVFA 2GFFA 1KC8T 3LAMA 3M9MB 4DSLA 4M5DB 2YNHB 1P27B 3SFGA 4FN5A 2YX4A 2IRXA 3DHXA 2W7OA 1S10A 1UVJA 2EVZA 2LA4A 4KSEB 3HVWA 4ECUA 4K4VA 2F3JA 1NEEA 2PIIA 4DDFA 3BSOA 2BYCA 1DHMA 2CQPA 4C97A 2VOPA 1VRUA 2X1GA 4MFBB 4H54A 3WDOA 1FESA 2YNGB 3SMZA 2PA3A 5C24B 2W24A 1SUQB 2J5AA 2P6SA 3UI3A 4HI1A 4CO0A 2KG1A 1H38A 2YWEA 2I8EA 2QA2A 4FS1A 5HMZA 2L48A 3FQKA 5HP1B 5KAKA 1VS3A 5F8JA 1T8EA 1FXLA 4QR1A 2CZVC 5JXSA 4IR9A 4ZMMA 4NXMF 4F02A 1M0SA 1UFWA 4CO3A 2BDPA 2LMIA 3I87A 1RTDA 1U8SA 2OPSA 2LECA 1CSJA 4HH0A 3K58A 1S1UA 4LF5F 1NHUA 4FXWA 1SUQA 4KRWA 1ZAVA 1S99A 2B9YA 4EBCA 2W9BB 2E44A 2ZC3A 3L09A 5HP1A 1HI0P 2PEHA 1XEZA 4HEA9 4OI4A 4YB1P 3C8YA 3MUVP 4C4WA 3GWCA 1U49A 2PGCA 3T5HA 3RRHA 2BABA 5HROB 1S0OA 2GGPB 5GADU 1F5AA 5EWGA 4QW8A 2MQQA 4AL5A 5AXNA 1QE1A 3NNHA 1KLNA 4DR4F 1SL0A 1GX6A 1QSLA 2U2FA 3J7Z5 2C3PA 4DN0A 4AYBD 1VQLS 2G0CA 1IR0A 1NK9A 2ZH6A 4ECXA 4B17A 4TYBA 1M5PC 2LKZA 3TVKA 2LXUA 5GAEI 2Q6BA 1VQMS 1U1PA 4GO7X 1W2BR 1IKXA 4C3KA 2HHHF 4JI7F 5B0FA 4RW4A 5T14A 4ECZA 3OHBA 5KFVA 4N8NA 1RT6A 4OI1A 5KFYA 4F2RA 5KFRA 3LP0A 3V81B 1TQLA 4NZ0A 3KHLA 2AJQA 4WFNQ 1UFLA 1Y3KA 3IXQA 2M52A 4OIXA 4EUVA 4MTPA 3MMBB 3TNVA 1BY9A 2QLXA 1FT8A 1U25A 2ASLA 3FCHA 1ZH5A 2IM2A 5A8WB 1SJ1A 1DLOA 3ZZZA 4I0WA 1UJ4A 2AYMA 1BWEA 2QA1A 1FF2A 3OXFA 2OPQB 3MMBA 4NLDA 4ZCLA 2AF6A 3OTEA 1U6ZA 2O66A 2RVJA 2ALZA 3QWPA 3TAMA 1N8RT 2LQ5A 4LFBF 5A8RB 1T94A 1D0EA 5KT7A 4DS5A 3HT3A 1HHTP 4W92B 2DH7A 1X4EA 3AA9A 3DDKA 4YB5A 1JLBA 1LFPA 4DHVA 3CCRS 2OPQA 1XMBA 3HVTA 4O3OA 2VV5A 4RW6B 3IR6B 1QAXA 3M8RA 1N4LA 2DPJA 2BANB 1SL1A 3D1OA 1DQAA 2A2CA 4DR5F 5L1IA 2ZD1A 3DI6B 4A8MP 3DRPA 5KFOA 3MOJB 2H9ZA 2EPIA 2FHJD 1DURA 2DD8S 3MM9B 2D74B 2CQ0A 5L8RC 4GC6A 2R7VA 3B8HA 4I69A 1K0TA 2JEFA 5J1PA 2HNDB 3MM5A 4ID5B 5B0DA 2LEBA 4MIAA 1RT5A 1HPZB 4HDGA 4DV5F 2RKIB 4DL6A 1IUJA 1S1XA 3LALA 3K57A 3LO3A 4Z37A 4PXCA 2E5HA 3IS9B 4EZ9A 3K5PA 2HVHA 3K2YA 2ZHBA 4DL0C 5KFSA 1L5UA 4B9MA 5HQ8A 5G4DA 3E8OA 1FEHA 2AJ0A 1S9GB 2IM1A 3FGVA 5C25A 2RB7A 2RRAA 1T05B 3HK2A 3O1LA 2BVZA 2ADBA 2KRRA 3A1YG 4A8WA 3KTQA 2FJEB 2R9LA 3PIPQ 2OTLS 3DU6A 1XBWA 4ES3A 2KRBA 1P1TA 4DV2F 1FDNA 3LWMA 2YKQA 2C2DA 3FMBA 2OPPA 1ZBTA 3CULA 2WOMB 5K5MA 2IM0A 3PXGa 4DLGA 1WF0A 5DG9A 3OR2B 1FKOB 2JWNA 2VG6A 2DCUB 3NAHA 2I5JB 2QMWA 4KQZA 5KG6A 3GG1A 3TVYA 3NBPB 5J2MA 2M8DB 4QIGA 4Q0BA 3PRBA 5A8KB 2NYIA 1KS2A 1T03A 3M4XA 3KG1A 1HBOB 2AGOA 2MZTA 3IG1B 4WU3A 3OR1A 1FEEA 1FXRA 1Q8IA 1X5SA 2GO8A 2ZNZA 5IM0A 1VBYA 2H5EA 2KHCA 3DN9A 5L9NA 4YUDA 1URNA 1LWFB 3RW6A 3BSNA 1UVNA 3KK3B 1DTTB 2FHKA 1FRLA 1ZZFA 1LWEA 2V8GA 5HBMB 4WTYA 5K8MA 4X4NA 1XERA 2RQCA 2HVZA 3FZ2A 4K59A 4CO4A 2ZITA 2B5JA 1HBNA 2AGPA 1HL6A 3CC4S 4ZVHA 4YB6A 3CF5Q 4NZ7A 3BDEA 1Q4RA 4F3MA 3N5FA 4ZHRB 2V5HG 1X4CA 2CG4A 3BO2A 1FRXA 5LMUF 4JI5F 2HHTA 1LK7A 4MIBA 1YJWS 3QO9A 1UEUA 2BJDA 2GCFA 3DOKB 4X4OA 4KPYA 1D9FA 4NLYA 2OSQA 2OH2A 4F3QA 1MMNA 1UJ5A 5KFNA 2VC0A 4RW7A 3KK1B 4RU2A 3GILA 3W7BA 4UUXA 3JYTB 5D77A 1ZAWA 3MEEB 2F8MA 2YWKA 3GV7B 1Y00A 4OZ0A 2XC9A 1NK0A 1XR5A 4ZPAA 1SJ3P 5L9XA 1JLFA 1N0VC 5EHHA 4B3TF 3TUZC 1DFDA 3DDNA 2BQ3A 2HFOA 5KFMA 5KFFA 2HHQA 5FIIA 1K1SA 1Y9OA 4OI3A 3E2EA 2MHNA 2GA7A 3UPFA 4WCEQ 4ECVA 4UQTA 3KK1A 2FVPA 7FD1A 4C8YA 4CTAA 3VAHA 4KB7A 4WZMA 2IM3A 2A1BA 2QZ8A 3QGGA 4USIA 2BJEA 1O5JA 1JWWA 4WJBA 1FKPA 2QA4G 4F67A 3MFHA 4CH1A 4ATNA 4V19J 2HMIB 2A2DA 2EFOA 4HH1A 2CPZA 1B0TA 2DK2A 1FTRA 4KV8A 3T1YF 5I42A 1H3DA 2XLIA 1HBNB 3LPYA 4Y3CA 1SC6A 1N5QA 2PA8D 3JSMB 4LVNP 3M1VB 4X2BA 2WRMA 1G7CB 2VFTA 4X62F 3KLEA 1QVGR 2MXYA 1GAOA 2VPYB 1HQEA 5F8MA 2NR0A 2FJWA 4PUOA 1SKWA 3V4MA 1N0UA 4JBCA 1XWLA 2YWFA 2RNEA 2VA2A 4WK1A 2ZZNA 3IAM9 5DO2A 3B4MA 4F3OA 3ENQA 3NS5A 3SCKE 3MEEA 1N33F 2AW0A 2WB1D 1QE1B 1FERA 2DB1A 5BR8F 3V4IA 4N41A 1XTZA 4IQXA 3ENWA 2KO1A 4ELVA 1VQ5S 3PM9A 3ETOA 5L1LA 1FK9B 1LXNA 3H5XA 1VI7A 1JNRB 4X4UA 5EUHA 1S77D 1TKXB 2K8GA 5GAHI 2OPPB 1RKIA 4CT8A 2ZOMA 2UUCF 2B43A 4LVOP 2E1MC 2XMJA 4MH8A 4FNHA 2CPDA 3CCQS 1U48A 4HLBA 5DGBA 4FPRA 2VG5B 1IQZA 2YKMB 2M3DA 1JLGB 4OJ1A 3V6KA 2YVSA 4RW7B 4ZCMA 1R3NA 4GKKF 3T9NA 3IWNC 4Z2XA 2QT7A 1S9EB 2JRSA 3UD4P 4C7QA 3M2VA 1S0MA 1KHWA 4ZP7A 1Z1ZA 3U1NA 4HI2A 1S9FA 3TX8A 1H7XA 3EZUA 4ZDN