2OJJA

Crystal structure of erk2 in complex with (s)-n-(1-(3-chloro-4-fluorophenyl)-2-hydroxyethyl)-4-(4-(3-chlorophenyl)-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
344
structure length
344
Chain Sequence
RGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Flipped Out: Structure-Guided Design of Selective Pyrazolylpyrrole ERK Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 111
structure length 344
sequence length 344
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ojjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ojjA01
5J1WA 3FLWA 3A7FA 4FICA 5CSVA 3HAMA 1DI8A 2VZ6A 3MYGA 4P5QA 1GIHA 4FE2A 1JNKA 3CCNA 5AP7A 3P79A 4BCOA 1OMWA 4GK4A 2YITA 4MNEB 3QL8A 4LMNA 2WIHA 5FRIA 4DBXA 2X2MA 5AIRA 3FQSA 2QO7A 1WBNA 4IQ6A 3ZZWA 1SVHA 4E4MA 4R6VA 4P5ZA 2GHLA 4K2RA 3GI3A 4KRCA 4TT7A 4FV5A 1Z9XA 4BGHA 4KKGA 4NFMA 4QMNA 2R3MA 2QG7A 3T9TA 4I3ZA 1SM2A 4FMQA 2XM9A 3ERKA 4M68A 4C35A 5J9LA 4CZUA 5IZFA 2WTVA 4IM0A 4DYMA 5E4HA 2PZPA 3LFEA 3ZHPC 2AYPA 5HCYA 4FV6A 4WNMA 4ZEGA 2NP8A 3GQLA 5K4IA 5T3QA 3VC4A 2Y7JA 3A4PA 5AWMA 2R3LA 2BIYA 3IGOA 3KCFA 3DV3A 5FTQA 4TL0A 4PL4A 5ETCA 1FOTA 5DT3A 3NGAA 4ZXTA 1BL6A 4ITHA 5BYZA 4RZWA 2JGZA 3MY0A 5HO8A 4AZTA 4JDJA 4WOVA 4F65A 3OWJA 4CCUA 1BX6A 2OO8X 5I9UA 4L67A 1UWJA 4D9UA 3ANRA 5CU0A 4JNWA 3OXTA 4EUUA 5A9UA 1KE9A 4AT4A 4MX9A 1A48A 3GU6A 4H1MA 3MJ1A 3LFBA 3DLZA 5IUIA 5DEYA 1E1VA 2OIQA 2W1ZA 4K0YA 4CV8A 4C7TA 1ZY4A 4FSRA 3GU8A 5K0KA 1H07A 2QI8A 3P23A 4CMTA 4PMTA 2RSVA 3EN9A 1STCE 4XYFA 2C6IA 2I40A 2W9ZB 4FV7A 2Y4IB 4Z55A 4A7CA 1OECA 3QX4A 3R2BA 5E92A 3ROYA 2B9IA 2Y9QA 4UEUA 2BPMA 1YI6A 5L6WL 2UW4A 3FL5A 4UALA 4PL3A 4IIRA 1JKKA 3PJ8A 3MWUA 2E9PA 4JAIA 2OZOA 4NW6A 4C58A 4KIOA 4J1RA 3MJ2A 2HAKA 2CNUA 2IZRA 4BGQA 3R02A 4CFNA 2J7TA 3C5UA 4WBBB 4EI4A 4R3CA 3A7HA 5TO8A 4JIKA 2W1GA 2CGWA 2PVMA 4Z16A 3KREA 4O0UA 2W9FB 4F9YA 3A7GA 3NW6A 5EI8A 4KSQA 5HVJA 4YSJA 4RVTA 2YDIA 3GT8A 3HRCA 3OCGA 3M1SA 3ZO1A 2UZVA 5KMNA 2EU9A 3CD8A 4LRKA 1XR1A 2I0HA 3ODYX 2R3QA 4L00A 2VO7A 3G33A 4ASEA 4CZTA 4KIKB 2GQRA 3F3VA 1REKA 3NW7A 4IB3A 4UMQA 4X3JA 3I1AA 3NCZA 4KB8A 4YBJA 3TKUA 3W2PA 4B4LA 4DH1A 2CNQA 2ITOA 2YM4A 3IO7A 4RQKA 4FZ6A 2YWPA 3OEZA 5DI1A 3T9IA 2W1IA 3UG2A 1O6KA 4HJOA 3TWJA 4DEAA 4UZDA 3W33A 3ZLWA 2OLCA 3KMUA 2GNFA 4WKQA 4QYFA 4HYIA 3AOXA 2WMVA 3R1SA 4AW1A 4HCVA 2B54A 4P90A 3EHAA 4G31A 1WBTA 4GFMA 3BLHA 1O9UA 1IAJA 3O71A 2WELA 3OW4A 4D2PA 3TKHA 2W5HA 2C30A 2JKQA 4DG0E 4ZJIA 4D0XA 1J3HA 2NRYA 4TN6A 5FXSA 3UOLA 3ZFXA 3QTXA 1OKWA 2B9HA 3LCDA 2XB7A 2WTKB 4EC9A 3D5UA 3UO5A 3OROA 4EYMA 2FYSA 3PYYA 4RA5A 3A61A 3FY0A 3LM0A 3PY0A 4FVPA 4XOYA 3CQWA 3UPZA 2C5VA 2OIDA 3V5PA 4R1VA 2F7ZE 4Q9SA 3DKOA 3OOGA 2RG6A 2QOOA 2C6MA 1H08A 3M2WA 4ACHA 2JKMA 5HG7A 3NIZA 4JIAA 2IW6A 2UVXA 5IF1A 2QC6A 4FZAB 2VO3A 3RM6A 3QCQA 2XH5A 5A4EA 3U6IA 5DHJA 2P0CA 5AV2A 3BGQA 4ACCA 4YZDA 5F4NA 4M84A 3CGOA 2V5QA 3NW5A 4U81A 4NU1A 3TNWA 3ZUUA 3W2QA 3MBLA 3DZOA 1ZY5A 4ERKA 2O8YA 4GK2A 3HUBA 4RJ7A 4U42A 3OS3A 4DLJA 3RALA 4AG8A 4Y95A 4E93A 4G9CA 4XOZA 2PE2A 5LARA 4O6EA 5AV0A 3DA6A 1UU9A 2UZDA 4FT5A 3ATTA 2J4ZA 4XUFA 5HE1A 3ZC6A 3KULB 3FZRA 4YMJA 4CGAA 5CF8A 3SAYA 1WCCA 3FSFA 3QRJA 3MVLA 4AGCA 4G3CA 2I1MA 2Z2WA 3ZUVA 4HGTA 4O22A 5J5SA 4EH7A 2B52A 3F2NA 5M4FA 1Q3DA 2GNJA 3HLLA 3PRFA 2F57A 2XK8A 5IQFA 1BL7A 3EKNA 2VO6A 3LZBA 4IWOA 4XG8A 5HLWA 4O7WA 1CMKE 5AFVA 2YIWA 4W8DA 4H1JA 1H1WA 4ZTQA 3Q9WA 3VF8A 4FEXA 1O6YA 3GNIB 4GV1A 4EQUA 2WMUA 3F3WA 2RG5A 2XK9A 4QT1A 4D55A 2QKWB 4EH5A 3UNKA 3VUGA 3LFCA 5BVEA 3FI3A 1LPUA 4J53A 2UUEA 3WYYA 2C0IA 4TPTA 1P4FA 4RBLA 4C02A 4MYGA 2C68A 3DFCB 3MH3A 5ANKA 4R3PA 4MWIA 4RX5A 3D5WA 3MB7A 3GOKA 3PIXA 4DG2E 3Q9ZA 2BDWA 2WOTA 1G3NA 4G3DA 4I24A 4LYNA 3MA3A 1ZZ2A 3HP5A 4YUQA 4R77A 4BHZA 4PF4A 1GIIA 2VWWA 2ZV7A 4HNIA 4LOPA 1EH4A 4Y72A 4FSWA 4AP7A 4NM3A 3ZFMA 2AC5A 2BTSA 1HCLA 4WSQA 5HU3A 3CQEA 3RJCA 3E64A 5CU2A 1W84A 2WMSA 4QYYA 4ZIMA 4RVKA 5EW3A 3R9HA 4MQ1A 3WBLA 4QP1A 5LQFA 4YJQA 3ZM4A 2B7AA 5EH0A 1JBPE 1PMNA 2DQ7X 1NY3A 3MGYA 4QPMA 5TKDA 2XKDA 3EKKA 2W05A 3K2LA 5DOSA 4CD0A 3UBDA 5ITAA 3PP0A 2JLDA 4ZP5A 3HRFA 5M4CA 4HGEA 5CU6A 3WYXA 2JD5A 4F7SA 3L9NA 2Y6MA 4N4SA 4YURA 2JITA 1JSVA 2Z7RA 2UZOA 4P2KA 2HELA 5AUXA 4RIOA 3UNJA 3QD0A 2VTAA 4G16A 5CNNA 4OLIA 3PXFA 2OH0E 2R3RA 1DM2A 4OR5A 3SC1A 4IVAA 5GZAA 1XH4A 2QOFA 4S33A 4IADA 4BI1A 1YRPA 4EWQA 3VUDA 3M42A 2PZ5A 4DGNA 5K3YA 4FTAA 5AP1A 4ZJVA 1YQJA 3H30A 4FTLA 2R9SA 4EK5A 2XBAA 3TI1A 5LJJA 4FBXA 5DFPA 1UNHA 5AAFA 4TY1A 2IZSA 2HCKA 2C0TA 4U40A 2QOHA 2BAQA 2YIYA 3CEKA 4YLKA 3VO3A 1KOBA 2FSLX 3NX8A 4YO6A 4QPSA 2QLUA 3R7VA 5M56A 2F7XE 4FKIA 5CAVA 3UZTA 3E62A 2XNEA 4E7WA 2FSMX 1G8AA 5CF6A 2ITUA 3FZOA 4E3CA 3TACA 2EUFB 3PXQA 1OIUA 1OL2A 1TQMA 4UV0A 4F63A 3BHHA 3BU3A 4GH2A 3UYSA 2VTHA 4E6DA 3QALE 5EM6A 2XYUA 1YWRA 1K3AA 3LCKA 3R9DA 3RPOA 3SV0A 5D10A 3ZCLA 4EOQA 5A4LA 4PUZA 3UZPA 3A62A 4AZSA 3UIUA 3FAAA 3PJCA 1SNUA 4RIWA 4XV9A 1OIQA 4S31A 5CYIA 5EHYA 3V5QA 1XHAA 3MW1A 4IAKA 5DMZA 4Z9LA 4F0FA 1S9IA 2C5XA 4M7IA 4PX6A 3KA0A 3T3VA 3K5VA 3W55A 2ZDTA 3CIKA 4J71A 1R3CA 5DBXA 4PDPA 5CWZA 3ZH8A 3DJ5A 1A9UA 2P2IA 1U54A 4GT3A 2W4OA 4ANLA 4CKRA 4DFNA 4FSZA 2EB3A 4PL5A 4E26A 4CYIA 2UZLA 3DNEA 3K3IA 2XCHA 4QQTA 5M44A 4BIDA 5JSMA 4M15A 4I6QA 3DK6A 3ZS5A 4AW5A 5IEXA 5KMKA 3MA6A 1PXJA 3UIMA 5GIPE 4I20A 5EYDA 2PVFA 4RLLA 2ITWA 4YPDA 4EORA 5JGAA 3R01A 4N70A 2VNWA 5HVYA 1H27A 3FI4A 3GFEA 4LUDA 4O81A 3BELA 3OUKA 5IMXA 2VTTA 3QZHA 3MV5A 1LEWA 3MIAA 4HZRA 3KK9A 3RMFA 5M08A 4YBKA 3Q53A 2YCQA 2W7XA 1PJKA 2A19B 4IC8A 1CKIA 4ZTSA 3FPMA 4XBUA 4YJUA 3EN5A 4YJSA 2W4JA 4FT9A 1XWSA 2FB8A 2W1EA 5JRSA 4W9XA 3FYJX 5AUVA 3GC9A 2XEYA 4FKRA 3G9NA 4FV8A 3EFLA 3DXQA 3VWAA 4AZWA 1SVGA 4KUJA 4ALWA 3QAME 5DA3A 4DA5A 4FL1A 2WTJA 3QCSA 1MQBA 1U5RA 4FUYA 3RPSA 4BKYA 1W98A 4EK6A 4ID7A 3C4ZA 4RJ6A 3TTIA 4DCEA 5BMSA 1W8CA 3W2RA 2C3JA 4ZMFA 3QTQA 2W17A 3IW8A 4PTCA 4F0GA 4J7BA 2C1AA 3D5VA 4FOCA 5M57A 3TNHA 3BHTA 2YIXA 4QMXA 4AE6A 3EQCA 2V7OA 2XA4A 2B0QA 2DYLA 4GUEA 2OZAB 3A7IA 4JDKA 2PVRA 5BUIA 2O63A 2BR1A 3QU0A 3SOAA 1WBOA 3DBQA 3OOMA 4CNHA 1Q8ZA 2P55A 2VTOA 5AV4A 3IKAA 3TJCA 4QMPA 4AZEA 1QPCA 4E73A 3H0ZA 1RJBA 3QA8A 4KABA 1YOLA 3GU5A 5BVWA 2WTWA 4RJ3A 4K18A 2CCIA 1JQHA 3UOHA 3S1HA 3E3PA 1PXLA 4A4XA 3BLQA 4IXPA 4MXYA 4EOSA 3FBVA 4KINA 4PTGA 4BBEA 2IG7A 4BWXA 1XQZA 3P7CA 3MVMA 3U9CA 5JT2A 3U6JA 4YTFA 1KOAA 4V0GA 3UVPA 4RFMA 3OBJA 3EZVA 1FGIA 1KE8A 3OBGA 3WARA 4C4IA 3EL8A 4U41A 4AWIA 2X8EA 5LVLA 4ACMA 1QPEA 4DLIA 2J0KA 4JQ7A 1V0BA 3FKNA 4O7SA 4Y83A 3FXZA 4BBMA 5LWNA 4O0SA 3VNTA 4ZLYA 5FEQA 4M97A 1GNGA 3JXWA 2XJ1A 4D58A 2OU7A 3QRTA 2CPKE 4U3YA 1L3RE 5EYMA 3OTVA 1Q4LA 5IA5A 3TN8A 4B8LA 1JKTA 4O0VA 3ZFYA 3V6SA 5FG8A 1PXMA 4AT3A 3DB6A 3AD6A 5DGZA 2I6LA 3C50A 4TYHA 3RHXA 3DKFA 4E6AA 3TT0A 1YVJA 3O7LD 5CAQA 3KN6A 4FC0A 4XNEA 1P14A 5IA0A 1K9AA 3ZLXA 5J79A 4K8AA 2GNHA 2HZIA 2JKKA 4NEUA 3AC5A 4ALUA 2VWZA 2UZEA 4X2GA 2UVYA 4RA4A 3W10A 3VUHA 5BUEA 4FIGA 3HMPA 3P08A 4FL2A 5EOLA 1GY3A 2JDRA 2X8DA 4QMOA 3FMJA 1Q41A 3AC1A 4GIHA 4WRGA 4NWMA 5GZ9A 4AT5A 4DH7A 2YIRA 3AGLA 3ACKA 3N4VA 1M7NA 3EQDA 3BX5A 5CXZA 5TT7A 4YHFA 4QO9A 2VX0A 2HIWA 5H8BA 2HW7A 2CKOA 1SZMA 2Z7LA 4RIXA 2XIYA 3PJ3A 2WQBA 3F6XA 4F1MA 3ETAA 5AP5A 5DR2A 2C47A 3C13A 3SX9A 3IECA 5DT0A 5KBRA 5J5TA 2ETKA 3P1AA 5EQYA 3VUKA 4PMSA 4AOTA 4S34A 2P3GX 4RX9A 5AUWA 4DTBA 3OVVA 4YC6A 2PVNA 4BR3A 4ONAA 4BCKA 2BHHA 4YGAA 1YXTA 3POOA 4I0TA 3QQGA 3UQGA 2FUMA 2XRWA 4RWJA 3SG8A 2YFXA 2YJRA 3OT3A 1H25A 4O2PA 4PQNA 4D4RA 4JR3A 4X3FB 3BEAA 1GZ8A 4O91A 1JVPP 3F69A 4I1ZA 5ACBC 2WU7A 1M2QA 4BCNA 4AQCA 4BCGA 4EOLA 2YHVA 3BWFA 3R8ZA 4S2ZA 4XHKB 3VS7A 3VULA 5HX8A 1UA2A 3U51A 3OD6X 3W18A 1VJYA 3AXWA 2ITTA 3ULZA 3LXPA 3RWQA 5L6PA 4YZ9A 1Q8TA 2OF4A 3SXSA 5AR8A 2IVVA 5HG5A 2X6EA 1UU7A 3ZO3A 2YM5A 2YJSA 2RFDA 2GQSA 1K2PA 1WBVA 3CS9A 5HHWA 5BYYA 3OHTA 3IPHA 2WKMA 3CKWA 3E87A 4H58A 5KMLA 1PRYA 2HXLA 2IO6A 4TWCA 4YZBA 4EK4A 4MXZA 3CY2A 2IVUA 2X9FA 4YNOA 4CZYB 3TUDA 4FUXA 3G90X 5AR3A 4PDOA 4I5CA 4R7HA 3MTLA 4MNFA 5DYJA 2QOBA 4BTMA 2G1TA 4PP7A 3Q2MA 5ANDA 2UW0A 3UP2A 2B9FA 3DGKA 3KVWA 3DXPA 1M52A 2WIPA 3KRXA 3FYKX 2VTRA 2VTLA 1YOJA 1UWHA 3QXPA 4FKTA 4RPVA 3RCDA 4AXAA 4UMUA 3DKCA 1H1QA 2XP2A 3OY1A 4B8MA 3BCEA 2GU8A 4DH8A 3IDBA 4ALVA 4GKHA 2NPQA 4FT7A 2BIKB 4F9CA 1E9HA 2ITVA 3GGFA 3N9XA 3RNYA 5I9YA 5L2WA 1NT2A 1I09A 4IX5A 4XLVA 5IQAA 5M51A 1CDKA 3FEGA 3R04A 4I5PA 4YTHA 2FGIA 3IDCA 2DS1A 3OCTA 3OCBA 4B6LA 2XNOA 5EDQA 2JDTA 2PUNA 4BYJA 2REIA 2QG5A 1OZ1A 2X6DA 4NM5A 2ZM3A 2PVJA 4UX9A 3ULIA 1GZOA 3U4WA 4WG5A 4A9SA 1IG1A 2BROA 4MH7A 4FIHA 3WOWA 4WNPA 4AAAA 3I5ZA 3IW6A 2CKQA 4K33A 5ANEA 1H01A 3NYNA 4FKUA 3BWJA 2XIKA 3TL8A 2GNGA 2QVSE 1DAYA 5EI2A 3N4UA 1NVSA 2Y4IC 4JVGA 4L3PA 5CQUA 5LOHA 4YR8A 3UZRA 5ACKA 4Y85A 3C51A 4AU8A 5HG8A 4C4HA 4ZSAA 5LVOA 4BVUA 4FV3A 5LVNA 2QOLA 5FQDC 4ZLOA 4M69B 3VS2A 2IW9A 4OTGA 3TCPA 5A14A 4IX6A 2JIVA 5AA9A 1YHSA 4FTNA 2HY0A 5FD2A 4MAOA 3N4TA 4BWKA 4GCJA 3HYHA 4RJ5A 1IRKA 1XH5A 3F5UA 3L8PA 3LFQA 2BVAA 2GDOA 1GZNA 5E7RA 2CN5A 2WU6A 3RINA 3E7OA 1M17A 4NSTA 5EDRA 5AUUA 2EXMA 3VRYA 2C3LA 4NZWB 3DBFA 4O1OA 4DHFA 4HOKA 4ASXA 4D4SA 5CLPA 4D9TA 2R64A 2XIRA 3SQQA 1PKGA 4FIJA 3OW3A 3FMDA 2A0CX 3ZSHA 4FV2A 5CU4A 4IVDA 4FTUA 5AAEA 5CF5A 3C4FA 3A2CA 2QHNA 2OF2A 2OXXA 2BRNA 1MRUA 5IQDA 3COKA 1WVWA 3KB7A 4JG8A 3FMEA 2YZLA 2PZIA 3QKMA 2NO3A 2XYNA 4CT2A 4J8NA 3H9RA 4FTOA 3BQCA 2Z60A 2QHMA 2V7AA 2W06A 4ZY6A 3UPXA 4C3FA 1V0PA 3EQBA 1WVXA 3DJ6A 4L44A 4F1TA 1YXVA 3KRWA 4A9UA 2IN6A 4DTAA 1VR2A 1WBSA 3LVPA 4IJPA 3SG9A 1JLUE 5AUZA 3GOPA 4JBVA 4WUNA 4YHTA 2QKRA 2R3KA 4CSVA 4ZY4A 4JBOA 4BL1A 3D7ZA 1YI4A 2WTKC 1AGWA 5I9VA 4O7YA 3RPRA 4QRCA 3BRBA 3QZFA 3PP1A 4GU9A 3FXXA 3TNQB 5HTIA 3NYVA 3THBA 4BTKA 3U6HA 3TDWA 1OPLA 4Q5HA 4RJ8A 3D83A 3NPCA 5JGBA 3C0GA 1H00A 2BILB 5LMBA 2ERZE 4BTFA 3OWPA 3PY3A 3Q6WA 3LE6A 4LGDA 2E9OA 2WQOA 4ZK5A 4D28A 5LVPA 3CP9A 4JX3A 5A4TA 4IHPA 4DTKA 3KU2A 2BDJA 2GS7A 5KMMA 3L8SA 5CSXA 4TYHB 2V62A 3DAEA 1W7HA 3FHIA 4J99A 2ZV8A 1GJOA 3MPTA 2IZTA 2OSCA 4TW9A 4Y5HA 4YC3A 3LCSA 3QQJA 4KRDA 3VBXA 1NXKA 2B55A 2WMQA 4C36A 3C5IA 5EYCA 4XCUA 1WFCA 3CC6A 4OTDA 2DWBA 3C4CA 4TYEA 4IW0A 5KCVA 4F7NA 4U0IA 3WF5A 4BZOA 4CFVA 2HY81 4WNOA 3R7UA 3QD4A 1R1WA 4EOIA 5FDXA 1ZMVA 4CT1A 5EYKA 5GIOE 3RZFA 2UZBA 4OTRA 3Q6UA 4W8EA 5CAPA 3OXZA 2JC6A 4I6BA 3ORIA 4L6QA 3FE3A 3D7TB 1IA8A 3QTZA 1WVYA 4R7IA 3DBDA 4X2FA 5L3AA 3ORNA 3RK5A 3OWLA 4LQMA 3FY2A 4NTSA 3PVUA 3M11A 2KTYA 5J87A 5IQIA 1AD5A 1OL1A 4FEUA 2JIUA 2W5AA 4D2TA 5IEVA 3QRIA 3GP0A 4UN0C 2R0UA 4I94A 4HVIA 2JKOA 3A60A 3RWPA 4USFA 4X2JA 3Q96A 4EBWA 2PUPA 3G6HA 4MQ2A 3NDMA 4FKWA 2C6LA 3I6WA 5B2LA 4K77A 4MXCA 4O38A 3QLFA 2YM7A 4LMUA 3Q9XA 5AP3A 4WNKA 3QTUA 4NIFA 3CPCA 2PTKA 4I0SA 3UO6A 3BE9A 4NYEA 3DQWA 4ZY5A 4FK6A 4QYHA 2YZAA 3E3BX 3ZONA 2FO0A 2X4ZA 3ROCA 2GS6A 3GCQA 4UXLA 3PA3A 3GENA 5I3RA 1OM1A 5AADA 1QPJA 2JDOA 4G2FA 1YI3A 3V3VA 3F66A 5IU2A 5KNJA 5CF4A 3PXZA 4N6ZA 4KKEA 1E1XA 1UV5A 5EM7A 5GJGA 2WNTA 4EZ3A 4I92A 5HI2A 2PULA 3PPKA 2UW6A 4UYNA 5L4QA 1KE7A 3MB6A 4QOXA 4BYIA 4FV0A 2BMCA 4H05A 1IEPA 3UP7A 4C38A 2W4KA 3PG3A 3CGFA 3Q9YA 3O96A 2PK9A 3JS2A 4TYIA 1PY5A 2JIIA 3MY1A 4JRNA 5AR4A 4XRLA 5KZIA 2C6DA 3ZBFA 2CN8A 4R78A 2OJFE 4WUAA 3VW8A 5HICA 3U8WA 3E63A 3R6XA 4QQCA 3RCJA 3SRVB 1BYGA 5HIDA 4F0IA 1CM8A 3HRBA 2VTNA 4IE9A 4ANSA 3RVGA 4P7EA 4BC6A 3CY3A 4ANQA 2B53A 4YJRA 3ORMA 4O2ZA 2R7IA 3LCTA 4HPUE 4USEA 2R3PA 3QQHA 4JT3A 4G5PA 3AC4A 3TTJA 2PE0A 4S30A 5JQ5A 4BGGA 4FSQA 4A06A 1OIRA 4YTCA 4FI1A 2VUWA 5FM3A 3R2YA 3PTGA 2O2UA 3DJ7A 3NS9A 2EWAA 2YAKA 2WO6A 3FLYA 3SKCA 4F9AA 3W8LA 2J5FA 3HV4A 1WBWA 5I3OA 3COMA 3W16A 4ENYA 3U4UA 4E5BA 4ZS4A 1P4OA 3DAKA 5HNGA 2XIXA 3BIZA 2VGOA 2OW3A 3LAUA 4TYJA 3CD3A 2BKKA 3FKLA 4XV2A 4FIEA 5HIBA 5BVDA 4CYJA 5FXRA 4PPCA 4IAFA 1J91A 1Q8UA 4PWNA 3PVGA 1B6CB 3PPZA 4IVCA 4CG8A 2OXYA 3BLRA 2CDZA 2QR8A 3EN6A 4I5HA 5CAOA 3E8DA 1UKIA 3NNWA 2YACA 5A6NA 3MPAA 3NWWA 4QP9A 3ANQA 3F7ZA 4EOMA 2ZB0A 2YISA 1YHVA 3R00A 1BKXA 4EBVA 4E6CA 3VBQA 4NK9A 2XEZA 5F1ZA 1SNXA 4FNZA 4LGGA 5D9HA 3G2FA 1J7IA 4A9RA 2IZUA 4I22A 3GBZA 3UOKA 4BZNA 5JFVA 2JAVA 4TWPA 1ZYLA 5E8TA 5M55A 2CLXA 2V55A 4HYUA 5BQ0A 3RBWA 4IANA 3MPMA 3S4QA 4C3PA 2UZWE 3B2WA 3WZUA 3E93A 3MI9A 2O0UA 4NCTC 1OPJA 5IDNA 5HTCA 5EKOA 3DAJA 4W4VA 5C9CA 5CEIA 4AA5A 5C26A 3VS6A 1MRVA 5I4NA 2QU5A 4IJ9A 4XS2A 5AX9A 4FGBA 2X1NA 4ASZA 4MD9E 4JL9A 4XG4A 4OUCA 4DGMA 5K9IA 3KF4A 4IDTA 2E2BA 3AMAA 2VTMA 5F95A 5FEEA 4EONA 4XLIA 5A6OA 2QURA 3TEIA 3QTRA 3ZBXA 2WPAA 4DN5A 5ETFA 4U9AA 2GFSA 4O83A 1A06A 3EQRA 2FH9A 4BKZA 4GYIA 4HYSA 4EOPA 4ZSJA 4AW2A 4FV9A 4D2RA 5CT0A 4O84A 1OB3A 3FZSA 3MFSA 2B9JA 4QMZA 3FUPA 3PXKA 5E1EA 3SHEA 4BDDA 2E9UA 4YNEA 3IOPA 3MN3A 1O6LA 1U46A 1G8SA 3HA8A 2VNYA 4C3RA 4AN9A 5I9ZA 4RFYA 5AR7A 5D7AA 3D14A 4YZMA 4Q2AA 2OFUA 4OTFA 4ZSEA 2J0JA 3RP9A 4B0GA 5TR6A 5ANOA 2GS2A 4F70A 2PUUA 1REJA 2XUUA 3D94A 4IFCA 4CFUA 3DY7A 3R1QA 4EK3A 4DT9A 1Y8YA 2ZYBA 2X2KA 4U43A 3R7YA 3RAIA 3BYVA 3FI2A 4GU6A 4MTAA 1OBDA 2PMIA 3COIA 4DE4A 1H28A 3I60A 4HCTA 4MEDA 4O7VA 4DINA 2IJMA 4FNWA 3MFRA 4XG7A 2E9VA 2GNIA 5JFXA 2VWUA 3O8TA 5IH4A 3JY0A 4GW8A 1ND4A 4AGDA 3ORPA 4DC2A 3P7AA 3LQ8A 4HVSA 3KRJA 4M13A 2GHMA 4ZTRA 4EH9A 1M14A 4EC8A 4JRVA 3VRZA 3NYXA 1BI8A 3HA6A 3UC3A 3GFWA 4JDIA 3BHUA 4D0WA 4EWHA 2QD9A 3B2TA 4GYGA 3U9NA 3QD2B 4M67A 4RG0A 2XNNA 3QRUA 4E20A 1H26A 3DK3A 1DS5A 3COHA 3NLBA 1Z57A 1PXKA 3I81A 4YU2A 3KF7A 3ZYAA 3E7VA 4R5SA 4ASDA 4Z7HA 1ZYDA 4RQVA 2VV9A 2CLQA 2C5NA 3Q2JA 4FKPA 4M3QA 3G0EA 4WD5A 1NVRA 1ATPE 2XZSA 4GRBA 1Y8GA 4RIYA 2YM6A 5HCXA 2F49A 3R63A 1ZARA 3VUMA 4CRSA 4LUEA 5DE2A 3F9NA 4BICA 4EQMA 3O0GA 4QP3A 2JEDA 1Y91A 2ZDUA 3HMIA 5B0XA 4AE9A 3DT1A 5C03A 3ENMA 2R3FA 1V1KA 3GU7A 2R3GA 4DEIA 2ONLA 3C7QA 3TZMA 5JKGA 3IK3A 3VHKA 3R7EA 4EH4A 2XK3A 3DKGA 5CQWA 3TDVA 3LW0A 2QOIA 3VS3A 2C0OA 3PJ2A 3CPBA 3FXWA 3QUPA 4QNYA 1PYXA 3FMHA 4F64A 1TQPA 4PPAA 5HLPA 3ACJA 1ZOHA 3UGCA 5TF9A 3VS0A 2W1DA 4IMYA 1LUFA 5D7VA 5IA1A 2Z02A 4MK0A 3QD3A 5B2MA 3LFNA 4JG7A 4GIIA 2CHLA 3SD0A 4FNXA 4K11A 3QUDA 5HEZA 3NUYA 4XJ0A 5C27A 3UODA 2PMNX 3CLYA 3L9MA 2O65A 5M4UA 4GK3A 5FGKA 2WMBA 4I93A 3RK7A 3UQFA 2PE1A 4FKQA 4IWPA 2I0YA 4MBLA 5I9WA 3OF0A 3FMMA 3BYUA 1BMKA 4F99A 5F9EA 3UE4A 3BV2A 3GUBA 2HK5A 3EWHA 2E9NA 3Q5ZA 1Q8WA 4OW8A 3AC2A 4GMYA 3V8SA 3W8QA 3U55A 3BYOA 4I6FA 4BDHA 3VHEA 4D1XA 3VBTA 3Q5IA 5ANJA 2OKRA 5IPJA 4D2WA 4FSNA 1RDQE 2YA9A 3QCXA 4WA9A 2PUIA 4KNBA 5TOZA 3MFTA 5E8UA 3ORZA 3I79A 3O17A 4AW0A 5JK3A 4HZSA 3QTSA 5F94A 2F2UA 5BPYA 3BQRA 4BBFA 4MVFA 5EHOA 4BTJA 1XBCA 1R78A 2GHGA 3ATSA 4NUSA 3BU6A 4X3FC 2OGVA 4PMMA 2QOCA 4LM5A 4EH8A 4F09A 2QOKA 4PPBA 4IX4A 4P4CA 4JX7A 4RVLA 4GS6A 4DGLC 1Q5KA 1FVRA 2VO0A 3G51A 3NVKI 4UMPA 3CQUA 4I5MA 4C0TA 1UNLA 2ITPA 4FL3A 4A07A 3BBWA 4Q9ZA 3OG7A 4IX3A 4OBQA 4W4YA 4YJNA 2VU3A 3ELJA 3JY9A 2XS0A 2AC3A 1OUKA 1XH8A 2J0IA 4IZYA 1P2AA 5L2SA 5ETIA 4WT6A 4YJOA 1OI9A 1Y57A 4ZTHA 3L1SA 4RC4A 5KMJA 3UQCA 3L8XA 5CEPA 3SW7A 4OTPA 4TZRA 3HX4A 3W2CA 3ET7A 4PV0A 3WZJA 4ANMA 1IAHA 5A3XA 3SVVA 2HZ0A 3FMKA 4RC2A 3KXGA 3SA0A 5FM2A 3TV4A 1JSTA 2X39A 2VAGA 4EOOA 3LXKA 4J96A 3R9RA 4MNEA 4UYAA 1M7QA 3T3UA 4Y5QA 3EFWA 4BCHA 4QTDA 2RFNA 1PW2A 2BRBA 4BDIA 2O64A 4ZMEA 4JAJA 2VX1A 5B7VA 4QMQA 3F3UA 3CXWA 1TQIA 3HV7A 2ZOQA 3Q4CA 3QA0A 4DGGA 3ALNA 4NKSA 4RWLA 3I0OA 4WHZA 5CVFA 3VS5A 5J7HA 3OWKA 3QQUA 4XP2A 3QC4A 2R7BA 4FTIA 1LR4A 1JSUA 4AN3A 3P4KA 5FWKK 3S0OA 5IMEA 1XH7A 4GEOA 5FXQA 4CTCA 2HENA 3OUNB 4GVAA 4L7FA 1W83A 5J95A 2JBPA 4RMZA 2W1FA 3MVJA 5CY3A 1APME 4C34A 5CASA 4IC7A 2XNMA 3E8NA 2G2IA 2O3PA 5HCZA 4JXFA 4FZDB 4MCVA 4MXXA 4NFNA 1YDRE 4TTHB 3V5TA 2XRUA 5GJDA 3FQEA 4C8BA 4F7LA 3G15A 3PE1A 2F7EE 3FLZA 4D1ZA 4FR4A 2NNWB 4GG7A 4OT6A 3QF9A 2YABA 3GCVA 3VVHA 2QNJA 4AOIA 2RFSA 2Z7QA 2FVDA 5HO6A 3EQHA 5HZNA 3ZC5A 4CXAA 5HD7A 1YXXA 4MF1A 2GSFA 3NAXA 4BCJA 3RTPA 1I44A 2Z7SA 3FMNA 5EW9A 2DUVA 4ARKA 2P33A 3JVSA 4I21A 4RFZA 4ITJA 4AOJA 5M09A 1X8BA 4E4XA 1F3MC 4C33A 3I4BA 5CS6A 5CEMA 5BYLA 3FPQA 3TUCA 3ZOSA 3AT3A 3EL7A 4MXAA 4Z3VA 4BI2A 1H24A 2YN8A 2V22A 3FDNA 3LFAA 1ZMWA 2R3HA 3QLGA 5CVHA 3VS1A 2OK1A 1TKIA 2AUHA 4BRXA 4L01A 3F2AA 4BKJA 3NNUA 3POZA 4QMMA 4FYNA 5HESA 3CR0A 2Y0AA 2OBJA 1UNGA 3O8UA 4QYGA 5HO7A 3IW7A 4DFXE 2OG8A 5EM5A 5HBHA 4DEBA 4IBMA 2UVZA 4H39A 2XMYA 4E8AA 4X7QA 3QGWA 4YTIA 2OWBA 1RQQA 4Y8DA 2XM8A 4O86A 3I7BA 4LOOA 3VJNA 3D15A 5JFSA 3QRKA 5CALA 5JZNA 4CFMA 4TWNA 2R0IA 3NZ0A 3QQLA 4GSBA 4QMSA 4KIKA 3WF9A 4I4FA 2VTPA 4QMVA 4YC8A 4IH8A 3O8PA 4C37A 4RIWB 4G9RA 4XG9A 5J9YA 4BHNA 4O7TA 2OJGA 4FX3A 4G6LA 3GC7A 3IG7A 3R9OA 3VAPA 4EEVA 3R21A 5DT4A 4X2NA 4BZDA 1R0PA 2HWOA 3FQHA 3VQUA 5D12A 3RK9A 3UDBA 3MY5A 4FIFA 5IQGA 3DLSA 2LGCA 1U54B 2Y6OA 4QP4A 3QZIA 2F4JA 2VX3A 4I0RA 2ZM4A 3MS9A 1MUOA 4YP8A 2BZKB 1W0XC 2YAAA 4O0TA 4AGUA 2P4IA 2JBOA 3QX2A 5L8JA 3SXRA 2BALA 1QL6A 4FTRA 4NT4A 4M66A 5DRDA 5G1XA 1CKJA 2Q0NA 4LV8A 5LVMA 2XKFA 3SDJA 3WF7A 5HE3A 1DAWA 1HOWA 4KS7A 2Y8OA 4OT5A 2UZTA 1TVOA 2WQEA 3HDMA 4U97A 3TV6A 4G1WA 3UNZA 3WF8A 3WIGA 4L53A 2ITXA 2PYWA 2J6MA 2WEIA 3AG9A 4BB4A 1OBGA 5DG5A 5IQHA 2QODA 2QCSA 4CG9A 4FSTA 4FEQA 4QP2A 2XF0A 4QP7A 2X7GA 5LCKA 1FPUA 3QTWA 2G15A 2GQGA 2WAJA 3AGMA 3O23A 3OTUA 3PE2A 4FNYA 4K1BA 4O7NA 3F5PA 3AT4A 3REPA 3KEXA 4BF2A 5L8LA 1KV2A 2EXEA 3KRRA 4AUAA 3IONA 3UO4A 4LV5A 4FIIA 4NH1A 5DPVA 2ESMA 3R8VA 4BDEA 5DWRA 2CGUA 2WHBA 2YCRA 3ZDIA 1QPDA 2X7FA 3MH2A 3OP5A 4APPA 4NM0A 5CSPA 4TXCA 1WBPA 1MP8A 3F3ZA 4F6SA 2KULA 3LHJA 3TZ7A 3HECA 3IW5A 4EKKA 3PUPA 2C6EA 3ORLA 1WMKA 3VJOA 3IOKA 4JLCA 3G9LX 2PY3A 3UG1A 3RKBA 1KWPA 1KSWA 3G6GA 4OTIA 5AIKA 4EZ7A 3KFAA 3LMIA 2GMXA 2XK6A 4ZTNA 3ODZX 4QD6A 4A4OA 2XJ2A 3LIJA 3NYOA 2R4BA 2RL5A 3KKVA 3R8LA 4HW7A 3KULA 3EYGA 3FV8A 4FKJA 2J9MA 3CTHA 4XG3A 4XH6A 4EYJA 5IQCA 4RWIA 4F7JA 3V5LA 4O7RA 5HD4A 1FBNA 5AX3A 5C4KA 3CJGA 4R1YA 4XX9A 4E4LA 3R22A 5H3QA 3D4QA 2C5OA 2A1AB 3R0TA 4EHVA 4E1ZA 2YWVA 3G0FA 3L9LA 3UIBA 1OPKA 2G2FA 2GPHA 1GZKA 2J0MB 5CU3A 4CQGA 1BLXA 3Q52A 4GJ3A 4HVDA 4E4NA 2QOQA 4V0GB 4O21A 4BY9E 5LMKC 4RT7A 5AP2A 3B8RA 4DG3E 3KY2A 4FOBA 4OBPA 3A99A 4UXQA 4BN1A 3P5KA 3VQHA 3C4EA 2F2CB 5FTOA 5HVKA 2EXCX 3KMMA 2YEXA 4ZJJA 2FSOX 4FGRA 4R7BA 4TNDA 3SXFA 4F08A 3TZ8A 1RE8A 1UU8A 5L8KA 4RWKA 2ETRA 3PRIA 4M0YA 4XG6A 3ALOA 3WILA 1OITA 5HNBA 5GJFA 3NUSA 3WI6A 4CRLA 4KS8A 3TJDA 3PPJA 1FQ1B 3C9WA 2LAVA 2CKEA 3MSSA 3PG1A 3TNPC 2BFXA 3PWYA 5IUGA 2QLQA 4ZTMA 4L9IA 4UY9A 3RM7A 4HGSA 2YIQA 3I5NA 1Q8YA 1ZOGA 2PHKA 3C4XA 3NRMA 4IZ7A 5J8IA 1IA9A 5EFQA 3L9PA 2C4GA 2CMWA 1OL6A 3HMMA 3NUNA 5BMMA 4QMTA 5E1SA 5IG1A 2Y4PA 3DXNA 4IM2A 3UVQA 4EJ7A 1P5EA 3BI6A 3MVHA 1YDTE 3VS4A 4C4GA 4TRLA 5C8KA 4B9DA 1FVTA 3H0YA 3NAYA 1WAKA 3QYZA 3R7IA 4Q5EA 5E8SA 5L2IA 3GEQA 2UW3A 4YZCA 3ZRMA 2VWIA 3FLNC 3I6UA 5CXHA 5E8YA 5KE0A 4I4EA 5KHXA 5AM7A 3EYHA 3PSDA 4EL9A 4KD1A 3JYAA 5JN2A 3LOKA 5DNRA 3KC3A 2JFMA 3GCUA 3HDNA 4D4YA 2PMLX 1ERKA 3C0IA 3LJ2A 4JI9A 2RF9A 3CE3A 4ZSGA 4RIXB 3ZDUA 4BIEA 1Q62A 4NKAA 3ORKA 4FEWA 3IGGA 5KKRC 5I5ZA 3DFAA 4L3JA 3EFJA 5AV1A 2X7OA 3MH0A 5IISA 4S32A 4MHAA 2PMOX 2OJIA 2XVDA 4KAOA 3RAHA 3F2RA 1XBAA 4EOJA 4PY1A 5HE0A 4F6WA 1H0WA 3OCSA 2OFVA 2OJJA 3ITZA 4BDFA 4U79A 2WMRA 3SW4A 3BZ3A 4DGOA 2C6TA 5ANGA 2XNBA 3UIXA 1U4DA 3LJ0A 3FC2A 3H9FA 4FSMA 4V05A 5ANIA 4CQEA 4NJDA 3PLSA 5BVFA 4WO5A 3GCSA 4J97A 4QMUA 5K5NA 3VUTA 3S95A 4E6QA 2ZB1A 3KGAA 5JFWA 1H0VA 1OKYA 5IUHA 4FSUA 4J98A 4TNBA 4NL0A 2PPQA 2UW9A 3P86A 4FZ7A 3HV6A 5H2UA 4FKGA 1PMEA 4UZHA 3QKLA 4O6LA 5GNKA 2CSNA 1OIYA 4O96A 4UWCA 4W9WA 4YHJA 3ZMMA 4ACGA 5IH6A 5KHWA 5DLSA 1PF8A 3P9JA 1PXNA 4V04A 5IA3A 2G9XA 3E92A 3UOJA 2P2HA 5J7BA 5CI6A 4NTTA 4DEEA 3D0EA 4KIQA 1LEZA 4ZZNA 3QKKA 4J52A 2ZMDA 1R0EA 4FKVA 2I0VA 5EOBA 2G2HA 4KWPA 3LPBA 4EKLA 3V8WA 4HPTE 1PXPA 1FINA 3TM0A 3E8CA 4G6NA 4BCQA 3GB2A 3LFDA 5HOAA 3NEWA 2WMWA 3A7JA 4G3GA 4ZS0A 3KXNA 4U6RA 4NCTA 3BV3A 4BCPA 4E5WA 2PWLA 4MKCA 5AP6A 2CCHA 5CEOA 3KXHA 4MBJA 1PMUA 3QBNA 2YM8A 3CSVA 4CV9A 4YJTA 1U59A 1XH6A 3QYWA 4YPSA 3MH1A 2IWIA 2RFEA 4H3QA 4Y73A 4XV1A 5CI7A 2UV2A 3HP2A 4GKIA 2IW8A 1GAGA 1ZYSA 4FSYA 4O0XA 4D5HA 4W4XA 2OH4A 1B39A 3QTIA 4JOAA 2XNPA 5KBQA 2WFYA 1SMHA 4LI5A 3KN5A 4QQ5A 5C01A 3A4OX 3RNIA 1FMKA 4QMWA 4X6RA 2R2PA 2XJ0A 2C6KA 3ENHA 4FVQA 4EHZA 3P0MA 3EQFA 3KVXA 5BVOA 3LXLA 4EHEA 5EI6A 5AA8A 4IB0A 5HE2A 4LL0A 4J95A 3DTWA 5D11A 2A4LA 4APCA 3OC1A 4RRVA 4UMRA 3QUEA 4AN2A 2YLEA 3DBCA 4IB5A 4RVMA 5IKWA 3R8UA 4IAYA 1YOMA 4KSPA 4D2SA 3Q32A 5JMSA 4UWBA 4FTTA 5AR2A 1PHKA 5B2KA 4AS0A 5I0BA 2YM3A 3WE4A 2J5EA 2VGPA 3GC0A 1ZWSA 2H8HA 5K0XA 2HWPA 2OZAA 5HLNA 2CJMA 5KKRB 3KXXA 4CTBA 3Q04A 1MRYA 5CENA 5KX8A 3R1YA 3IW4A 4CLIA 3FZPA 2VN9A 4IZ5A 3QQKA 3GVUA 4IEBA 4MD8E 3UMXA 2Q83A 4U5JA 2G01A 2ITNA 3O7LB 3LKMA 4FZFB 4AX8A 3Q60A 5IA4A 3LQ5A 4RLKA 5TE0A 2OI4X 4UB7A 4UBAA 4F1OA 2VWVA 3FKOA 2CGVA 4C59A 4C61A 4D1SA 4WBOA 2X4FA 2NRUA 4LRJA 5BVNA 4X21A 3HMNA 4HVGA 2WMAA 4EH6A 3BPRA 3QC9A 4UWYA 4DFZE 2C6OA 3DDQA 5C1QB 3LLAA 5EQPA 4IDVA 5CSWA 2ZMCA 5DEWA 3ZO4A 4BFMA 5E8WA 2RGPA 4KBAA 2H6DA 2ACXA 2WB8A 2XKCA 2GTNA 3V01A 4PDYA 5H8EA 5E90A 3NNVA 3LMGA 3R28A 4GFGA 3R73A 5FBOA 3AMBA 3S3IA 5GHVA 3VIDA 3Q4TA 4ACDA 2BHEA 1ZXEA 3OT8A 4CKJA 2BUJA 4YSMA 3OEFX 3R8MA 4AZFA 4X2KA 1YKRA 5E91A 1PMVA 3V8TA 4BCFA 1IR3A 3RI1A 2IPXA 5FP6A 3W2SA 1U5QA 2WTDA 1J1CA 4L3LA 5JZJA 2X0GA 4JJRA 4ITIA 3TKIA 2RKUA 4OAUC 3K3JA 4RZVA 1L8TA 4XBRA 2BTRA 4PNIA 5AJQA 4KBKA 1GIJA 3FZTA 4HNFA 1QMZA 4FK3A 4WG3A 5BVKA 4XP0A 5AR5A 2ERKA 4A4LA 4GT4A 4B7TA 2VTJA 1UKHA 1H1RA 5EHLA 2YERA 4LFIA 5CSHA 1HCKA 1KE6A 2BZHB 2R3NA 1Q24A 3HKOA 5HKMA 3VW6A 4O1PA 1FGKA 4QNAA 1XKKA 4DFYA 4G34A 4U44A 3FLQA 5HORA 5DRBA 3RZBA 4QP8A 3GQIA 4ZAUA 5FDPA 3LFSA 3H4JA 5D41A 1Z5MA 4L7SA 2ITYA 2VWYA 1NA7A 3ZLYA 3G5DA 3VBWA 1YW2A 2X81A 3DU8A 3F88A 3PA4A 4U8ZA 1OVEA 5LCJA 3EMGA 4M0ZA 1T46A 3PVWA 4O0RA 3R1NA 3R30A 2Q0BA 3O2MA 1R39A 3QGYA 4RC3A 1OUYA 2R5TA 4XG2A 5BX0A 2W96B 4GFOA 3QHWA 1YXSA 1BUHA 2R3IA 2WMXA 3E8EA 3NSZA 4FG7A 2OJ9A 5BNJA 3LQ3A 3ZU7A 5KUPA 5FTGA 1ZLTA 3NUPA 3TIYA 4XP3A 2J2IB 4BWPA 2J51A 3R7OA 3FWQA 5E8VA 4X3FA 5G6VA 2HW6A 3RAKA 4DH5A 2A27A 3BYSA 1XJDA 4OBOA 1Q61A 4FTCA 5CZHA 5H9BA 1ZYJA 3EQIA 2C5YA 3HMOA 2PSQA 4OTHA 5C8NA 2X8IA 4IM3A 5CTPA 4NJ3A 3ZXZA 2W1HA 5EQEA 4M12A 3PXRA 4ERWA 2ITQA 3F61A 3FSKA 4G6OA 3GU4A 4OAVB 2YLFA 4CLJA 2BAJA 3PSCA 1J1BA 4NIFB 1YXUA 3PIYA 3KRLA 5A4CA 1T45A 3DTCA 2YCSA 4IVBA 1MQ4A 4DT8A 2WXVA 3BU5A 2PVKA 5CT7A 3PFQA 2VWXA 3AC3A 2UW7A 3RGFA 3ZXTA 4DFBA 3RHKA 4F9BA 2JFLA 4MF0A 1PYEA 4O0YA 2C3IB 3QHRA 5IEYA 1CKPA 4EH2A 4G3EA 5CEQA 5HQ0A 4GVJA 4EK8A 4LG4A 1VEBA 3RAWA 3MIYA 4PP9A 3OY3A 1F5QA 4E5AX 1YHWA 2XK7A 5AEPA 5L6OA 3H9OA 2BKZA 3DB8A 4I41A 2ITZA 1F0QA 4J8MA 3PSBA 4LGHA 5LMAA 3SGCA 3D9VA 3NUXA 4A9TA 3LJ1A 3WZDA 4EHGA 5EKNA 4L45A 4EJNA 1UVRA 3H3CA 3ZLSA 2PU8A 2EB2A 1OL5A 2QONA 1DI9A 3VBYA 3E5AA 3R9NA 4ZSLA 1OKZA 1Q3WA 3WE8A 4FVRA 4W4WA 3PIZA 4JR7A 3V04A 4BCMA 3Q3BA 2H96A 5E9EA 1WZYA 2OIBA 4BDJA 1FVVA 3WZEA 2HOGA 4EZ5A 3NUAA 2WTIA 5ETAA 1JOWB 3VBVA 4FT3A 5AUTA 3UJGA 3EZRA 3PLAE 3VUIA 2BAKA 4CVAA 3WIKA 3ZRKA 2YDJA 3BHVA 4AFJA 4CFFA 3SOCA 3HZTA 4QQJA 3MFUA 3O50A 2XCKA 5T68A 5BUJA 4JS8A 3OFMA 4EOKA 5HGIA 3KL8A 4JDHA 3CBLA 4TKSA 3DZQA 3LLTA 5EG3A 4U45A 3HGKA 5FUTA 4AFEA 1ZOEA 5L2TA 4CCBA 2PVHA 1H4LA 3KXMA 4M69A 3TG1A 1KUTA 4DF3A 3TUBA 3HVCA 1ZRZA 3SLSA 3ZM9A 4L43A 3NUUA 2CGXA 3JR1A 4LRMA 2ZV9A 3QQFA 5EK7A 2J50A 4OTQA 2ZJWA 4TWOA 5K5XA 4PRJA 1JKLA 5AP0A 4DH3A 5JH6A 1Q99A 1ZYCA 1M2PA 3PJ1A 3T8OA 1IASA 2W0JA 4RJ4A 4AF3A 4F6UA 1J7LA 5H8GA 3PA5A 2HZ4A 3PZHA 4IAIA 4QYEA 4XRJA 3CTQA 5AUYA 3QWJA 2WEVA 4GUBA 3NMUF 3QFVA 5HU9A 4GJ2A 2XNGA 4A9YA 3EQGA 4C2WA 3W32A 5IH5A 4O27B 1W82A 4R3RA 5E8XA 4DBNA 1GOLA 4FYOA 2GTMA 3A8XA 3GCPA 3NVMB 4PMPA 4QTAA 5EM8A 5GZ8A 1RW8A 2QQ7A 4IWDA 4XV3A 3QZGA 4C4JA 2W1CA 4BCIA 3B8QA 3FMLA 3NIEA 4X6QC 3BGZA 4UMTA 3UYTA 3WF6A 5IDPA 1BI7A 3D5XA 1SVEA 3HUCA 4L8MA 4CFWA 2IVTA 4GT5A 5D1JA 2BRMA 5DR6A 4X0MA 3HNGA 3LCOA 5HNIX 3OXIA 4L52A 4PNKA 3KCKA 1QCFA 2BDFA 3HEGA 1OL7A 2XBJA 4JG6A 3ZSGA 3KQ7A 4YLJA 5LWMA 2ONLC 3ZO2A 4D2VA 4FG9A 4KKHA 5KZ0A 5AMNA 3ZSIA 4BDGA 4BDKA 5GINE 3R83A 3FC1X 2XK4A 3K5UA 4BDBA 3EJ1A 3BBTB 4FTJA 4OGRA 3QCYA 4EUTA 2YDKA 3EH9A 3BHYA 4U80A 4PTEA 2X9EA 2HZNA 2WMTA 3E88A 1H8FA 2I0EA 4DITA 4XMOA 2WOUA 2I7QA 2BRGA 4DFLA 4HYHA 1YDSE 5M07A 4ANBA 4FKOA 4ANOA 3R8PA 5FBNC 4DAWA 3Q4UA 4DEGA 3PWDA 4MWHA 4ZZOA 5E8ZA 3AD5A 2QO2A 1FMOE 4FTQA 3UMWA 2UW5A 1KV1A 2J90A 2ZV2A 3AMYA 3EIDA 3EFKA 3I0QA 1CTPE 4G3FA 3UVRA 4IFGA 3TIZA 4YJPA 4KBCA 3DK7A 3FHRA 3MTFA 3TNIA 5HTBA 1J7UA 3ZEWA 3ZEPA 4CFXA 5CVGA 4F9WA 1VZOA 4CMUA 5A46A 5HBJA 3JVRA 5KMIA 1URWA 4AA0A 3FI8A 5K4JA 5AAGA 2OICA 4ZOGA 2PZRA 5AP4A 5IQEA 2VTSA 4FV4A 3EOCA 3O51A 5DVRA 4YLLA 4IACA 4QTCA 1AQ1A 5EDPA 3BE2A 2C69A 4MXOA 3TV7A 4I23A 3ZTXA 4IAAA 4PDSA 4RSSA 5KMOA 3DS6A 2UZUE 3LM5A 4RX8A 3IQ7A 4YJVA 5L2QA 5I9XA 5M53A 2WZJA 2JDSA 3HV3A 4BDAA 4FEVA 1KE5A 3D7TA 3PDTA 1PXIA 4JQ8A 5IQBA 2F9GA 3JPVA 3ID6C 4U3ZA 4BI0A 2FA2A 2XKEA 4IZAA 3S00A 4I6HA 4C4EA 2WQNA 4KIPA 4QMLA 1ZAOA 3W1FA 5F20A 2BZJA 3TXOA 4H3BA 3KK8A 1PKDA 4CKIA 3LFFA 4LOQA 4Y46A 2WQMA 3IS5A 3QXOA 2CNVA 2GCDA 1SYKA 2Z8CA 1Y6AA 4QTBA 4BDCA 4FG8A 1XBBA 3UTOA 5DN3A 5CX9A 3DQXA 3ORTA 3U54A 4HVHA 5HX6A 1V0OA 2BFYA 4QMYA 2H34A 4R8QA 1H1SA 3UC4A 2VTIA 2JDVA 5M4IA 4L42A 3N51A 1G5SA 1UU3A 4RX7A 2BCJA 4ZLZA 4WRSA 2FSTX 5FEDA 4L68A 3FL4A 2ZVAA 4MBIA 5AV3A 3W2OA 5JQ8A 1Y6BA 5DH3A 4MD7E 3C4WA 2V0DA 3EN4A 3EB0A 5IA2A 4M14A 1VYZA 4XEYA 2ZM1A 5CNOA 5EW8A 1YWNA 4G5JA 1XH9A 3K54A 4RIYB 4Z7GA 4FODA 2PVLA 3BEGA 4QPAA 5M06A 2VRXA 4FKLA 4BIBA 3GXLA 5C8MA 3V5WA 3LMHA 1ZZLA 2W99B 3D2IA 5AM6A 2QU6A 5LXMA 4ZZMA 2B1PA 3WZKA 4II5A 3AC8A 4G17A 3BKBA 3Q4ZA 5J1VA 4JQEA 2WD1A 5LMKA 5FP5A 3ZZEA 3JUHA 3F5GA 1JAMA 1Q97A 3F5XA 3NNXA 1B38A 4K9YA 3AD4A 3H10A 3TZ9A 3HL7A 4O0WA 4FTMA 3F7WA 4FV1A 3V51A 5J9ZA 5KO1A 3ORXA 4WG4A 4N0SA 4K6ZA 2CKPA 3BYMA 3A8WA 3DBEA 2HXQA 2GFCA 2UW8A 3R7GA 2VD5A 4KA3A 3PZEA 4FKSA 1YWVA 4TYGA 3DCVA 3U87A 4NM7A 5ICPA 4C57A 3SRVA 3DNDA 3IDPA 3PVBA 4M8TA 4QTEA 3PXYA 4N6YA 4FF8A 3R71A 2RIOA 3KXZA 2ETMA 2BZIB 2R3OA 2W5BA 4IWQA 5CZIA 4AA4A 5CANA 2QR7A 3RPVA 4YZNA 2H9VA 2WTCA 5DR9A 1H1PA 2O5KA 4H36A 4DFUA 3CKXA 2PVYA 1OKVA 1VYWA 2GNLA 3I7CA 3OZ6A 3DOGA 4HCUA 4RGJA 5T6KA 4USDA 3DDPA 1NW1A 5JRQA 5FLFA 3MDYA 2A2AA 2EVAA 4FA2A 5CEKA 3HAVA 4AGWA 4WSYA 2YCFA 3C0HA 1S9JA 3FLSA 4FTKA 4R5YA 3HV5A 3EQPA 2VTQA 3P7BA 4IAZA 4L46A 4OTWA 4DEHA 2PZYA 4ENXA 2X2LA 3PY1A 4CMOA 4LL5A 4HGLA 3II5A 2ZAZA 3AQVA 1JPAA 2SRCA 4H3PA 3OMVA 3VN9A 1LP4A 2VWBA 4C2VA 4C62A 3GC8A 4D5KA 1JKSA 2C3KA 3LXNA 4JBQA 3AT2A 1M2RA 3EN7A 4CEGA 3KMWA 4GG5A 4QP6A 4NW5A 4DEDA 3DPKA 2WGJA 2XIZA 5JGDA 3FJQE 1NVQA 2OXDA 4IB1A 3V5JA 4ANNA 4F4PA 4AACA 5HIEA 4ORKA 4WIHA 5HBEA 1OGUA 2IVSA 2J0LA 3D2KA 3CJFA 3P78A 5JEBA 4ZTLA 3FZ1A 4AZVA 2UZNA 3CTJA 4B99A 5A54A 5CAUA 4N57A 4O7LA 3ZUTA 3MESA 4C4FA 4O82A 4D4VA 3F3TA 1CSNA 2R3JA 3NR9A 1XO2B 3QWKA 4V01A 3S2PA 3ZRLA 1JWHA 4O7ZA 2PL0A 3NCGA 4DCAA 3C1XA 1PXOA 3VF9A 5DIAA 1URCA 4U7ZA 3V6RA 1ZMUA 2JAMA 3L8VA 5C4LA 3RPYA 5HG9A 4EQCA 2BRHA 2HYYA 2QO9A 3F82A 5A4QA 4FT0A 4GL9A 4JBPA 4EH3A 3BGPA 4YO4A 2B4SB 2C1BA
chains in the Genus database with same CATH superfamily
5J1WA 3FLWA 3A7FA 4FICA 5CSVA 3HAMA 1DI8A 1TFFA 2VZ6A 3MYGA 4P5QA 3TMOA 1GIHA 4FE2A 1JNKA 3CCNA 5AP7A 3P79A 4BCOA 1OMWA 4GK4A 2YITA 4MNEB 3QL8A 4LMNA 2WIHA 5FRIA 4DBXA 2X2MA 5AIRA 3FQSA 2QO7A 1WBNA 4IQ6A 3ZZWA 1SVHA 4E4MA 4R6VA 4P5ZA 2GHLA 4K2RA 3GI3A 4KRCA 4TT7A 4FV5A 1Z9XA 4BGHA 4KKGA 4NFMA 4QMNA 2R3MA 2QG7A 3T9TA 4I3ZA 1SM2A 4FMQA 2XM9A 3ERKA 4M68A 4C35A 5J9LA 4CZUA 5IZFA 2WTVA 4IM0A 4DYMA 5E4HA 2PZPA 3LFEA 3ZHPC 2AYPA 5HCYA 4FV6A 4WNMA 4ZEGA 2NP8A 3GQLA 5K4IA 5T3QA 3VC4A 2Y7JA 3A4PA 5AWMA 2R3LA 2BIYA 3IGOA 3KCFA 3DV3A 5FTQA 4TL0A 4PL4A 5ETCA 1FOTA 5DT3A 3NGAA 3BLAA 4ZXTA 1BL6A 4ITHA 5BYZA 4RZWA 2JGZA 3MY0A 5HO8A 4AZTA 4JDJA 4WOVA 4F65A 3OWJA 4CCUA 1BX6A 2OO8X 5I9UA 4L67A 1UWJA 4D9UA 3ANRA 5CU0A 4JNWA 3OXTA 4EUUA 5A9UA 1KE9A 4AT4A 4MX9A 1A48A 3GU6A 4H1MA 3MJ1A 3LFBA 3DLZA 5IUIA 5DEYA 1E1VA 2OIQA 2W1ZA 4K0YA 4CV8A 4C7TA 1ZY4A 4FSRA 3GU8A 5K0KA 1H07A 2QI8A 3P23A 4CMTA 4PMTA 2RSVA 3EN9A 1STCE 4XYFA 2C6IA 2I40A 2W9ZB 4FV7A 2Y4IB 4Z55A 4A7CA 1OECA 3QX4A 3R2BA 5E92A 3ROYA 2B9IA 2Y9QA 4UEUA 2BPMA 1YI6A 5L6WL 2UW4A 3FL5A 4UALA 4PL3A 4IIRA 1JKKA 3PJ8A 3MWUA 2E9PA 4JAIA 2OZOA 4NW6A 4C58A 4KIOA 4J1RA 3MJ2A 2HAKA 2CNUA 2IZRA 4BGQA 3R02A 4CFNA 2J7TA 3C5UA 4WBBB 4EI4A 4R3CA 3A7HA 5TO8A 4JIKA 2W1GA 2CGWA 2PVMA 4Z16A 3KREA 4O0UA 2W9FB 4F9YA 3A7GA 3NW6A 5EI8A 4KSQA 5HVJA 4YSJA 4RVTA 2YDIA 3GT8A 3HRCA 3OCGA 3M1SA 3ZO1A 2UZVA 5KMNA 2EU9A 3CD8A 4LRKA 1XR1A 2I0HA 3ODYX 2R3QA 4L00A 2VO7A 3G33A 4ASEA 4CZTA 4KIKB 2GQRA 3F3VA 1REKA 3NW7A 4IB3A 4UMQA 4X3JA 3I1AA 3NCZA 4KB8A 4YBJA 3TKUA 3W2PA 4B4LA 4DH1A 2CNQA 2ITOA 2YM4A 3IO7A 4RQKA 4FZ6A 2YWPA 3OEZA 5DI1A 3T9IA 2W1IA 3UG2A 1O6KA 4HJOA 3TWJA 4DEAA 4UZDA 3W33A 3ZLWA 2OLCA 3KMUA 4FRFA 2GNFA 4WKQA 4QYFA 4HYIA 3AOXA 2WMVA 3R1SA 4AW1A 4HCVA 2B54A 4P90A 3EHAA 4G31A 1WBTA 4GFMA 3BLHA 1O9UA 1IAJA 3O71A 2WELA 3OW4A 4D2PA 3TKHA 2W5HA 2C30A 2JKQA 4DG0E 4ZJIA 4D0XA 1J3HA 2NRYA 4TN6A 5FXSA 3UOLA 3ZFXA 3QTXA 1OKWA 2B9HA 3LCDA 2XB7A 2WTKB 4EC9A 3D5UA 3UO5A 3OROA 4EYMA 2FYSA 3PYYA 4RA5A 3A61A 3FY0A 3LM0A 3PY0A 4FVPA 4XOYA 3CQWA 3UPZA 2C5VA 2OIDA 3V5PA 4R1VA 2F7ZE 4Q9SA 3DKOA 3OOGA 2RG6A 2QOOA 2C6MA 1H08A 3M2WA 4ACHA 2JKMA 5HG7A 3NIZA 4JIAA 2IW6A 2UVXA 5IF1A 2QC6A 4FZAB 2VO3A 3RM6A 3QCQA 2XH5A 5A4EA 3U6IA 5DHJA 2P0CA 5AV2A 3BGQA 4ACCA 4YZDA 1W2DA 5F4NA 4M84A 3CGOA 2V5QA 3NW5A 2ZFYA 4U81A 4NU1A 3TNWA 3ZUUA 3W2QA 3MBLA 3DZOA 1ZY5A 4ERKA 2O8YA 4GK2A 3HUBA 4RJ7A 4U42A 3OS3A 4DLJA 3RALA 4AG8A 4Y95A 4E93A 4G9CA 4XOZA 2PE2A 5LARA 4O6EA 5AV0A 4DHZA 3DA6A 1UU9A 2UZDA 4FT5A 3ATTA 2J4ZA 4XUFA 5HE1A 3ZC6A 3KULB 3FZRA 4YMJA 4CGAA 5CF8A 3SAYA 1WCCA 3FSFA 3QRJA 3MVLA 4AGCA 4G3CA 2I1MA 2Z2WA 3ZUVA 4HGTA 4O22A 5J5SA 4EH7A 2B52A 3F2NA 5M4FA 1Q3DA 2GNJA 4O4EA 3HLLA 3PRFA 2F57A 2XK8A 5IQFA 1BL7A 3EKNA 2VO6A 3LZBA 4IWOA 4XG8A 5HLWA 4O7WA 1CMKE 5AFVA 2YIWA 4W8DA 4H1JA 1H1WA 4ZTQA 3Q9WA 3VF8A 4FEXA 1O6YA 3GNIB 4GV1A 4EQUA 2WMUA 3F3WA 2RG5A 2XK9A 4QT1A 4D55A 2QKWB 4EH5A 3UNKA 3VUGA 3LFCA 5BVEA 3FI3A 1LPUA 4J53A 2UUEA 3WYYA 2C0IA 4TPTA 1P4FA 4RBLA 4C02A 4MYGA 2C68A 3DFCB 3MH3A 5ANKA 4R3PA 4MWIA 4RX5A 3D5WA 3MB7A 3GOKA 3PIXA 4DG2E 3Q9ZA 2BDWA 2WOTA 1G3NA 4G3DA 4I24A 2XARA 4LYNA 3MA3A 1ZZ2A 3HP5A 4YUQA 4R77A 4BHZA 4PF4A 1GIIA 2VWWA 2ZV7A 4HNIA 4LOPA 1EH4A 4Y72A 4FSWA 4AP7A 4NM3A 3ZFMA 2AC5A 2BTSA 1HCLA 4WSQA 5HU3A 3CQEA 3RJCA 3E64A 5CU2A 1W84A 2WMSA 4QYYA 4O4CA 4ZIMA 4RVKA 4MUQA 5EW3A 3R9HA 4MQ1A 3WBLA 4QP1A 5LQFA 4YJQA 3ZM4A 2B7AA 5EH0A 1JBPE 1PMNA 2DQ7X 1NY3A 3MGYA 4QPMA 5TKDA 2XKDA 3EKKA 2W05A 3K2LA 5DOSA 4CD0A 3UBDA 5ITAA 3PP0A 2JLDA 4ZP5A 3HRFA 5M4CA 4HGEA 5CU6A 3WYXA 2JD5A 4F7SA 3L9NA 2Y6MA 4N4SA 4YURA 2JITA 1JSVA 2Z7RA 2UZOA 4P2KA 2HELA 5AUXA 4RIOA 3UNJA 3QD0A 2VTAA 4G16A 5CNNA 4OLIA 3PXFA 2OH0E 2R3RA 1DM2A 4OR5A 3SC1A 4IVAA 5GZAA 1XH4A 2QOFA 4S33A 4IADA 4BI1A 1YRPA 4EWQA 3VUDA 3M42A 2PZ5A 4DGNA 5K3YA 4FTAA 5AP1A 4ZJVA 1YQJA 3H30A 4FTLA 2R9SA 4EK5A 2XBAA 3TI1A 5LJJA 4FBXA 5DFPA 1UNHA 5AAFA 4TY1A 2IZSA 2HCKA 2C0TA 4U40A 2QOHA 2BAQA 2YIYA 3CEKA 4YLKA 3VO3A 1KOBA 2FSLX 3NX8A 4YO6A 4QPSA 2QLUA 3R7VA 5M56A 2F7XE 4FKIA 5CAVA 3UZTA 3E62A 2XNEA 4E7WA 2FSMX 1G8AA 5CF6A 2ITUA 3FZOA 4E3CA 3TACA 3UDZA 2EUFB 3PXQA 1OIUA 1OL2A 1TQMA 4UV0A 4F63A 3BHHA 3BU3A 4GH2A 3UYSA 2VTHA 4E6DA 3QALE 5EM6A 2XYUA 1YWRA 1K3AA 3LCKA 3R9DA 3RPOA 3SV0A 5D10A 3ZCLA 4EOQA 5A4LA 4PUZA 3UZPA 3A62A 4AZSA 3UIUA 3FAAA 3PJCA 1SNUA 4RIWA 4XV9A 1OIQA 4S31A 5CYIA 5EHYA 3V5QA 1XHAA 3MW1A 4IAKA 5DMZA 4Z9LA 4F0FA 1S9IA 2C5XA 4M7IA 4PX6A 3KA0A 3T3VA 3K5VA 3W55A 2ZDTA 3CIKA 4J71A 1R3CA 5DBXA 4PDPA 5CWZA 3ZH8A 3DJ5A 1A9UA 2P2IA 4DDGA 1U54A 4GT3A 2W4OA 4ANLA 4CKRA 4DFNA 4FSZA 2EB3A 4PL5A 4E26A 4CYIA 2UZLA 3DNEA 3K3IA 2XCHA 4QQTA 5M44A 4BIDA 5JSMA 4M15A 4I6QA 3DK6A 3ZS5A 4AW5A 5IEXA 5KMKA 3MA6A 1PXJA 3UIMA 5GIPE 4I20A 5EYDA 2PVFA 4RLLA 2ITWA 4YPDA 4EORA 5JGAA 3R01A 4N70A 2VNWA 5HVYA 1H27A 3FI4A 3GFEA 4LUDA 4O81A 3BELA 3OUKA 5IMXA 2VTTA 3QZHA 3MV5A 1LEWA 3MIAA 4HZRA 3KK9A 3RMFA 5M08A 4YBKA 3Q53A 2YCQA 2W7XA 1PJKA 2A19B 4IC8A 1CKIA 4ZTSA 3FPMA 4XBUA 4YJUA 3EN5A 4YJSA 2W4JA 4FT9A 1XWSA 2FB8A 2W1EA 5JRSA 4W9XA 3FYJX 5AUVA 3GC9A 2XEYA 4FKRA 3G9NA 4FV8A 3EFLA 3DXQA 3VWAA 4AZWA 1SVGA 4KUJA 2X0QA 4ALWA 3QAME 5DA3A 4DA5A 4FL1A 4O4BB 2WTJA 3QCSA 1MQBA 1U5RA 4FUYA 3RPSA 4BKYA 1W98A 4EK6A 4ID7A 3C4ZA 4RJ6A 3TTIA 4DCEA 5BMSA 1W8CA 3W2RA 2C3JA 4ZMFA 3QTQA 2W17A 3IW8A 4PTCA 4F0GA 4J7BA 2C1AA 3D5VA 4FOCA 5M57A 3TNHA 3BHTA 2YIXA 4QMXA 4AE6A 3EQCA 3W0OA 2V7OA 2XA4A 2B0QA 2DYLA 4GUEA 2OZAB 3A7IA 4JDKA 2PVRA 5BUIA 2O63A 2BR1A 3QU0A 3SOAA 1WBOA 3DBQA 3OOMA 4CNHA 1Q8ZA 2P55A 2VTOA 5AV4A 3IKAA 3TJCA 4QMPA 4AZEA 1QPCA 4E73A 3H0ZA 1RJBA 3QA8A 4KABA 1YOLA 3GU5A 5BVWA 2WTWA 4RJ3A 4K18A 2CCIA 1JQHA 3UOHA 3S1HA 3E3PA 1PXLA 4A4XA 3BLQA 4IXPA 4MXYA 4EOSA 3FBVA 4KINA 4PTGA 4BBEA 2IG7A 4BWXA 1XQZA 3P7CA 3MVMA 3U9CA 5JT2A 3U6JA 4YTFA 1KOAA 4V0GA 3UVPA 4RFMA 3OBJA 3EZVA 1FGIA 1KE8A 3OBGA 3WARA 4C4IA 3EL8A 1ST0A 4U41A 4AWIA 2X8EA 5LVLA 4ACMA 1QPEA 4DLIA 2J0KA 4JQ7A 1V0BA 3FKNA 4O7SA 4Y83A 3FXZA 4BBMA 5LWNA 4O0SA 3VNTA 4ZLYA 3AKKA 5FEQA 4M97A 1GNGA 3JXWA 2XJ1A 4D58A 2OU7A 3QRTA 2CPKE 4U3YA 1L3RE 5EYMA 3OTVA 1Q4LA 5IA5A 3TN8A 4B8LA 1JKTA 4O0VA 3ZFYA 3V6SA 5FG8A 1PXMA 4AT3A 3DB6A 3AD6A 5DGZA 2I6LA 3C50A 4TYHA 3RHXA 3DKFA 4E6AA 3TT0A 1YVJA 3O7LD 5CAQA 3KN6A 4FC0A 4XNEA 1P14A 5IA0A 1K9AA 3ZLXA 5J79A 4K8AA 2GNHA 2HZIA 2JKKA 4NEUA 3AC5A 4ALUA 2VWZA 2UZEA 4X2GA 2UVYA 4RA4A 3W10A 3VUHA 5BUEA 4FIGA 3HMPA 3P08A 4FL2A 5EOLA 1GY3A 2JDRA 2X8DA 4QMOA 3FMJA 1Q41A 3AC1A 4GIHA 4WRGA 4NWMA 5GZ9A 4AT5A 4DH7A 2YIRA 3AGLA 3ACKA 3N4VA 1M7NA 3EQDA 3BX5A 5CXZA 5TT7A 4YHFA 4QO9A 2VX0A 2HIWA 5H8BA 2HW7A 2CKOA 1SZMA 2Z7LA 4RIXA 2XIYA 3PJ3A 2WQBA 3F6XA 4F1MA 3ETAA 5AP5A 5DR2A 2C47A 3C13A 3SX9A 3IECA 5DT0A 5KBRA 5J5TA 2ETKA 3P1AA 5EQYA 3VUKA 3O5AA 4PMSA 4AOTA 4S34A 2P3GX 4RX9A 5AUWA 4DTBA 3OVVA 4YC6A 2PVNA 4BR3A 4ONAA 4BCKA 2BHHA 4YGAA 1YXTA 3POOA 4I0TA 3QQGA 3UQGA 2FUMA 2XRWA 4RWJA 3SG8A 2YFXA 2YJRA 3OT3A 1H25A 4O2PA 4PQNA 4D4RA 4JR3A 4X3FB 3BEAA 1GZ8A 4O91A 1JVPP 3F69A 4I1ZA 5ACBC 2WU7A 1M2QA 4BCNA 4AQCA 4BCGA 4EOLA 2YHVA 3BWFA 3R8ZA 4S2ZA 4XHKB 3VS7A 3VULA 5HX8A 1UA2A 3U51A 3OD6X 3W18A 1VJYA 3AXWA 2ITTA 3ULZA 3LXPA 3RWQA 5L6PA 4YZ9A 1Q8TA 2OF4A 3SXSA 5AR8A 2IVVA 5HG5A 2X6EA 1UU7A 3ZO3A 2YM5A 2YJSA 2RFDA 2GQSA 1K2PA 1WBVA 3CS9A 5HHWA 5BYYA 3OHTA 3IPHA 2WKMA 3CKWA 3E87A 4H58A 5KMLA 1PRYA 2HXLA 2IO6A 4TWCA 4YZBA 4EK4A 4MXZA 3CY2A 2IVUA 2X9FA 4YNOA 4CZYB 3TUDA 4FUXA 3G90X 5AR3A 4PDOA 4I5CA 4R7HA 3MTLA 4MNFA 5DYJA 2QOBA 4BTMA 2G1TA 4PP7A 3Q2MA 5ANDA 2UW0A 3UP2A 2B9FA 3DGKA 3KVWA 3DXPA 1M52A 2WIPA 3KRXA 3FYKX 2VTRA 2VTLA 1YOJA 1UWHA 3QXPA 4FKTA 4RPVA 3RCDA 4AXAA 4UMUA 3DKCA 1H1QA 2XP2A 3OY1A 4B8MA 3BCEA 2GU8A 4DH8A 3IDBA 4ALVA 4GKHA 2NPQA 4FT7A 2BIKB 4F9CA 1E9HA 2ITVA 3GGFA 3N9XA 3RNYA 5I9YA 5L2WA 1NT2A 1I09A 4IX5A 4XLVA 5IQAA 5M51A 1CDKA 3FEGA 3R04A 4I5PA 4YTHA 2FGIA 3IDCA 2DS1A 3OCTA 3OCBA 4B6LA 2XNOA 5EDQA 2JDTA 2PUNA 4BYJA 2REIA 2QG5A 1OZ1A 2X6DA 4NM5A 2ZM3A 2PVJA 4UX9A 3ULIA 1GZOA 3U4WA 4WG5A 4A9SA 1IG1A 2BROA 4MH7A 4FIHA 3WOWA 4WNPA 4AAAA 3I5ZA 3IW6A 2CKQA 4K33A 5ANEA 1H01A 3NYNA 3UDSA 4FKUA 3BWJA 2XIKA 3TL8A 2GNGA 2QVSE 1DAYA 5EI2A 3N4UA 1NVSA 2Y4IC 4JVGA 4L3PA 5CQUA 5LOHA 4YR8A 3UZRA 5ACKA 4Y85A 3C51A 4AU8A 5HG8A 4C4HA 4ZSAA 5LVOA 4BVUA 4FV3A 5LVNA 2QOLA 5FQDC 4ZLOA 4M69B 3VS2A 2IW9A 4OTGA 3TCPA 5A14A 4IX6A 2JIVA 5AA9A 1YHSA 4FTNA 2HY0A 5FD2A 4MAOA 3N4TA 4BWKA 4GCJA 3HYHA 4RJ5A 1IRKA 1XH5A 3F5UA 3L8PA 3LFQA 2BVAA 2GDOA 1GZNA 2X0OA 5E7RA 2CN5A 2WU6A 3RINA 3E7OA 1M17A 4NSTA 5EDRA 5AUUA 2EXMA 3VRYA 2C3LA 4NZWB 3DBFA 4O1OA 4DHFA 4HOKA 4ASXA 4D4SA 5CLPA 4D9TA 2R64A 2XIRA 3SQQA 1PKGA 4FIJA 3OW3A 3FMDA 2A0CX 3ZSHA 4FV2A 5CU4A 4IVDA 4FTUA 5AAEA 5CF5A 3C4FA 3A2CA 2QHNA 2OF2A 2OXXA 2BRNA 1MRUA 5IQDA 3COKA 1WVWA 3KB7A 4JG8A 3FMEA 2YZLA 2PZIA 3QKMA 2NO3A 2XYNA 4CT2A 4J8NA 3H9RA 4FTOA 3BQCA 2Z60A 2QHMA 2V7AA 2W06A 4ZY6A 3UPXA 4C3FA 1V0PA 3EQBA 4O4DA 1WVXA 3DJ6A 4L44A 4F1TA 1YXVA 3KRWA 4A9UA 2IN6A 4DTAA 1VR2A 1WBSA 3LVPA 4IJPA 3SG9A 1JLUE 5AUZA 3GOPA 4JBVA 4WUNA 4YHTA 2QKRA 2R3KA 4CSVA 4ZY4A 4JBOA 4BL1A 3D7ZA 1YI4A 2WTKC 1AGWA 5I9VA 4O7YA 3RPRA 4QRCA 3BRBA 3QZFA 3PP1A 4GU9A 3FXXA 3TNQB 5HTIA 3NYVA 3THBA 4BTKA 3U6HA 3TDWA 1OPLA 4Q5HA 4RJ8A 3D83A 3NPCA 5JGBA 3C0GA 1H00A 2BILB 5LMBA 2ERZE 4BTFA 3OWPA 3PY3A 3Q6WA 3LE6A 4LGDA 2E9OA 2WQOA 4ZK5A 4D28A 5LVPA 3CP9A 4JX3A 5A4TA 3W0SA 4IHPA 4DTKA 3KU2A 2BDJA 2GS7A 5KMMA 3L8SA 5CSXA 4TYHB 2V62A 3DAEA 1W7HA 3FHIA 1XMLA 4J99A 2ZV8A 1GJOA 3MPTA 2IZTA 2OSCA 4TW9A 4Y5HA 4YC3A 3LCSA 3QQJA 4KRDA 3VBXA 1NXKA 2B55A 2WMQA 4C36A 3C5IA 5EYCA 4XCUA 1WFCA 3CC6A 4OTDA 2DWBA 3C4CA 4TYEA 4IW0A 5KCVA 4F7NA 4U0IA 3WF5A 4BZOA 4CFVA 2HY81 4WNOA 3R7UA 3QD4A 1R1WA 4EOIA 5FDXA 1ZMVA 4CT1A 5EYKA 5GIOE 3RZFA 2UZBA 4OTRA 3Q6UA 4W8EA 5CAPA 3OXZA 2JC6A 4I6BA 3ORIA 4L6QA 3FE3A 3D7TB 1IA8A 3QTZA 1WVYA 4R7IA 3DBDA 4X2FA 5L3AA 3ORNA 3RK5A 3OWLA 4LQMA 3FY2A 4NTSA 3PVUA 3M11A 2KTYA 5J87A 5IQIA 1AD5A 1OL1A 4FEUA 4DHIB 2JIUA 2W5AA 4D2TA 5IEVA 3QRIA 3GP0A 4UN0C 2R0UA 4AXEA 4I94A 4HVIA 2JKOA 3A60A 3RWPA 4USFA 4X2JA 3Q96A 4EBWA 2PUPA 3G6HA 4MQ2A 3NDMA 4FKWA 2C6LA 3I6WA 5B2LA 4K77A 4MXCA 4O38A 3QLFA 2YM7A 4LMUA 3Q9XA 5AP3A 4WNKA 1VLRA 3QTUA 4NIFA 3CPCA 2PTKA 4I0SA 3UO6A 3BE9A 4NYEA 3DQWA 4ZY5A 4FK6A 4QYHA 2YZAA 3E3BX 3ZONA 2FO0A 2X4ZA 3ROCA 2GS6A 2XAOA 3GCQA 4UXLA 3PA3A 3GENA 5I3RA 1OM1A 5AADA 1QPJA 2JDOA 4G2FA 1YI3A 3V3VA 3F66A 5IU2A 5KNJA 5CF4A 3PXZA 4N6ZA 4KKEA 1E1XA 1UV5A 5EM7A 5GJGA 2WNTA 4EZ3A 4I92A 5HI2A 2PULA 3PPKA 4BJJA 2UW6A 4UYNA 5L4QA 1KE7A 3MB6A 4QOXA 4BYIA 4FV0A 2BMCA 4H05A 1IEPA 3UP7A 4C38A 2W4KA 3PG3A 3CGFA 3Q9YA 3O96A 2PK9A 3JS2A 4TYIA 1PY5A 2JIIA 3MY1A 4JRNA 5AR4A 4XRLA 5KZIA 2C6DA 3ZBFA 2CN8A 4R78A 2OJFE 4WUAA 3VW8A 5HICA 3U8WA 3E63A 3R6XA 4QQCA 3RCJA 3SRVB 1BYGA 5HIDA 4F0IA 1CM8A 3HRBA 2VTNA 4IE9A 4ANSA 3RVGA 4P7EA 4BC6A 3CY3A 4ANQA 2B53A 4YJRA 3ORMA 4O2ZA 2R7IA 3PUFC 3LCTA 4HPUE 4USEA 2R3PA 3QQHA 4JT3A 4G5PA 3AC4A 3TTJA 2PE0A 4S30A 5JQ5A 4BGGA 4FSQA 4A06A 1OIRA 4YTCA 4FI1A 2VUWA 5FM3A 3R2YA 3PTGA 2O2UA 3DJ7A 3NS9A 2EWAA 2YAKA 2WO6A 3FLYA 3SKCA 4F9AA 3W8LA 2J5FA 3HV4A 1WBWA 5I3OA 3COMA 3W16A 4ENYA 3U4UA 4E5BA 4ZS4A 1P4OA 3DAKA 4DHJA 5HNGA 2XIXA 3BIZA 2VGOA 2OW3A 3LAUA 4TYJA 3CD3A 2BKKA 3FKLA 4XV2A 4FIEA 5HIBA 5BVDA 4CYJA 5FXRA 4PPCA 4IAFA 1J91A 1Q8UA 4PWNA 3PVGA 1B6CB 3PPZA 4IVCA 4CG8A 2OXYA 3BLRA 2CDZA 3TYKA 2QR8A 3EN6A 4I5HA 5CAOA 3E8DA 1UKIA 3NNWA 2YACA 5A6NA 3MPAA 3NWWA 4QP9A 3ANQA 3F7ZA 4EOMA 2ZB0A 2YISA 1YHVA 3R00A 1BKXA 4EBVA 4E6CA 3VBQA 4NK9A 2XEZA 5F1ZA 1SNXA 4FNZA 4LGGA 5D9HA 3G2FA 1J7IA 4A9RA 2IZUA 4I22A 3GBZA 3UOKA 4BZNA 5JFVA 2JAVA 4TWPA 1ZYLA 5E8TA 5M55A 2CLXA 2V55A 4HYUA 5BQ0A 3RBWA 4IANA 3MPMA 3S4QA 4C3PA 2UZWE 3B2WA 3WZUA 3E93A 3MI9A 2O0UA 4NCTC 1OPJA 5IDNA 5HTCA 5EKOA 3W0QA 3DAJA 4W4VA 5C9CA 5CEIA 4AA5A 5C26A 3VS6A 1MRVA 5I4NA 2QU5A 4IJ9A 4XS2A 5AX9A 4FGBA 2X1NA 4ASZA 4MD9E 4JL9A 3AKLA 4XG4A 4OUCA 4DGMA 5K9IA 3KF4A 4IDTA 2E2BA 3AMAA 2VTMA 5F95A 5FEEA 4EONA 4XLIA 5A6OA 2QURA 3TEIA 3QTRA 3ZBXA 2WPAA 4DN5A 5ETFA 4U9AA 2GFSA 4O83A 1A06A 3EQRA 2FH9A 4BKZA 4GYIA 4HYSA 4EOPA 4ZSJA 4AW2A 4FV9A 4D2RA 5CT0A 4O84A 1OB3A 3FZSA 3MFSA 2B9JA 4QMZA 3FUPA 3PXKA 5E1EA 3SHEA 4BDDA 2E9UA 4YNEA 3IOPA 3PFYA 3MN3A 1O6LA 1U46A 1G8SA 3HA8A 2VNYA 4C3RA 4AN9A 5I9ZA 4RFYA 5AR7A 5D7AA 3D14A 4YZMA 4Q2AA 2OFUA 4OTFA 4ZSEA 2J0JA 3RP9A 4B0GA 5TR6A 5ANOA 2GS2A 4F70A 2PUUA 1REJA 2XUUA 3D94A 4IFCA 4CFUA 3DY7A 3R1QA 4EK3A 4DT9A 1Y8YA 2ZYBA 2X2KA 4U43A 3R7YA 3RAIA 3BYVA 3FI2A 4GU6A 4MTAA 1OBDA 5BV3A 2PMIA 3COIA 4DE4A 1H28A 3I60A 4HCTA 4MEDA 4O7VA 4DINA 2IJMA 4FNWA 3MFRA 4XG7A 2E9VA 2GNIA 5JFXA 2VWUA 3O8TA 5IH4A 3JY0A 4GW8A 1ND4A 4AGDA 4JMQA 3ORPA 4DC2A 3P7AA 3LQ8A 4HVSA 3KRJA 4M13A 2GHMA 4ZTRA 4EH9A 1M14A 4EC8A 1G8KA 4JRVA 3VRZA 3NYXA 1BI8A 3HA6A 3UC3A 3GFWA 4JDIA 3BHUA 4D0WA 4EWHA 2QD9A 3B2TA 4GYGA 3U9NA 3QD2B 4M67A 4RG0A 2XNNA 3QRUA 4E20A 1H26A 3DK3A 1DS5A 3COHA 3NLBA 1Z57A 1PXKA 3I81A 4YU2A 3KF7A 3ZYAA 3E7VA 4R5SA 4ASDA 4Z7HA 1ZYDA 4RQVA 2VV9A 2CLQA 2C5NA 3Q2JA 4FKPA 4M3QA 3G0EA 4WD5A 1NVRA 1ATPE 2XZSA 4GRBA 1Y8GA 4RIYA 2YM6A 5HCXA 2F49A 3R63A 1ZARA 3VUMA 4CRSA 4LUEA 2A98A 5DE2A 3F9NA 4BICA 4EQMA 3W0RA 3O0GA 4QP3A 2JEDA 1Y91A 2ZDUA 3HMIA 5B0XA 4AE9A 3DT1A 5C03A 3ENMA 1W2FA 2R3FA 1V1KA 3GU7A 2R3GA 4DEIA 2ONLA 3C7QA 3TZMA 5JKGA 3IK3A 3VHKA 3R7EA 4EH4A 2XK3A 3DKGA 5CQWA 3TDVA 3LW0A 2QOIA 3VS3A 2C0OA 3PJ2A 3CPBA 3FXWA 3QUPA 3W0PA 4QNYA 1PYXA 3FMHA 4F64A 1TQPA 4PPAA 5HLPA 3ACJA 1ZOHA 3UGCA 5TF9A 3VS0A 2W1DA 4IMYA 1LUFA 5D7VA 5IA1A 2Z02A 4MK0A 3QD3A 5B2MA 3LFNA 4JG7A 4GIIA 2CHLA 3SD0A 4FNXA 4K11A 3QUDA 5HEZA 3NUYA 4XJ0A 5C27A 3UODA 2PMNX 3CLYA