2OJWA

Crystal structure of human glutamine synthetase in complex with adp and phosphate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
366
structure length
360
Chain Sequence
YFQSMASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamine synthetase
publication title Crystal structures of mammalian glutamine synthetases illustrate substrate-induced conformational changes and provide opportunities for drug and herbicide design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 110
structure length 360
sequence length 366
chains with identical sequence B, C, D, E
ec nomenclature ec 2.3.1.225: Protein S-acyltransferase.
pdb deposition date 2007-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 2ojwA01
3.30.590.40 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Creatine Kinase; Chain A, domain 2 2ojwA02
3FKYA 4BAXA 4S17A 1FPYA 4HPPA 4S0RA 1LGRA 2LGSA 1HTOA 4LNKA 3ZXVA 1F52A 1F1HA 3ZXRA 4ACFA 2OJWA 2GLSA 4LNFA 2UU7A 3NG0A 4LNNA 2D3AA 2D3CA 4LNIA 2WHIA 4XYCA 2D3BA 4LNOA 1HTQA 2BVCA 2WGSA 2QC8A
chains in the Genus database with same CATH superfamily
1G0WA 3PRZA 4XX5A 1HEZE 2JSVX 2L3ZA 2YLMA 2IO0B 1E7PB 3CF6E 1VRPA 2GOWA 3NRZA 1EWYC 2GB1A 1FO4A 2N1WA 3SFEB 3WANA 4WH4A 2PTLA 1XF5L 5E6PA 1TZOA 2KTFA 1B9RA 3SEBA 4RGTA 4RCOA 3K9OB 1M4VA 4RFBA 2B3AA 2BYEA 2UU7A 1F77A 3U7DA 3IAM1 2X38A 3A4SC 2BS3B 3BIID 3QHTA 1F2RC 1XO3A 2MQJA 2XN9C 5C3JB 1WE7A 5HFYA 5CHVC 1JRUA 4HLEA 1MPEA 1JROA 3DBRI 2NVUI 4BKSA 2FBWB 4JWSC 4JQWC 4GB9A 4P6VF 1WX7A 4K3CA 1P1AA 2MBQA 3Q3MC 1BUIC 4DQOC 5L83A 1PYWD 2KZRA 2J0JA 4BG4A 1H8CA 3U52E 4M01A 3RNBC 3DWMA 4AWJA 5D3IB 3M10A 2NTTA 2EMTA 3L0WB 1M94A 3C19A 4N58A 2KJ6A 3AEAB 4W9KA 1N62A 3QWZB 3CWIA 2LI5A 4W9EA 2JZPA 2K9XA 1T5XD 5AUIA 1T3QA 2L32A 1L4ZB 3DHGC 2WLBA 4JLCA 4LJPB 1CJEA 1WZ3A 2IBIB 3BVGA 2G4DB 4E3CA 5L95C 2DYMA 4G3XB 3LB8C 2C7NB 1L5PA 1JQ4A 3ZDMC 2DBYA 3JQ3A 3R66C 2LXCA 1YJJA 2QILA 5DPWA 3DBSA 3NS1A 4PYUA 2WXJA 1I4HA 4ACFA 5BYQA 4US9A 3V62A 1ZGUB 2J52A 1YIWA 1KH0A 2L8JA 3QX1A 2ZZPB 1QOGA 3ZNHB 2IPKD 1TKEA 1V1PA 2D3GA 4KIKB 1SE2A 2LUEA 4USAA 1TT5B 4JWUC 1GNUA 5H8YE 4YSZB 2CHWA 1AN8A 2OJRA 2O2VB 5TSSA 3RNFC 2E6XA 4EEWA 1MVKA 4BKGA 1Q0WB 4XWWA 2M8SA 2I2YA 3H8HA 3J9CA 2PVOD 4DXFA 1Q1OA 4HCNB 1WZ0A 1WX9A 4YXDB 4KDIC 3VH3B 3Q3FA 3ZNZB 5J17A 2KFKB 2KO3A 5G55A 2YEPF 2WXOA 1R7SA 5D6JB 5BO4B 3NZUA 1C79A 3V61A 1CQVA 2D5GA 3ONSA 1J0GA 3BVMA 3EFCA 4MH0E 3NY5A 3S2AA 3RNEC 1L0VB 4C7YA 1Q5WB 1D5XC 2UYZB 3LDZE 5JZEB 2IJ0A 2CS4A 3HUIA 1UUPA 1ZPSA 4ZDVA 1V8CA 2DX5B 1PDXA 1ESFA 2KC1A 4OZBA 1QKZA 1WIAA 4MGKE 1YX6B 3U2SC 4FJZA 4CHKA 2FE8A 2LVOA 3NVVA 4HXDA 1NYQA 4KSLC 3B2GA 2ZCCA 2ZJDA 3KUCB 4FHJA 1MHHE 4DHZB 3TSSA 3WALA 2KDEB 2WXNA 2JQRB 2K8BA 4NJ6A 1HXYD 2LGYA 1WY8A 2WXLA 4TUUA 3DVNV 4JIOU 1K53A 4DBGA 4CQNA 4GSWA 3ZQ4A 1E8XA 2N1VA 2LGDA 2L76A 1I0EA 1F2RI 2PJHA 4GVZA 4YTPB 5E6OA 1ZP0B 2JWZA 2JXXA 2OEDA 2C7HA 1PGBA 3HHMA 1WR6E 2C9WB 2MJDA 4D2KA 3VAWA 3WIMA 5DPTA 1WR1A 4EFOA 2KWDA 1AYFA 4GDKB 3A9KB 5D7GA 3ZW3A 1GJZA 1D6EC 3IXSA 4I6NB 2QEJC 3UQAA 3OLMD 3HVDA 3AEFB 5EDSA 1ACCA 2KQ4X 2FIDA 1L0XB 2WWZA 4HROA 3AE4B 4GDLB 3U4EG 3GP7A 1V1OA 1HQRD 2M0XA 4N6EB 2LXAA 2MBBB 2V9HA 2GI9A 2K6DB 3PVLA 5IA7A 4F7ZA 3ZGZA 3OJ4B 2MLBA 2DAJA 2O6VB 2TSSA 2KXJA 3FILA 4X57B 3CMMB 3Q14C 1OFFA 3E56A 5AZFA 2ZEQA 2BS4B 3GOEA 3ZTCA 1LM8B 4W9GA 5KHQA 2L0FA 3DBHB 2SEBD 3DVGX 2D10A 3H7SA 2L83A 3JW0X 2W55A 2JWUA 1QQRA 1GUAB 1WM2A 2FCSA 1HE8A 1TJEA 2DZJA 4L23A 4AS1A 2BT6A 1IP9A 2WDTB 1Z5SB 1GC6A 3HVZA 1FIQA 1G6JA 3DWGC 3U7ZA 4RGOS 4DXGA 1XD3B 4AQ7A 3V6CB 3AB5A 2M0AA 4CO7A 1SSNA 2WXPA 2O2VA 2ZVOA 3AE7B 5EE3A 4DDGD 3I5JC 2HD5B 5EE0A 2QHOA 2GBRA 2GLSA 1ET9A 4IG7B 3VUWA 5GMVA 4EKUA 3VQIA 4WWNA 3PZ7A 1E5WA 4WIPA 4LDTD 1F9JA 1SIJA 2VH1A 1YQ4B 2BVCA 1EU4A 3U8ZA 1UGMA 2MH7A 4JGHB 1GOZA 1D3ZA 2FIFA 1I4GA 2N7EA 1TKGA 3GE3C 4BOSC 3N20C 4FULA 2KNBA 2EKEC 2LZ6A 4K81A 3UIOB 4E71A 4BBNF 1JALA 1SEBD 1WRIA 2A4ZA 2DYBA 4RNAA 3KUDB 1EO6A 4BG4B 3H9DA 4P7IA 4JPSA 4GW2A 2Z8LA 3ZTDA 1SJED 2HDEA 2KDMA 3L2EA 3ZLZA 4KDLB 1FXIA 1BXTA 2WDVB 1SXTA 2PMVA 2G4SA 2WXRA 5FKAC 1P9DU 2RR9A 4YWGG 5LNK1 3IT4B 4BOZB 1XCTL 2IO1B 4DWFA 1VR9A 2MBEA 1WRDB 1QILA 3LXFA 2UWQA 4C4VA 3L16A 3DQVA 2RDBC 3BVZA 2J4XA 5CHWA 4HEA1 1FNUA 1UWXA 2KC2A 1FCCC 1DYQA 3PLVA 4MT5A 4HPPA 1E0ZA 3KLSX 3U30A 2N9PC 2WU5B 3W9CB 3AE1B 2HE7A 3BINA 1WXVA 4LK0M 2PW9A 3VVWB 3VUXA 4B0EA 1J7CA 1L6VA 3PS6A 1ENFA 4ZYSA 1V1PB 4HKQA 1E7UA 3Q8FA 4Z9MA 4MDKE 1TY2A 2CHZA 4BAXA 2BWFA 3VTUA 3NOBA 4NAWA 1VCBA 2Z0EB 2L1AA 4J3OD 2KN5A 2EMSA 4IW0A 3SFDB 4AP4C 5AZGA 2NBWB 3P2BA 1UF0A 4WAFA 4ARCA 4N59A 2REXA 3TJPA 2GBKA 1JWBD 4L1BA 1LGRA 3URYA 4PS8A 1F1HA 3PGEA 2IY0B 1AW7A 3RNGC 4W9JA 1J8CA 5FR3A 2NTSA 4C56C 4NAMA 1NVID 2RD0A 5KHOA 4ZRIA 2GBNA 4IM2A 2NCNA 2O6VD 1UBQA 3JVZX 4RF9A 3P4SB 1J7BA 3RNAC 2AEHA 2JPHA 1OGWA 3A4RA 1C76A 3N1ZC 5J99A 3MFGA 2YVCA 2KJHB 1FXTB 1OEYJ 1E7VA 1XT9B 2N9EB 1JW9D 3UIPB 3DBLI 3X23A 1UELA 1TY0A 3AXCA 2CRKA 1DOXA 3A1QA 3IAS1 5AZHA 1AARA 4RGNA 2XK5A 2AL3A 1WXMA 4LLGM 5AUKA 4LNFA 2KWUB 5LXIB 3MHSD 1WGKA 2MCNB 1SJHD 2MJEA 5J2RA 2AQ2B 2M19A 4OVZA 3TIXA 2RDHA 2JXTA 4ZRPA 3LJ3A 2R61A 4II3B 3AM9A 4MEMA 1FD6A 4HCPB 3W1SC 1SB3C 3NVWA 3KWLA 5DCNA 4BVUC 2JZ3B 3WAMA 5C23A 3Q8AA 3P1MA 2MWSB 1T6BX 4ANXA 2Y5BB 2RPQA 4FN2A 3N1XC 3QJZA 1R4MB 1V4GA 1EF5A 1I4XA 2LFIA 2MBHA 4DHJD 3ABVB 3JU5A 1JWAD 3ZJUA 4BKSD 2ZPNA 1YMHE 2ZW0A 2K8CA 1UD7A 4ZRQA 3TEWA 2WDQB 4NJCA 1FFUA 2G45B 3CIRB 2JUOA 4GOCA 1YJ1A 1QK1A 2LVQA 3T9LA 1KLGD 3AH7A 4RF8A 5G5HA 2K6QA 2BGFA 2E3TA 4GU2A 3TL5A 2MSED 3IFWB 3BYYB 3M95A 3R7RA 3FILB 4US8A 3AEGB 1TTNA 1ZDVA 3D32A 3AE8B 1AWDA 3Q2AC 4KX6B 2V4IB 4H2AA 4AJYB 1FCLA 1YJIA 3DBHI 4RF0A 1PGXA 5HI1A 2IO3B 3NZSA 1HZ5A 1UZXB 3W1SA 4RF1A 1V9JA 4GXBA 4CYEA 2IDYA 2LGSA 1HTOA 2AL6A 3L13A 2RGFA 2R2OA 1WJ4A 3H7PA 1J7AA 2JZZA 1N61A 2KVZA 2M17A 3BYTB 1I4QA 1WMHA 4RMAA 2AQ1B 3KVFB 1IGCA 2BYTA 3P4PB 1C78A 4HRSA 3IHPC 5GXGB 1SF0A 4G11A 4TQ1A 4IWQA 3IG5A 4IWOA 3JSVA 4ASWC 4W9FA 2WX0A 3Q3JA 4WWOA 3RCZA 3B1LX 4OZCA 2KWCA 3I63C 4REZA 3I57A 1WGHA 3PLUA 4A3OA 4OHJA 1WJNA 2WS3B 1NI2A 2QC8A 3JYUA 4B95A 1NEKB 1WI0A 1XLOA 4K7SA 1BMLC 2HTME 2JYTA 1FNWA 2CU3A 1PQSA 2KDBA 2IO2B 3DREA 3PZ8A 1PUTA 2PE6B 1HA5A 2QSDA 4MSQB 2C60A 3X0WA 5I4DA 1KOTA 4FADA 1YQ3B 3NHEB 3ZYYX 2BTEA 2JRIB 3AECB 1WWTA 2KMAA 3M62B 2WXIA 3PPAA 3ZJVA 2NBVB 1QZEA 2ACZB 2V3SA 1MJDA 3QA8A 5D2MB 4TQ0A 2KQSA 4W9IA 2INNE 1Y8RC 3DBLB 4KZ0A 4GIVA 4NJ7A 2RPVA 3L2EB 3IT6B 2FNJB 2M4NA 3OJ3A 3IG8A 2BS2B 1S3SG 4WQOB 4C80A 2LHEA 2N9XA 2WXFA 3ECIA 2L05A 3DDCB 2KWVB 1V86A 1C4PA 3PO0A 1T0SC 3SR6A 1ET6A 4ICUA 3APDA 3A9JA 3ZRCA 3AULA 1NBFC 4KVGB 4O1NA 4C7ZA 5T8IA 1QOFA 1EWCA 5J9AA 2DLBA 2MBOA 3AE2B 3T8MA 3APFA 4AM1A 1YQBA 3LVVA 4BHLA 3M63B 4C4VB 2QDFA 3V3XA 4P16A 4LTUA 3ZJTA 4PK1A 1QH4A 4MGYE 2JT4B 4LNKA 1KM7A 1Q10A 1WXQA 3EHVA 3HIZA 3VTVA 1YOVB 2BB6A 4B0MA 1QF6A 3AMZA 1P98A 1WJ6A 4ZHOA 4DHZE 5BMHA 3QC8B 4XGAB 1RAXA 4M0WA 2LRWA 3L08A 4E74A 3RI7C 1LFDA 4W9CA 1VZ8A 3GE8C 4KGTA 4YSYB 3AEDB 2FCQA 2DYOA 5IN7A 4NAWB 1F0ZA 2I1JA 1XXGA 2DWQA 2D3AA 1UWMA 2PKOA 4TKNA 2LASA 4II2B 4PS7A 2JF5A 4A9AA 2I1KA 4B6WA 2WHIA 1V2YA 1TS5A 1HZ6A 5IKCM 3AU4A 5FK9C 3IG3A 3QAQA 3VRAB 1B1ZA 3BK1A 3DHHC 3HK0A 1P7EA 4YTNB 2INPE 1ZXIA 2IYDB 2KACA 4GGQA 4RM9A 2K3UA 3HM6X 4XDDA 3TEXA 2D3BA 2G3QB 4HDOA 2MA9B 2V1YA 4HWIB 2IZVB 3RZWC 2OOBB 2JYEA 2L0TA 3VHTC 1RFKA 5C1ZA 1ZDXA 2KTRA 4ZRKA 1OEYA 2AX5A 3Q8BA 5D3DA 5H92C 2QJLA 4A8XC 1GB4A 2RMMA 2ZNVB 3MC9A 2GWCA 1V97A 3A1QB 2ICIA 2HJ8A 5TR5A 1NDDA 1C77A 4IWPA 4PS3A 1C9FA 3PHXB 1L0YB 1ZUD2 1XLPA 2XK5B 1QLBB 2N7DA 2W3SA 2Z0DB 3TBLD 3NVYA 3W5VB 3N30A 4AJWA 3HM3A 4RM8A 2EELA 3MJWA 3DCGA 1A5RA 2I38A 5JH5C 2NBUA 4MJSA 1L2NA 4MACA 2IGGA 4K7UA 2XEWA 2BPSA 2V4LA 3NS8A 3EFUA 3L54A 3Q8CA 1V49A 4EZLA 1WGYA 1KJTA 3VDZA 2D32A 1R4MI 2J0MA 1I35A 2J1QA 2Y5PA 2MP2A 4BBNC 1T0QC 2AYOB 4BZAA 1UNSA 3ENEA 3IVFA 1WJUA 1C4CA 2SAKA 3BY4B 2KMMA 4L2YA 1RYJA 3ZNGC 3L10B 3N1YC 2K25A 4J6IA 2LGXA 1N6ZA 3LN6A 2KANA 1R8GA 1E90A 2CKHB 1ZW7A 1SD0A 4WWPA 2GRIA 2KLCA 1FEHA 2J0KA 4A6QA 4XE0A 2H88B 5DPSA 4G0NB 3B2FA 4JX1C 4C00A 1STEA 2FUHB 2L00B 3PV1A 3H7PB 4HVBA 1JWUD 1Y56A 3P4QB 4BKTA 3NZTA 2GWDA 4TMAB 1WMHB 3PSEB 5C2TB 2W3RA 4I6PA 2ZNVC 1X1MA 2BYFA 3Q3OC 2XBBC 2KVRA 2NPTA 5DPRA 2KHWB 3JSVB 3HRDD 3DHIC 1SE9A 4IOIE 4XDCA 3OAWA 1K52A 2CJOA 3Q6BA 4MELA 4GVYA 4URKA 1ZKHA 2HTHA 3VFKA 2GMIC 1N5WA 3TMPB 3PRPB 5JXVA 2LVPA 2V3NA 5E6NA 1VD2A 3KQ4A 2N9LA 2LRUA 2NMQA 2XNAC 2HJ1A 3KW5B 4GMVA 2LJ5A 1CRKA 5BMGA 4FHKA 4W9LA 2K5PA 1FRDA 1Z2MA 3DOWA 1WX8A 3Q3NC 4LNOA 3C0RB 2KN4A 5EE1A 3FKYA 1FPYA 3APCA 2D07B 3ML8A 3WCQA 2H89B 2DAFA 3KYDD 1KTKA 1TT4A 1DGJA 3VH4B 3W5UB 2INCC 3KWVA 4KGSA 1BT0A 4MH8A 4WJQA 5BYSA 1NENB 2K0PA 2WU2B 1V5OA 3ZXVA 3BK2A 3A9JB 4I6LB 1M15A 3ETRA 2M1MA 4MM3B 4MGZE 1FM0D 2LJIA 1E9MA 2NS5A 3EECA 2G9HD 1IYFA 2GBJA 2RSUA 3W1YA 1OQQA 1IBXA 5LXHA 1D5ZC 3P63A 1UBIA 1GG3A 2LEKA 3ZO5B 1GAQB 1I4RA 4ICVA 1IGDA 1LO5D 1A70A 2MW5A 4P1BC 2DNFA 2BBCA 2YEPB 2DENB 2JVCA 2ZPYA 4M02A 3GZNB 3EC8A 2ZVNA 2IGDA 2FUG1 4M0WB 1RRBA 4KKJA 1JRPA 4RH6A 3N32A 4JE3B 2C7MB 2KT7A 3AE5B 2KKCA 1L4DB 4HJGE 4KSKC 1L7YA 4IC7B 1GC7A 3Q69A 2IY1B 3R2TA 1KLVA 3R7QA 1RWSA 5EE9A 2JX5A 1ZXHA 4GW0A 1J19A 1C3TA 2CU1A 1RFAA 1TBEA 1CZPA 2QCZA 2W9NA 4K3BA 1K8RB 5G5GA 1P7FA 1JCKB 1SBBB 3UGBB 5MPOA 4EOYA 3DRBA 1V6EA 1P0RA 3AE9B 3QQ8B 4AOFA 4PT5A 3FC4A 4WWMA 3A33B 1WXAA 4IM3A 4K1RB 2X8XX 2Y3AA 4FXCA 3WAOA 2KMCA 3KUZA 3SHQA 2J42A 4IUMB 4G50A 4N9F4 2VZKB 3VR8B 4W9DA 2D2QA 2KTRB 5BYRA 5IAAC 3GS2A 2LMCA 3T3OA 3N3KB 1KFYB 4A20A 3ZVVA 3CSFA 3AEEB 4WURA 1WYWB 3VUYA 3ALBA 4UDUC 3I3TB 3KYCD 4TSSA 1TYGB 3RPFC 1JWMD 3LVWA 3AI5A 3B08A 2KD0A 5HG2A 1K50A 3N9YC 3JU6A 2WP9B 3L17A 3PRMB 4MJSB 1P3QU 4W9HA 2WX1A 3VR9B 3RYTA 3V05A 1RL9A 3ZRFA 4YTMB 3VXWA 3MTNB 1WF9A 3GB1A 4LDTB 1RM6C 2KAJA 1ZOYB 1WYGA 2DZIA 3SDLC 3AN1A 1U4AA 2CHXA 1I7HA 5HHDG 5JHAA 3ZIMA 2KLGA 1R4NI 2L7RA 4ANWA 2GBMA 4FJVB 3QK0A 4WAAA 3RFZB 4NQKE 3JPZA 1VA6A 1N5XA 3SD5A 4ANVA 2CR5A 4IM0A 3CSTA 1JMLA 2ZW1A 1KF6B 1EF1A 4MSMB 4TV3A 1I4PA 1RLFA 2MP2B 2KDFB 3RMKC 2K1FA 3PREA 2A5UA 3WAPA 3TUOA 2ASQA 2B76B 4YSXB 2ZCBA 2BB5A 4KV2A 1TIFA 3AU5A 2WGSA 1IPGA 1MI0A 4KZCA 4NY0A 4RF7A 3Q8EA 2BKFA 2PLPA 3K9PB 2KDIA 4F8CB 2R2QA 1XQQA 2LHDA 1F52A 3ZXRA 2PE9A 4MM3A 2D3CA 4RF6A 3RNCC 4Q2JA 1KRHA 2BF8B 4XC2A 4A55A 4ZHPA 1GB1A 4NNJB 2ON8A 1E8WA 4FBJB 3UI3A 1EU3A 4ITKA 1MHXA 5CHFA 1VZ6A 3BZDB 1C1YB 1N60A 2QIEB 4LNNA 2CJNA 3SU8X 4AUQC 1VRAB 1EUVB 3ML9A 1P52A 2Q5WD 2L52A 3PT2B 5IO9A 5J18A 3R8BA 1TZ1A 3MC0B 1HTQA 3V6EB 2QMTA 1SIFA 1TS2A 4XZ4A 2K39A 4OZAA 1T0YA 5BMIA 3DBRB 3IBEA 2NPTB 2WYQA 2OJWA 1LXDA 3M3JA 3RD2A 2JU6X 1WM3A 4A3PA 2KYWA 2INDC 1IUEA 3RULA 5IP4D 2M56B 3P42A 3RT3B 3AV8A 2LGIA 3MJ5A 4OVUA 3EA6A 1V81A 3EUB2 3PHWB 2NR2A 2PPHA 2WXQA 3B0AA 3WA0A 4A90A 1S1QB 1LQBA 2KJRA 1H4RA 1QOAA 2JY6A 4MGIE 2IGHA 3B6RA 1SE3A 4DK5A 3QIJA 3T3NA 2WNMA 1E8YA 1QT9A 2MJ3A 2WXKA 1XLQA 2PEAA 1GPXA 1XLNA 1FMAD 3UINB 1P50A 1WFYA 2PIAA 2K8HA 3W2DA 4NQLB 1T0RC 2V0GA 2PVGC 1UGJA 4P1CC 1XCQL 1JWSD 4GLSC 3NJTA 1CK1A 2BKRB 3H1UA 3FAHA 3LYYA 4B9KA 3PZDA 4M00A 4HKZE 1E10A 4LJOB 2KFJA 1WGDA 1MFWA 1D5MC 4HDQA 3UF8A 2W82A 3R3MA 4ZYNA 5HKHA 1TGZB 4M8NA 1SGHA 2OHFA 2VZKD 4ZOHC 4WJNA 1EM7A 4FA6A 2KX3A 2KK8A 2VH2A 3TEZA 1SE4A 2Y5CA 1NYRA 4ANUA 2N4FA 1TS4A 4KIKA 4EE2A 1FXAA 1OQRA 2WQYB 3EGRA 3OG5A 4EZJA 1IBXB 4F1SA 1V5TA 4HPMB 2W54A 1ROEA 4HPLB 5JHBA 4ZRJA 2MX2A 4KGRA 3L2DA 4IDIA 4FLHA 5LLIA 1WH3A 1WGGA 1DOYA 1FNVA 1R4NB 3AE3B 4K7WA 3R2IA 3NZ3A 1KLUD 3O65B 1NI3A 4R3DA 2FCMA 1OQYA 3I9V1 5FR6A 3GZNI 4HJKA 2KFKA 2WDRB 3PTFC 3L4PA 3VRBB 4EUTA 1U6RA 2MEKA 2JRHA 4GN1A 1ZE3D 3MC8A 1E6EB 4DHJB 3LN7A 1V80A 1WSPA 5E6JA 4DXAB 2KOXA 4KKIA 4LNIA 2RDGA 3QARA 4NPNA 2D11A 1YD8U 4OW0A 3P4RB 1VDVA 2LUMA 4S17A 2LD9A 4NZLB 4EZKA 3NG0A 2MRPA 1BG0A 1YN3A 4DDID 3TEYA 1L6UA 1FRRA 4YT0B 1VLBA 2J53A 3ZUNA 3BWUD 1QOBA 2Z59B 4FJYA 3QCAA 2MHJA 3MHZA 1I42A 3ZNID 1FFVA 3ZKJC 3DPDA 1DOIA 2AQ3B 2V3PA 4YL8A 2K22A 1WE6A 3KH0A 1D4BA 3DVNU 3V60A 1WXSA 1YNTE 2C5LC 4RGMA 3MP9A 5CTRC 3O13A 1MG8A 2DHZA 3DVGY 4JL9A 1YN5A 3E9SA 2BWES 2WXHA 1MG4A 3ZDTA 3RZFA 2AWTA 4S0RA 2G1EA 4OVVA 1OTRB 4QAYA 1VJKA 4WJPA 2N7JA 2WXMA 1K51A 2N9KA 4IKGA 4LCDE 1ISNA 2BYVE 5IOIA 1YX5B 3AE6B 4GDKA 3A9KA 4WJOA 3TCAA 1UH6A 2DZMA 3H6NA 2LWPA 3B9JA 1E8ZA 1CMXB 2VRRB 4Q2RA 2FCNA 2ONQA 4PYZA 4XWTA 2EKIA 4GDLA 3RN9C 1YN4A 5CX3A 1XEEA 1TS3A 3RUIB 4BFRA 2DZKA 2FAZA 3NVZA 2J7QB 3NUHB 3VTWA 5AEKB 2O6VA 2KX0A 2BW2A 2BQQA 2N0SB 4HK2A 1TKYA 5D94A 4WQMA 4ARIA 1PGAA 5G2NA 1C4AA 4M8MA 2D33A 1N63A 1PFDA 1WGRA 1VZ7A 4XYCA 3C8YA 3AEBB 3OWEB 3UQBA 2WXGA 2KQ7A
chains in the Genus database with same CATH topology
3FKYA 2D32A 4BAXA 4S17A 1FPYA 3IG5A 4HPPA 4S0RA 1LGRA 2LGSA 1HTOA 4LNKA 3ZXVA 1F52A 1F1HA 3ZXRA 4ACFA 2OJWA 2GLSA 4LNFA 2UU7A 3NG0A 3LN7A 4LNNA 2D3AA 1TT4A 2D3CA 3LN6A 4LNIA 1R8GA 2D33A 3LVWA 1V4GA 2WHIA 4XYCA 2D3BA 3IG8A 3LVVA 1VA6A 2GWDA 3NZTA 4LNOA 1HTQA 2BVCA 2WGSA 2GWCA 2QC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKY A;  4BAX A;  4S17 A;  1FPY A;  4HPP A;  4S0R A;  1LGR A;  2LGS A;  1HTO A;  4LNK A;  3ZXV A;  1F52 A;  1F1H A;  3ZXR A;  4ACF A;  2OJW A;  2GLS A;  4LNF A;  2UU7 A;  3NG0 A;  4LNN A;  2D3A A;  2D3C A;  4LNI A;  2WHI A;  4XYC A;  2D3B A;  4LNO A;  1HTQ A;  2BVC A;  2WGS A;  2QC8 A; 
#chains in the Genus database with same CATH topology
 1G0W A;  3PRZ A;  4XX5 A;  1HEZ E;  2JSV X;  2L3Z A;  2YLM A;  2IO0 B;  1E7P B;  3CF6 E;  1VRP A;  2GOW A;  3NRZ A;  1EWY C;  2GB1 A;  1FO4 A;  2N1W A;  3SFE B;  3WAN A;  4WH4 A;  2PTL A;  1XF5 L;  5E6P A;  1TZO A;  2KTF A;  1B9R A;  3SEB A;  4RGT A;  4RCO A;  3K9O B;  1M4V A;  4RFB A;  2B3A A;  2BYE A;  2UU7 A;  1F77 A;  3U7D A;  3IAM 1;  2X38 A;  3A4S C;  2BS3 B;  3BII D;  3QHT A;  1F2R C;  1XO3 A;  2MQJ A;  2XN9 C;  5C3J B;  1WE7 A;  5HFY A;  5CHV C;  1JRU A;  4HLE A;  1MPE A;  1JRO A;  3DBR I;  2NVU I;  4BKS A;  2FBW B;  4JWS C;  4JQW C;  4GB9 A;  4P6V F;  1WX7 A;  4K3C A;  1P1A A;  2MBQ A;  3Q3M C;  1BUI C;  4DQO C;  5L83 A;  1PYW D;  2KZR A;  2J0J A;  4BG4 A;  1H8C A;  3U52 E;  4M01 A;  3RNB C;  3DWM A;  4AWJ A;  5D3I B;  3M10 A;  2NTT A;  2EMT A;  3L0W B;  1M94 A;  3C19 A;  4N58 A;  2KJ6 A;  3AEA B;  4W9K A;  1N62 A;  3QWZ B;  3CWI A;  2LI5 A;  4W9E A;  2JZP A;  2K9X A;  1T5X D;  5AUI A;  1T3Q A;  2L32 A;  1L4Z B;  3DHG C;  2WLB A;  4JLC A;  4LJP B;  1CJE A;  1WZ3 A;  2IBI B;  3BVG A;  2G4D B;  4E3C A;  5L95 C;  2DYM A;  4G3X B;  3LB8 C;  2C7N B;  1L5P A;  1JQ4 A;  3ZDM C;  2DBY A;  3JQ3 A;  3R66 C;  2LXC A;  1YJJ A;  2QIL A;  5DPW A;  3DBS A;  3NS1 A;  4PYU A;  2WXJ A;  1I4H A;  4ACF A;  5BYQ A;  4US9 A;  3V62 A;  1ZGU B;  2J52 A;  1YIW A;  1KH0 A;  2L8J A;  3QX1 A;  2ZZP B;  1QOG A;  3ZNH B;  2IPK D;  1TKE A;  1V1P A;  2D3G A;  4KIK B;  1SE2 A;  2LUE A;  4USA A;  1TT5 B;  4JWU C;  1GNU A;  5H8Y E;  4YSZ B;  2CHW A;  1AN8 A;  2OJR A;  2O2V B;  5TSS A;  3RNF C;  2E6X A;  4EEW A;  1MVK A;  4BKG A;  1Q0W B;  4XWW A;  2M8S A;  2I2Y A;  3H8H A;  3J9C A;  2PVO D;  4DXF A;  1Q1O A;  4HCN B;  1WZ0 A;  1WX9 A;  4YXD B;  4KDI C;  3VH3 B;  3Q3F A;  3ZNZ B;  5J17 A;  2KFK B;  2KO3 A;  5G55 A;  2YEP F;  2WXO A;  1R7S A;  5D6J B;  5BO4 B;  3NZU A;  1C79 A;  3V61 A;  1CQV A;  2D5G A;  3ONS A;  1J0G A;  3BVM A;  3EFC A;  4MH0 E;  3NY5 A;  3S2A A;  3RNE C;  1L0V B;  4C7Y A;  1Q5W B;  1D5X C;  2UYZ B;  3LDZ E;  5JZE B;  2IJ0 A;  2CS4 A;  3HUI A;  1UUP A;  1ZPS A;  4ZDV A;  1V8C A;  2DX5 B;  1PDX A;  1ESF A;  2KC1 A;  4OZB A;  1QKZ A;  1WIA A;  4MGK E;  1YX6 B;  3U2S C;  4FJZ A;  4CHK A;  2FE8 A;  2LVO A;  3NVV A;  4HXD A;  1NYQ A;  4KSL C;  3B2G A;  2ZCC A;  2ZJD A;  3KUC B;  4FHJ A;  1MHH E;  4DHZ B;  3TSS A;  3WAL A;  2KDE B;  2WXN A;  2JQR B;  2K8B A;  4NJ6 A;  1HXY D;  2LGY A;  1WY8 A;  2WXL A;  4TUU A;  3DVN V;  4JIO U;  1K53 A;  4DBG A;  4CQN A;  4GSW A;  3ZQ4 A;  1E8X A;  2N1V A;  2LGD A;  2L76 A;  1I0E A;  1F2R I;  2PJH A;  4GVZ A;  4YTP B;  5E6O A;  1ZP0 B;  2JWZ A;  2JXX A;  2OED A;  2C7H A;  1PGB A;  3HHM A;  1WR6 E;  2C9W B;  2MJD A;  4D2K A;  3VAW A;  3WIM A;  5DPT A;  1WR1 A;  4EFO A;  2KWD A;  1AYF A;  4GDK B;  3A9K B;  5D7G A;  3ZW3 A;  1GJZ A;  1D6E C;  3IXS A;  4I6N B;  2QEJ C;  3UQA A;  3OLM D;  3HVD A;  3AEF B;  5EDS A;  1ACC A;  2KQ4 X;  2FID A;  1L0X B;  2WWZ A;  4HRO A;  3AE4 B;  4GDL B;  3U4E G;  3GP7 A;  1V1O A;  1HQR D;  2M0X A;  4N6E B;  2LXA A;  2MBB B;  2V9H A;  2GI9 A;  2K6D B;  3PVL A;  5IA7 A;  4F7Z A;  3ZGZ A;  3OJ4 B;  2MLB A;  2DAJ A;  2O6V B;  2TSS A;  2KXJ A;  3FIL A;  4X57 B;  3CMM B;  3Q14 C;  1OFF A;  3E56 A;  5AZF A;  2ZEQ A;  2BS4 B;  3GOE A;  3ZTC A;  1LM8 B;  4W9G A;  5KHQ A;  2L0F A;  3DBH B;  2SEB D;  3DVG X;  2D10 A;  3H7S A;  2L83 A;  3JW0 X;  2W55 A;  2JWU A;  1QQR A;  1GUA B;  1WM2 A;  2FCS A;  1HE8 A;  1TJE A;  2DZJ A;  4L23 A;  4AS1 A;  2BT6 A;  1IP9 A;  2WDT B;  1Z5S B;  1GC6 A;  3HVZ A;  1FIQ A;  1G6J A;  3DWG C;  3U7Z A;  4RGO S;  4DXG A;  1XD3 B;  4AQ7 A;  3V6C B;  3AB5 A;  2M0A A;  4CO7 A;  1SSN A;  2WXP A;  2O2V A;  2ZVO A;  3AE7 B;  5EE3 A;  4DDG D;  3I5J C;  2HD5 B;  5EE0 A;  2QHO A;  2GBR A;  2GLS A;  1ET9 A;  4IG7 B;  3VUW A;  5GMV A;  4EKU A;  3VQI A;  4WWN A;  3PZ7 A;  1E5W A;  4WIP A;  4LDT D;  1F9J A;  1SIJ A;  2VH1 A;  1YQ4 B;  2BVC A;  1EU4 A;  3U8Z A;  1UGM A;  2MH7 A;  4JGH B;  1GOZ A;  1D3Z A;  2FIF A;  1I4G A;  2N7E A;  1TKG A;  3GE3 C;  4BOS C;  3N20 C;  4FUL A;  2KNB A;  2EKE C;  2LZ6 A;  4K81 A;  3UIO B;  4E71 A;  4BBN F;  1JAL A;  1SEB D;  1WRI A;  2A4Z A;  2DYB A;  4RNA A;  3KUD B;  1EO6 A;  4BG4 B;  3H9D A;  4P7I A;  4JPS A;  4GW2 A;  2Z8L A;  3ZTD A;  1SJE D;  2HDE A;  2KDM A;  3L2E A;  3ZLZ A;  4KDL B;  1FXI A;  1BXT A;  2WDV B;  1SXT A;  2PMV A;  2G4S A;  2WXR A;  5FKA C;  1P9D U;  2RR9 A;  4YWG G;  5LNK 1;  3IT4 B;  4BOZ B;  1XCT L;  2IO1 B;  4DWF A;  1VR9 A;  2MBE A;  1WRD B;  1QIL A;  3LXF A;  2UWQ A;  4C4V A;  3L16 A;  3DQV A;  2RDB C;  3BVZ A;  2J4X A;  5CHW A;  4HEA 1;  1FNU A;  1UWX A;  2KC2 A;  1FCC C;  1DYQ A;  3PLV A;  4MT5 A;  4HPP A;  1E0Z A;  3KLS X;  3U30 A;  2N9P C;  2WU5 B;  3W9C B;  3AE1 B;  2HE7 A;  3BIN A;  1WXV A;  4LK0 M;  2PW9 A;  3VVW B;  3VUX A;  4B0E A;  1J7C A;  1L6V A;  3PS6 A;  1ENF A;  4ZYS A;  1V1P B;  4HKQ A;  1E7U A;  3Q8F A;  4Z9M A;  4MDK E;  1TY2 A;  2CHZ A;  4BAX A;  2BWF A;  3VTU A;  3NOB A;  4NAW A;  1VCB A;  2Z0E B;  2L1A A;  4J3O D;  2KN5 A;  2EMS A;  4IW0 A;  3SFD B;  4AP4 C;  5AZG A;  2NBW B;  3P2B A;  1UF0 A;  4WAF A;  4ARC A;  4N59 A;  2REX A;  3TJP A;  2GBK A;  1JWB D;  4L1B A;  1LGR A;  3URY A;  4PS8 A;  1F1H A;  3PGE A;  2IY0 B;  1AW7 A;  3RNG C;  4W9J A;  1J8C A;  5FR3 A;  2NTS A;  4C56 C;  4NAM A;  1NVI D;  2RD0 A;  5KHO A;  4ZRI A;  2GBN A;  4IM2 A;  2NCN A;  2O6V D;  1UBQ A;  3JVZ X;  4RF9 A;  3P4S B;  1J7B A;  3RNA C;  2AEH A;  2JPH A;  1OGW A;  3A4R A;  1C76 A;  3N1Z C;  5J99 A;  3MFG A;  2YVC A;  2KJH B;  1FXT B;  1OEY J;  1E7V A;  1XT9 B;  2N9E B;  1JW9 D;  3UIP B;  3DBL I;  3X23 A;  1UEL A;  1TY0 A;  3AXC A;  2CRK A;  1DOX A;  3A1Q A;  3IAS 1;  5AZH A;  1AAR A;  4RGN A;  2XK5 A;  2AL3 A;  1WXM A;  4LLG M;  5AUK A;  4LNF A;  2KWU B;  5LXI B;  3MHS D;  1WGK A;  2MCN B;  1SJH D;  2MJE A;  5J2R A;  2AQ2 B;  2M19 A;  4OVZ A;  3TIX A;  2RDH A;  2JXT A;  4ZRP A;  3LJ3 A;  2R61 A;  4II3 B;  3AM9 A;  4MEM A;  1FD6 A;  4HCP B;  3W1S C;  1SB3 C;  3NVW A;  3KWL A;  5DCN A;  4BVU C;  2JZ3 B;  3WAM A;  5C23 A;  3Q8A A;  3P1M A;  2MWS B;  1T6B X;  4ANX A;  2Y5B B;  2RPQ A;  4FN2 A;  3N1X C;  3QJZ A;  1R4M B;  1V4G A;  1EF5 A;  1I4X A;  2LFI A;  2MBH A;  4DHJ D;  3ABV B;  3JU5 A;  1JWA D;  3ZJU A;  4BKS D;  2ZPN A;  1YMH E;  2ZW0 A;  2K8C A;  1UD7 A;  4ZRQ A;  3TEW A;  2WDQ B;  4NJC A;  1FFU A;  2G45 B;  3CIR B;  2JUO A;  4GOC A;  1YJ1 A;  1QK1 A;  2LVQ A;  3T9L A;  1KLG D;  3AH7 A;  4RF8 A;  5G5H A;  2K6Q A;  2BGF A;  2E3T A;  4GU2 A;  3TL5 A;  2MSE D;  3IFW B;  3BYY B;  3M95 A;  3R7R A;  3FIL B;  4US8 A;  3AEG B;  1TTN A;  1ZDV A;  3D32 A;  3AE8 B;  1AWD A;  3Q2A C;  4KX6 B;  2V4I B;  4H2A A;  4AJY B;  1FCL A;  1YJI A;  3DBH I;  4RF0 A;  1PGX A;  5HI1 A;  2IO3 B;  3NZS A;  1HZ5 A;  1UZX B;  3W1S A;  4RF1 A;  1V9J A;  4GXB A;  4CYE A;  2IDY A;  2LGS A;  1HTO A;  2AL6 A;  3L13 A;  2RGF A;  2R2O A;  1WJ4 A;  3H7P A;  1J7A A;  2JZZ A;  1N61 A;  2KVZ A;  2M17 A;  3BYT B;  1I4Q A;  1WMH A;  4RMA A;  2AQ1 B;  3KVF B;  1IGC A;  2BYT A;  3P4P B;  1C78 A;  4HRS A;  3IHP C;  5GXG B;  1SF0 A;  4G11 A;  4TQ1 A;  4IWQ A;  3IG5 A;  4IWO A;  3JSV A;  4ASW C;  4W9F A;  2WX0 A;  3Q3J A;  4WWO A;  3RCZ A;  3B1L X;  4OZC A;  2KWC A;  3I63 C;  4REZ A;  3I57 A;  1WGH A;  3PLU A;  4A3O A;  4OHJ A;  1WJN A;  2WS3 B;  1NI2 A;  2QC8 A;  3JYU A;  4B95 A;  1NEK B;  1WI0 A;  1XLO A;  4K7S A;  1BML C;  2HTM E;  2JYT A;  1FNW A;  2CU3 A;  1PQS A;  2KDB A;  2IO2 B;  3DRE A;  3PZ8 A;  1PUT A;  2PE6 B;  1HA5 A;  2QSD A;  4MSQ B;  2C60 A;  3X0W A;  5I4D A;  1KOT A;  4FAD A;  1YQ3 B;  3NHE B;  3ZYY X;  2BTE A;  2JRI B;  3AEC B;  1WWT A;  2KMA A;  3M62 B;  2WXI A;  3PPA A;  3ZJV A;  2NBV B;  1QZE A;  2ACZ B;  2V3S A;  1MJD A;  3QA8 A;  5D2M B;  4TQ0 A;  2KQS A;  4W9I A;  2INN E;  1Y8R C;  3DBL B;  4KZ0 A;  4GIV A;  4NJ7 A;  2RPV A;  3L2E B;  3IT6 B;  2FNJ B;  2M4N A;  3OJ3 A;  3IG8 A;  2BS2 B;  1S3S G;  4WQO B;  4C80 A;  2LHE A;  2N9X A;  2WXF A;  3ECI A;  2L05 A;  3DDC B;  2KWV B;  1V86 A;  1C4P A;  3PO0 A;  1T0S C;  3SR6 A;  1ET6 A;  4ICU A;  3APD A;  3A9J A;  3ZRC A;  3AUL A;  1NBF C;  4KVG B;  4O1N A;  4C7Z A;  5T8I A;  1QOF A;  1EWC A;  5J9A A;  2DLB A;  2MBO A;  3AE2 B;  3T8M A;  3APF A;  4AM1 A;  1YQB A;  3LVV A;  4BHL A;  3M63 B;  4C4V B;  2QDF A;  3V3X A;  4P16 A;  4LTU A;  3ZJT A;  4PK1 A;  1QH4 A;  4MGY E;  2JT4 B;  4LNK A;  1KM7 A;  1Q10 A;  1WXQ A;  3EHV A;  3HIZ A;  3VTV A;  1YOV B;  2BB6 A;  4B0M A;  1QF6 A;  3AMZ A;  1P98 A;  1WJ6 A;  4ZHO A;  4DHZ E;  5BMH A;  3QC8 B;  4XGA B;  1RAX A;  4M0W A;  2LRW A;  3L08 A;  4E74 A;  3RI7 C;  1LFD A;  4W9C A;  1VZ8 A;  3GE8 C;  4KGT A;  4YSY B;  3AED B;  2FCQ A;  2DYO A;  5IN7 A;  4NAW B;  1F0Z A;  2I1J A;  1XXG A;  2DWQ A;  2D3A A;  1UWM A;  2PKO A;  4TKN A;  2LAS A;  4II2 B;  4PS7 A;  2JF5 A;  4A9A A;  2I1K A;  4B6W A;  2WHI A;  1V2Y A;  1TS5 A;  1HZ6 A;  5IKC M;  3AU4 A;  5FK9 C;  3IG3 A;  3QAQ A;  3VRA B;  1B1Z A;  3BK1 A;  3DHH C;  3HK0 A;  1P7E A;  4YTN B;  2INP E;  1ZXI A;  2IYD B;  2KAC A;  4GGQ A;  4RM9 A;  2K3U A;  3HM6 X;  4XDD A;  3TEX A;  2D3B A;  2G3Q B;  4HDO A;  2MA9 B;  2V1Y A;  4HWI B;  2IZV B;  3RZW C;  2OOB B;  2JYE A;  2L0T A;  3VHT C;  1RFK A;  5C1Z A;  1ZDX A;  2KTR A;  4ZRK A;  1OEY A;  2AX5 A;  3Q8B A;  5D3D A;  5H92 C;  2QJL A;  4A8X C;  1GB4 A;  2RMM A;  2ZNV B;  3MC9 A;  2GWC A;  1V97 A;  3A1Q B;  2ICI A;  2HJ8 A;  5TR5 A;  1NDD A;  1C77 A;  4IWP A;  4PS3 A;  1C9F A;  3PHX B;  1L0Y B;  1ZUD 2;  1XLP A;  2XK5 B;  1QLB B;  2N7D A;  2W3S A;  2Z0D B;  3TBL D;  3NVY A;  3W5V B;  3N30 A;  4AJW A;  3HM3 A;  4RM8 A;  2EEL A;  3MJW A;  3DCG A;  1A5R A;  2I38 A;  5JH5 C;  2NBU A;  4MJS A;  1L2N A;  4MAC A;  2IGG A;  4K7U A;  2XEW A;  2BPS A;  2V4L A;  3NS8 A;  3EFU A;  3L54 A;  3Q8C A;  1V49 A;  4EZL A;  1WGY A;  1KJT A;  3VDZ A;  2D32 A;  1R4M I;  2J0M A;  1I35 A;  2J1Q A;  2Y5P A;  2MP2 A;  4BBN C;  1T0Q C;  2AYO B;  4BZA A;  1UNS A;  3ENE A;  3IVF A;  1WJU A;  1C4C A;  2SAK A;  3BY4 B;  2KMM A;  4L2Y A;  1RYJ A;  3ZNG C;  3L10 B;  3N1Y C;  2K25 A;  4J6I A;  2LGX A;  1N6Z A;  3LN6 A;  2KAN A;  1R8G A;  1E90 A;  2CKH B;  1ZW7 A;  1SD0 A;  4WWP A;  2GRI A;  2KLC A;  1FEH A;  2J0K A;  4A6Q A;  4XE0 A;  2H88 B;  5DPS A;  4G0N B;  3B2F A;  4JX1 C;  4C00 A;  1STE A;  2FUH B;  2L00 B;  3PV1 A;  3H7P B;  4HVB A;  1JWU D;  1Y56 A;  3P4Q B;  4BKT A;  3NZT A;  2GWD A;  4TMA B;  1WMH B;  3PSE B;  5C2T B;  2W3R A;  4I6P A;  2ZNV C;  1X1M A;  2BYF A;  3Q3O C;  2XBB C;  2KVR A;  2NPT A;  5DPR A;  2KHW B;  3JSV B;  3HRD D;  3DHI C;  1SE9 A;  4IOI E;  4XDC A;  3OAW A;  1K52 A;  2CJO A;  3Q6B A;  4MEL A;  4GVY A;  4URK A;  1ZKH A;  2HTH A;  3VFK A;  2GMI C;  1N5W A;  3TMP B;  3PRP B;  5JXV A;  2LVP A;  2V3N A;  5E6N A;  1VD2 A;  3KQ4 A;  2N9L A;  2LRU A;  2NMQ A;  2XNA C;  2HJ1 A;  3KW5 B;  4GMV A;  2LJ5 A;  1CRK A;  5BMG A;  4FHK A;  4W9L A;  2K5P A;  1FRD A;  1Z2M A;  3DOW A;  1WX8 A;  3Q3N C;  4LNO A;  3C0R B;  2KN4 A;  5EE1 A;  3FKY A;  1FPY A;  3APC A;  2D07 B;  3ML8 A;  3WCQ A;  2H89 B;  2DAF A;  3KYD D;  1KTK A;  1TT4 A;  1DGJ A;  3VH4 B;  3W5U B;  2INC C;  3KWV A;  4KGS A;  1BT0 A;  4MH8 A;  4WJQ A;  5BYS A;  1NEN B;  2K0P A;  2WU2 B;  1V5O A;  3ZXV A;  3BK2 A;  3A9J B;  4I6L B;  1M15 A;  3ETR A;  2M1M A;  4MM3 B;  4MGZ E;  1FM0 D;  2LJI A;  1E9M A;  2NS5 A;  3EEC A;  2G9H D;  1IYF A;  2GBJ A;  2RSU A;  3W1Y A;  1OQQ A;  1IBX A;  5LXH A;  1D5Z C;  3P63 A;  1UBI A;  1GG3 A;  2LEK A;  3ZO5 B;  1GAQ B;  1I4R A;  4ICV A;  1IGD A;  1LO5 D;  1A70 A;  2MW5 A;  4P1B C;  2DNF A;  2BBC A;  2YEP B;  2DEN B;  2JVC A;  2ZPY A;  4M02 A;  3GZN B;  3EC8 A;  2ZVN A;  2IGD A;  2FUG 1;  4M0W B;  1RRB A;  4KKJ A;  1JRP A;  4RH6 A;  3N32 A;  4JE3 B;  2C7M B;  2KT7 A;  3AE5 B;  2KKC A;  1L4D B;  4HJG E;  4KSK C;  1L7Y A;  4IC7 B;  1GC7 A;  3Q69 A;  2IY1 B;  3R2T A;  1KLV A;  3R7Q A;  1RWS A;  5EE9 A;  2JX5 A;  1ZXH A;  4GW0 A;  1J19 A;  1C3T A;  2CU1 A;  1RFA A;  1TBE A;  1CZP A;  2QCZ A;  2W9N A;  4K3B A;  1K8R B;  5G5G A;  1P7F A;  1JCK B;  1SBB B;  3UGB B;  5MPO A;  4EOY A;  3DRB A;  1V6E A;  1P0R A;  3AE9 B;  3QQ8 B;  4AOF A;  4PT5 A;  3FC4 A;  4WWM A;  3A33 B;  1WXA A;  4IM3 A;  4K1R B;  2X8X X;  2Y3A A;  4FXC A;  3WAO A;  2KMC A;  3KUZ A;  3SHQ A;  2J42 A;  4IUM B;  4G50 A;  4N9F 4;  2VZK B;  3VR8 B;  4W9D A;  2D2Q A;  2KTR B;  5BYR A;  5IAA C;  3GS2 A;  2LMC A;  3T3O A;  3N3K B;  1KFY B;  4A20 A;  3ZVV A;  3CSF A;  3AEE B;  4WUR A;  1WYW B;  3VUY A;  3ALB A;  4UDU C;  3I3T B;  3KYC D;  4TSS A;  1TYG B;  3RPF C;  1JWM D;  3LVW A;  3AI5 A;  3B08 A;  2KD0 A;  5HG2 A;  1K50 A;  3N9Y C;  3JU6 A;  2WP9 B;  3L17 A;  3PRM B;  4MJS B;  1P3Q U;  4W9H A;  2WX1 A;  3VR9 B;  3RYT A;  3V05 A;  1RL9 A;  3ZRF A;  4YTM B;  3VXW A;  3MTN B;  1WF9 A;  3GB1 A;  4LDT B;  1RM6 C;  2KAJ A;  1ZOY B;  1WYG A;  2DZI A;  3SDL C;  3AN1 A;  1U4A A;  2CHX A;  1I7H A;  5HHD G;  5JHA A;  3ZIM A;  2KLG A;  1R4N I;  2L7R A;  4ANW A;  2GBM A;  4FJV B;  3QK0 A;  4WAA A;  3RFZ B;  4NQK E;  3JPZ A;  1VA6 A;  1N5X A;  3SD5 A;  4ANV A;  2CR5 A;  4IM0 A;  3CST A;  1JML A;  2ZW1 A;  1KF6 B;  1EF1 A;  4MSM B;  4TV3 A;  1I4P A;  1RLF A;  2MP2 B;  2KDF B;  3RMK C;  2K1F A;  3PRE A;  2A5U A;  3WAP A;  3TUO A;  2ASQ A;  2B76 B;  4YSX B;  2ZCB A;  2BB5 A;  4KV2 A;  1TIF A;  3AU5 A;  2WGS A;  1IPG A;  1MI0 A;  4KZC A;  4NY0 A;  4RF7 A;  3Q8E A;  2BKF A;  2PLP A;  3K9P B;  2KDI A;  4F8C B;  2R2Q A;  1XQQ A;  2LHD A;  1F52 A;  3ZXR A;  2PE9 A;  4MM3 A;  2D3C A;  4RF6 A;  3RNC C;  4Q2J A;  1KRH A;  2BF8 B;  4XC2 A;  4A55 A;  4ZHP A;  1GB1 A;  4NNJ B;  2ON8 A;  1E8W A;  4FBJ B;  3UI3 A;  1EU3 A;  4ITK A;  1MHX A;  5CHF A;  1VZ6 A;  3BZD B;  1C1Y B;  1N60 A;  2QIE B;  4LNN A;  2CJN A;  3SU8 X;  4AUQ C;  1VRA B;  1EUV B;  3ML9 A;  1P52 A;  2Q5W D;  2L52 A;  3PT2 B;  5IO9 A;  5J18 A;  3R8B A;  1TZ1 A;  3MC0 B;  1HTQ A;  3V6E B;  2QMT A;  1SIF A;  1TS2 A;  4XZ4 A;  2K39 A;  4OZA A;  1T0Y A;  5BMI A;  3DBR B;  3IBE A;  2NPT B;  2WYQ A;  2OJW A;  1LXD A;  3M3J A;  3RD2 A;  2JU6 X;  1WM3 A;  4A3P A;  2KYW A;  2IND C;  1IUE A;  3RUL A;  5IP4 D;  2M56 B;  3P42 A;  3RT3 B;  3AV8 A;  2LGI A;  3MJ5 A;  4OVU A;  3EA6 A;  1V81 A;  3EUB 2;  3PHW B;  2NR2 A;  2PPH A;  2WXQ A;  3B0A A;  3WA0 A;  4A90 A;  1S1Q B;  1LQB A;  2KJR A;  1H4R A;  1QOA A;  2JY6 A;  4MGI E;  2IGH A;  3B6R A;  1SE3 A;  4DK5 A;  3QIJ A;  3T3N A;  2WNM A;  1E8Y A;  1QT9 A;  2MJ3 A;  2WXK A;  1XLQ A;  2PEA A;  1GPX A;  1XLN A;  1FMA D;  3UIN B;  1P50 A;  1WFY A;  2PIA A;  2K8H A;  3W2D A;  4NQL B;  1T0R C;  2V0G A;  2PVG C;  1UGJ A;  4P1C C;  1XCQ L;  1JWS D;  4GLS C;  3NJT A;  1CK1 A;  2BKR B;  3H1U A;  3FAH A;  3LYY A;  4B9K A;  3PZD A;  4M00 A;  4HKZ E;  1E10 A;  4LJO B;  2KFJ A;  1WGD A;  1MFW A;  1D5M C;  4HDQ A;  3UF8 A;  2W82 A;  3R3M A;  4ZYN A;  5HKH A;  1TGZ B;  4M8N A;  1SGH A;  2OHF A;  2VZK D;  4ZOH C;  4WJN A;  1EM7 A;  4FA6 A;  2KX3 A;  2KK8 A;  2VH2 A;  3TEZ A;  1SE4 A;  2Y5C A;  1NYR A;  4ANU A;  2N4F A;  1TS4 A;  4KIK A;  4EE2 A;  1FXA A;  1OQR A;  2WQY B;  3EGR A;  3OG5 A;  4EZJ A;  1IBX B;  4F1S A;  1V5T A;  4HPM B;  2W54 A;  1ROE A;  4HPL B;  5JHB A;  4ZRJ A;  2MX2 A;  4KGR A;  3L2D A;  4IDI A;  4FLH A;  5LLI A;  1WH3 A;  1WGG A;  1DOY A;  1FNV A;  1R4N B;  3AE3 B;  4K7W A;  3R2I A;  3NZ3 A;  1KLU D;  3O65 B;  1NI3 A;  4R3D A;  2FCM A;  1OQY A;  3I9V 1;  5FR6 A;  3GZN I;  4HJK A;  2KFK A;  2WDR B;  3PTF C;  3L4P A;  3VRB B;  4EUT A;  1U6R A;  2MEK A;  2JRH A;  4GN1 A;  1ZE3 D;  3MC8 A;  1E6E B;  4DHJ B;  3LN7 A;  1V80 A;  1WSP A;  5E6J A;  4DXA B;  2KOX A;  4KKI A;  4LNI A;  2RDG A;  3QAR A;  4NPN A;  2D11 A;  1YD8 U;  4OW0 A;  3P4R B;  1VDV A;  2LUM A;  4S17 A;  2LD9 A;  4NZL B;  4EZK A;  3NG0 A;  2MRP A;  1BG0 A;  1YN3 A;  4DDI D;  3TEY A;  1L6U A;  1FRR A;  4YT0 B;  1VLB A;  2J53 A;  3ZUN A;  3BWU D;  1QOB A;  2Z59 B;  4FJY A;  3QCA A;  2MHJ A;  3MHZ A;  1I42 A;  3ZNI D;  1FFV A;  3ZKJ C;  3DPD A;  1DOI A;  2AQ3 B;  2V3P A;  4YL8 A;  2K22 A;  1WE6 A;  3KH0 A;  1D4B A;  3DVN U;  3V60 A;  1WXS A;  1YNT E;  2C5L C;  4RGM A;  3MP9 A;  5CTR C;  3O13 A;  1MG8 A;  2DHZ A;  3DVG Y;  4JL9 A;  1YN5 A;  3E9S A;  2BWE S;  2WXH A;  1MG4 A;  3ZDT A;  3RZF A;  2AWT A;  4S0R A;  2G1E A;  4OVV A;  1OTR B;  4QAY A;  1VJK A;  4WJP A;  2N7J A;  2WXM A;  1K51 A;  2N9K A;  4IKG A;  4LCD E;  1ISN A;  2BYV E;  5IOI A;  1YX5 B;  3AE6 B;  4GDK A;  3A9K A;  4WJO A;  3TCA A;  1UH6 A;  2DZM A;  3H6N A;  2LWP A;  3B9J A;  1E8Z A;  1CMX B;  2VRR B;  4Q2R A;  2FCN A;  2ONQ A;  4PYZ A;  4XWT A;  2EKI A;  4GDL A;  3RN9 C;  1YN4 A;  5CX3 A;  1XEE A;  1TS3 A;  3RUI B;  4BFR A;  2DZK A;  2FAZ A;  3NVZ A;  2J7Q B;  3NUH B;  3VTW A;  5AEK B;  2O6V A;  2KX0 A;  2BW2 A;  2BQQ A;  2N0S B;  4HK2 A;  1TKY A;  5D94 A;  4WQM A;  4ARI A;  1PGA A;  5G2N A;  1C4A A;  4M8M A;  2D33 A;  1N63 A;  1PFD A;  1WGR A;  1VZ7 A;  4XYC A;  3C8Y A;  3AEB B;  3OWE B;  3UQB A;  2WXG A;  2KQ7 A; 
#chains in the Genus database with same CATH homology
 3FKY A;  2D32 A;  4BAX A;  4S17 A;  1FPY A;  3IG5 A;  4HPP A;  4S0R A;  1LGR A;  2LGS A;  1HTO A;  4LNK A;  3ZXV A;  1F52 A;  1F1H A;  3ZXR A;  4ACF A;  2OJW A;  2GLS A;  4LNF A;  2UU7 A;  3NG0 A;  3LN7 A;  4LNN A;  2D3A A;  1TT4 A;  2D3C A;  3LN6 A;  4LNI A;  1R8G A;  2D33 A;  3LVW A;  1V4G A;  2WHI A;  4XYC A;  2D3B A;  3IG8 A;  3LVV A;  1VA6 A;  2GWD A;  3NZT A;  4LNO A;  1HTQ A;  2BVC A;  2WGS A;  2GWC A;  2QC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...