2OJWA

Crystal structure of human glutamine synthetase in complex with adp and phosphate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
366
structure length
360
Chain Sequence
b'YFQSMASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamine synthetase
publication title Crystal structures of mammalian glutamine synthetases illustrate substrate-induced conformational changes and provide opportunities for drug and herbicide design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 110
structure length 360
sequence length 366
chains with identical sequence B, C, D, E
ec nomenclature ec 2.3.1.225: Protein S-acyltransferase.
pdb deposition date 2007-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 2ojwA01
3.30.590.40 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Creatine Kinase; Chain A, domain 2 2ojwA02
3ZXRA 2BVCA 1F52A 4ACFA 2WGSA 1FPYA 1F1HA 3NG0A 2UU7A 4XYCA 2OJWA 2QC8A 1LGRA 4BAXA 2WHIA 4LNNA 4S17A 4LNKA 4LNFA 2GLSA 4LNIA 1HTQA 2D3BA 2D3AA 4HPPA 1HTOA 3ZXVA 4S0RA 2D3CA 2LGSA 4LNOA 3FKYA
chains in the Genus database with same CATH superfamily
1N61A 2J53A 2ONQA 3WALA 3QIJA 2PLPA 2C7MB 2EKEC 1TGZB 2ZCCA 3I3TB 1K52A 1QILA 4TV3A 1CQVA 3APCA 1S3SG 1Y8RC 2D3CA 3PS6A 3RUIB 1ZP0B 3AEEB 2ZNVC 2XK5B 4AJYB 3U8ZA 4XWTA 1TKYA 3W9CB 3LDZE 1L2NA 3M62B 2JU6X 4HJGE 3ZIMA 2BW2A 2IJ0A 1T0SC 2JX5A 5HHDG 5IAAC 3AE9B 1C3TA 3PV1A 2RSUA 1R4MB 2KC2A 4MM3A 4NJ6A 4IOIE 1A70A 1PDXA 4W9CA 4ZDVA 2MBHA 2MH7A 2KKCA 2KWDA 3HK0A 2KYWA 5LXIB 1F2RC 1WSPA 2IO2B 4FJVB 1Q5WB 1QKZA 3PT2B 3W2DA 1ZUD2 5CX3A 4TMAB 1PYWD 3TMPB 2WXNA 4BKSA 5D6JB 2V4LA 1TJEA 4RF0A 4EZLA 4NY0A 2LGXA 1I4HA 4EKUA 2HJ1A 3P2BA 2FCNA 2KVZA 1HTQA 4PS8A 3AE8B 1I4PA 1VZ7A 3OJ4B 2JSVX 3B2GA 3DPDA 3Q2AC 4ZYNA 1ZXHA 1KF6B 3BVMA 3AE2B 1XF5L 2BKRB 5TSSA 2BB5A 3KQ4A 4HRSA 3VHTC 3P4RB 4LNIA 4HROA 2NTSA 2KJ6A 1RYJA 2WDQB 4BZAA 2GMIC 4B9KA 2LXCA 3FKYA 1M15A 3ZNZB 4OZAA 2GBMA 3RNFC 4W9KA 2I1KA 1MI0A 2L7RA 1UGMA 4GDKB 3PPAA 1J7AA 2FCMA 3CWIA 5J17A 3VQIA 3NS8A 3N32A 2KWCA 5EE0A 3WAOA 3KYCD 4LNKA 1OQQA 3Q3JA 1S1QB 1WJ6A 4DK5A 2EELA 1F77A 1WM2A 1XO3A 3QHTA 1WR1A 2LVQA 2K1FA 1ESFA 1WXMA 4NAWA 1L4ZB 1SIJA 2KACA 2KC1A 4ANUA 1QOBA 1FO4A 2LHDA 3SR6A 1UWMA 2NCNA 4K3BA 3UIPB 2TSSA 1RL9A 3MHSD 4M0WA 4GXBA 4KSLC 3NZTA 2O6VD 4US9A 1OQYA 3P4SB 1R4NI 3N9YC 4K7SA 3H8HA 2LI5A 3DRBA 2BVCA 3RNCC 1WZ0A 1E5WA 2G3QB 3IG3A 1IBXA 4GOCA 1EWCA 2NTTA 2WXMA 1TZ1A 1WJUA 3IBEA 4WAFA 2N1VA 5FKAC 2WXFA 4A55A 4BOSC 3IHPC 4NNJB 2JUOA 3ZXVA 2N9EB 3I63C 4G0NB 1I4RA 2MBOA 4C7ZA 4KVGB 4YTMB 2N9LA 4BG4B 1K50A 1YIWA 1E7UA 4HKQA 1WMHB 3DWMA 2MBEA 2ZW0A 4AS1A 3P63A 1DYQA 1RFKA 3VUYA 4A8XC 1TY0A 2KMMA 2O6VB 3A9KA 1JRUA 2MX2A 5JHBA 3QC8B 3ONSA 3SHQA 3APDA 3ZNID 1V81A 3M10A 2PVOD 1GOZA 4BOZB 1WGGA 4JWUC 1J8CA 1WXQA 2HD5B 4OVUA 3QK0A 3JU6A 1V1PA 3W1SC 2INDC 2L3ZA 2D3BA 2QIEB 1ZGUB 3WA0A 2ZEQA 1B1ZA 1SBBB 4ICUA 2AQ3B 5J18A 1FFUA 1SD0A 2CJOA 4DWFA 4Z9MA 4GSWA 1L4DB 3B08A 4MH8A 2MQJA 2FBWB 3Q69A 3TEZA 2ICIA 4WQOB 3MJWA 4BHLA 5BYSA 3B1LX 3CSTA 3RN9C 3LB8C 4WIPA 3ZDTA 5BMHA 2NBUA 2LGDA 3Q14C 1TS5A 4NJCA 4E71A 3QARA 3VH4B 1KOTA 1QOFA 1RAXA 1JCKB 1L6UA 1YJIA 3RMKC 1V2YA 3OG5A 1WFYA 4HDQA 4EZJA 3L4PA 2AX5A 3V05A 2WNMA 2HTME 5JH5C 4KIKA 3AB5A 1C4PA 2JWZA 1T0QC 2K25A 5IA7A 3HVDA 3ZLZA 1ENFA 1I4XA 3BK1A 3P42A 5I4DA 2XNAC 1JWSD 3ZQ4A 3L2EB 2K5PA 2ZCBA 3Q8AA 1JWMD 2KFJA 5IN7A 4DHJD 3RT3B 3V6CB 4ZOHC 4GMVA 3L54A 2DYOA 2AQ1B 4MDKE 1V6EA 4GDLA 1N63A 1L0YB 3N20C 3ZNHB 2V3PA 3A4SC 1P50A 1YQBA 5HFYA 2WWZA 2X38A 1WF9A 5IO9A 5G2NA 2QILA 4IDIA 3TCAA 2JWUA 2ASQA 1MPEA 1WJNA 2KHWB 1NI3A 4YL8A 4WQMA 5DCNA 2KTFA 1KLUD 2INNE 4OVZA 4ZYSA 2DENB 4X57B 2XEWA 1UUPA 3Q3NC 4IUMB 4W9LA 3PHXB 2BTEA 3LVVA 2YEPB 3U52E 1E8XA 2CJNA 3AM9A 1WXVA 1KJTA 3BYTB 4Q2JA 4FADA 2W54A 2V0GA 4KZ0A 4ZRJA 2QDFA 2MW5A 3B9JA 4HK2A 2H88B 3TUOA 4CYEA 2MHJA 3X0WA 4M8NA 3H7PB 5G5GA 3I9V1 1YNTE 2BF8B 3IAS1 3ECIA 2E3TA 4EUTA 1HE8A 3AE7B 3AE3B 2O2VB 4MGZE 3ZNGC 1D5ZC 3FILB 4W9IA 3Q8EA 4N59A 4EOYA 5LLIA 2G1EA 2L00B 3QCAA 4USAA 5DPSA 3TIXA 1I35A 4UDUC 3PZ8A 1U6RA 1GNUA 3ZJVA 3BK2A 2CR5A 2ZVNA 2ZPNA 2ZW1A 3TSSA 1MVKA 2PEAA 3PGEA 2AEHA 4PS7A 5D3IB 3HM3A 1TIFA 4LJPB 3RI7C 4HVBA 4KKJA 4FA6A 4B0MA 5EE3A 2BKFA 5FK9C 1SE4A 4BBNC 2KZRA 2B76B 4KDIC 5AZGA 1FMAD 3HIZA 2K22A 2D32A 1XLNA 2NBWB 1TYGB 2D10A 1KTKA 4MM3B 5E6JA 3RYTA 2KO3A 4XYCA 2NMQA 1Q1OA 3PZDA 4DDGD 4AWJA 1MHHE 1WH3A 4F7ZA 3U30A 2DAFA 5T8IA 3VUXA 1IUEA 1E10A 2INCC 2M19A 1V1OA 2N9XA 2K0PA 1WYWB 1C77A 2W82A 4B95A 4M8MA 1D5MC 1IP9A 4URKA 2IY0B 4KDLB 4B0EA 5L83A 2NPTA 3JPZA 4BVUC 2EKIA 1HQRD 2L52A 2FCSA 4YWGG 3RZFA 1TS2A 2KFKA 1TTNA 2QSDA 1GB1A 1RRBA 4L2YA 3QQ8B 4A20A 1E90A 1JW9D 1I4GA 3QX1A 4EZKA 3KYDD 1ZPSA 1AW7A 1GB4A 2J42A 2IGGA 2DZMA 3H7PA 3EC8A 2MEKA 4C56C 2GLSA 2WDVB 4GU2A 2KDBA 4XC2A 3ENEA 3BY4B 3CMMB 2GB1A 2RDGA 3Q8FA 2PKOA 3NZUA 4RF9A 3KLSX 1EO6A 3FILA 3EFUA 4ARIA 4CO7A 4DXGA 5E6PA 2I1JA 1LFDA 2WXKA 4WWMA 2GWCA 3RPFC 2OOBB 1CZPA 2KQ7A 4F1SA 5JHAA 2WX0A 4KGTA 4AP4C 5JXVA 1XT9B 1WX7A 5E6OA 3ZO5B 2WXOA 2IZVB 1F52A 4TKNA 2G45B 4PK1A 4ZHOA 2BYVE 5C1ZA 3WIMA 3ZKJC 1J19A 1K53A 2KT7A 2LEKA 3SDLC 4NAWB 3AE4B 4IC7B 1GJZA 1P0RA 3AU5A 1VJKA 2L1AA 3LN7A 2K8CA 4M0WB 2IO0B 4TUUA 1E9MA 3VTVA 1VZ6A 1IYFA 4BKTA 2KK8A 3BVGA 3O13A 2LGYA 4NQKE 4GB9A 3PHWB 2KANA 1NYQA 5DPTA 4NAMA 3P4QB 1IBXB 2MCNB 4GGQA 1TBEA 4MEMA 5C3JB 1NEKB 5CHWA 1WX8A 2JZ3B 2KWUB 4AM1A 2JYTA 4JGHB 2SEBD 4HJKA 1QK1A 2HE7A 1ZDVA 1V5TA 4LNFA 2L8JA 1SE9A 1WGRA 4S0RA 4OW0A 3GS2A 2CHXA 3N3KB 2KDIA 3A9KB 3AN1A 2ZPYA 1R8GA 2LFIA 3URYA 2RPVA 2J0MA 3M63B 1VA6A 2KX0A 3DBRB 4HPLB 3DHIC 3RFZB 1GG3A 5AZHA 2EMSA 1HA5A 1SB3C 1EF1A 1R4MI 1FXIA 4GLSC 3DBLB 2G4DB 1WGYA 1V1PB 2OHFA 2D33A 1FRRA 2VZKD 4K7UA 3VDZA 3NS1A 1I7HA 2NVUI 1ISNA 2W3RA 1AARA 2K6QA 2M4NA 1BMLC 4JL9A 1J7BA 4IM3A 3PLUA 4MGIE 3W5VB 3AEBB 2JRIB 4P16A 2R61A 4I6LB 3L16A 4IWOA 2JVCA 2SAKA 1XLPA 2CS4A 1UD7A 3UF8A 4RNAA 3FAHA 3UGBB 1ZW7A 2KXJA 2J0JA 2KD0A 4QAYA 2WXIA 3JW0X 2KWVB 2J52A 4N9F4 5HG2A 2LVPA 4LDTD 2BYEA 1NENB 1PGAA 1D5XC 2KTRB 1FD6A 5BYQA 1TS3A 3RNEC 2BS2B 3P4PB 1F9JA 3WAMA 3N1YC 1WI0A 5FR6A 3DBRI 1FNVA 3T3NA 4LLGM 4RM9A 5D94A 3V62A 1YD8U 4KIKB 3A4RA 2EMTA 5AUKA 2KJHB 3B2FA 2PE6B 1TT4A 2NR2A 5GMVA 5G55A 4II3B 1SXTA 2BYFA 1VD2A 4RF1A 2I38A 2J1QA 3ZTCA 2C7NB 3BIID 2JZPA 4LDTB 4RF7A 2CRKA 4NPNA 3LVWA 2ZJDA 1JMLA 2WYQA 2XN9C 5C23A 4GDLB 1SSNA 4RMAA 1MG4A 2BT6A 3M95A 4A3OA 4L1BA 2JT4B 2YLMA 3DVNU 2IYDB 5AZFA 3A9JA 1XD3B 3SFEB 2MRPA 2XBBC 2LWPA 2Y3AA 3EFCA 1JALA 1MJDA 1P3QU 3IG5A 3DBSA 4GN1A 5C2TB 4KV2A 3PTFC 3M3JA 1NI2A 1F0ZA 2V1YA 3TEYA 4ITKA 2MA9B 1CRKA 1GAQB 3AV8A 4D2KA 3ZRCA 3ZTDA 1I42A 2LASA 2GBKA 3ZW3A 1YJ1A 3TBLD 3V3XA 1E6EB 2LRWA 4J6IA 1QLBB 4HPPA 2JF5A 3AH7A 4AOFA 1GC6A 3IAM1 4G3XB 2MBQA 1ZKHA 3LN6A 2AQ2B 3HHMA 3ZVVA 3C0RB 1XCTL 4PYZA 3L0WB 3R7QA 1T0RC 4JPSA 2E6XA 1HZ5A 2KTRA 5H92C 5BO4B 2K6DB 4HKZE 3UI3A 5LXHA 4LNNA 4P7IA 3DBHB 4KX6B 3A1QA 2GBRA 3NVWA 2JXTA 1D4BA 2LGSA 4BBNF 1EM7A 2L05A 3JVZX 3PVLA 4M01A 1WE7A 2L32A 4MELA 2L0FA 1T5XD 3MFGA 1X1MA 3KUDB 4US8A 3N1ZC 4IKGA 1QH4A 4DQOC 1P7FA 2DZIA 2DWQA 3IXSA 3W1YA 1P7EA 4I6NB 5CHFA 1N62A 2Q5WD 2HTHA 1VRAB 3SEBA 4XE0A 4W9EA 2BYTA 4WJOA 5MPOA 3L13A 2PMVA 2Z0DB 1C78A 2A5UA 3IVFA 2IO1B 1ZXIA 1QT9A 3MHZA 3R8BA 1WY8A 2G9HD 1YN4A 4DDID 2N9PC 2BS4B 3NVVA 1NDDA 4HCNB 1FCCC 4HWIB 5EDSA 4KGRA 1V8CA 4G50A 1XCQL 1Y56A 4YT0B 3V6EB 4RGOS 2PTLA 5GXGB 1FEHA 3VRAB 3NZ3A 3Q3FA 1JWBD 2LJIA 5J99A 3DBHI 3MC9A 1E8YA 3WCQA 2MP2B 3ETRA 3MC0B 2V9HA 2NPTB 3L10B 2KX3A 3RCZA 1A5RA 3PRZA 2KFKB 3ZXRA 2DBYA 4A9AA 4DHJB 2N1WA 3NG0A 2M0XA 2QHOA 3R3MA 2K3UA 3O65B 2Y5CA 1WXSA 2W55A 2FNJB 4O1NA 4P1CC 3AECB 3VH3B 5BMIA 1V49A 3B6RA 2MLBA 4GW0A 2WXPA 4A6QA 4N6EB 1DGJA 2CU1A 1AWDA 4ACFA 1P9DU 3ML9A 1VLBA 2WDTB 3ML8A 4TSSA 3NOBA 4A3PA 3KWVA 5J9AA 1R7SA 2C5LC 1WE6A 2M0AA 5D3DA 1RWSA 1EF5A 4FXCA 2GBJA 2K8HA 1WX9A 4DXAB 2WHIA 2WDRB 1G6JA 3BZDB 3DDCB 2DHZA 3APFA 5KHOA 2N7DA 3R2IA 1SGHA 3AE5B 1WIAA 4MT5A 4YTPB 1VZ8A 3C8YA 3JQ3A 2QJLA 4GVYA 2YVCA 4HEA1 4YTNB 3VTWA 2JZZA 2GI9A 4IM2A 2PJHA 5JZEB 1FM0D 1DOYA 4YSXB 1XEEA 2M17A 4MH0E 3DOWA 2QCZA 1CJEA 1JWAD 4WWOA 2QC8A 1J7CA 5HI1A 3RZWC 4RF8A 5CTRC 3EHVA 1WZ3A 2R2OA 1RLFA 2YEPF 3NZSA 3HVZA 3V61A 2INPE 3AXCA 1P98A 3WAPA 2PW9A 2KN4A 4MACA 4C80A 4ZRKA 1IGCA 4W9GA 2M56B 3IG8A 2N9KA 1E8WA 2D2QA 1YX6B 2M1MA 1OTRB 2MP2A 2JRHA 3GE3C 2BS3B 2RDBC 1L7YA 1ACCA 1OGWA 4S17A 4JWSC 1M4VA 1NBFC 2WXJA 1NVID 2FUG1 2KN5A 2NS5A 3EUB2 2AYOB 1H4RA 3NRZA 2X8XX 3AU4A 3T3OA 2RR9A 5D2MB 1N5WA 2KDFB 2Z0EB 3WANA 1V97A 1E0ZA 4YSZB 1Q0WB 1FNWA 1YN5A 3CSFA 4OZBA 3KH0A 3TEXA 4REZA 3AULA 3PZ7A 4ANXA 3H7SA 3ZUNA 1G0WA 4RCOA 1PGXA 4LNOA 3GB1A 1YOVB 3TL5A 3AE6B 3UINB 4EFOA 3VR9B 5LNK1 1V5OA 1P52A 1PQSA 2UU7A 3DWGC 4C4VA 1PFDA 4HXDA 1E7VA 1ET6A 3J9CA 4PT5A 1VR9A 4C00A 3DVNV 2IPKD 4ZRPA 3PRPB 4FBJB 2BWES 5HKHA 2WXLA 4RH6A 1HXYD 4W9FA 2DYBA 3PREA 1WXAA 4FJYA 3L08A 3VXWA 2N7JA 4DHZB 2BPSA 4XX5A 2JQRB 3DHHC 2DZJA 3NVYA 2A4ZA 4RM8A 3HRDD 2WS3B 3DVGY 2W9NA 4WJNA 4JQWC 2DAJA 1UF0A 2RGFA 1L6VA 1BXTA 2KLCA 2LUEA 2KDMA 3MJ5A 5J2RA 1JQ4A 2LD9A 4IG7B 2M8SA 3Q3MC 3LJ3A 1ROEA 1Q10A 2FAZA 3N1XC 4W9HA 1J0GA 1DOIA 2KAJA 1KLVA 3RNAC 5EE9A 3GZNB 1B9RA 2LUMA 1UH6A 3PO0A 4XWWA 1FXAA 2DX5B 3RULA 2WGSA 3DREA 1D6EC 4LCDE 3H6NA 3DVGX 3E9SA 1SE2A 5G5HA 2LRUA 1EWYC 3AI5A 4FHJA 2WXRA 1C4AA 2D3AA 1H8CA 3PSEB 3NY5A 2N0SB 2KOXA 1K8RB 1CK1A 2ON8A 1QOAA 1EU4A 3UQBA 4FULA 2JY6A 2AWTA 1EU3A 1T6BX 1C79A 1L0VB 3GOEA 3A9JB 4NQLB 2RMMA 4JLCA 4ANWA 1XQQA 3TJPA 1R4NB 3T9LA 2D5GA 3DHGC 4MJSB 2L0TA 2FCQA 1T0YA 4H2AA 4IWPA 2QMTA 3BINA 1C4CA 3VAWA 1OEYA 2UWQA 1UBQA 3GZNI 4JE3B 2ZZPB 4GW2A 1UZXB 1FIQA 3W1SA 4JX1C 2KVRA 2VH1A 3U4EG 3Q8BA 3MTNB 3AEFB 4C7YA 1GUAB 1LQBA 2KMCA 2RD0A 4K3CA 3LXFA 4G11A 3VRBB 4Q2RA 4ASWC 4GIVA 1YJJA 2CHWA 2XK5A 3VFKA 3U2SC 1IGDA 3RNGC 2JPHA 1WR6E 5CHVC 3A1QB 2VZKB 2KLGA 3KUCB 2FE8A 3VUWA 1SJHD 4BKGA 1FPYA 4CQNA 3IT6B 2RPQA 2BWFA 1QOGA 4B6WA 4XZ4A 1SE3A 3OLMD 1VRPA 3Q8CA 1OFFA 1LXDA 4HCPB 1C1YB 3Q3OC 3DBLI 3ZRFA 3QA8A 1BG0A 2RDHA 2LGIA 3H1UA 4A90A 3Q6BA 2LHEA 3R7RA 1K51A 2BBCA 2DYMA 1OEYJ 2ACZB 1I4QA 4LJOB 1U4AA 2DLBA 3HUIA 3W5UB 1GPXA 4WAAA 2WX1A 4ANVA 1AYFA 1JROA 2Y5BB 2FIDA 4FLHA 2OJRA 3B0AA 4OVVA 3EA6A 2KQ4X 4L23A 2DZKA 1BT0A 1ZDXA 1C9FA 1FXTB 4RGMA 3TEWA 1P1AA 4WJPA 2WXGA 1EUVB 4KZCA 3R2TA 3RNBC 3VTUA 5IOIA 1F1HA 2OEDA 1XXGA 1Z2MA 1WGDA 4ARCA 3ZJUA 4TQ1A 1ZOYB 2Z59B 3PRMB 5AUIA 5FR3A 1JWUD 4TQ0A 3X23A 4BFRA 4ZHPA 1LM8B 3A33B 2WLBA 4MJSA 4W9JA 3K9OB 1D3ZA 2LJ5A 4EEWA 3U7DA 2C60A 5KHQA 3PLVA 1IPGA 1WRIA 4WWNA 4W9DA 1WJ4A 2L83A 2FUHB 1KRHA 1FFVA 2VH2A 3JYUA 2D3GA 1WM3A 1UELA 2CHZA 4PYUA 3KVFB 2J0KA 1M94A 1QZEA 1WGKA 4GDKA 4RFBA 1Z5SB 3V60A 4FJZA 1YX5B 3KWLA 2REXA 3R66C 1FRDA 5DPRA 2L76A 3EECA 3CF6E 2K39A 3P1MA 2HJ8A 4WH4A 3U7ZA 3QJZA 4MSQB 1MG8A 3E56A 3ZJTA 3FC4A 2K9XA 1KFYB 3EGRA 2V3NA 2UYZB 2MJDA 4P6VF 3OJ3A 4IWQA 3NUHB 5D7GA 5H8YE 1SIFA 3KW5B 2FIFA 4IM0A 3AMZA 3L17A 2N4FA 3BWUD 3NJTA 3AEGB 4K81A 2PIAA 1TKGA 1AN8A 3GE8C 1VCBA 2C9WB 1UBIA 3SD5A 2C7HA 2GOWA 3H9DA 3MP9A 1RM6C 4HDOA 1WYGA 3VVWB 4FHKA 1E7PB 4AUQC 1OQRA 5TR5A 2ZNVB 4ZRQA 3VR8B 2PE9A 1HTOA 2J4XA 5AEKB 1MFWA 1I0EA 4BG4A 1HEZE 2HDEA 1WMHA 3D32A 4AQ7A 2J7QB 3LYYA 4IW0A 1CMXB 4CHKA 2OJWA 1V80A 3IFWB 2WXQA 2O6VA 2B3AA 1TS4A 4WJQA 4MGKE 4ZRIA 2LXAA 3QAQA 3ZGZA 2R2QA 4R3DA 4GVZA 1V86A 1L5PA 4HPMB 4MSMB 3JSVB 2W3SA 2KQSA 1VDVA 2D11A 3IT4B 3S2AA 2Y5PA 4OHJA 1KM7A 2MSED 4DHZE 5EE1A 3UQAA 2JXXA 3DCGA 4RGNA 3K9PB 5BYRA 2AL3A 1ZE3D 1TKEA 3CIRB 2MJ3A 1YN3A 3NHEB 3T8MA 1QQRA 4K7WA 2GWDA 2IBIB 3QWZB 3NVZA 4PS3A 1YQ4B 4P1BC 3MC8A 1TZOA 1FNUA 4FN2A 3KUZA 4LTUA 3AEDB 1UWXA 4WWPA 1STEA 1XLOA 4E3CA 2AL6A 4NZLB 4YSYB 4J3OD 5BMGA 1RFAA 3JU5A 4C4VB 1WWTA 3ALBA 3OWEB 1HZ6A 1KLGD 1PGBA 4KSKC 2LZ6A 3ZYYX 4II2B 2G4SA 1MHXA 4N58A 3C19A 1UGJA 1WGHA 2GRIA 2LVOA 2WP9B 2ZVOA 4MGYE 2CU3A 2WXHA 2V4IB 1YMHE 2CKHB 4BAXA 1C76A 4XGAB 2KDEB 2KMAA 4XDDA 2KNBA 1N60A 1F2RI 4EE2A 1NYRA 1SEBD 2IY1B 1YQ3B 4BKSD 3AE1B 4M02A 3SFDB 3L2EA 4F8CB 4KKIA 4WURA 2N7EA 2H89B 3I5JC 3OAWA 2Z8LA 1QF6A 2IO3B 1DOXA 1FCLA 2IDYA 3BVZA 2JYEA 3GP7A 1GC7A 2DNFA 3UIOB 3L2DA 1LGRA 1KH0A 4M00A 2WQYB 3HM6X 2D07B 4JIOU 1E8ZA 3BYYB 1SF0A 2K8BA 1WRDB 3JSVA 3ABVB 5E6NA 1TY2A 4DXFA 4I6PA 2KJRA 2VRRB 4RF6A 3I57A 1TT5B 3N30A 2NBVB 1N5XA 4RGTA 3RD2A 4OZCA 5IP4D 2V3SA 2MBBB 1V4GA 2BB6A 4LK0M 2IGDA 2PVGC 3ZDMC 4HLEA 2QEJC 1N6ZA 1PUTA 2GBNA 2WU5B 1BUIC 1T3QA 1SJED 1XLQA 2LMCA 2WU2B 4ICVA 2I2YA 1V9JA 4XDCA 1JRPA 4NJ7A 4K1RB 3SU8X 4E74A 1LO5D 5DPWA 2MWSB 3DQVA 4AJWA 2BGFA 2PPHA 2IGHA 4YXDB 1L0XB 4KGSA 4DBGA 1ET9A 2BQQA 2MJEA 5L95C 1UNSA 5IKCM 3AEAB 2O2VA
chains in the Genus database with same CATH topology
3ZXRA 2D32A 2BVCA 3LN6A 3LVVA 1F52A 4ACFA 1R8GA 2WGSA 1FPYA 1F1HA 3NG0A 2UU7A 1VA6A 3IG8A 4XYCA 2OJWA 1V4GA 2QC8A 1LGRA 4BAXA 2GWCA 3LVWA 2WHIA 4LNNA 4S17A 4LNKA 4LNFA 2GLSA 1TT4A 4LNIA 1HTQA 3IG5A 2D3BA 2D3AA 4HPPA 2GWDA 3LN7A 1HTOA 3NZTA 3ZXVA 4S0RA 2D3CA 2LGSA 4LNOA 3FKYA 2D33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZXR A;  2BVC A;  1F52 A;  4ACF A;  2WGS A;  1FPY A;  1F1H A;  3NG0 A;  2UU7 A;  4XYC A;  2OJW A;  2QC8 A;  1LGR A;  4BAX A;  2WHI A;  4LNN A;  4S17 A;  4LNK A;  4LNF A;  2GLS A;  4LNI A;  1HTQ A;  2D3B A;  2D3A A;  4HPP A;  1HTO A;  3ZXV A;  4S0R A;  2D3C A;  2LGS A;  4LNO A;  3FKY A; 
#chains in the Genus database with same CATH topology
 1N61 A;  2J53 A;  2ONQ A;  3WAL A;  3QIJ A;  2PLP A;  2C7M B;  2EKE C;  1TGZ B;  2ZCC A;  3I3T B;  1K52 A;  1QIL A;  4TV3 A;  1CQV A;  3APC A;  1S3S G;  1Y8R C;  2D3C A;  3PS6 A;  3RUI B;  1ZP0 B;  3AEE B;  2ZNV C;  2XK5 B;  4AJY B;  3U8Z A;  4XWT A;  1TKY A;  3W9C B;  3LDZ E;  1L2N A;  3M62 B;  2JU6 X;  4HJG E;  3ZIM A;  2BW2 A;  2IJ0 A;  1T0S C;  2JX5 A;  5HHD G;  5IAA C;  3AE9 B;  1C3T A;  3PV1 A;  2RSU A;  1R4M B;  2KC2 A;  4MM3 A;  4NJ6 A;  4IOI E;  1A70 A;  1PDX A;  4W9C A;  4ZDV A;  2MBH A;  2MH7 A;  2KKC A;  2KWD A;  3HK0 A;  2KYW A;  5LXI B;  1F2R C;  1WSP A;  2IO2 B;  4FJV B;  1Q5W B;  1QKZ A;  3PT2 B;  3W2D A;  1ZUD 2;  5CX3 A;  4TMA B;  1PYW D;  3TMP B;  2WXN A;  4BKS A;  5D6J B;  2V4L A;  1TJE A;  4RF0 A;  4EZL A;  4NY0 A;  2LGX A;  1I4H A;  4EKU A;  2HJ1 A;  3P2B A;  2FCN A;  2KVZ A;  1HTQ A;  4PS8 A;  3AE8 B;  1I4P A;  1VZ7 A;  3OJ4 B;  2JSV X;  3B2G A;  3DPD A;  3Q2A C;  4ZYN A;  1ZXH A;  1KF6 B;  3BVM A;  3AE2 B;  1XF5 L;  2BKR B;  5TSS A;  2BB5 A;  3KQ4 A;  4HRS A;  3VHT C;  3P4R B;  4LNI A;  4HRO A;  2NTS A;  2KJ6 A;  1RYJ A;  2WDQ B;  4BZA A;  2GMI C;  4B9K A;  2LXC A;  3FKY A;  1M15 A;  3ZNZ B;  4OZA A;  2GBM A;  3RNF C;  4W9K A;  2I1K A;  1MI0 A;  2L7R A;  1UGM A;  4GDK B;  3PPA A;  1J7A A;  2FCM A;  3CWI A;  5J17 A;  3VQI A;  3NS8 A;  3N32 A;  2KWC A;  5EE0 A;  3WAO A;  3KYC D;  4LNK A;  1OQQ A;  3Q3J A;  1S1Q B;  1WJ6 A;  4DK5 A;  2EEL A;  1F77 A;  1WM2 A;  1XO3 A;  3QHT A;  1WR1 A;  2LVQ A;  2K1F A;  1ESF A;  1WXM A;  4NAW A;  1L4Z B;  1SIJ A;  2KAC A;  2KC1 A;  4ANU A;  1QOB A;  1FO4 A;  2LHD A;  3SR6 A;  1UWM A;  2NCN A;  4K3B A;  3UIP B;  2TSS A;  1RL9 A;  3MHS D;  4M0W A;  4GXB A;  4KSL C;  3NZT A;  2O6V D;  4US9 A;  1OQY A;  3P4S B;  1R4N I;  3N9Y C;  4K7S A;  3H8H A;  2LI5 A;  3DRB A;  2BVC A;  3RNC C;  1WZ0 A;  1E5W A;  2G3Q B;  3IG3 A;  1IBX A;  4GOC A;  1EWC A;  2NTT A;  2WXM A;  1TZ1 A;  1WJU A;  3IBE A;  4WAF A;  2N1V A;  5FKA C;  2WXF A;  4A55 A;  4BOS C;  3IHP C;  4NNJ B;  2JUO A;  3ZXV A;  2N9E B;  3I63 C;  4G0N B;  1I4R A;  2MBO A;  4C7Z A;  4KVG B;  4YTM B;  2N9L A;  4BG4 B;  1K50 A;  1YIW A;  1E7U A;  4HKQ A;  1WMH B;  3DWM A;  2MBE A;  2ZW0 A;  4AS1 A;  3P63 A;  1DYQ A;  1RFK A;  3VUY A;  4A8X C;  1TY0 A;  2KMM A;  2O6V B;  3A9K A;  1JRU A;  2MX2 A;  5JHB A;  3QC8 B;  3ONS A;  3SHQ A;  3APD A;  3ZNI D;  1V81 A;  3M10 A;  2PVO D;  1GOZ A;  4BOZ B;  1WGG A;  4JWU C;  1J8C A;  1WXQ A;  2HD5 B;  4OVU A;  3QK0 A;  3JU6 A;  1V1P A;  3W1S C;  2IND C;  2L3Z A;  2D3B A;  2QIE B;  1ZGU B;  3WA0 A;  2ZEQ A;  1B1Z A;  1SBB B;  4ICU A;  2AQ3 B;  5J18 A;  1FFU A;  1SD0 A;  2CJO A;  4DWF A;  4Z9M A;  4GSW A;  1L4D B;  3B08 A;  4MH8 A;  2MQJ A;  2FBW B;  3Q69 A;  3TEZ A;  2ICI A;  4WQO B;  3MJW A;  4BHL A;  5BYS A;  3B1L X;  3CST A;  3RN9 C;  3LB8 C;  4WIP A;  3ZDT A;  5BMH A;  2NBU A;  2LGD A;  3Q14 C;  1TS5 A;  4NJC A;  4E71 A;  3QAR A;  3VH4 B;  1KOT A;  1QOF A;  1RAX A;  1JCK B;  1L6U A;  1YJI A;  3RMK C;  1V2Y A;  3OG5 A;  1WFY A;  4HDQ A;  4EZJ A;  3L4P A;  2AX5 A;  3V05 A;  2WNM A;  2HTM E;  5JH5 C;  4KIK A;  3AB5 A;  1C4P A;  2JWZ A;  1T0Q C;  2K25 A;  5IA7 A;  3HVD A;  3ZLZ A;  1ENF A;  1I4X A;  3BK1 A;  3P42 A;  5I4D A;  2XNA C;  1JWS D;  3ZQ4 A;  3L2E B;  2K5P A;  2ZCB A;  3Q8A A;  1JWM D;  2KFJ A;  5IN7 A;  4DHJ D;  3RT3 B;  3V6C B;  4ZOH C;  4GMV A;  3L54 A;  2DYO A;  2AQ1 B;  4MDK E;  1V6E A;  4GDL A;  1N63 A;  1L0Y B;  3N20 C;  3ZNH B;  2V3P A;  3A4S C;  1P50 A;  1YQB A;  5HFY A;  2WWZ A;  2X38 A;  1WF9 A;  5IO9 A;  5G2N A;  2QIL A;  4IDI A;  3TCA A;  2JWU A;  2ASQ A;  1MPE A;  1WJN A;  2KHW B;  1NI3 A;  4YL8 A;  4WQM A;  5DCN A;  2KTF A;  1KLU D;  2INN E;  4OVZ A;  4ZYS A;  2DEN B;  4X57 B;  2XEW A;  1UUP A;  3Q3N C;  4IUM B;  4W9L A;  3PHX B;  2BTE A;  3LVV A;  2YEP B;  3U52 E;  1E8X A;  2CJN A;  3AM9 A;  1WXV A;  1KJT A;  3BYT B;  4Q2J A;  4FAD A;  2W54 A;  2V0G A;  4KZ0 A;  4ZRJ A;  2QDF A;  2MW5 A;  3B9J A;  4HK2 A;  2H88 B;  3TUO A;  4CYE A;  2MHJ A;  3X0W A;  4M8N A;  3H7P B;  5G5G A;  3I9V 1;  1YNT E;  2BF8 B;  3IAS 1;  3ECI A;  2E3T A;  4EUT A;  1HE8 A;  3AE7 B;  3AE3 B;  2O2V B;  4MGZ E;  3ZNG C;  1D5Z C;  3FIL B;  4W9I A;  3Q8E A;  4N59 A;  4EOY A;  5LLI A;  2G1E A;  2L00 B;  3QCA A;  4USA A;  5DPS A;  3TIX A;  1I35 A;  4UDU C;  3PZ8 A;  1U6R A;  1GNU A;  3ZJV A;  3BK2 A;  2CR5 A;  2ZVN A;  2ZPN A;  2ZW1 A;  3TSS A;  1MVK A;  2PEA A;  3PGE A;  2AEH A;  4PS7 A;  5D3I B;  3HM3 A;  1TIF A;  4LJP B;  3RI7 C;  4HVB A;  4KKJ A;  4FA6 A;  4B0M A;  5EE3 A;  2BKF A;  5FK9 C;  1SE4 A;  4BBN C;  2KZR A;  2B76 B;  4KDI C;  5AZG A;  1FMA D;  3HIZ A;  2K22 A;  2D32 A;  1XLN A;  2NBW B;  1TYG B;  2D10 A;  1KTK A;  4MM3 B;  5E6J A;  3RYT A;  2KO3 A;  4XYC A;  2NMQ A;  1Q1O A;  3PZD A;  4DDG D;  4AWJ A;  1MHH E;  1WH3 A;  4F7Z A;  3U30 A;  2DAF A;  5T8I A;  3VUX A;  1IUE A;  1E10 A;  2INC C;  2M19 A;  1V1O A;  2N9X A;  2K0P A;  1WYW B;  1C77 A;  2W82 A;  4B95 A;  4M8M A;  1D5M C;  1IP9 A;  4URK A;  2IY0 B;  4KDL B;  4B0E A;  5L83 A;  2NPT A;  3JPZ A;  4BVU C;  2EKI A;  1HQR D;  2L52 A;  2FCS A;  4YWG G;  3RZF A;  1TS2 A;  2KFK A;  1TTN A;  2QSD A;  1GB1 A;  1RRB A;  4L2Y A;  3QQ8 B;  4A20 A;  1E90 A;  1JW9 D;  1I4G A;  3QX1 A;  4EZK A;  3KYD D;  1ZPS A;  1AW7 A;  1GB4 A;  2J42 A;  2IGG A;  2DZM A;  3H7P A;  3EC8 A;  2MEK A;  4C56 C;  2GLS A;  2WDV B;  4GU2 A;  2KDB A;  4XC2 A;  3ENE A;  3BY4 B;  3CMM B;  2GB1 A;  2RDG A;  3Q8F A;  2PKO A;  3NZU A;  4RF9 A;  3KLS X;  1EO6 A;  3FIL A;  3EFU A;  4ARI A;  4CO7 A;  4DXG A;  5E6P A;  2I1J A;  1LFD A;  2WXK A;  4WWM A;  2GWC A;  3RPF C;  2OOB B;  1CZP A;  2KQ7 A;  4F1S A;  5JHA A;  2WX0 A;  4KGT A;  4AP4 C;  5JXV A;  1XT9 B;  1WX7 A;  5E6O A;  3ZO5 B;  2WXO A;  2IZV B;  1F52 A;  4TKN A;  2G45 B;  4PK1 A;  4ZHO A;  2BYV E;  5C1Z A;  3WIM A;  3ZKJ C;  1J19 A;  1K53 A;  2KT7 A;  2LEK A;  3SDL C;  4NAW B;  3AE4 B;  4IC7 B;  1GJZ A;  1P0R A;  3AU5 A;  1VJK A;  2L1A A;  3LN7 A;  2K8C A;  4M0W B;  2IO0 B;  4TUU A;  1E9M A;  3VTV A;  1VZ6 A;  1IYF A;  4BKT A;  2KK8 A;  3BVG A;  3O13 A;  2LGY A;  4NQK E;  4GB9 A;  3PHW B;  2KAN A;  1NYQ A;  5DPT A;  4NAM A;  3P4Q B;  1IBX B;  2MCN B;  4GGQ A;  1TBE A;  4MEM A;  5C3J B;  1NEK B;  5CHW A;  1WX8 A;  2JZ3 B;  2KWU B;  4AM1 A;  2JYT A;  4JGH B;  2SEB D;  4HJK A;  1QK1 A;  2HE7 A;  1ZDV A;  1V5T A;  4LNF A;  2L8J A;  1SE9 A;  1WGR A;  4S0R A;  4OW0 A;  3GS2 A;  2CHX A;  3N3K B;  2KDI A;  3A9K B;  3AN1 A;  2ZPY A;  1R8G A;  2LFI A;  3URY A;  2RPV A;  2J0M A;  3M63 B;  1VA6 A;  2KX0 A;  3DBR B;  4HPL B;  3DHI C;  3RFZ B;  1GG3 A;  5AZH A;  2EMS A;  1HA5 A;  1SB3 C;  1EF1 A;  1R4M I;  1FXI A;  4GLS C;  3DBL B;  2G4D B;  1WGY A;  1V1P B;  2OHF A;  2D33 A;  1FRR A;  2VZK D;  4K7U A;  3VDZ A;  3NS1 A;  1I7H A;  2NVU I;  1ISN A;  2W3R A;  1AAR A;  2K6Q A;  2M4N A;  1BML C;  4JL9 A;  1J7B A;  4IM3 A;  3PLU A;  4MGI E;  3W5V B;  3AEB B;  2JRI B;  4P16 A;  2R61 A;  4I6L B;  3L16 A;  4IWO A;  2JVC A;  2SAK A;  1XLP A;  2CS4 A;  1UD7 A;  3UF8 A;  4RNA A;  3FAH A;  3UGB B;  1ZW7 A;  2KXJ A;  2J0J A;  2KD0 A;  4QAY A;  2WXI A;  3JW0 X;  2KWV B;  2J52 A;  4N9F 4;  5HG2 A;  2LVP A;  4LDT D;  2BYE A;  1NEN B;  1PGA A;  1D5X C;  2KTR B;  1FD6 A;  5BYQ A;  1TS3 A;  3RNE C;  2BS2 B;  3P4P B;  1F9J A;  3WAM A;  3N1Y C;  1WI0 A;  5FR6 A;  3DBR I;  1FNV A;  3T3N A;  4LLG M;  4RM9 A;  5D94 A;  3V62 A;  1YD8 U;  4KIK B;  3A4R A;  2EMT A;  5AUK A;  2KJH B;  3B2F A;  2PE6 B;  1TT4 A;  2NR2 A;  5GMV A;  5G55 A;  4II3 B;  1SXT A;  2BYF A;  1VD2 A;  4RF1 A;  2I38 A;  2J1Q A;  3ZTC A;  2C7N B;  3BII D;  2JZP A;  4LDT B;  4RF7 A;  2CRK A;  4NPN A;  3LVW A;  2ZJD A;  1JML A;  2WYQ A;  2XN9 C;  5C23 A;  4GDL B;  1SSN A;  4RMA A;  1MG4 A;  2BT6 A;  3M95 A;  4A3O A;  4L1B A;  2JT4 B;  2YLM A;  3DVN U;  2IYD B;  5AZF A;  3A9J A;  1XD3 B;  3SFE B;  2MRP A;  2XBB C;  2LWP A;  2Y3A A;  3EFC A;  1JAL A;  1MJD A;  1P3Q U;  3IG5 A;  3DBS A;  4GN1 A;  5C2T B;  4KV2 A;  3PTF C;  3M3J A;  1NI2 A;  1F0Z A;  2V1Y A;  3TEY A;  4ITK A;  2MA9 B;  1CRK A;  1GAQ B;  3AV8 A;  4D2K A;  3ZRC A;  3ZTD A;  1I42 A;  2LAS A;  2GBK A;  3ZW3 A;  1YJ1 A;  3TBL D;  3V3X A;  1E6E B;  2LRW A;  4J6I A;  1QLB B;  4HPP A;  2JF5 A;  3AH7 A;  4AOF A;  1GC6 A;  3IAM 1;  4G3X B;  2MBQ A;  1ZKH A;  3LN6 A;  2AQ2 B;  3HHM A;  3ZVV A;  3C0R B;  1XCT L;  4PYZ A;  3L0W B;  3R7Q A;  1T0R C;  4JPS A;  2E6X A;  1HZ5 A;  2KTR A;  5H92 C;  5BO4 B;  2K6D B;  4HKZ E;  3UI3 A;  5LXH A;  4LNN A;  4P7I A;  3DBH B;  4KX6 B;  3A1Q A;  2GBR A;  3NVW A;  2JXT A;  1D4B A;  2LGS A;  4BBN F;  1EM7 A;  2L05 A;  3JVZ X;  3PVL A;  4M01 A;  1WE7 A;  2L32 A;  4MEL A;  2L0F A;  1T5X D;  3MFG A;  1X1M A;  3KUD B;  4US8 A;  3N1Z C;  4IKG A;  1QH4 A;  4DQO C;  1P7F A;  2DZI A;  2DWQ A;  3IXS A;  3W1Y A;  1P7E A;  4I6N B;  5CHF A;  1N62 A;  2Q5W D;  2HTH A;  1VRA B;  3SEB A;  4XE0 A;  4W9E A;  2BYT A;  4WJO A;  5MPO A;  3L13 A;  2PMV A;  2Z0D B;  1C78 A;  2A5U A;  3IVF A;  2IO1 B;  1ZXI A;  1QT9 A;  3MHZ A;  3R8B A;  1WY8 A;  2G9H D;  1YN4 A;  4DDI D;  2N9P C;  2BS4 B;  3NVV A;  1NDD A;  4HCN B;  1FCC C;  4HWI B;  5EDS A;  4KGR A;  1V8C A;  4G50 A;  1XCQ L;  1Y56 A;  4YT0 B;  3V6E B;  4RGO S;  2PTL A;  5GXG B;  1FEH A;  3VRA B;  3NZ3 A;  3Q3F A;  1JWB D;  2LJI A;  5J99 A;  3DBH I;  3MC9 A;  1E8Y A;  3WCQ A;  2MP2 B;  3ETR A;  3MC0 B;  2V9H A;  2NPT B;  3L10 B;  2KX3 A;  3RCZ A;  1A5R A;  3PRZ A;  2KFK B;  3ZXR A;  2DBY A;  4A9A A;  4DHJ B;  2N1W A;  3NG0 A;  2M0X A;  2QHO A;  3R3M A;  2K3U A;  3O65 B;  2Y5C A;  1WXS A;  2W55 A;  2FNJ B;  4O1N A;  4P1C C;  3AEC B;  3VH3 B;  5BMI A;  1V49 A;  3B6R A;  2MLB A;  4GW0 A;  2WXP A;  4A6Q A;  4N6E B;  1DGJ A;  2CU1 A;  1AWD A;  4ACF A;  1P9D U;  3ML9 A;  1VLB A;  2WDT B;  3ML8 A;  4TSS A;  3NOB A;  4A3P A;  3KWV A;  5J9A A;  1R7S A;  2C5L C;  1WE6 A;  2M0A A;  5D3D A;  1RWS A;  1EF5 A;  4FXC A;  2GBJ A;  2K8H A;  1WX9 A;  4DXA B;  2WHI A;  2WDR B;  1G6J A;  3BZD B;  3DDC B;  2DHZ A;  3APF A;  5KHO A;  2N7D A;  3R2I A;  1SGH A;  3AE5 B;  1WIA A;  4MT5 A;  4YTP B;  1VZ8 A;  3C8Y A;  3JQ3 A;  2QJL A;  4GVY A;  2YVC A;  4HEA 1;  4YTN B;  3VTW A;  2JZZ A;  2GI9 A;  4IM2 A;  2PJH A;  5JZE B;  1FM0 D;  1DOY A;  4YSX B;  1XEE A;  2M17 A;  4MH0 E;  3DOW A;  2QCZ A;  1CJE A;  1JWA D;  4WWO A;  2QC8 A;  1J7C A;  5HI1 A;  3RZW C;  4RF8 A;  5CTR C;  3EHV A;  1WZ3 A;  2R2O A;  1RLF A;  2YEP F;  3NZS A;  3HVZ A;  3V61 A;  2INP E;  3AXC A;  1P98 A;  3WAP A;  2PW9 A;  2KN4 A;  4MAC A;  4C80 A;  4ZRK A;  1IGC A;  4W9G A;  2M56 B;  3IG8 A;  2N9K A;  1E8W A;  2D2Q A;  1YX6 B;  2M1M A;  1OTR B;  2MP2 A;  2JRH A;  3GE3 C;  2BS3 B;  2RDB C;  1L7Y A;  1ACC A;  1OGW A;  4S17 A;  4JWS C;  1M4V A;  1NBF C;  2WXJ A;  1NVI D;  2FUG 1;  2KN5 A;  2NS5 A;  3EUB 2;  2AYO B;  1H4R A;  3NRZ A;  2X8X X;  3AU4 A;  3T3O A;  2RR9 A;  5D2M B;  1N5W A;  2KDF B;  2Z0E B;  3WAN A;  1V97 A;  1E0Z A;  4YSZ B;  1Q0W B;  1FNW A;  1YN5 A;  3CSF A;  4OZB A;  3KH0 A;  3TEX A;  4REZ A;  3AUL A;  3PZ7 A;  4ANX A;  3H7S A;  3ZUN A;  1G0W A;  4RCO A;  1PGX A;  4LNO A;  3GB1 A;  1YOV B;  3TL5 A;  3AE6 B;  3UIN B;  4EFO A;  3VR9 B;  5LNK 1;  1V5O A;  1P52 A;  1PQS A;  2UU7 A;  3DWG C;  4C4V A;  1PFD A;  4HXD A;  1E7V A;  1ET6 A;  3J9C A;  4PT5 A;  1VR9 A;  4C00 A;  3DVN V;  2IPK D;  4ZRP A;  3PRP B;  4FBJ B;  2BWE S;  5HKH A;  2WXL A;  4RH6 A;  1HXY D;  4W9F A;  2DYB A;  3PRE A;  1WXA A;  4FJY A;  3L08 A;  3VXW A;  2N7J A;  4DHZ B;  2BPS A;  4XX5 A;  2JQR B;  3DHH C;  2DZJ A;  3NVY A;  2A4Z A;  4RM8 A;  3HRD D;  2WS3 B;  3DVG Y;  2W9N A;  4WJN A;  4JQW C;  2DAJ A;  1UF0 A;  2RGF A;  1L6V A;  1BXT A;  2KLC A;  2LUE A;  2KDM A;  3MJ5 A;  5J2R A;  1JQ4 A;  2LD9 A;  4IG7 B;  2M8S A;  3Q3M C;  3LJ3 A;  1ROE A;  1Q10 A;  2FAZ A;  3N1X C;  4W9H A;  1J0G A;  1DOI A;  2KAJ A;  1KLV A;  3RNA C;  5EE9 A;  3GZN B;  1B9R A;  2LUM A;  1UH6 A;  3PO0 A;  4XWW A;  1FXA A;  2DX5 B;  3RUL A;  2WGS A;  3DRE A;  1D6E C;  4LCD E;  3H6N A;  3DVG X;  3E9S A;  1SE2 A;  5G5H A;  2LRU A;  1EWY C;  3AI5 A;  4FHJ A;  2WXR A;  1C4A A;  2D3A A;  1H8C A;  3PSE B;  3NY5 A;  2N0S B;  2KOX A;  1K8R B;  1CK1 A;  2ON8 A;  1QOA A;  1EU4 A;  3UQB A;  4FUL A;  2JY6 A;  2AWT A;  1EU3 A;  1T6B X;  1C79 A;  1L0V B;  3GOE A;  3A9J B;  4NQL B;  2RMM A;  4JLC A;  4ANW A;  1XQQ A;  3TJP A;  1R4N B;  3T9L A;  2D5G A;  3DHG C;  4MJS B;  2L0T A;  2FCQ A;  1T0Y A;  4H2A A;  4IWP A;  2QMT A;  3BIN A;  1C4C A;  3VAW A;  1OEY A;  2UWQ A;  1UBQ A;  3GZN I;  4JE3 B;  2ZZP B;  4GW2 A;  1UZX B;  1FIQ A;  3W1S A;  4JX1 C;  2KVR A;  2VH1 A;  3U4E G;  3Q8B A;  3MTN B;  3AEF B;  4C7Y A;  1GUA B;  1LQB A;  2KMC A;  2RD0 A;  4K3C A;  3LXF A;  4G11 A;  3VRB B;  4Q2R A;  4ASW C;  4GIV A;  1YJJ A;  2CHW A;  2XK5 A;  3VFK A;  3U2S C;  1IGD A;  3RNG C;  2JPH A;  1WR6 E;  5CHV C;  3A1Q B;  2VZK B;  2KLG A;  3KUC B;  2FE8 A;  3VUW A;  1SJH D;  4BKG A;  1FPY A;  4CQN A;  3IT6 B;  2RPQ A;  2BWF A;  1QOG A;  4B6W A;  4XZ4 A;  1SE3 A;  3OLM D;  1VRP A;  3Q8C A;  1OFF A;  1LXD A;  4HCP B;  1C1Y B;  3Q3O C;  3DBL I;  3ZRF A;  3QA8 A;  1BG0 A;  2RDH A;  2LGI A;  3H1U A;  4A90 A;  3Q6B A;  2LHE A;  3R7R A;  1K51 A;  2BBC A;  2DYM A;  1OEY J;  2ACZ B;  1I4Q A;  4LJO B;  1U4A A;  2DLB A;  3HUI A;  3W5U B;  1GPX A;  4WAA A;  2WX1 A;  4ANV A;  1AYF A;  1JRO A;  2Y5B B;  2FID A;  4FLH A;  2OJR A;  3B0A A;  4OVV A;  3EA6 A;  2KQ4 X;  4L23 A;  2DZK A;  1BT0 A;  1ZDX A;  1C9F A;  1FXT B;  4RGM A;  3TEW A;  1P1A A;  4WJP A;  2WXG A;  1EUV B;  4KZC A;  3R2T A;  3RNB C;  3VTU A;  5IOI A;  1F1H A;  2OED A;  1XXG A;  1Z2M A;  1WGD A;  4ARC A;  3ZJU A;  4TQ1 A;  1ZOY B;  2Z59 B;  3PRM B;  5AUI A;  5FR3 A;  1JWU D;  4TQ0 A;  3X23 A;  4BFR A;  4ZHP A;  1LM8 B;  3A33 B;  2WLB A;  4MJS A;  4W9J A;  3K9O B;  1D3Z A;  2LJ5 A;  4EEW A;  3U7D A;  2C60 A;  5KHQ A;  3PLV A;  1IPG A;  1WRI A;  4WWN A;  4W9D A;  1WJ4 A;  2L83 A;  2FUH B;  1KRH A;  1FFV A;  2VH2 A;  3JYU A;  2D3G A;  1WM3 A;  1UEL A;  2CHZ A;  4PYU A;  3KVF B;  2J0K A;  1M94 A;  1QZE A;  1WGK A;  4GDK A;  4RFB A;  1Z5S B;  3V60 A;  4FJZ A;  1YX5 B;  3KWL A;  2REX A;  3R66 C;  1FRD A;  5DPR A;  2L76 A;  3EEC A;  3CF6 E;  2K39 A;  3P1M A;  2HJ8 A;  4WH4 A;  3U7Z A;  3QJZ A;  4MSQ B;  1MG8 A;  3E56 A;  3ZJT A;  3FC4 A;  2K9X A;  1KFY B;  3EGR A;  2V3N A;  2UYZ B;  2MJD A;  4P6V F;  3OJ3 A;  4IWQ A;  3NUH B;  5D7G A;  5H8Y E;  1SIF A;  3KW5 B;  2FIF A;  4IM0 A;  3AMZ A;  3L17 A;  2N4F A;  3BWU D;  3NJT A;  3AEG B;  4K81 A;  2PIA A;  1TKG A;  1AN8 A;  3GE8 C;  1VCB A;  2C9W B;  1UBI A;  3SD5 A;  2C7H A;  2GOW A;  3H9D A;  3MP9 A;  1RM6 C;  4HDO A;  1WYG A;  3VVW B;  4FHK A;  1E7P B;  4AUQ C;  1OQR A;  5TR5 A;  2ZNV B;  4ZRQ A;  3VR8 B;  2PE9 A;  1HTO A;  2J4X A;  5AEK B;  1MFW A;  1I0E A;  4BG4 A;  1HEZ E;  2HDE A;  1WMH A;  3D32 A;  4AQ7 A;  2J7Q B;  3LYY A;  4IW0 A;  1CMX B;  4CHK A;  2OJW A;  1V80 A;  3IFW B;  2WXQ A;  2O6V A;  2B3A A;  1TS4 A;  4WJQ A;  4MGK E;  4ZRI A;  2LXA A;  3QAQ A;  3ZGZ A;  2R2Q A;  4R3D A;  4GVZ A;  1V86 A;  1L5P A;  4HPM B;  4MSM B;  3JSV B;  2W3S A;  2KQS A;  1VDV A;  2D11 A;  3IT4 B;  3S2A A;  2Y5P A;  4OHJ A;  1KM7 A;  2MSE D;  4DHZ E;  5EE1 A;  3UQA A;  2JXX A;  3DCG A;  4RGN A;  3K9P B;  5BYR A;  2AL3 A;  1ZE3 D;  1TKE A;  3CIR B;  2MJ3 A;  1YN3 A;  3NHE B;  3T8M A;  1QQR A;  4K7W A;  2GWD A;  2IBI B;  3QWZ B;  3NVZ A;  4PS3 A;  1YQ4 B;  4P1B C;  3MC8 A;  1TZO A;  1FNU A;  4FN2 A;  3KUZ A;  4LTU A;  3AED B;  1UWX A;  4WWP A;  1STE A;  1XLO A;  4E3C A;  2AL6 A;  4NZL B;  4YSY B;  4J3O D;  5BMG A;  1RFA A;  3JU5 A;  4C4V B;  1WWT A;  3ALB A;  3OWE B;  1HZ6 A;  1KLG D;  1PGB A;  4KSK C;  2LZ6 A;  3ZYY X;  4II2 B;  2G4S A;  1MHX A;  4N58 A;  3C19 A;  1UGJ A;  1WGH A;  2GRI A;  2LVO A;  2WP9 B;  2ZVO A;  4MGY E;  2CU3 A;  2WXH A;  2V4I B;  1YMH E;  2CKH B;  4BAX A;  1C76 A;  4XGA B;  2KDE B;  2KMA A;  4XDD A;  2KNB A;  1N60 A;  1F2R I;  4EE2 A;  1NYR A;  1SEB D;  2IY1 B;  1YQ3 B;  4BKS D;  3AE1 B;  4M02 A;  3SFD B;  3L2E A;  4F8C B;  4KKI A;  4WUR A;  2N7E A;  2H89 B;  3I5J C;  3OAW A;  2Z8L A;  1QF6 A;  2IO3 B;  1DOX A;  1FCL A;  2IDY A;  3BVZ A;  2JYE A;  3GP7 A;  1GC7 A;  2DNF A;  3UIO B;  3L2D A;  1LGR A;  1KH0 A;  4M00 A;  2WQY B;  3HM6 X;  2D07 B;  4JIO U;  1E8Z A;  3BYY B;  1SF0 A;  2K8B A;  1WRD B;  3JSV A;  3ABV B;  5E6N A;  1TY2 A;  4DXF A;  4I6P A;  2KJR A;  2VRR B;  4RF6 A;  3I57 A;  1TT5 B;  3N30 A;  2NBV B;  1N5X A;  4RGT A;  3RD2 A;  4OZC A;  5IP4 D;  2V3S A;  2MBB B;  1V4G A;  2BB6 A;  4LK0 M;  2IGD A;  2PVG C;  3ZDM C;  4HLE A;  2QEJ C;  1N6Z A;  1PUT A;  2GBN A;  2WU5 B;  1BUI C;  1T3Q A;  1SJE D;  1XLQ A;  2LMC A;  2WU2 B;  4ICV A;  2I2Y A;  1V9J A;  4XDC A;  1JRP A;  4NJ7 A;  4K1R B;  3SU8 X;  4E74 A;  1LO5 D;  5DPW A;  2MWS B;  3DQV A;  4AJW A;  2BGF A;  2PPH A;  2IGH A;  4YXD B;  1L0X B;  4KGS A;  4DBG A;  1ET9 A;  2BQQ A;  2MJE A;  5L95 C;  1UNS A;  5IKC M;  3AEA B;  2O2V A; 
#chains in the Genus database with same CATH homology
 3ZXR A;  2D32 A;  2BVC A;  3LN6 A;  3LVV A;  1F52 A;  4ACF A;  1R8G A;  2WGS A;  1FPY A;  1F1H A;  3NG0 A;  2UU7 A;  1VA6 A;  3IG8 A;  4XYC A;  2OJW A;  1V4G A;  2QC8 A;  1LGR A;  4BAX A;  2GWC A;  3LVW A;  2WHI A;  4LNN A;  4S17 A;  4LNK A;  4LNF A;  2GLS A;  1TT4 A;  4LNI A;  1HTQ A;  3IG5 A;  2D3B A;  2D3A A;  4HPP A;  2GWD A;  3LN7 A;  1HTO A;  3NZT A;  3ZXV A;  4S0R A;  2D3C A;  2LGS A;  4LNO A;  3FKY A;  2D33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...