2OJWA

Crystal structure of human glutamine synthetase in complex with adp and phosphate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
366
structure length
360
Chain Sequence
YFQSMASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamine synthetase
publication title Crystal structures of mammalian glutamine synthetases illustrate substrate-induced conformational changes and provide opportunities for drug and herbicide design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 110
structure length 360
sequence length 366
chains with identical sequence B, C, D, E
ec nomenclature ec 2.3.1.225: Protein S-acyltransferase.
pdb deposition date 2007-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00120 Gln-synt_C Glutamine synthetase, catalytic domain
A PF03951 Gln-synt_N Glutamine synthetase, beta-Grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.70 Alpha Beta Roll Ubiquitin-like (UB roll) Glutamine synthetase, N-terminal domain 2ojwA01
3.30.590.40 Alpha Beta 2-Layer Sandwich Creatine Kinase; Chain A, domain 2 Creatine Kinase; Chain A, domain 2 2ojwA02
1HTQA 2UU7A 4BAXA 2WGSA 4LNIA 2BVCA 2OJWA 4HPPA 1LGRA 2QC8A 2GLSA 1HTOA 2D3AA 3ZXRA 4S0RA 4ACFA 3FKYA 4XYCA 2D3BA 3NG0A 3ZXVA 2WHIA 2D3CA 4LNFA 1F1HA 2LGSA 4LNNA 4S17A 1FPYA 1F52A 4LNOA 4LNKA
chains in the Genus database with same CATH superfamily
1TZ1A 4M8MA 4GW2A 2BYFA 3IG5A 1N61A 5CHVC 4Q2RA 2C7HA 1YIWA 1HZ6A 2PMVA 2NBWB 4IWOA 4C4VA 2MW5A 4EE2A 3MC8A 1G0WA 5IA7A 3AE7B 2H88B 3B1LX 3DHHC 3JU6A 4ACFA 1WXSA 2D3BA 3JPZA 2AX5A 3AE4B 1SIJA 2REXA 3L17A 2WXMA 3C0RB 4RM8A 3K9OB 2DHZA 2ON8A 4WWOA 2IZVB 4HVBA 1TS5A 4C00A 1JALA 3HHMA 2ZEQA 3WIMA 3E56A 2LXAA 1XT9B 4GDKB 3BWUD 2FAZA 3AECB 1VZ7A 3NVYA 1N6ZA 3P4QB 2N7DA 5GXGB 3QWZB 1NYQA 1RLFA 3ZDMC 1WXQA 5LLIA 2BWES 1JQ4A 3HK0A 4IM3A 3JVZX 4WQOB 3R2IA 2QJLA 1LM8B 1E7VA 1AWDA 4KDIC 4XC2A 3P42A 4RF0A 4MGYE 4D2KA 1KLUD 4KDLB 3APDA 2WWZA 4AQ7A 2G9HD 4TSSA 4MH8A 4ZRKA 3A4SC 1LGRA 1P50A 2PIAA 3Q3NC 3KVFB 4ANXA 4OVZA 3V61A 3ETRA 1TT5B 2PTLA 2MBOA 4DDID 5FR3A 1HZ5A 1TS3A 3LVWA 4ANUA 4ZYSA 3L2DA 3NY5A 1PUTA 1ISNA 4LDTD 2IDYA 1VZ8A 4HDQA 3ZKJC 4LLGM 1D4BA 4AWJA 2KK8A 1SJED 2V3SA 2M1MA 1YNTE 2JYTA 2GBMA 4OVUA 4XZ4A 1L4DB 4EUTA 4C7ZA 4MM3B 4YSXB 1OTRB 3SEBA 1YN4A 2QEJC 4FJVB 2R61A 2WXQA 4KX6B 3PO0A 1J8CA 1WSPA 1ROEA 3NZ3A 4IWPA 3RMKC 4EZJA 2L1AA 3MP9A 4KKIA 3A9KA 3ZNID 1QOAA 3AE8B 2IYDB 5DPRA 1PQSA 4JLCA 2KWCA 3J9CA 1QT9A 1V4GA 4IDIA 3T9LA 4BBNC 5BYSA 1F52A 2KT7A 4XGAB 4LJPB 3E9SA 2B76B 1WYGA 1JW9D 1I4PA 2KN5A 5C23A 2W54A 3B08A 4RGNA 2BPSA 1V81A 3PHXB 3GS2A 4NJ6A 3ZJVA 4PS8A 3TEZA 3V6EB 2KO3A 3PLVA 2ACZB 1WRDB 3NUHB 3WAMA 1FRDA 1L6VA 4YXDB 1EM7A 1TY2A 3Q14C 2KWVB 1XLOA 2L7RA 1IGDA 2DLBA 1HTQA 1JWAD 1SEBD 2D5GA 2WXOA 1V9JA 2HD5B 2MBQA 1E90A 4NJCA 2W3RA 3BY4B 4XX5A 1WE6A 1QZEA 3PRZA 3W1SC 1FXAA 3QCAA 4GMVA 1K8RB 2QC8A 1SE9A 2FBWB 1CQVA 4IKGA 1VJKA 1NEKB 1IGCA 2W3SA 2UYZB 2BKFA 3H1UA 1D5XC 3ZQ4A 2WXHA 2PE6B 5CHWA 4GN1A 2AQ1B 2OJWA 2M19A 4PK1A 3RZWC 1VR9A 1F2RC 2BS3B 4GIVA 3JQ3A 2AL6A 3L2EB 4MGZE 5J2RA 4DHZE 2CRKA 2M56B 2PLPA 5EE9A 2BGFA 2JWZA 2KYWA 1A70A 2BWFA 1WJ6A 2GOWA 1OEYJ 4A55A 3TL5A 1R4MI 3TEXA 1P1AA 2IO3B 4KKJA 1FXIA 2LXCA 2G1EA 3RNBC 1MVKA 3Q6BA 4AP4C 1V1PA 2KWUB 5JHBA 2WHIA 1GB1A 4HCNB 3TSSA 4W9LA 3AU4A 2HTHA 2LASA 3VUXA 2WNMA 1UELA 3T3NA 1YX6B 1WRIA 2EMTA 2N0SB 2MLBA 4OHJA 3N30A 2KJRA 3GP7A 1M15A 3IG3A 4FULA 4BG4A 2KOXA 2G4DB 1CZPA 4K7WA 2AWTA 2I1KA 2KC1A 3L4PA 4WURA 2FCNA 2DAFA 4M02A 4W9CA 4F8CB 1OEYA 2K6DB 3ZUNA 1X1MA 3M62B 3VR8B 1DOXA 2DNFA 4RF1A 5JXVA 4KIKB 2IGHA 3PRMB 2MHJA 4WWNA 2DYMA 3Q8BA 4HKZE 2KX0A 4WH4A 4S17A 4HDOA 3P1MA 1UZXB 1XLNA 1KRHA 2JYEA 4PS3A 3IXSA 1GUAB 2KTFA 4H2AA 1GC7A 3HVDA 2KD0A 2XK5A 3NVZA 2JU6X 2VZKB 2W82A 1F1HA 3RPFC 2W9NA 3GOEA 2JF5A 4J3OD 4O1NA 2MWSB 1ZXHA 3LN7A 4AUQC 1R7SA 1L4ZB 2BVCA 2JZPA 4JGHB 1NDDA 4URKA 1JWBD 2K25A 2MJDA 3IVFA 5BYRA 4KSLC 1XCQL 2DBYA 2J0KA 1JRPA 4GGQA 3KQ4A 2BF8B 3B0AA 2NBUA 2FCQA 3VHTC 4DQOC 1GPXA 2WXPA 3VTUA 2GMIC 1E9MA 4L2YA 3DPDA 1SGHA 2LMCA 3BYYB 3U52E 4E3CA 4Q2JA 1AW7A 3AEFB 2LVOA 4KZ0A 1WGRA 3RULA 4G11A 3TEWA 2LVPA 1T6BX 4HWIB 2CJNA 1FNUA 1SBBB 1T0SC 1WE7A 1XXGA 2C60A 2XBBC 3B2GA 4HCPB 2L00B 4ZOHC 3RFZB 4BOSC 1D5MC 1A5RA 3PRPB 3GZNB 4DHJB 2GI9A 3U8ZA 1P52A 1HTOA 2RPQA 2VH2A 4MSQB 1LXDA 3VTWA 3BYTB 1GAQB 5BMHA 4KV2A 2WLBA 4LK0M 4DXGA 2IPKD 3DBSA 3AN1A 1YQBA 1ZUD2 3ZJTA 2D10A 4GDKA 5I4DA 2BBCA 2KVZA 1VZ6A 2ZZPB 4LNKA 4RF8A 1TY0A 1C76A 3P4PB 1WR1A 2NTTA 3O65B 2V4IB 1K50A 1WFYA 1ZW7A 4KSKC 4BKGA 2ICIA 3H8HA 3BINA 1NBFC 4G3XB 4IC7B 4IW0A 5H8YE 2R2QA 4LNFA 2LGSA 4LNNA 2CR5A 2L76A 3NOBA 3KW5B 4LDTB 4RNAA 5AZGA 1JCKB 1WY8A 3BK1A 4MDKE 4W9KA 1V2YA 2HDEA 2J52A 2KDFB 2FCSA 5J18A 4FJZA 2LUMA 1L6UA 3MJ5A 3ZNZB 4RGTA 4A8XC 3WANA 4FHKA 1PYWD 4OZAA 4YSZB 4EOYA 2D33A 4GOCA 1J0GA 3ZLZA 1I0EA 3ABVB 2MCNB 1ZDXA 1QQRA 2J0MA 2DZIA 1WXAA 3DBRI 3RN9C 4NQLB 5C3JB 4DBGA 3X0WA 1FIQA 3OJ4B 1EU3A 1ZDVA 3AI5A 4F1SA 3JSVB 2BB6A 2KC2A 1WF9A 2L8JA 3IT4B 2RDGA 4NAMA 4W9GA 3PV1A 4QAYA 1I35A 2KMMA 1WZ0A 3FILB 3W5UB 3ZIMA 4IWQA 4W9JA 1YQ3B 1FXTB 1H4RA 2L52A 3HM6X 3K9PB 3KUDB 4RGOS 1YJJA 2IO0B 4JQWC 4FLHA 1GJZA 4MM3A 2LD9A 3LYYA 2HE7A 3EHVA 3PZDA 1M94A 3IG8A 1I7HA 3GE8C 4GVZA 1CJEA 3Q3OC 3EECA 1XO3A 3LN6A 4ICVA 2DX5B 1WJ4A 2O6VB 3KUZA 2MH7A 3VUWA 2QMTA 4RH6A 2D07B 1N63A 4BOZB 1FM0D 2KZRA 4KZCA 3IFWB 4ARCA 1CK1A 2KDMA 4WJNA 2A4ZA 1EF1A 4WQMA 1C77A 2CS4A 3R2TA 3ML9A 3OG5A 2KJ6A 2WDRB 1F77A 2H89B 3L16A 4HJKA 2K8CA 3GB1A 3MC9A 1HXYD 2JQRB 1IUEA 2KN4A 2KQSA 2VH1A 2JWUA 2FNJB 1P98A 4W9HA 4BAXA 3NZUA 5FK9C 4LCDE 3OJ3A 4M0WB 2QILA 3P2BA 1ZE3D 1FMAD 4YSYB 2WXNA 3A4RA 2KQ4X 3EFCA 2AL3A 2N9KA 2N1VA 3VRAB 3EA6A 1WZ3A 2N9LA 1YQ4B 2LGYA 5D2MB 3CF6E 1OGWA 4ZHOA 1EO6A 1C4PA 4K3CA 5IAAC 4FJYA 4HXDA 1L0VB 4OZBA 2SEBD 3LVVA 4JE3B 2IY1B 1EF5A 3DHGC 1T0YA 1C9FA 4RM9A 3Q3FA 5L95C 3GE3C 4Z9MA 3KLSX 3QC8B 3TMPB 3X23A 3CMMB 2A5UA 1RM6C 3L2EA 4MELA 2PPHA 1QH4A 2WU2B 1IBXB 2WXRA 3RNGC 2JSVX 4P16A 3RNAC 3DBLI 2CU1A 5FKAC 4ITKA 2MP2B 1YOVB 4KGRA 2ZPYA 1YN3A 5IOIA 3DWGC 2LVQA 5DPWA 1MHXA 2N7JA 2DZJA 1FNWA 2GLSA 1NI3A 3VH3B 5D3IB 1I4QA 3TCAA 4JX1C 4YWGG 3AM9A 2WXFA 1LQBA 2C5LC 3QARA 4REZA 3WAOA 5AUIA 1IP9A 4ZYNA 3FAHA 1IPGA 3N9YC 3AXCA 2IY0B 5G2NA 5LXHA 1OQQA 4OVVA 1P7EA 2X38A 3VUYA 1F9JA 1NENB 2INCC 4JWSC 3LB8C 2PVOD 1RL9A 2FCMA 4AOFA 2RPVA 2EKEC 1HA5A 2YVCA 2CHWA 3MHSD 2IO1B 3IBEA 1HQRD 2J1QA 1ACCA 1VA6A 2EKIA 1I4RA 4LJOB 4ANWA 4NPNA 2N9EB 3DHIC 5CTRC 1VRPA 2E3TA 1BUIC 4K7SA 2N1WA 2INNE 4KIKA 2YEPB 2FIFA 2MBEA 3ZW3A 1UGJA 4W9IA 5DCNA 2DAJA 1WJUA 2V3NA 4E71A 3C19A 4FA6A 4ZDVA 4HEA1 1J19A 1KF6B 2MBHA 3SFEB 2K0PA 2NPTB 2I38A 1TTNA 3UQAA 3QA8A 4LTUA 2BYVE 1E7UA 2OOBB 4BBNF 5EE1A 2KDEB 2JXXA 4MGKE 3N20C 1R4MB 2AQ3B 2LWPA 2SAKA 2B3AA 3PS6A 1FCCC 3TJPA 2ZJDA 4MH0E 2J7QB 1VCBA 4EZKA 2DWQA 3ZNHB 2KNBA 4MACA 3AU5A 3DWMA 2OHFA 3U7DA 2GRIA 3SU8X 2KLCA 3VFKA 3Q8CA 1CRKA 2RGFA 3TUOA 3DRBA 3SD5A 1L0XB 2WDVB 2HJ8A 1MHHE 3H9DA 3RI7C 2C7NB 4L23A 5GMVA 5BMGA 2BYTA 1AYFA 3AH7A 2G45B 1FD6A 3P4RB 4K1RB 4S0RA 2ZW1A 4GLSC 3NG0A 4HRSA 4IUMB 4ICUA 4ZRPA 2LI5A 4DDGD 1E8YA 1SB3C 4LNOA 2Y5BB 3ZJUA 2ASQA 2K1FA 2BYEA 1L7YA 3L0WB 3KH0A 3V62A 3L13A 1DYQA 3IAM1 4CQNA 2LGIA 3ZRCA 1T3QA 4US9A 1UH6A 2KJHB 4PS7A 3EFUA 4YL8A 2N9XA 1QOGA 1TZOA 5E6PA 1SE3A 2KLGA 1JMLA 3A1QB 3AEBB 5FR6A 3ML8A 1YX5B 5LXIB 1HEZE 4NY0A 1QF6A 4HKQA 2WXJA 1V5OA 4N6EB 2NCNA 2MX2A 2K9XA 3AE5B 3JW0X 1UWMA 5AUKA 2PEAA 3PHWB 2JVCA 1T0QC 4BFRA 4XDDA 1WXVA 1Z2MA 2MA9B 3UF8A 1XCTL 3TBLD 3B2FA 4I6PA 3ALBA 5IN7A 1E8ZA 2ZNVC 3W1YA 2V1YA 2LGXA 3RNFC 4P1CC 4XE0A 2N4FA 4WAAA 4TQ0A 2Z59B 4BKTA 4HK2A 2C9WB 3DVGY 5T8IA 2Y5CA 2NTSA 3W9CB 2XEWA 4FADA 4GU2A 3QQ8B 1SE2A 2LUEA 3NRZA 4M01A 3RZFA 3ZDTA 1E5WA 1ESFA 3HM3A 3VRBB 3I57A 2KMAA 2QCZA 5J9AA 3VH4B 2I2YA 3CSTA 2JT4B 4KGTA 1V8CA 3JSVA 3PLUA 2KFJA 1P0RA 1AN8A 1EUVB 5IO9A 3FILA 4YT0B 3UGBB 3ENEA 3I3TB 1BT0A 3Q8AA 1RYJA 1OQYA 1V86A 3ZTCA 1L0YB 2HJ1A 1D6EC 3V05A 4HLEA 4DWFA 2J42A 1V6EA 1ZGUB 3MFGA 5LNK1 4WJPA 2PKOA 2GBRA 3AEAB 1ZP0B 4IM0A 5TR5A 3L54A 5EDSA 1C1YB 3HIZA 4MJSB 4B9KA 3KWVA 1MI0A 2FUHB 5E6JA 3BVMA 4IOIE 4HPMB 3WCQA 2O6VA 3WAPA 1PFDA 1YD8U 2QIEB 3RD2A 4CHKA 5KHOA 3TEYA 4AJYB 2D3CA 3OLMD 1UUPA 2XN9C 1E7PB 4FN2A 3DOWA 3RYTA 3UIOB 1QLBB 4PT5A 3HUIA 4W9FA 2DYOA 4L1BA 1GG3A 1QILA 2KHWB 1N62A 1TIFA 1BG0A 1WI0A 2RD0A 2INDC 4C7YA 1HE8A 3QJZA 4WWPA 3DBRB 2JY6A 3Q69A 3A9JA 4YTNB 1P9DU 5DPSA 4LNIA 4PYZA 4GDLB 1C79A 1GOZA 1GC6A 4M0WA 4AS1A 1TT4A 4JL9A 2KTRB 2ZPNA 3DQVA 2QHOA 3EUB2 3H7PB 1N5WA 3OWEB 2WXLA 4HPPA 5G55A 1KM7A 3DVNU 2GWCA 3AMZA 3DVGX 4EFOA 3RCZA 1EWYC 2JPHA 1Y8RC 3PZ8A 1Q10A 2L0TA 4TQ1A 1WGKA 2KMCA 5G5GA 1IBXA 1MFWA 1ENFA 2XNAC 1DOYA 3A33B 1UBQA 2Q5WD 2KFKB 2L3ZA 2MP2A 4AM1A 2D3AA 3AEGB 3JYUA 4K3BA 1Q0WB 1C4CA 2KAJA 2LEKA 4P6VF 3U2SC 1VRAB 4EKUA 5HFYA 4DK5A 3M95A 1LFDA 5AEKB 4GSWA 2VRRB 2RR9A 1UGMA 1I4HA 3VVWB 1J7AA 3W5VB 4ZRQA 1M4VA 3IAS1 1MJDA 2FUG1 5TSSA 2Z8LA 3TIXA 2LRWA 1FFVA 2CKHB 3P63A 4II2B 4W9EA 2AYOB 2O2VA 3AV8A 3D32A 3S2AA 3QAQA 2L05A 1I4GA 3VTVA 1XLPA 4B0MA 1D5ZC 3AE1B 2BQQA 4TKNA 3NVWA 3PVLA 2M8SA 3ZYYX 2D3GA 3ZGZA 5IP4D 1I42A 4OZCA 1QOBA 2WDQB 4BVUC 3AB5A 2L0FA 3V3XA 1I4XA 2V3PA 2DENB 2NVUI 2D32A 2CHZA 1PDXA 2IBIB 4HROA 1QK1A 1RFAA 4ZHPA 4I6LB 3T8MA 2KANA 2KDIA 2VZKD 3FC4A 3DVNV 3NS1A 2N7EA 2NPTA 1FO4A 1C78A 1WMHB 3A9JB 3DBLB 1XEEA 3PGEA 1CMXB 3OAWA 4WWMA 1STEA 3PSEB 1UD7A 3Q3JA 1MG8A 2KXJA 4A3PA 2J0JA 1R4NI 1V80A 2WX0A 3PZ7A 1WGYA 4J6IA 3SFDB 1E0ZA 1JRUA 2WS3B 2D2QA 4RF7A 3BZDB 3L08A 2K22A 3RNEC 3NVVA 4JIOU 3DBHI 4FBJB 1K53A 1VD2A 1DGJA 4TMAB 3JU5A 2R2OA 1TYGB 2C7MB 2ZCCA 4NJ7A 3ZRFA 2K3UA 2YEPF 2IGGA 2FE8A 2QSDA 2K39A 1JWUD 3N32A 3EGRA 3ECIA 1TKYA 2MEKA 2M0AA 4DHJD 4KVGB 2KQ7A 4N59A 1E6EB 3M10A 1V97A 1J7BA 1K51A 4DXFA 1E10A 2GB1A 4II3B 3Q8FA 4TUUA 5AZHA 1V49A 3R7QA 1YJIA 3QX1A 3ONSA 4ASWC 5J17A 3AE3B 3NHEB 2WQYB 3IHPC 3WA0A 3AEEB 1WWTA 1ZOYB 4AJWA 2WU5B 2X8XX 1KTKA 1XLQA 2AQ2B 1P3QU 2J4XA 2TSSA 3EC8A 3AE9B 1OQRA 5IKCM 3LXFA 3L10B 5BMIA 3A1QA 1RFKA 1L2NA 2O2VB 5KHQA 2K8HA 3I5JC 4HJGE 5JH5C 3N1XC 4A3OA 2W55A 2M4NA 1RRBA 5G5HA 4K81A 1ZKHA 4W9DA 5D6JB 3U30A 2WDTB 2NMQA 1N5XA 4WJOA 4MGIE 2K6QA 4NAWA 1BXTA 1UF0A 1WX9A 1PGAA 1TKGA 3PPAA 2Z0DB 2DYBA 3NZSA 3AE2B 2RDBC 1RWSA 3W1SA 1WGHA 3LDZE 1ET9A 1KH0A 3M63B 5HHDG 4C4VB 3KWLA 2NBVB 2MJ3A 4BKSA 2HTME 2KDBA 1WH3A 4WIPA 1NI2A 3KYDD 3RNCC 2WYQA 1SJHD 2BKRB 1WM3A 3P4SB 2INPE 3AULA 1Q5WB 4RMAA 4MT5A 1WJNA 4A20A 2ZW0A 2BW2A 3WALA 3M3JA 3ZO5B 5DPTA 3BK2A 2GBKA 1FCLA 3H6NA 2V0GA 3FKYA 1R8GA 4MSMB 5MPOA 1Y56A 1IYFA 2O6VD 1KFYB 1Z5SB 3HRDD 1B1ZA 1V1OA 3VDZA 1B9RA 3N1YC 2M17A 5EE0A 2JXTA 5H92C 1S1QB 2PE9A 1YMHE 4EZLA 4ZRIA 3URYA 4DHZB 1SF0A 2OJRA 1UWXA 4MJSA 2G4SA 4DXAB 2LJIA 4X57B 3U4EG 5D3DA 3O13A 3ZTDA 3IT6B 1ZXIA 2K5PA 5HKHA 3BVZA 3V60A 2V4LA 3NZTA 2M0XA 3SHQA 1UNSA 4FHJA 4N58A 2JZZA 1S3SG 1WIAA 5EE3A 4XWTA 1D3ZA 1SD0A 2CHXA 4TV3A 1FFUA 1NVID 1SSNA 4A9AA 4MEMA 2IGDA 1TS2A 2KX3A 5AZFA 4FXCA 4YTMB 2KKCA 2BS4B 2BB5A 2EELA 4GXBA 3KUCB 1YN5A 4RGMA 4GDLA 4HPLB 1JROA 1MPEA 3UIPB 2MQJA 3PTFC 2KTRA 2V9HA 2NR2A 5E6OA 2WX1A 3BVGA 3VR9B 1QOFA 2FIDA 2ZVNA 4I6NB 2WP9B 4ZRJA 3H7PA 3SDLC 2MJEA 4NAWB 1FRRA 2LRUA 1RAXA 4ARIA 2DZKA 3B9JA 2JX5A 1E8XA 3ZNGC 3Q2AC 2PVGC 1Q1OA 2IJ0A 1FNVA 4OW0A 1N60A 3N3KB 3ZVVA 3AEDB 2G3QB 2AEHA 4GB9A 4RCOA 4BZAA 2BT6A 2CJOA 2LFIA 1L5PA 3R8BA 2Y3AA 1K52A 3A9KB 3HVZA 1T0RC 1SXTA 1BMLC 3BIID 3I9V1 1KOTA 2ZCBA 4GW0A 4R3DA 2KFKA 1EWCA 4B6WA 2I1JA 4C80A 1TS4A 3R66C 3APFA 3U7ZA 3LJ3A 3CSFA 1MG4A 1E8WA 2LZ6A 5C1ZA 3MTNB 1VLBA 2Z0EB 3DDCB 1DOIA 4EEWA 2N9PC 2D11A 2WXIA 1H8CA 1YJ1A 4WJQA 2YLMA 3ZXRA 4XYCA 3VQIA 1XF5L 5L83A 3UQBA 2ONQA 4K7UA 2IO2B 1UBIA 2L32A 5JHAA 2KACA 3W2DA 1TKEA 2LGDA 4NQKE 1SIFA 3PREA 4YTPB 4WAFA 4P7IA 4IM2A 1WYWB 3NJTA 3V6CB 3R7RA 1FPYA 1TJEA 3AE6B 2EMSA 3DCGA 2UU7A 4N9F4 3RUIB 2NS5A 1WR6E 2DZMA 3RT3B 1U4AA 1C4AA 3MHZA 1J7CA 4US8A 1KLVA 1WGDA 1ET6A 4P1BC 2RMMA 1F2RI 5HI1A 1LO5D 2ZNVB 1WMHA 3QIJA 2WGSA 2JUOA 4C56C 3KYCD 3R3MA 4ANVA 1WX7A 4NNJB 3SR6A 1JWMD 3B6RA 3QHTA 1V1PB 1WM2A 1V5TA 5HG2A 2ZVOA 4XWWA 4JPSA 5D94A 2L83A 3T3OA 4XDCA 2JRIB 3MJWA 4IG7B 2JZ3B 2LHEA 2RSUA 3VXWA 4NZLB 3CWIA 4BHLA 1SE4A 1WX8A 1KJTA 4BG4B 4F7ZA 4GVYA 1PGBA 2GBNA 5CX3A 4E74A 3ZXVA 2WXGA 1ZPSA 2E6XA 1P7FA 1XD3B 3UI3A 1XQQA 4CO7A 3H7SA 4A6QA 1QKZA 2MBBB 4USAA 2GWDA 3UINB 2PW9A 3MC0B 2BTEA 1JWSD 4RF6A 4A90A 2BS2B 3GZNI 4B0EA 3N1ZC 4JWUC 2KWDA 5J99A 1U6RA 2OEDA 1VDVA 5D7GA 2KVRA 3Q8EA 2QDFA 4M8NA 1NYRA 3APCA 4G50A 3I63C 3VAWA 2MRPA 4UDUC 1G6JA 5C2TB 2XK5B 4RF9A 1GNUA 1TGZB 2PJHA 3QK0A 2UWQA 5CHFA 2GBJA 3C8YA 5BYQA 4G0NB 4RFBA 5BO4B 3NS8A 1R4NB 2LHDA 2Y5PA 1C3TA 1OFFA 4B95A 1KLGD 2CU3A 3Q3MC 1T5XD 2RDHA 2K8BA 2MSED 1AARA 5E6NA 2LJ5A 1FEHA 1F0ZA 4PYUA 5JZEB 4CYEA 3CIRB 4M00A 1TBEA 2WXKA 1PGXA 2JRHA 3PT2B 4BKSD 2J53A 1EU4A 1GB4A 1WGGA 3DBHB 4KGSA 1WXMA 3DREA
chains in the Genus database with same CATH topology
3NZTA 1HTQA 2UU7A 4BAXA 2WGSA 3LN7A 3LN6A 3IG5A 4LNIA 2BVCA 2OJWA 1VA6A 3LVWA 4HPPA 3LVVA 2GWDA 1TT4A 1LGRA 2GWCA 2QC8A 2GLSA 1HTOA 2D3AA 3ZXRA 4S0RA 4ACFA 3FKYA 4XYCA 1R8GA 2D3BA 2D33A 3NG0A 3ZXVA 2WHIA 2D3CA 4LNFA 1F1HA 2LGSA 4LNNA 4S17A 1FPYA 2D32A 1V4GA 3IG8A 1F52A 4LNOA 4LNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HTQ A;  2UU7 A;  4BAX A;  2WGS A;  4LNI A;  2BVC A;  2OJW A;  4HPP A;  1LGR A;  2QC8 A;  2GLS A;  1HTO A;  2D3A A;  3ZXR A;  4S0R A;  4ACF A;  3FKY A;  4XYC A;  2D3B A;  3NG0 A;  3ZXV A;  2WHI A;  2D3C A;  4LNF A;  1F1H A;  2LGS A;  4LNN A;  4S17 A;  1FPY A;  1F52 A;  4LNO A;  4LNK A; 
#chains in the Genus database with same CATH topology
 1TZ1 A;  4M8M A;  4GW2 A;  2BYF A;  3IG5 A;  1N61 A;  5CHV C;  4Q2R A;  2C7H A;  1YIW A;  1HZ6 A;  2PMV A;  2NBW B;  4IWO A;  4C4V A;  2MW5 A;  4EE2 A;  3MC8 A;  1G0W A;  5IA7 A;  3AE7 B;  2H88 B;  3B1L X;  3DHH C;  3JU6 A;  4ACF A;  1WXS A;  2D3B A;  3JPZ A;  2AX5 A;  3AE4 B;  1SIJ A;  2REX A;  3L17 A;  2WXM A;  3C0R B;  4RM8 A;  3K9O B;  2DHZ A;  2ON8 A;  4WWO A;  2IZV B;  4HVB A;  1TS5 A;  4C00 A;  1JAL A;  3HHM A;  2ZEQ A;  3WIM A;  3E56 A;  2LXA A;  1XT9 B;  4GDK B;  3BWU D;  2FAZ A;  3AEC B;  1VZ7 A;  3NVY A;  1N6Z A;  3P4Q B;  2N7D A;  5GXG B;  3QWZ B;  1NYQ A;  1RLF A;  3ZDM C;  1WXQ A;  5LLI A;  2BWE S;  1JQ4 A;  3HK0 A;  4IM3 A;  3JVZ X;  4WQO B;  3R2I A;  2QJL A;  1LM8 B;  1E7V A;  1AWD A;  4KDI C;  4XC2 A;  3P42 A;  4RF0 A;  4MGY E;  4D2K A;  1KLU D;  4KDL B;  3APD A;  2WWZ A;  4AQ7 A;  2G9H D;  4TSS A;  4MH8 A;  4ZRK A;  3A4S C;  1LGR A;  1P50 A;  2PIA A;  3Q3N C;  3KVF B;  4ANX A;  4OVZ A;  3V61 A;  3ETR A;  1TT5 B;  2PTL A;  2MBO A;  4DDI D;  5FR3 A;  1HZ5 A;  1TS3 A;  3LVW A;  4ANU A;  4ZYS A;  3L2D A;  3NY5 A;  1PUT A;  1ISN A;  4LDT D;  2IDY A;  1VZ8 A;  4HDQ A;  3ZKJ C;  4LLG M;  1D4B A;  4AWJ A;  2KK8 A;  1SJE D;  2V3S A;  2M1M A;  1YNT E;  2JYT A;  2GBM A;  4OVU A;  4XZ4 A;  1L4D B;  4EUT A;  4C7Z A;  4MM3 B;  4YSX B;  1OTR B;  3SEB A;  1YN4 A;  2QEJ C;  4FJV B;  2R61 A;  2WXQ A;  4KX6 B;  3PO0 A;  1J8C A;  1WSP A;  1ROE A;  3NZ3 A;  4IWP A;  3RMK C;  4EZJ A;  2L1A A;  3MP9 A;  4KKI A;  3A9K A;  3ZNI D;  1QOA A;  3AE8 B;  2IYD B;  5DPR A;  1PQS A;  4JLC A;  2KWC A;  3J9C A;  1QT9 A;  1V4G A;  4IDI A;  3T9L A;  4BBN C;  5BYS A;  1F52 A;  2KT7 A;  4XGA B;  4LJP B;  3E9S A;  2B76 B;  1WYG A;  1JW9 D;  1I4P A;  2KN5 A;  5C23 A;  2W54 A;  3B08 A;  4RGN A;  2BPS A;  1V81 A;  3PHX B;  3GS2 A;  4NJ6 A;  3ZJV A;  4PS8 A;  3TEZ A;  3V6E B;  2KO3 A;  3PLV A;  2ACZ B;  1WRD B;  3NUH B;  3WAM A;  1FRD A;  1L6V A;  4YXD B;  1EM7 A;  1TY2 A;  3Q14 C;  2KWV B;  1XLO A;  2L7R A;  1IGD A;  2DLB A;  1HTQ A;  1JWA D;  1SEB D;  2D5G A;  2WXO A;  1V9J A;  2HD5 B;  2MBQ A;  1E90 A;  4NJC A;  2W3R A;  3BY4 B;  4XX5 A;  1WE6 A;  1QZE A;  3PRZ A;  3W1S C;  1FXA A;  3QCA A;  4GMV A;  1K8R B;  2QC8 A;  1SE9 A;  2FBW B;  1CQV A;  4IKG A;  1VJK A;  1NEK B;  1IGC A;  2W3S A;  2UYZ B;  2BKF A;  3H1U A;  1D5X C;  3ZQ4 A;  2WXH A;  2PE6 B;  5CHW A;  4GN1 A;  2AQ1 B;  2OJW A;  2M19 A;  4PK1 A;  3RZW C;  1VR9 A;  1F2R C;  2BS3 B;  4GIV A;  3JQ3 A;  2AL6 A;  3L2E B;  4MGZ E;  5J2R A;  4DHZ E;  2CRK A;  2M56 B;  2PLP A;  5EE9 A;  2BGF A;  2JWZ A;  2KYW A;  1A70 A;  2BWF A;  1WJ6 A;  2GOW A;  1OEY J;  4A55 A;  3TL5 A;  1R4M I;  3TEX A;  1P1A A;  2IO3 B;  4KKJ A;  1FXI A;  2LXC A;  2G1E A;  3RNB C;  1MVK A;  3Q6B A;  4AP4 C;  1V1P A;  2KWU B;  5JHB A;  2WHI A;  1GB1 A;  4HCN B;  3TSS A;  4W9L A;  3AU4 A;  2HTH A;  2LAS A;  3VUX A;  2WNM A;  1UEL A;  3T3N A;  1YX6 B;  1WRI A;  2EMT A;  2N0S B;  2MLB A;  4OHJ A;  3N30 A;  2KJR A;  3GP7 A;  1M15 A;  3IG3 A;  4FUL A;  4BG4 A;  2KOX A;  2G4D B;  1CZP A;  4K7W A;  2AWT A;  2I1K A;  2KC1 A;  3L4P A;  4WUR A;  2FCN A;  2DAF A;  4M02 A;  4W9C A;  4F8C B;  1OEY A;  2K6D B;  3ZUN A;  1X1M A;  3M62 B;  3VR8 B;  1DOX A;  2DNF A;  4RF1 A;  5JXV A;  4KIK B;  2IGH A;  3PRM B;  2MHJ A;  4WWN A;  2DYM A;  3Q8B A;  4HKZ E;  2KX0 A;  4WH4 A;  4S17 A;  4HDO A;  3P1M A;  1UZX B;  1XLN A;  1KRH A;  2JYE A;  4PS3 A;  3IXS A;  1GUA B;  2KTF A;  4H2A A;  1GC7 A;  3HVD A;  2KD0 A;  2XK5 A;  3NVZ A;  2JU6 X;  2VZK B;  2W82 A;  1F1H A;  3RPF C;  2W9N A;  3GOE A;  2JF5 A;  4J3O D;  4O1N A;  2MWS B;  1ZXH A;  3LN7 A;  4AUQ C;  1R7S A;  1L4Z B;  2BVC A;  2JZP A;  4JGH B;  1NDD A;  4URK A;  1JWB D;  2K25 A;  2MJD A;  3IVF A;  5BYR A;  4KSL C;  1XCQ L;  2DBY A;  2J0K A;  1JRP A;  4GGQ A;  3KQ4 A;  2BF8 B;  3B0A A;  2NBU A;  2FCQ A;  3VHT C;  4DQO C;  1GPX A;  2WXP A;  3VTU A;  2GMI C;  1E9M A;  4L2Y A;  3DPD A;  1SGH A;  2LMC A;  3BYY B;  3U52 E;  4E3C A;  4Q2J A;  1AW7 A;  3AEF B;  2LVO A;  4KZ0 A;  1WGR A;  3RUL A;  4G11 A;  3TEW A;  2LVP A;  1T6B X;  4HWI B;  2CJN A;  1FNU A;  1SBB B;  1T0S C;  1WE7 A;  1XXG A;  2C60 A;  2XBB C;  3B2G A;  4HCP B;  2L00 B;  4ZOH C;  3RFZ B;  4BOS C;  1D5M C;  1A5R A;  3PRP B;  3GZN B;  4DHJ B;  2GI9 A;  3U8Z A;  1P52 A;  1HTO A;  2RPQ A;  2VH2 A;  4MSQ B;  1LXD A;  3VTW A;  3BYT B;  1GAQ B;  5BMH A;  4KV2 A;  2WLB A;  4LK0 M;  4DXG A;  2IPK D;  3DBS A;  3AN1 A;  1YQB A;  1ZUD 2;  3ZJT A;  2D10 A;  4GDK A;  5I4D A;  2BBC A;  2KVZ A;  1VZ6 A;  2ZZP B;  4LNK A;  4RF8 A;  1TY0 A;  1C76 A;  3P4P B;  1WR1 A;  2NTT A;  3O65 B;  2V4I B;  1K50 A;  1WFY A;  1ZW7 A;  4KSK C;  4BKG A;  2ICI A;  3H8H A;  3BIN A;  1NBF C;  4G3X B;  4IC7 B;  4IW0 A;  5H8Y E;  2R2Q A;  4LNF A;  2LGS A;  4LNN A;  2CR5 A;  2L76 A;  3NOB A;  3KW5 B;  4LDT B;  4RNA A;  5AZG A;  1JCK B;  1WY8 A;  3BK1 A;  4MDK E;  4W9K A;  1V2Y A;  2HDE A;  2J52 A;  2KDF B;  2FCS A;  5J18 A;  4FJZ A;  2LUM A;  1L6U A;  3MJ5 A;  3ZNZ B;  4RGT A;  4A8X C;  3WAN A;  4FHK A;  1PYW D;  4OZA A;  4YSZ B;  4EOY A;  2D33 A;  4GOC A;  1J0G A;  3ZLZ A;  1I0E A;  3ABV B;  2MCN B;  1ZDX A;  1QQR A;  2J0M A;  2DZI A;  1WXA A;  3DBR I;  3RN9 C;  4NQL B;  5C3J B;  4DBG A;  3X0W A;  1FIQ A;  3OJ4 B;  1EU3 A;  1ZDV A;  3AI5 A;  4F1S A;  3JSV B;  2BB6 A;  2KC2 A;  1WF9 A;  2L8J A;  3IT4 B;  2RDG A;  4NAM A;  4W9G A;  3PV1 A;  4QAY A;  1I35 A;  2KMM A;  1WZ0 A;  3FIL B;  3W5U B;  3ZIM A;  4IWQ A;  4W9J A;  1YQ3 B;  1FXT B;  1H4R A;  2L52 A;  3HM6 X;  3K9P B;  3KUD B;  4RGO S;  1YJJ A;  2IO0 B;  4JQW C;  4FLH A;  1GJZ A;  4MM3 A;  2LD9 A;  3LYY A;  2HE7 A;  3EHV A;  3PZD A;  1M94 A;  3IG8 A;  1I7H A;  3GE8 C;  4GVZ A;  1CJE A;  3Q3O C;  3EEC A;  1XO3 A;  3LN6 A;  4ICV A;  2DX5 B;  1WJ4 A;  2O6V B;  3KUZ A;  2MH7 A;  3VUW A;  2QMT A;  4RH6 A;  2D07 B;  1N63 A;  4BOZ B;  1FM0 D;  2KZR A;  4KZC A;  3IFW B;  4ARC A;  1CK1 A;  2KDM A;  4WJN A;  2A4Z A;  1EF1 A;  4WQM A;  1C77 A;  2CS4 A;  3R2T A;  3ML9 A;  3OG5 A;  2KJ6 A;  2WDR B;  1F77 A;  2H89 B;  3L16 A;  4HJK A;  2K8C A;  3GB1 A;  3MC9 A;  1HXY D;  2JQR B;  1IUE A;  2KN4 A;  2KQS A;  2VH1 A;  2JWU A;  2FNJ B;  1P98 A;  4W9H A;  4BAX A;  3NZU A;  5FK9 C;  4LCD E;  3OJ3 A;  4M0W B;  2QIL A;  3P2B A;  1ZE3 D;  1FMA D;  4YSY B;  2WXN A;  3A4R A;  2KQ4 X;  3EFC A;  2AL3 A;  2N9K A;  2N1V A;  3VRA B;  3EA6 A;  1WZ3 A;  2N9L A;  1YQ4 B;  2LGY A;  5D2M B;  3CF6 E;  1OGW A;  4ZHO A;  1EO6 A;  1C4P A;  4K3C A;  5IAA C;  4FJY A;  4HXD A;  1L0V B;  4OZB A;  2SEB D;  3LVV A;  4JE3 B;  2IY1 B;  1EF5 A;  3DHG C;  1T0Y A;  1C9F A;  4RM9 A;  3Q3F A;  5L95 C;  3GE3 C;  4Z9M A;  3KLS X;  3QC8 B;  3TMP B;  3X23 A;  3CMM B;  2A5U A;  1RM6 C;  3L2E A;  4MEL A;  2PPH A;  1QH4 A;  2WU2 B;  1IBX B;  2WXR A;  3RNG C;  2JSV X;  4P16 A;  3RNA C;  3DBL I;  2CU1 A;  5FKA C;  4ITK A;  2MP2 B;  1YOV B;  4KGR A;  2ZPY A;  1YN3 A;  5IOI A;  3DWG C;  2LVQ A;  5DPW A;  1MHX A;  2N7J A;  2DZJ A;  1FNW A;  2GLS A;  1NI3 A;  3VH3 B;  5D3I B;  1I4Q A;  3TCA A;  4JX1 C;  4YWG G;  3AM9 A;  2WXF A;  1LQB A;  2C5L C;  3QAR A;  4REZ A;  3WAO A;  5AUI A;  1IP9 A;  4ZYN A;  3FAH A;  1IPG A;  3N9Y C;  3AXC A;  2IY0 B;  5G2N A;  5LXH A;  1OQQ A;  4OVV A;  1P7E A;  2X38 A;  3VUY A;  1F9J A;  1NEN B;  2INC C;  4JWS C;  3LB8 C;  2PVO D;  1RL9 A;  2FCM A;  4AOF A;  2RPV A;  2EKE C;  1HA5 A;  2YVC A;  2CHW A;  3MHS D;  2IO1 B;  3IBE A;  1HQR D;  2J1Q A;  1ACC A;  1VA6 A;  2EKI A;  1I4R A;  4LJO B;  4ANW A;  4NPN A;  2N9E B;  3DHI C;  5CTR C;  1VRP A;  2E3T A;  1BUI C;  4K7S A;  2N1W A;  2INN E;  4KIK A;  2YEP B;  2FIF A;  2MBE A;  3ZW3 A;  1UGJ A;  4W9I A;  5DCN A;  2DAJ A;  1WJU A;  2V3N A;  4E71 A;  3C19 A;  4FA6 A;  4ZDV A;  4HEA 1;  1J19 A;  1KF6 B;  2MBH A;  3SFE B;  2K0P A;  2NPT B;  2I38 A;  1TTN A;  3UQA A;  3QA8 A;  4LTU A;  2BYV E;  1E7U A;  2OOB B;  4BBN F;  5EE1 A;  2KDE B;  2JXX A;  4MGK E;  3N20 C;  1R4M B;  2AQ3 B;  2LWP A;  2SAK A;  2B3A A;  3PS6 A;  1FCC C;  3TJP A;  2ZJD A;  4MH0 E;  2J7Q B;  1VCB A;  4EZK A;  2DWQ A;  3ZNH B;  2KNB A;  4MAC A;  3AU5 A;  3DWM A;  2OHF A;  3U7D A;  2GRI A;  3SU8 X;  2KLC A;  3VFK A;  3Q8C A;  1CRK A;  2RGF A;  3TUO A;  3DRB A;  3SD5 A;  1L0X B;  2WDV B;  2HJ8 A;  1MHH E;  3H9D A;  3RI7 C;  2C7N B;  4L23 A;  5GMV A;  5BMG A;  2BYT A;  1AYF A;  3AH7 A;  2G45 B;  1FD6 A;  3P4R B;  4K1R B;  4S0R A;  2ZW1 A;  4GLS C;  3NG0 A;  4HRS A;  4IUM B;  4ICU A;  4ZRP A;  2LI5 A;  4DDG D;  1E8Y A;  1SB3 C;  4LNO A;  2Y5B B;  3ZJU A;  2ASQ A;  2K1F A;  2BYE A;  1L7Y A;  3L0W B;  3KH0 A;  3V62 A;  3L13 A;  1DYQ A;  3IAM 1;  4CQN A;  2LGI A;  3ZRC A;  1T3Q A;  4US9 A;  1UH6 A;  2KJH B;  4PS7 A;  3EFU A;  4YL8 A;  2N9X A;  1QOG A;  1TZO A;  5E6P A;  1SE3 A;  2KLG A;  1JML A;  3A1Q B;  3AEB B;  5FR6 A;  3ML8 A;  1YX5 B;  5LXI B;  1HEZ E;  4NY0 A;  1QF6 A;  4HKQ A;  2WXJ A;  1V5O A;  4N6E B;  2NCN A;  2MX2 A;  2K9X A;  3AE5 B;  3JW0 X;  1UWM A;  5AUK A;  2PEA A;  3PHW B;  2JVC A;  1T0Q C;  4BFR A;  4XDD A;  1WXV A;  1Z2M A;  2MA9 B;  3UF8 A;  1XCT L;  3TBL D;  3B2F A;  4I6P A;  3ALB A;  5IN7 A;  1E8Z A;  2ZNV C;  3W1Y A;  2V1Y A;  2LGX A;  3RNF C;  4P1C C;  4XE0 A;  2N4F A;  4WAA A;  4TQ0 A;  2Z59 B;  4BKT A;  4HK2 A;  2C9W B;  3DVG Y;  5T8I A;  2Y5C A;  2NTS A;  3W9C B;  2XEW A;  4FAD A;  4GU2 A;  3QQ8 B;  1SE2 A;  2LUE A;  3NRZ A;  4M01 A;  3RZF A;  3ZDT A;  1E5W A;  1ESF A;  3HM3 A;  3VRB B;  3I57 A;  2KMA A;  2QCZ A;  5J9A A;  3VH4 B;  2I2Y A;  3CST A;  2JT4 B;  4KGT A;  1V8C A;  3JSV A;  3PLU A;  2KFJ A;  1P0R A;  1AN8 A;  1EUV B;  5IO9 A;  3FIL A;  4YT0 B;  3UGB B;  3ENE A;  3I3T B;  1BT0 A;  3Q8A A;  1RYJ A;  1OQY A;  1V86 A;  3ZTC A;  1L0Y B;  2HJ1 A;  1D6E C;  3V05 A;  4HLE A;  4DWF A;  2J42 A;  1V6E A;  1ZGU B;  3MFG A;  5LNK 1;  4WJP A;  2PKO A;  2GBR A;  3AEA B;  1ZP0 B;  4IM0 A;  5TR5 A;  3L54 A;  5EDS A;  1C1Y B;  3HIZ A;  4MJS B;  4B9K A;  3KWV A;  1MI0 A;  2FUH B;  5E6J A;  3BVM A;  4IOI E;  4HPM B;  3WCQ A;  2O6V A;  3WAP A;  1PFD A;  1YD8 U;  2QIE B;  3RD2 A;  4CHK A;  5KHO A;  3TEY A;  4AJY B;  2D3C A;  3OLM D;  1UUP A;  2XN9 C;  1E7P B;  4FN2 A;  3DOW A;  3RYT A;  3UIO B;  1QLB B;  4PT5 A;  3HUI A;  4W9F A;  2DYO A;  4L1B A;  1GG3 A;  1QIL A;  2KHW B;  1N62 A;  1TIF A;  1BG0 A;  1WI0 A;  2RD0 A;  2IND C;  4C7Y A;  1HE8 A;  3QJZ A;  4WWP A;  3DBR B;  2JY6 A;  3Q69 A;  3A9J A;  4YTN B;  1P9D U;  5DPS A;  4LNI A;  4PYZ A;  4GDL B;  1C79 A;  1GOZ A;  1GC6 A;  4M0W A;  4AS1 A;  1TT4 A;  4JL9 A;  2KTR B;  2ZPN A;  3DQV A;  2QHO A;  3EUB 2;  3H7P B;  1N5W A;  3OWE B;  2WXL A;  4HPP A;  5G55 A;  1KM7 A;  3DVN U;  2GWC A;  3AMZ A;  3DVG X;  4EFO A;  3RCZ A;  1EWY C;  2JPH A;  1Y8R C;  3PZ8 A;  1Q10 A;  2L0T A;  4TQ1 A;  1WGK A;  2KMC A;  5G5G A;  1IBX A;  1MFW A;  1ENF A;  2XNA C;  1DOY A;  3A33 B;  1UBQ A;  2Q5W D;  2KFK B;  2L3Z A;  2MP2 A;  4AM1 A;  2D3A A;  3AEG B;  3JYU A;  4K3B A;  1Q0W B;  1C4C A;  2KAJ A;  2LEK A;  4P6V F;  3U2S C;  1VRA B;  4EKU A;  5HFY A;  4DK5 A;  3M95 A;  1LFD A;  5AEK B;  4GSW A;  2VRR B;  2RR9 A;  1UGM A;  1I4H A;  3VVW B;  1J7A A;  3W5V B;  4ZRQ A;  1M4V A;  3IAS 1;  1MJD A;  2FUG 1;  5TSS A;  2Z8L A;  3TIX A;  2LRW A;  1FFV A;  2CKH B;  3P63 A;  4II2 B;  4W9E A;  2AYO B;  2O2V A;  3AV8 A;  3D32 A;  3S2A A;  3QAQ A;  2L05 A;  1I4G A;  3VTV A;  1XLP A;  4B0M A;  1D5Z C;  3AE1 B;  2BQQ A;  4TKN A;  3NVW A;  3PVL A;  2M8S A;  3ZYY X;  2D3G A;  3ZGZ A;  5IP4 D;  1I42 A;  4OZC A;  1QOB A;  2WDQ B;  4BVU C;  3AB5 A;  2L0F A;  3V3X A;  1I4X A;  2V3P A;  2DEN B;  2NVU I;  2D32 A;  2CHZ A;  1PDX A;  2IBI B;  4HRO A;  1QK1 A;  1RFA A;  4ZHP A;  4I6L B;  3T8M A;  2KAN A;  2KDI A;  2VZK D;  3FC4 A;  3DVN V;  3NS1 A;  2N7E A;  2NPT A;  1FO4 A;  1C78 A;  1WMH B;  3A9J B;  3DBL B;  1XEE A;  3PGE A;  1CMX B;  3OAW A;  4WWM A;  1STE A;  3PSE B;  1UD7 A;  3Q3J A;  1MG8 A;  2KXJ A;  4A3P A;  2J0J A;  1R4N I;  1V80 A;  2WX0 A;  3PZ7 A;  1WGY A;  4J6I A;  3SFD B;  1E0Z A;  1JRU A;  2WS3 B;  2D2Q A;  4RF7 A;  3BZD B;  3L08 A;  2K22 A;  3RNE C;  3NVV A;  4JIO U;  3DBH I;  4FBJ B;  1K53 A;  1VD2 A;  1DGJ A;  4TMA B;  3JU5 A;  2R2O A;  1TYG B;  2C7M B;  2ZCC A;  4NJ7 A;  3ZRF A;  2K3U A;  2YEP F;  2IGG A;  2FE8 A;  2QSD A;  2K39 A;  1JWU D;  3N32 A;  3EGR A;  3ECI A;  1TKY A;  2MEK A;  2M0A A;  4DHJ D;  4KVG B;  2KQ7 A;  4N59 A;  1E6E B;  3M10 A;  1V97 A;  1J7B A;  1K51 A;  4DXF A;  1E10 A;  2GB1 A;  4II3 B;  3Q8F A;  4TUU A;  5AZH A;  1V49 A;  3R7Q A;  1YJI A;  3QX1 A;  3ONS A;  4ASW C;  5J17 A;  3AE3 B;  3NHE B;  2WQY B;  3IHP C;  3WA0 A;  3AEE B;  1WWT A;  1ZOY B;  4AJW A;  2WU5 B;  2X8X X;  1KTK A;  1XLQ A;  2AQ2 B;  1P3Q U;  2J4X A;  2TSS A;  3EC8 A;  3AE9 B;  1OQR A;  5IKC M;  3LXF A;  3L10 B;  5BMI A;  3A1Q A;  1RFK A;  1L2N A;  2O2V B;  5KHQ A;  2K8H A;  3I5J C;  4HJG E;  5JH5 C;  3N1X C;  4A3O A;  2W55 A;  2M4N A;  1RRB A;  5G5H A;  4K81 A;  1ZKH A;  4W9D A;  5D6J B;  3U30 A;  2WDT B;  2NMQ A;  1N5X A;  4WJO A;  4MGI E;  2K6Q A;  4NAW A;  1BXT A;  1UF0 A;  1WX9 A;  1PGA A;  1TKG A;  3PPA A;  2Z0D B;  2DYB A;  3NZS A;  3AE2 B;  2RDB C;  1RWS A;  3W1S A;  1WGH A;  3LDZ E;  1ET9 A;  1KH0 A;  3M63 B;  5HHD G;  4C4V B;  3KWL A;  2NBV B;  2MJ3 A;  4BKS A;  2HTM E;  2KDB A;  1WH3 A;  4WIP A;  1NI2 A;  3KYD D;  3RNC C;  2WYQ A;  1SJH D;  2BKR B;  1WM3 A;  3P4S B;  2INP E;  3AUL A;  1Q5W B;  4RMA A;  4MT5 A;  1WJN A;  4A20 A;  2ZW0 A;  2BW2 A;  3WAL A;  3M3J A;  3ZO5 B;  5DPT A;  3BK2 A;  2GBK A;  1FCL A;  3H6N A;  2V0G A;  3FKY A;  1R8G A;  4MSM B;  5MPO A;  1Y56 A;  1IYF A;  2O6V D;  1KFY B;  1Z5S B;  3HRD D;  1B1Z A;  1V1O A;  3VDZ A;  1B9R A;  3N1Y C;  2M17 A;  5EE0 A;  2JXT A;  5H92 C;  1S1Q B;  2PE9 A;  1YMH E;  4EZL A;  4ZRI A;  3URY A;  4DHZ B;  1SF0 A;  2OJR A;  1UWX A;  4MJS A;  2G4S A;  4DXA B;  2LJI A;  4X57 B;  3U4E G;  5D3D A;  3O13 A;  3ZTD A;  3IT6 B;  1ZXI A;  2K5P A;  5HKH A;  3BVZ A;  3V60 A;  2V4L A;  3NZT A;  2M0X A;  3SHQ A;  1UNS A;  4FHJ A;  4N58 A;  2JZZ A;  1S3S G;  1WIA A;  5EE3 A;  4XWT A;  1D3Z A;  1SD0 A;  2CHX A;  4TV3 A;  1FFU A;  1NVI D;  1SSN A;  4A9A A;  4MEM A;  2IGD A;  1TS2 A;  2KX3 A;  5AZF A;  4FXC A;  4YTM B;  2KKC A;  2BS4 B;  2BB5 A;  2EEL A;  4GXB A;  3KUC B;  1YN5 A;  4RGM A;  4GDL A;  4HPL B;  1JRO A;  1MPE A;  3UIP B;  2MQJ A;  3PTF C;  2KTR A;  2V9H A;  2NR2 A;  5E6O A;  2WX1 A;  3BVG A;  3VR9 B;  1QOF A;  2FID A;  2ZVN A;  4I6N B;  2WP9 B;  4ZRJ A;  3H7P A;  3SDL C;  2MJE A;  4NAW B;  1FRR A;  2LRU A;  1RAX A;  4ARI A;  2DZK A;  3B9J A;  2JX5 A;  1E8X A;  3ZNG C;  3Q2A C;  2PVG C;  1Q1O A;  2IJ0 A;  1FNV A;  4OW0 A;  1N60 A;  3N3K B;  3ZVV A;  3AED B;  2G3Q B;  2AEH A;  4GB9 A;  4RCO A;  4BZA A;  2BT6 A;  2CJO A;  2LFI A;  1L5P A;  3R8B A;  2Y3A A;  1K52 A;  3A9K B;  3HVZ A;  1T0R C;  1SXT A;  1BML C;  3BII D;  3I9V 1;  1KOT A;  2ZCB A;  4GW0 A;  4R3D A;  2KFK A;  1EWC A;  4B6W A;  2I1J A;  4C80 A;  1TS4 A;  3R66 C;  3APF A;  3U7Z A;  3LJ3 A;  3CSF A;  1MG4 A;  1E8W A;  2LZ6 A;  5C1Z A;  3MTN B;  1VLB A;  2Z0E B;  3DDC B;  1DOI A;  4EEW A;  2N9P C;  2D11 A;  2WXI A;  1H8C A;  1YJ1 A;  4WJQ A;  2YLM A;  3ZXR A;  4XYC A;  3VQI A;  1XF5 L;  5L83 A;  3UQB A;  2ONQ A;  4K7U A;  2IO2 B;  1UBI A;  2L32 A;  5JHA A;  2KAC A;  3W2D A;  1TKE A;  2LGD A;  4NQK E;  1SIF A;  3PRE A;  4YTP B;  4WAF A;  4P7I A;  4IM2 A;  1WYW B;  3NJT A;  3V6C B;  3R7R A;  1FPY A;  1TJE A;  3AE6 B;  2EMS A;  3DCG A;  2UU7 A;  4N9F 4;  3RUI B;  2NS5 A;  1WR6 E;  2DZM A;  3RT3 B;  1U4A A;  1C4A A;  3MHZ A;  1J7C A;  4US8 A;  1KLV A;  1WGD A;  1ET6 A;  4P1B C;  2RMM A;  1F2R I;  5HI1 A;  1LO5 D;  2ZNV B;  1WMH A;  3QIJ A;  2WGS A;  2JUO A;  4C56 C;  3KYC D;  3R3M A;  4ANV A;  1WX7 A;  4NNJ B;  3SR6 A;  1JWM D;  3B6R A;  3QHT A;  1V1P B;  1WM2 A;  1V5T A;  5HG2 A;  2ZVO A;  4XWW A;  4JPS A;  5D94 A;  2L83 A;  3T3O A;  4XDC A;  2JRI B;  3MJW A;  4IG7 B;  2JZ3 B;  2LHE A;  2RSU A;  3VXW A;  4NZL B;  3CWI A;  4BHL A;  1SE4 A;  1WX8 A;  1KJT A;  4BG4 B;  4F7Z A;  4GVY A;  1PGB A;  2GBN A;  5CX3 A;  4E74 A;  3ZXV A;  2WXG A;  1ZPS A;  2E6X A;  1P7F A;  1XD3 B;  3UI3 A;  1XQQ A;  4CO7 A;  3H7S A;  4A6Q A;  1QKZ A;  2MBB B;  4USA A;  2GWD A;  3UIN B;  2PW9 A;  3MC0 B;  2BTE A;  1JWS D;  4RF6 A;  4A90 A;  2BS2 B;  3GZN I;  4B0E A;  3N1Z C;  4JWU C;  2KWD A;  5J99 A;  1U6R A;  2OED A;  1VDV A;  5D7G A;  2KVR A;  3Q8E A;  2QDF A;  4M8N A;  1NYR A;  3APC A;  4G50 A;  3I63 C;  3VAW A;  2MRP A;  4UDU C;  1G6J A;  5C2T B;  2XK5 B;  4RF9 A;  1GNU A;  1TGZ B;  2PJH A;  3QK0 A;  2UWQ A;  5CHF A;  2GBJ A;  3C8Y A;  5BYQ A;  4G0N B;  4RFB A;  5BO4 B;  3NS8 A;  1R4N B;  2LHD A;  2Y5P A;  1C3T A;  1OFF A;  4B95 A;  1KLG D;  2CU3 A;  3Q3M C;  1T5X D;  2RDH A;  2K8B A;  2MSE D;  1AAR A;  5E6N A;  2LJ5 A;  1FEH A;  1F0Z A;  4PYU A;  5JZE B;  4CYE A;  3CIR B;  4M00 A;  1TBE A;  2WXK A;  1PGX A;  2JRH A;  3PT2 B;  4BKS D;  2J53 A;  1EU4 A;  1GB4 A;  1WGG A;  3DBH B;  4KGS A;  1WXM A;  3DRE A; 
#chains in the Genus database with same CATH homology
 3NZT A;  1HTQ A;  2UU7 A;  4BAX A;  2WGS A;  3LN7 A;  3LN6 A;  3IG5 A;  4LNI A;  2BVC A;  2OJW A;  1VA6 A;  3LVW A;  4HPP A;  3LVV A;  2GWD A;  1TT4 A;  1LGR A;  2GWC A;  2QC8 A;  2GLS A;  1HTO A;  2D3A A;  3ZXR A;  4S0R A;  4ACF A;  3FKY A;  4XYC A;  1R8G A;  2D3B A;  2D33 A;  3NG0 A;  3ZXV A;  2WHI A;  2D3C A;  4LNF A;  1F1H A;  2LGS A;  4LNN A;  4S17 A;  1FPY A;  2D32 A;  1V4G A;  3IG8 A;  1F52 A;  4LNO A;  4LNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...