2OJXA

Molecular and structural basis of polo-like kinase 1 substrate recognition: implications in centrosomal localization
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
222
structure length
204
Chain Sequence
b'HLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSERLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PLK1
publication title Molecular and structural basis of polo-like kinase 1 substrate recognition: Implications in centrosomal localization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 61
structure length 204
sequence length 222
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2007-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 2ojxA02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 2ojxA01
3P34A 3C5LA 4RCPA 4WHLA 4E9CA 4O6WA 2N19A 2OJXA 3BZIA 4LKMA 3FVHA 4O56A 3P35A 3HIHA 4X9VA 4X9WA 4HCOA 4LKLA 4X9RA 4DFWA 3RQ7A 3HIKA 3P36A 2OGQA 4H71A 5LHZA 4YYPA 1Q4OA 3P2WA 4XB0A 4J7BB 4E67A 5DMVC 5DNJA 1Q4KA 3Q1IA 4WHKA 1UMWA 4HY2A 4H5XA 4E9DA 3P2ZA 5DMSA 5J19A 4O9WA 4WHHA 4RS6A 4HABA 3P37A
chains in the Genus database with same CATH superfamily
3C5LA 1E2TA 4LKMA 2OJXA 4G7NA 1E2SP 4O56A 2I9XA 4N7VA 3RQ7A 3P36A 2QZUA 2OGQA 4H71A 4CYSA 4FDIA 4XB0A 1E1ZP 3LM3A 4CXSA 1E3CP 5DNJA 1Q4KA 1F32A 4CXKA 3HMJG 4WHHA 4FDJA 3P34A 2E50A 3BZIA 4X9WA 3ED4A 4X9RA 3KDRA 5DMVC 1AUKA 3HFDA 2VKZG 4CXUA 3P2ZA 1N2LA 5J19A 1FSUA 2I9ZA 4RS6A 4HABA 3P37A 4WHLA 4E9CA 2IA9A 1HDHA 3FVHA 3HIHA 3P35A 4HCOA 1F34B 3GYVA 5LHZA 4YYPA 1Q4OA 3P2WA 4J7BB 4E67A 4WHKA 1N2KA 4HY2A 4NK7A 5DMSA 4NKBA 4RCPA 1E33P 3GYWA 1A87A 4O6WA 3LXQA 2N19A 5DAYA 4N9JA 4X9VA 5AJ9A 1P49A 4LKLA 4DFWA 3HIKA 2UV8G 3FS3A 3Q1IA 1UMWA 4CYRA 4H5XA 4E9DA 4N7ZA 4O9WA
chains in the Genus database with same CATH topology
3P34A 3C5LA 4RCPA 4WHLA 4E9CA 4O6WA 2N19A 2OJXA 3BZIA 4LKMA 3FVHA 4O56A 3P35A 3HIHA 4X9VA 4X9WA 4HCOA 4LKLA 4X9RA 4DFWA 3RQ7A 3HIKA 3P36A 2OGQA 4H71A 5LHZA 4YYPA 1Q4OA 3P2WA 4XB0A 4J7BB 4E67A 5DMVC 5DNJA 1Q4KA 3Q1IA 4WHKA 1UMWA 4HY2A 4H5XA 4E9DA 3P2ZA 5DMSA 5J19A 4O9WA 4WHHA 4RS6A 4HABA 3P37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P34 A;  3C5L A;  4RCP A;  4WHL A;  4E9C A;  4O6W A;  2N19 A;  2OJX A;  3BZI A;  4LKM A;  3FVH A;  4O56 A;  3P35 A;  3HIH A;  4X9V A;  4X9W A;  4HCO A;  4LKL A;  4X9R A;  4DFW A;  3RQ7 A;  3HIK A;  3P36 A;  2OGQ A;  4H71 A;  5LHZ A;  4YYP A;  1Q4O A;  3P2W A;  4XB0 A;  4J7B B;  4E67 A;  5DMV C;  5DNJ A;  1Q4K A;  3Q1I A;  4WHK A;  1UMW A;  4HY2 A;  4H5X A;  4E9D A;  3P2Z A;  5DMS A;  5J19 A;  4O9W A;  4WHH A;  4RS6 A;  4HAB A;  3P37 A; 
#chains in the Genus database with same CATH topology
 3C5L A;  1E2T A;  4LKM A;  2OJX A;  4G7N A;  1E2S P;  4O56 A;  2I9X A;  4N7V A;  3RQ7 A;  3P36 A;  2QZU A;  2OGQ A;  4H71 A;  4CYS A;  4FDI A;  4XB0 A;  1E1Z P;  3LM3 A;  4CXS A;  1E3C P;  5DNJ A;  1Q4K A;  1F32 A;  4CXK A;  3HMJ G;  4WHH A;  4FDJ A;  3P34 A;  2E50 A;  3BZI A;  4X9W A;  3ED4 A;  4X9R A;  3KDR A;  5DMV C;  1AUK A;  3HFD A;  2VKZ G;  4CXU A;  3P2Z A;  1N2L A;  5J19 A;  1FSU A;  2I9Z A;  4RS6 A;  4HAB A;  3P37 A;  4WHL A;  4E9C A;  2IA9 A;  1HDH A;  3FVH A;  3HIH A;  3P35 A;  4HCO A;  1F34 B;  3GYV A;  5LHZ A;  4YYP A;  1Q4O A;  3P2W A;  4J7B B;  4E67 A;  4WHK A;  1N2K A;  4HY2 A;  4NK7 A;  5DMS A;  4NKB A;  4RCP A;  1E33 P;  3GYW A;  1A87 A;  4O6W A;  3LXQ A;  2N19 A;  5DAY A;  4N9J A;  4X9V A;  5AJ9 A;  1P49 A;  4LKL A;  4DFW A;  3HIK A;  2UV8 G;  3FS3 A;  3Q1I A;  1UMW A;  4CYR A;  4H5X A;  4E9D A;  4N7Z A;  4O9W A; 
#chains in the Genus database with same CATH homology
 3P34 A;  3C5L A;  4RCP A;  4WHL A;  4E9C A;  4O6W A;  2N19 A;  2OJX A;  3BZI A;  4LKM A;  3FVH A;  4O56 A;  3P35 A;  3HIH A;  4X9V A;  4X9W A;  4HCO A;  4LKL A;  4X9R A;  4DFW A;  3RQ7 A;  3HIK A;  3P36 A;  2OGQ A;  4H71 A;  5LHZ A;  4YYP A;  1Q4O A;  3P2W A;  4XB0 A;  4J7B B;  4E67 A;  5DMV C;  5DNJ A;  1Q4K A;  3Q1I A;  4WHK A;  1UMW A;  4HY2 A;  4H5X A;  4E9D A;  3P2Z A;  5DMS A;  5J19 A;  4O9W A;  4WHH A;  4RS6 A;  4HAB A;  3P37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...