2OJYD

Crystal structure of indol-3-acetaldehyde derived ttq-amide adduct of aromatic amine dehydrogenase
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
Knots found
sequence length
110
structure length
109
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase, small subunit
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 28
structure length 109
sequence length 110
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2007-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2ojyD00
3C75L 2IUPD 2HKRD 2Q7QD 2AGLD 3ORVC 2AGXD 2J56L 2J57K 4FA5C 2GC4B 4L3HC 2HJ4D 4K3IC 3SXTC 4FAVC 4Y5RC 2GC7B 4FA4C 3SWSC 3L4MC 2MADL 4FA9C 2H47B 1MAFL 1MG2B 2IUQD 2IURD 2IUVD 3L4OC 3SVWC 2I0SD 2OJYD 2J55L 2OK4D 3PXTC 3SJLC 2HJBD 2AGWD 4L1QC 3RN1C 4FB1C 2I0TD 2OK6D 4FANC 4L3GC 4FA1C 3RN0C 3SLEC 2IAAB 2OIZD 3RMZC 2H3XB 1MG3B 2BBKL 1MAEL 1MDAL 2AGZD 3PXSC 2MTAL 2AH0D 3PXWC 2AH1D 2I0RD 2HKMD 2AGYD 4O1QC 2HXCD 3RLMC
chains in the Genus database with same CATH superfamily
3C75L 2IUPD 2HKRD 2Q7QD 2AGLD 3ORVC 2AGXD 2J56L 2J57K 4FA5C 2GC4B 4L3HC 2HJ4D 4K3IC 3SXTC 4FAVC 4Y5RC 2GC7B 4FA4C 3SWSC 3L4MC 2MADL 4FA9C 2H47B 1MAFL 1MG2B 2IUQD 2IURD 2IUVD 3L4OC 3SVWC 2I0SD 2OJYD 2J55L 2OK4D 3PXTC 3SJLC 2HJBD 2AGWD 4L1QC 3RN1C 4FB1C 2I0TD 2OK6D 4FANC 4L3GC 4FA1C 3RN0C 3SLEC 2IAAB 2OIZD 3RMZC 2H3XB 1MG3B 2BBKL 1MAEL 1MDAL 2AGZD 3PXSC 2MTAL 2AH0D 3PXWC 2AH1D 2I0RD 2HKMD 2AGYD 4O1QC 2HXCD 3RLMC
chains in the Genus database with same CATH topology
3C75L 2IUPD 2HKRD 2Q7QD 2AGLD 3ORVC 2AGXD 2J56L 2J57K 4FA5C 2GC4B 4L3HC 2HJ4D 4K3IC 3SXTC 4FAVC 4Y5RC 2GC7B 4FA4C 3SWSC 3L4MC 2MADL 4FA9C 2H47B 1MAFL 1MG2B 2IUQD 2IURD 2IUVD 3L4OC 3SVWC 2I0SD 2OJYD 2J55L 2OK4D 3PXTC 3SJLC 2HJBD 2AGWD 4L1QC 3RN1C 4FB1C 2I0TD 2OK6D 4FANC 4L3GC 4FA1C 3RN0C 3SLEC 2IAAB 2OIZD 3RMZC 2H3XB 1MG3B 2BBKL 1MAEL 1MDAL 2AGZD 3PXSC 2MTAL 2AH0D 3PXWC 2AH1D 2I0RD 2HKMD 2AGYD 4O1QC 2HXCD 3RLMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C75 L;  2IUP D;  2HKR D;  2Q7Q D;  2AGL D;  3ORV C;  2AGX D;  2J56 L;  2J57 K;  4FA5 C;  2GC4 B;  4L3H C;  2HJ4 D;  4K3I C;  3SXT C;  4FAV C;  4Y5R C;  2GC7 B;  4FA4 C;  3SWS C;  3L4M C;  2MAD L;  4FA9 C;  2H47 B;  1MAF L;  1MG2 B;  2IUQ D;  2IUR D;  2IUV D;  3L4O C;  3SVW C;  2I0S D;  2OJY D;  2J55 L;  2OK4 D;  3PXT C;  3SJL C;  2HJB D;  2AGW D;  4L1Q C;  3RN1 C;  4FB1 C;  2I0T D;  2OK6 D;  4FAN C;  4L3G C;  4FA1 C;  3RN0 C;  3SLE C;  2IAA B;  2OIZ D;  3RMZ C;  2H3X B;  1MG3 B;  2BBK L;  1MAE L;  1MDA L;  2AGZ D;  3PXS C;  2MTA L;  2AH0 D;  3PXW C;  2AH1 D;  2I0R D;  2HKM D;  2AGY D;  4O1Q C;  2HXC D;  3RLM C; 
#chains in the Genus database with same CATH topology
 3C75 L;  2IUP D;  2HKR D;  2Q7Q D;  2AGL D;  3ORV C;  2AGX D;  2J56 L;  2J57 K;  4FA5 C;  2GC4 B;  4L3H C;  2HJ4 D;  4K3I C;  3SXT C;  4FAV C;  4Y5R C;  2GC7 B;  4FA4 C;  3SWS C;  3L4M C;  2MAD L;  4FA9 C;  2H47 B;  1MAF L;  1MG2 B;  2IUQ D;  2IUR D;  2IUV D;  3L4O C;  3SVW C;  2I0S D;  2OJY D;  2J55 L;  2OK4 D;  3PXT C;  3SJL C;  2HJB D;  2AGW D;  4L1Q C;  3RN1 C;  4FB1 C;  2I0T D;  2OK6 D;  4FAN C;  4L3G C;  4FA1 C;  3RN0 C;  3SLE C;  2IAA B;  2OIZ D;  3RMZ C;  2H3X B;  1MG3 B;  2BBK L;  1MAE L;  1MDA L;  2AGZ D;  3PXS C;  2MTA L;  2AH0 D;  3PXW C;  2AH1 D;  2I0R D;  2HKM D;  2AGY D;  4O1Q C;  2HXC D;  3RLM C; 
#chains in the Genus database with same CATH homology
 3C75 L;  2IUP D;  2HKR D;  2Q7Q D;  2AGL D;  3ORV C;  2AGX D;  2J56 L;  2J57 K;  4FA5 C;  2GC4 B;  4L3H C;  2HJ4 D;  4K3I C;  3SXT C;  4FAV C;  4Y5R C;  2GC7 B;  4FA4 C;  3SWS C;  3L4M C;  2MAD L;  4FA9 C;  2H47 B;  1MAF L;  1MG2 B;  2IUQ D;  2IUR D;  2IUV D;  3L4O C;  3SVW C;  2I0S D;  2OJY D;  2J55 L;  2OK4 D;  3PXT C;  3SJL C;  2HJB D;  2AGW D;  4L1Q C;  3RN1 C;  4FB1 C;  2I0T D;  2OK6 D;  4FAN C;  4L3G C;  4FA1 C;  3RN0 C;  3SLE C;  2IAA B;  2OIZ D;  3RMZ C;  2H3X B;  1MG3 B;  2BBK L;  1MAE L;  1MDA L;  2AGZ D;  3PXS C;  2MTA L;  2AH0 D;  3PXW C;  2AH1 D;  2I0R D;  2HKM D;  2AGY D;  4O1Q C;  2HXC D;  3RLM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...