2OJYD

Crystal structure of indol-3-acetaldehyde derived ttq-amide adduct of aromatic amine dehydrogenase
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
Knots found
sequence length
110
structure length
109
Chain Sequence
b'EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase, small subunit
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 28
structure length 109
sequence length 110
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2007-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2ojyD00
3RMZC 2I0RD 2J57K 2HKRD 2BBKL 2J56L 2OJYD 3RN0C 3C75L 2OK4D 4FA1C 4FA4C 4FB1C 2IUPD 4FA9C 1MDAL 1MG3B 2IUQD 4O1QC 2MADL 3SVWC 2IURD 1MAFL 3RN1C 2IUVD 2AGWD 2OIZD 3L4MC 4FANC 3SJLC 4FA5C 2OK6D 2GC4B 2IAAB 2I0TD 2MTAL 3SWSC 2AGZD 2HKMD 2AGLD 4L1QC 1MAEL 2J55L 3PXTC 2H3XB 2AGYD 3L4OC 3PXSC 4L3GC 2AH0D 3SXTC 2H47B 2HJBD 2I0SD 2AGXD 2HJ4D 3RLMC 4L3HC 4Y5RC 4FAVC 2Q7QD 2GC7B 3PXWC 4K3IC 3SLEC 1MG2B 2AH1D 3ORVC 2HXCD
chains in the Genus database with same CATH superfamily
3RMZC 2I0RD 2J57K 2HKRD 2BBKL 2J56L 2OJYD 3RN0C 3C75L 2OK4D 4FA1C 4FA4C 4FB1C 2IUPD 4FA9C 1MDAL 1MG3B 2IUQD 4O1QC 2MADL 3SVWC 2IURD 1MAFL 3RN1C 2IUVD 2AGWD 2OIZD 3L4MC 4FANC 3SJLC 4FA5C 2OK6D 2GC4B 2IAAB 2I0TD 2MTAL 3SWSC 2AGZD 2HKMD 2AGLD 4L1QC 1MAEL 2J55L 3PXTC 2H3XB 2AGYD 3L4OC 3PXSC 4L3GC 2AH0D 3SXTC 2H47B 2HJBD 2I0SD 2AGXD 2HJ4D 3RLMC 4L3HC 4Y5RC 4FAVC 2Q7QD 2GC7B 3PXWC 4K3IC 3SLEC 1MG2B 2AH1D 3ORVC 2HXCD
chains in the Genus database with same CATH topology
3RMZC 2I0RD 2J57K 2HKRD 2BBKL 2J56L 2OJYD 3RN0C 3C75L 2OK4D 4FA1C 4FA4C 4FB1C 2IUPD 4FA9C 1MDAL 1MG3B 2IUQD 4O1QC 2MADL 3SVWC 2IURD 1MAFL 3RN1C 2IUVD 2AGWD 2OIZD 3L4MC 4FANC 3SJLC 4FA5C 2OK6D 2GC4B 2IAAB 2I0TD 2MTAL 3SWSC 2AGZD 2HKMD 2AGLD 4L1QC 1MAEL 2J55L 3PXTC 2H3XB 2AGYD 3L4OC 3PXSC 4L3GC 2AH0D 3SXTC 2H47B 2HJBD 2I0SD 2AGXD 2HJ4D 3RLMC 4L3HC 4Y5RC 4FAVC 2Q7QD 2GC7B 3PXWC 4K3IC 3SLEC 1MG2B 2AH1D 3ORVC 2HXCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMZ C;  2I0R D;  2J57 K;  2HKR D;  2BBK L;  2J56 L;  2OJY D;  3RN0 C;  3C75 L;  2OK4 D;  4FA1 C;  4FA4 C;  4FB1 C;  2IUP D;  4FA9 C;  1MDA L;  1MG3 B;  2IUQ D;  4O1Q C;  2MAD L;  3SVW C;  2IUR D;  1MAF L;  3RN1 C;  2IUV D;  2AGW D;  2OIZ D;  3L4M C;  4FAN C;  3SJL C;  4FA5 C;  2OK6 D;  2GC4 B;  2IAA B;  2I0T D;  2MTA L;  3SWS C;  2AGZ D;  2HKM D;  2AGL D;  4L1Q C;  1MAE L;  2J55 L;  3PXT C;  2H3X B;  2AGY D;  3L4O C;  3PXS C;  4L3G C;  2AH0 D;  3SXT C;  2H47 B;  2HJB D;  2I0S D;  2AGX D;  2HJ4 D;  3RLM C;  4L3H C;  4Y5R C;  4FAV C;  2Q7Q D;  2GC7 B;  3PXW C;  4K3I C;  3SLE C;  1MG2 B;  2AH1 D;  3ORV C;  2HXC D; 
#chains in the Genus database with same CATH topology
 3RMZ C;  2I0R D;  2J57 K;  2HKR D;  2BBK L;  2J56 L;  2OJY D;  3RN0 C;  3C75 L;  2OK4 D;  4FA1 C;  4FA4 C;  4FB1 C;  2IUP D;  4FA9 C;  1MDA L;  1MG3 B;  2IUQ D;  4O1Q C;  2MAD L;  3SVW C;  2IUR D;  1MAF L;  3RN1 C;  2IUV D;  2AGW D;  2OIZ D;  3L4M C;  4FAN C;  3SJL C;  4FA5 C;  2OK6 D;  2GC4 B;  2IAA B;  2I0T D;  2MTA L;  3SWS C;  2AGZ D;  2HKM D;  2AGL D;  4L1Q C;  1MAE L;  2J55 L;  3PXT C;  2H3X B;  2AGY D;  3L4O C;  3PXS C;  4L3G C;  2AH0 D;  3SXT C;  2H47 B;  2HJB D;  2I0S D;  2AGX D;  2HJ4 D;  3RLM C;  4L3H C;  4Y5R C;  4FAV C;  2Q7Q D;  2GC7 B;  3PXW C;  4K3I C;  3SLE C;  1MG2 B;  2AH1 D;  3ORV C;  2HXC D; 
#chains in the Genus database with same CATH homology
 3RMZ C;  2I0R D;  2J57 K;  2HKR D;  2BBK L;  2J56 L;  2OJY D;  3RN0 C;  3C75 L;  2OK4 D;  4FA1 C;  4FA4 C;  4FB1 C;  2IUP D;  4FA9 C;  1MDA L;  1MG3 B;  2IUQ D;  4O1Q C;  2MAD L;  3SVW C;  2IUR D;  1MAF L;  3RN1 C;  2IUV D;  2AGW D;  2OIZ D;  3L4M C;  4FAN C;  3SJL C;  4FA5 C;  2OK6 D;  2GC4 B;  2IAA B;  2I0T D;  2MTA L;  3SWS C;  2AGZ D;  2HKM D;  2AGL D;  4L1Q C;  1MAE L;  2J55 L;  3PXT C;  2H3X B;  2AGY D;  3L4O C;  3PXS C;  4L3G C;  2AH0 D;  3SXT C;  2H47 B;  2HJB D;  2I0S D;  2AGX D;  2HJ4 D;  3RLM C;  4L3H C;  4Y5R C;  4FAV C;  2Q7Q D;  2GC7 B;  3PXW C;  4K3I C;  3SLE C;  1MG2 B;  2AH1 D;  3ORV C;  2HXC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...