2OJYD

Crystal structure of indol-3-acetaldehyde derived ttq-amide adduct of aromatic amine dehydrogenase
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
Knots found
sequence length
110
structure length
109
Chain Sequence
EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase, small subunit
publication title New insights into the reductive half-reaction mechanism of aromatic amine dehydrogenase revealed by reaction with carbinolamine substrates.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 28
structure length 109
sequence length 110
chains with identical sequence H
other databases KnotProt 2.0: K
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2007-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 2ojyD00
2AGLD 2H3XB 2HXCD 3RN0C 4FANC 2GC7B 2AGWD 3SJLC 3RMZC 1MAFL 2OJYD 4FA1C 3RLMC 4Y5RC 2IAAB 2OIZD 2J56L 2J55L 4L3HC 3L4OC 1MDAL 2OK6D 3C75L 2IUPD 3RN1C 2HJ4D 2IUVD 2H47B 3SXTC 4FB1C 4FA9C 1MG2B 2HKRD 3SLEC 2GC4B 3PXWC 4O1QC 4FA5C 3ORVC 2BBKL 1MAEL 4FAVC 3SVWC 3L4MC 3PXSC 4K3IC 3PXTC 2I0TD 2AGYD 2HKMD 2Q7QD 2MADL 1MG3B 2I0SD 4L1QC 4L3GC 2MTAL 2I0RD 2J57K 3SWSC 2IURD 2AH1D 2HJBD 2IUQD 4FA4C 2AH0D 2AGXD 2AGZD 2OK4D
chains in the Genus database with same CATH superfamily
2AGLD 2H3XB 2HXCD 3RN0C 4FANC 2GC7B 2AGWD 3SJLC 3RMZC 1MAFL 2OJYD 4FA1C 3RLMC 4Y5RC 2IAAB 2OIZD 2J56L 2J55L 4L3HC 3L4OC 1MDAL 2OK6D 3C75L 2IUPD 3RN1C 2HJ4D 2IUVD 2H47B 3SXTC 4FB1C 4FA9C 1MG2B 2HKRD 3SLEC 2GC4B 3PXWC 4O1QC 4FA5C 3ORVC 2BBKL 1MAEL 4FAVC 3SVWC 3L4MC 3PXSC 4K3IC 3PXTC 2I0TD 2AGYD 2HKMD 2Q7QD 2MADL 1MG3B 2I0SD 4L1QC 4L3GC 2MTAL 2I0RD 2J57K 3SWSC 2IURD 2AH1D 2HJBD 2IUQD 4FA4C 2AH0D 2AGXD 2AGZD 2OK4D
chains in the Genus database with same CATH topology
2AGLD 2H3XB 2HXCD 3RN0C 4FANC 2GC7B 2AGWD 3SJLC 3RMZC 1MAFL 2OJYD 4FA1C 3RLMC 4Y5RC 2IAAB 2OIZD 2J56L 2J55L 4L3HC 3L4OC 1MDAL 2OK6D 3C75L 2IUPD 3RN1C 2HJ4D 2IUVD 2H47B 3SXTC 4FB1C 4FA9C 1MG2B 2HKRD 3SLEC 2GC4B 3PXWC 4O1QC 4FA5C 3ORVC 2BBKL 1MAEL 4FAVC 3SVWC 3L4MC 3PXSC 4K3IC 3PXTC 2I0TD 2AGYD 2HKMD 2Q7QD 2MADL 1MG3B 2I0SD 4L1QC 4L3GC 2MTAL 2I0RD 2J57K 3SWSC 2IURD 2AH1D 2HJBD 2IUQD 4FA4C 2AH0D 2AGXD 2AGZD 2OK4D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGL D;  2H3X B;  2HXC D;  3RN0 C;  4FAN C;  2GC7 B;  2AGW D;  3SJL C;  3RMZ C;  1MAF L;  2OJY D;  4FA1 C;  3RLM C;  4Y5R C;  2IAA B;  2OIZ D;  2J56 L;  2J55 L;  4L3H C;  3L4O C;  1MDA L;  2OK6 D;  3C75 L;  2IUP D;  3RN1 C;  2HJ4 D;  2IUV D;  2H47 B;  3SXT C;  4FB1 C;  4FA9 C;  1MG2 B;  2HKR D;  3SLE C;  2GC4 B;  3PXW C;  4O1Q C;  4FA5 C;  3ORV C;  2BBK L;  1MAE L;  4FAV C;  3SVW C;  3L4M C;  3PXS C;  4K3I C;  3PXT C;  2I0T D;  2AGY D;  2HKM D;  2Q7Q D;  2MAD L;  1MG3 B;  2I0S D;  4L1Q C;  4L3G C;  2MTA L;  2I0R D;  2J57 K;  3SWS C;  2IUR D;  2AH1 D;  2HJB D;  2IUQ D;  4FA4 C;  2AH0 D;  2AGX D;  2AGZ D;  2OK4 D; 
#chains in the Genus database with same CATH topology
 2AGL D;  2H3X B;  2HXC D;  3RN0 C;  4FAN C;  2GC7 B;  2AGW D;  3SJL C;  3RMZ C;  1MAF L;  2OJY D;  4FA1 C;  3RLM C;  4Y5R C;  2IAA B;  2OIZ D;  2J56 L;  2J55 L;  4L3H C;  3L4O C;  1MDA L;  2OK6 D;  3C75 L;  2IUP D;  3RN1 C;  2HJ4 D;  2IUV D;  2H47 B;  3SXT C;  4FB1 C;  4FA9 C;  1MG2 B;  2HKR D;  3SLE C;  2GC4 B;  3PXW C;  4O1Q C;  4FA5 C;  3ORV C;  2BBK L;  1MAE L;  4FAV C;  3SVW C;  3L4M C;  3PXS C;  4K3I C;  3PXT C;  2I0T D;  2AGY D;  2HKM D;  2Q7Q D;  2MAD L;  1MG3 B;  2I0S D;  4L1Q C;  4L3G C;  2MTA L;  2I0R D;  2J57 K;  3SWS C;  2IUR D;  2AH1 D;  2HJB D;  2IUQ D;  4FA4 C;  2AH0 D;  2AGX D;  2AGZ D;  2OK4 D; 
#chains in the Genus database with same CATH homology
 2AGL D;  2H3X B;  2HXC D;  3RN0 C;  4FAN C;  2GC7 B;  2AGW D;  3SJL C;  3RMZ C;  1MAF L;  2OJY D;  4FA1 C;  3RLM C;  4Y5R C;  2IAA B;  2OIZ D;  2J56 L;  2J55 L;  4L3H C;  3L4O C;  1MDA L;  2OK6 D;  3C75 L;  2IUP D;  3RN1 C;  2HJ4 D;  2IUV D;  2H47 B;  3SXT C;  4FB1 C;  4FA9 C;  1MG2 B;  2HKR D;  3SLE C;  2GC4 B;  3PXW C;  4O1Q C;  4FA5 C;  3ORV C;  2BBK L;  1MAE L;  4FAV C;  3SVW C;  3L4M C;  3PXS C;  4K3I C;  3PXT C;  2I0T D;  2AGY D;  2HKM D;  2Q7Q D;  2MAD L;  1MG3 B;  2I0S D;  4L1Q C;  4L3G C;  2MTA L;  2I0R D;  2J57 K;  3SWS C;  2IUR D;  2AH1 D;  2HJB D;  2IUQ D;  4FA4 C;  2AH0 D;  2AGX D;  2AGZ D;  2OK4 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...