2OK0H

Fab ed10-dna complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
216
Chain Sequence
EVQLEESGPELVKPGASVKISCKASGYTFTDYYMNWLRQKPGQGLEWIGWVYPGSIKYNEKFKDKATLTADTSSSIVYMHLSSLTSDDNAVYFCTRWTYGSSFDYWGEGTLLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*C)-3'
publication title Specific recognition of a DNA immunogen by its elicited antibody
pubmed doi rcsb
molecule tags Immune system/dna
total genus 42
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2007-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ok0H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ok0H02
3MRHB 5CILL 1W8OA 1L7IH 2DRUA 1P7QA 5IVZA 4GRWH 4HQQH 4KHTL 3U2SA 3GSNL 5E1AB 4LCWE 4UIMA 5DLML 5I18L 4ZNCD 4N0UA 1QR1B 5IFJB 3OKMA 5BCAA 4ODHL 3MUZ1 3LKNB 4PRAA 4HAFA 3JTSB 1SY6A 3SGKA 3UPCA 2G60L 1IC5H 2WW8A 4DKEL 1XGPA 3GRWL 4CVWA 1FNEA 1P4IH 2F74B 1G9NH 2CO7B 4FZ8L 4JY4A 4K9EL 2FSEB 4NKOA 5INCB 5I17B 1CD1A 4FZEL 5GHWL 4POUB 4PGBB 2GFBA 5DTFB 2IBBA 5F6HI 4WIQA 4ENEC 2Z4QA 3DX8B 4HK0A 4OIBA 4Y5XB 5DD6B 5F9AC 4P2RE 5AYUL 5A2FA 1ZHLB 1IM9B 1IGFH 2Z93A 3LQAL 2A6IB 4XP4L 3X3FH 2ZOLB 4NQSB 5GGRY 3QAZC 2EH7L 4YXKL 1QRNB 1RUQL 1P7KB 3GKWL 4PJHE 5BRZA 2ESVD 4HK3J 3TPUB 4L8CA 4R0LB 4OBRA 4BFEA 1U95B 5E94B 4K8RD 4LHUG 1C1EL 4JFFD 2VNCA 1Q0XH 1ED3A 2W0LA 4M6NL 3RDTC 3IDNB 1L6ZA 2BVPB 5HVHB 1XIWB 2XZQH 2BCKA 1SVZA 2OJZH 3SOBH 2W0FB 1LO5A 4S2SB 1M7DA 5E00B 2IAMB 2FJFA 1WF5A 3ZE2F 2PXYC 1JGEA 2FX7L 4OFKA 1VESA 3TBYB 5GZOD 4GRWE 3RPIA 5JZ7C 3AB0B 4A6YL 1C08A 3VXTB 4V1DD 2BX5A 4MD0A 1F58H 2JCCA 5DGRA 3Q3GB 5D7IF 2HFFA 2YEZB 2GUOA 3N06B 5JOPE 1J88A 3QFDA 1EO5A 4P2YA 2DQIH 4IOIB 3PQYD 4LGRB 5F8RC 3JBG7 3KJ4B 4FTVE 4CL7A 5T3XD 8CGTA 2EE3A 1EAPA 4ZFOL 4ZFFA 1EEQA 4YO0B 2EXYC 3IS0X 5K93A 2IANB 4PREA 3K4ZA 1PYWA 2CKBB 4TPRL 3WS6A 1N6VA 4XCYB 4KXZI 1UEMA 5FV2A 3JUZA 1OF2A 1CDYA 1EGJL 4NN6C 4MXQD 5LKNA 4JG0L 4JANA 2OQJB 3PWVA 3IGAB 2J88H 3I9GH 4QYOA 5DI8B 3CH8A 2D03H 1EX0A 1DP0A 1WWCA 2UUDH 1E4KC 2ILLA 1F4WH 5HTSA 5JHLL 1EHLL 4BSWB 4MCZA 1RV6X 4XAWL 3QWQB 3FTGB 5JW4Q 1OGTA 1JZ3A 4EI5D 3NACH 1WBYA 3LKRA 5H94B 2FHBA 2YPLB 1ADQH 2A6KA 3ARED 1NUGA 2C26A 1RZ8A 1QBAA 3VXMB 2Z31B 4U7KA 4L4VD 5KVGH 3BT2L 3FFDA 4MAUL 3SE8L 1MWAH 1CDCA 3HAEH 3TZVC 3UTSE 1GHFH 2A0LD 3PGCB 2OZ4L 4IMLA 4PJFA 1MHPL 4FFZL 5JQHC 2Q3ZA 4WRLA 1JPTL 4G8GD 4I0PB 4XH2A 3T1WA 2GQHA 1WZ1H 4HG4J 3T1FB 4YDKH 5J11B 5J06A 1F6AB 3DXAD 3LS4L 4FQJL 4K07A 5EU3A 4N0RA 3DNKA 4HPOL 4H8WL 1K5NA 5F6IB 3BQUA 3D6GA 1U8PB 3STZA 5D2LA 1LE5B 4PS4L 1IEBA 2AEWA 2HA1A 2YA0A 3MV7E 4HIHB 4LSQH 2VDOH 4TRPL 1CFSA 5T5NF 4GW5B 5FYKU 2P5WD 3TN0D 4OF7A 3C8KA 3QWRA 4WTXA 1CDJA 3MFFA 4Z77B 5D1QB 3CMGA 4JHWL 3OXRB 4ZAKB 3FN0L 4E9LA 2EDLA 1XF3B 3ARGD 5C71A 5IOPB 4NZUH 5F9DC 4I3RL 3U79A 4F58L 1MRDH 3MR9A 2AXHA 5EBMB 1FNHA 1CVSC 4M7JL 4FP8L 4HDIA 1QSFE 4GRLA 4Y4KC 2PTTB 3BHBB 2ICWJ 1UB6B 3T2NH 3NN8B 1NAML 2BY0A 4HKJA 5LGHH 3QULA 3SKMB 4MB3A 3TCXA 2O61B 3NFPA 1ZANH 1S9XB 4R26H 4PJ8B 1CS6A 3EDDA 4XWOD 3IRPX 3EFFB 3U0PB 1JBJA 5IW1A 5DJAB 2Q86A 1VERA 1DZBA 2O5YH 5CP7A 5DQ9A 4WUKL 5MEQB 4I18C 3LQZA 4OD3H 3KPLA 1NC4D 5AUMA 4QF1B 2H1PL 1IM3A 1UCBH 5T3ZL 1DL7H 4UDUB 3NAAH 4G6FD 1OOAA 4HLJA 1IRAY 4OCSL 1JYNA 5F97E 1YEEL 3REWB 5TH2A 3T65B 5TFSH 1M7XA 4PJCA 4OGYL 4KRPC 1UZ8A 5GIRA 2Z35A 4APQA 4K94L 4QGYA 3ULVF 1UKSA 1R3KB 2OXHA 1OAQL 2XA3A 1NGWB 3EW3B 4R97C 5DYOB 3ILQD 1ZA3B 3VGAB 4GS7B 4EN3D 1YDPA 3PJSB 2DQGL 4HGWA 3SY0B 5IB2B 4P46B 4LNRA 2QL1A 1I4FA 3HI1B 2XPGB 4R8WL 4ZFZB 1RUML 1F2QA 4JN2B 4LVEA 4N0YH 4WWKC 1JWUA 4NRXB 1RULH 5FCUH 3TVMA 1AGDA 2VXTL 3LRGA 5IM7B 2GJZB 3ZSSA 3BEWB 1JPSH 3O4LA 4MD5A 2EDKA 2QLVB 4XBGB 4QLRA 3D87B 4LGSB 1J1PH 1J05B 1ZHKB 4RMQA 4OZFH 1EIBA 3KYNB 1JIBA 2EIBA 3JWOH 1RJZB 2A38A 3VW3H 5JLZB 2H26A 2R56H 1Q94A 4OAWB 1NCUA 4ZNEE 3DUSA 3RIAF 2HT3C 3KPTA 3UTSB 3W9DB 5IVXA 1HQRA 4D0BA 1CLZL 2W60B 5KVDL 2MMXA 1IGCH 2PF6A 1MFAH 4DJMA 1I1AC 4XVTL 4DFHA 5C0BD 1HSBA 1J11A 3CFBA 5DRWB 5CBEB 4P2QA 5JXEC 5GISH 5IK3B 1P5UA 5IHBA 3P2TA 4W6WB 3H2WA 4AZ8A 2J2ZA 2VSCA 4DW2H 1WVZA 1UWGL 4M6OL 5F89A 2G2RA 3UZVB 1N64L 1MCEA 5I15H 5DMKB 4JVPA 2BSSA 5H35A 3GSVB 2Z91A 3D85D 4IEFB 5HYQA 4YBLC 1XF5A 1H3UA 2I24N 1AXSA 3F7VB 3KPPB 3QIUB 4XHQA 2C4FT 2PCPA 4KKBC 1SMOA 4XBPB 3EO9L 4HWEH 4KJYA 2VIRA 5IIEA 3BZFB 3QO0A 3NIDE 3V6BR 4IHOB 3QRFM 4NJ9L 3TNNB 5FB8B 1L4IA 5BO1L 1KIPB 4CVXA 3LPFA 4X4MA 5CJ5A 5HVWA 1ORQA 2EZ0C 3WFBL 3BN9D 1MY7A 3EDKA 3NPZB 5DJ0B 3OX8B 3RU8L 3CCHA 4QOKA 4JO2L 4NQXA 5EOTB 4NC0B 4FQXC 5MI0C 2AJZB 1D5XB 3HMXL 3QAZB 2CR6A 3V6OC 3RAJH 3V95A 3DO3A 2GJ6A 4JKLA 5CJXC 3QUYC 1MIEH 4J1UA 1A3LH 1KLUB 2AKRA 3SDXF 5DDHA 3RDTB 5FGBC 3LB6D 4ZSOA 1H3VA 1MLBA 4AL8H 5HHQB 3D39D 2H2SC 4UT9L 4AJ0A 2Y72A 3KPSE 4QWWC 3IJSB 4MVBC 2QKIB 1FRGH 2PXYB 2EEAA 3QDAA 1F02I 4PY7B 3HPLB 1BM3H 4H0GA 2VXQH 2AK4A 5I1CL 4LEOB 4ODUB 1YUHB 4XTRD 3BW9B 5DK3A 1NAKH 3C9NA 5KN5A 4HZLA 5C08A 4OF0A 5CZXC 4RISL 5GGVY 2FZ3B 1NANI 3HE7D 4EUPH 1XGYL 1YEJH 4Y89A 4NRZA 3B9KA 3OAZH 2F53A 1R5VA 3MV8A 2AABH 4M7LT 3VI3F 3RZCD 5C3TA 1I9IL 4X6FB 3RI5K 3T09A 1OT2A 3ORJA 3VD7A 3ZHKA 2KZWA 3CSYA 2IQ9L 3VGDA 1EA9C 3G5YA 1JF1B 4P3DB 5JW5A 4NQED 4PRIE 4ZTPL 3MTRA 4LBEA 1AH1A 3FQWA 4G5ZL 3PHQA 1IGML 4RWHA 4JZNA 3P77B 3WO4C 1TLKA 4O2CA 1WAAF 2OTWA 2XTJE 4E41E 2VDQH 5KOMC 2DQHH 4NN6B 1YMMA 4JEGB 3FB7B 2HT4D 2X89A 4OLYL 4U1SA 3LMJH 4LIQL 2DLFL 3GMOB 2Q87A 3VFTB 3MLUH 4PRHE 4U1HA 2X10A 1IEAB 3C60C 2PR4L 4PJGB 4LCUA 2WBJB 3MYZA 3CMOH 3GJEB 5FUCE 5TE4L 1S7RB 4OZHA 3BGFB 3RVXD 2NXZC 4DZ8A 4OQTH 3GSOB 1T2QL 1U91A 4K71C 5J4MA 2W91A 1BOGA 2X40A 5TPWL 1JGLL 3TWCL 3JVGC 1BLNA 5E70A 4QRPE 2D7TL 4QXUL 4FMKA 4JR9H 1Z5LA 1DANU 3TZVB 4OD1H 4G9DA 2XN9B 5DD1H 4AIXA 3KWWB 5IG7A 3MRJB 1IGJB 1UT9A 2OL3A 2YK1H 4PJGF 4RFEA 5C0CD 5FYKE 2QJDA 3JTTA 2VZ1A 1BD2E 2EKJA 4K8RL 5DJ8A 4DGYH 4NYLA 1PY4A 2YBRA 1DQQA 4C54A 2WINA 3BD5A 3MA9H 1GCFA 3ILPB 2JJUA 5F1NA 4LLVA 4LU5L 4LSDA 5SWSB 2W65A 3U82B 4ZUUB 5JO5A 4MQ7B 1EFXA 1L9MA 4AQOA 4DQOH 4P9HL 4S0TD 4DN4L 1FGNH 1JV5B 2AV7B 2Y36H 1U6AL 4KU1A 2OI9B 4D9RD 3O6FD 2FLBT 5IQ9B 2B0SH 5D7JB 2DJSA 4HUVB 4Z0BL 2BXZA 2DLGA 2ZSWA 3MV9D 3RA7H 2DLEA 3MRFA 2Z92A 5ILTL 4YHIB 1AIFB 3I75A 4YGVA 4JFDA 4WO4D 1T4KB 4Q9QH 1H3XA 5E6YA 1PX4A 2HFEB 2JF1A 2AV1B 2JIXA 4AY0A 2GT9A 1A9BB 1Z9OA 4UT6H 1NQBA 1T1XB 4L4TB 5T3XL 5DMIL 1F00I 5KANG 3KPSB 4Y4KB 1KLGB 3HA0A 5TF0A 4RWYH 1EXUB 2FIRT 1KT2A 1CZ8H 3H3PH 2X4NA 2PYFA 3QDGA 3TT1H 3U36A 1A7NH 1FO0B 1PZ5A 3QNZA 5TDPB 5FDWB 5LGKA 3ZMRA 4TVPD 3SCMA 2DL2A 3UZEA 4XVJH 5FV1L 1N5YL 1QEWB 1MQKH 1L6XA 3EGSA 5D5MF 1TITA 2FHCA 5K59F 1CD9B 4HPYH 2AJ3A 3VJ6B 1ZTXH 2CK0H 4I18B 4JRWA 4PLJC 4FQCL 5LJYH 3MNZA 1WBXB 2GYSA 3W0WE 5L2KA 5DHYB 1A6ZB 4HAGA 5DHVH 2ICEA 2NY1D 5MEOB 4OI9A 1TMCB 2ADIB 2ITCA 1FPTL 4F9LA 1AP2B 2V5SA 4FNLL 5HHOB 2XY1A 5EU6D 4ZQKA 2I9TB 1QFWH 3VRIA 4WFED 4GBXA 4UAOB 3S4SB 3E3QE 4R97B 1YPZA 1CXFA 2HP4A 4E41B 1MFDH 2IJ0C 1JWSA 4P3CL 1VKXB 3CVIH 3IFOB 1UWXK 3RIAK 5EBWA 4KPHL 1OSZA 3MBEC 3WS3B 4XNYH 3GJFB 5LVEA 1HHKB 4WNQB 3W2DL 1WZKA 3MUGA 4QXGL 4RNRA 5F7FA 4CVZB 1AGFA 3GBNH 3MRBA 4P4KC 1MREL 1HK6A 3QDJA 1TCRB 5E95B 4FXGA 1LO2H 5ICYA 1S9WA 1V7NL 4KVCH 2WWKO 5FGCE 1FBIL 1FL5A 2K1MA 4LDEB 1BQSA 1NCCH 3VXRE 4ZFGH 5FHAH 4X5WB 3CC5B 6FABH 3ZHDA 4RAVA 2WUCH 4KK9C 3ZYZA 4Z7WA 4PJEE 1I7TA 4U1LA 1P2CA 3INUL 5FKAB 3WV0A 1H5BC 1NLDH 1GYAA 4MZ3A 4P99A 2J5LC 4JQVA 4NC1C 5F3HB 3SDCA 3VXSD 1T89A 5IF0A 4NWUL 4UV7H 3UJTH 3WDHA 1PEZA 3QIWD 1Y6KR 4OCLC 3KPQA 5CMAA 3VXQB 4NM8L 3MACL 3DETD 2QEJA 1XF4A 2IFFL 5EO9A 1AHWC 3PIQA 2XZAH 5I6XC 1A6WL 1DN0B 5IB5A 1XR9A 1W72H 1LP9B 2R0LH 5E8EB 4Y0GA 2FBJH 1K8IA 1NGQH 1HYRC 1G0DA 4NOBA 2SEBA 2X4OA 3B3IB 3CDYA 4JFQA 4M5YL 4ESKA 3KGRA 4YBLB 5DJDB 1U8JA 1MHCA 2XWBA 4LCYA 2YD1A 3HUJA 3RUGA 1QACA 3L1OL 2B1AH 1FFPA 3CVHH 3CU7A 1EK3A 4Y5VA 4M6AA 3QR2A 3GM8A 1HEZB 4O9HL 1P1ZA 4YHOL 1NCDH 3IXAA 3LKSA 2DMKA 1WSST 3FN9A 3PL6D 1PLGL 3V4PH 3S96A 3MRHA 1CLYL 2CDGA 1T0NB 4Q9RL 3NCFB 2R2EA 3O3EB 4ISVA 3K8LA 4FQXB 4JVWA 4L8DB 5J89A 4EOWH 2GY7B 4YZFE 1I7UB 2Q20A 2QHRH 1CGSH 1NUDA 1VFBB 1QR1A 5IFJA 3P0VH 4YEEA 1KCRL 4PRBB 4ELME 3V7AE 2Y6SD 4H20H 3TO4C 2A73A 1IGYA 4C56E 3HCVB 3JTSA 2D9CA 3NIFF 2ZJSL 2AGJH 4FQHB 3QH3B 4KK8C 1AJ7H 3WLWC 1DLHA 4X0KB 1CFVL 3MLWL 4S1RH 2YWZA 3ZHLA 5INCA 2BVYA 4PGBA 2DDQL 5DTFA 2B20A 4OFYA 1OGAB 1NGZB 2QQQA 4Y5XA 1V7ML 3RQ3A 3RVWD 3UTOA 1QBBA 1BBDH 1IM9A 1ZHLA 2D4DA 2A6IA 1NBVL 4ZD3H 3KHOA 2VTFA 2YPVL 4JO4H 1DBJH 2H3NB 2ZOLA 3OR6A 4NQSA 4G6JH 5E2TH 1QRNA 2HRLA 5CEYB 1CIUA 2F54D 3SKNA 4YHML 3TPUA 4KJQD 1J5OH 3BH9A 4R0LA 1U95A 2E7LC 5E94A 5DQJB 2XRAH 3IDJA 4RBPK 4Z0XA 3K4AA 4K3JL 3IDNA 2BVPA 1XIWA 1A14H 1E6OH 2EDNA 2MFNA 3DX7A 3F7QA 2IAMA 5I1AB 1BMGA 3WO4B 1A9EA 4OLEA 2PO6C 2WP3T 1KXTB 1QKZL 5I1KL 4MJ6A 2CD0A 1ZLUH 5SWQA 3X14B 3VXTA 1KCSL 1EHAA 4CJ0A 3C60B 1CLOH 1VPOH 3C5ZC 3SCMD 2RBLA 3CIQA 2NXZB 4M6MH 4EJ1C 1D7FA 4K71B 2R2BB 3NZHH 1ZXQA 2VR4A 1KEML 4BFIA 1U0QA 3P73B 4IBLT 4M48L 1KENH 3QZWG 4V2BA 1NL0L 3BUYB 4JVUA 1WT5C 1C12B 4OZGA 2CKBA 3IDXH 4Y2DD 1PY9A 5F9WC 1ULVA 4YHZL 4FFWC 4FHBD 4JPKH 4QEGA 4XCYA 1KB9K 3MZGB 4LKCA 2R0KH 3BKJH 2C1PB 3MYJA 4GXVH 4NCC1 1C5CL 2X9XA 4WEBL 4F57H 4N0FB 1RK0B 2OQJA 1T0MA 3X11B 3IGAA 3VD9A 4I48B 1Q1JH 3WNKA 1H9VA 4GG8A 3IVKB 1NGPL 4UMGA 4Y5YC 2E6JA 2X4PA 3IU3B 4BSWA 3FTGA 3FO2B 3FB5B 2NY5L 5T1KB 3P4MB 3QJFB 5KJRH 4M03A 2YPLA 4O2EB 5DD3H 2Q7NA 1A22B 4AYFA 2W1NA 4BFGA 1T7WA 1GL4B 2XKNB 4XHJD 4GQ9L 4TQEH 2Z31A 1GGBH 4JCLA 3ARBC 5E5MA 1AI1L 2AJSL 3HE6D 2FYYB 3PGCA 4ELMB 1UEYA 3KYMA 1R6VA 1N6QL 4I0PA 3EO0B 1U93B 3PDGA 4JFXB 3SDCD 3SDAC 5DUBB 4KI5D 2DQJL 3T1FA 3K2UL 1QFUL 1MPAH 4HXBH 5EIQA 3V4UH 2YA1A 4LLMB 4N5ED 5ALCL 3ZDYE 3HB3D 5D4QA 1EV2E 1U8PA 2VZUA 4H1LA 4GKNA 4OFVA 4JFYB 3RWGB 5J1SC 1LE5A 5GQBA 4P2RA 2LV4A 1RUAL 5IQ7H 2VABA 4YHLL 4ACPA 4GW5A 5IKCB 2JELH 3DRTA 1KCVL 4JZOB 4K9EC 4Z77A 4EQ2A 3W5MA 3HLAA 4ZAKA 4KDVA 4GMTL 1XF3A 2HLAB 5IOPA 4WI3A 12E8H 4Y16B 5JIKA 3ZE2E 2Q1EA 3ARDD 1N0XL 1JYWA 3LQAC 4OI8A 1UJTA 4W70A 2I25N 4O5LH 2YS4A 3V79C 1OAYL 3CFJB 5FUOH 1RZFH 3I6KB 1HNGA 4OT1H 2PTTA 5E8NA 5JR1L 1UB6A 3SKMA 5D7IE 5HXMA 1RIVL 2A6DB 2R0WH 3MBEB 4I2XE 4KKLC 4HCRA 3CFKB 4UINH 4L8SC 4PJ8A 2F19L 5J57B 3WUWA 3TA3D 1WC7B 3EFFA 1HCVA 3H8NA 3IDMB 4FQPA 3GK8L 4JFOB 4HUMB 4NKDB 4P4KB 3LEVH 1P6FA 3L5WB 1MELA 2Y06H 5MEQA 3WJJC 2LU4A 3OGOE 2X1PA 5DVMA 4GXUN 1X5LA 2YD4A 4NQDE 1U42A 1T2JA 2OYPA 4OLZL 3MNVB 5BZWA 4MNHA 1H5BB 2J5LB 1NGWA 5DYOA 3UX9B 3U6RA 5F7WC 1OTSD 5LG1A 1ZA3A 3M1BB 5HDOA 3PJSA 5DJZA 4BUHA 1AC6A 3SY0A 5IB2A 1NCAH 2IQAB 1D5BB 4KK6C 4GAJL 4P46A 5DJYB 3QXVA 3HI1A 1DN2A 5SX5H 4HWNA 1AHWB 1OAUH 1G1YA 5B4MC 5I6XB 4NRXA 1X5JA 2NY6C 3QEQD 1RMFL 5DT1L 3QEGH 3OAUH 5J6GB 1YEIL 2PW1B 3CDGB 2R15A 3GGWA 3O3BB 2G5BB 4HBCL 5IM7A 5E2UL 5IB4B 2GJZA 3ZE1E 5AEAA 4LNVA 3P9LB 2FJHB 2JJTC 1DQDH 1J05A 3VXUE 3GUTB 1ZHKA 5FO8B 1JWMB 2P48B 3KYNA 3LV3B 1BFTA 3ULUE 1KB9J 4OUOA 5JLZA 4NJAH 4OAWA 4QHMB 1P4BL 4ELKB 3UTSA 3F8UB 3W9DA 1HHIB 5HHPB 2YZ1A 4UNVA 2IMNA 1JFQH 3QIBD 4DGIL 4AM0A 5J7CC 3IF1B 2C3VB 3ULVH 2FATH 1PQZB 4M5ZH 5E56A 3AU1B 1D9KD 2VLKD 2QR0B 3FAWA 5CBEA 1OP9A 4N8VB 5CP3A 5EUOB 5CEXB 3ES6B 2VC2L 4GAYB 4NNYB 4N0CC 4WUUE 3T0ED 5K9KA 1J0KA 5ALBL 3LY6A 1S7QB 3PWJA 3P30H 5DMKA 2V2XB 3TP4A 4H26A 3HZMA 3TH4T 3Q0HA 1HWHB 2P43B 2E9WA 1HI6B 3F7VA 3KPPA 3QIUA 2RQ8A 3QUMB 4MWFA 5EUOF 4XBPA 5DRZA 3WHE1 1UKQA 2HKHL 4NPYB 1FLTX 2YD7A 3BZFA 5C0RH 1CGYA 1X7QB 4XBEL 3TNNA 3V8OA 5FB8A 4ODBD 1VDGA 4O00A 4AT6A 3RVVD 1KIPA 3V2AR 1QSFA 1QO3B 4XPTH 1H8NA 2QADD 3FL7A 3WJLC 4P2OC 4ONGH 4D3CH 4KZEH 3G6JF 4PJAE 5DJ0A 1CR9H 4HJJH 3OB0K 5EOTA 5C8JA 5MEND 1O0VA 4NKIH 2AJZA 4C4KT 3D3VE 1F90H 4LCWD 2BRRL 4CKVX 4Z5RB 3MROB 2LU3A 3H7BB 4PJXF 5I1IH 3PHSA 1FL3B 1LEGB 5BV7H 3V0VA 1A3RL 2CLRB 1ORSA 3ULVE 1JPFA 1TJGH 5HHQA 3S88H 2DQTL 1CFTB 5GSVA 1FDLH 4U6XB 3PWPE 1OB1A 4U1MA 3OZ9L 3IJSA 2QKIA 3DARA 2PO6B 3SE4C 4PY7A 3QJHB 3HPLA 4GG6F 4HWUA 1Y18B 5GRJH 2VL4A 2OJEB 3O6LH 4ODUA 2NMSA 5HI5C 1YUHA 3BW9A 4XPHH 4XAKD 2IGFH 4F37F 3HMWL 3ESVF 2FZ3A 1J8KA 1S7UB 3C5ZB 2ZP0T 3IU4H 32C2B 1I3GL 3B83A 4G8IB 5I1GH 5B21A 2XWJA 3DVFA 5DGQA 3QI9D 3VXPB 1DFBL 3OF6D 4UUJA 3V9FA 1AC0A 3C08H 1LK3L 4QTHB 5J3HC 2EE9A 3BAEH 5T33L 3HNVH 1X5AA 3L95B 1FFOB 2X9YA 5L0QC 4ZS6D 2R29H 2ZUTA 1JF1A 5F9WB 1XZ0A 1U36A 2CRIA 1IFHH 3VXUB 2ZNWA 1ETZB 1REIA 3N1QC 4G42B 4WHDA 1RVFH 3QPQC 2XFXB 3FB6B 4MB5A 4OF6A 1IT9L 1T80A 5C2UB 4ZNEA 3V52H 1AGCA 2WM0A 4ODSH 3FB7A 3H6JA 4JFEE 1IGIL 4R90L 3TT3L 1BQLL 2V7NA 3VFTA 1TZGL 2DI7A 3QPXL 4Y5YB 4DKFH 4JM2A 4CU8A 3BFOA 2WBJA 3GJEA 2ARWA 1S7RA 4MS8C 4EBQL 1N4XH 2EDBA 1RU9L 3GSOA 2XICA 1K3IA 1OAXL 4DWHA 1GJIA 3VFNB 5FF6A 2N56A 5LGJB 5T1LB 4F3FB 1Q9WB 4FTVD 1MRCL 2DJUA 1INQB 3SJVB 4L3ED 1INDL 3ZTNL 4YPGB 4Z18A 4P9MH 4AEEA 4KGJA 3TZVA 4N9OB 4YE4L 2XN9A 3WL9A 5GSRB 3KWWA 3MRJA 3DX9B 3KLSA 4QRRE 4BQ9A 3GSNB 4OCXH 3WFZA 4HD9A 3VGHA 1X4XA 5D7LE 4J4PA 4NP4H 4G6ML 4XXDB 1BIHA 1SEBA 4U6HA 2F58H 3MBXH 4KRNA 1F8TH 1I3UA 4F15C 4UV4H 4A2LA 5EORH 5D9SB 5DSCB 5HDLA 4XI5C 4O02H 5SWSA 1E4WH 2ADFH 2B1HH 3RGVD 2J6EH 3HAEG 1QSED 3FOLA 3MO1B 1T21A 1ITBB 1JV5A 3B2UC 5F1IA 4OLXH 4HC1L 4HJ0C 5D7JA 3P9WB 1BX2A 3MCLH 4RBPH 3T0VA 4GW1B 2VDNH 1LK2A 1WIPA 2YUZA 1AIFA 3IAGC 1G9EA 4WI9A 4RFNC 3G08A 1T4KA 8FABB 3UZQA 3S9DB 1EO8L 2HFEA 4J7RA 4X99B 4H25B 2DQUL 1A9BA 2XWTB 4XC1L 5EUKB 1EMTL 4PJ5E 1T1XA 1T66D 4L4TA 5AZEL 3KPSA 3LH2L 2AAVA 1EXUA 3BJ91 3OSKA 1KGCE 3OR7A 3LKOB 5A2JH 2ICES 4L8SB 1FO0A 3STLB 1TXKA 2D7NA 5TDPA 3VFSB 5FDWA 4HBQA 5D7SL 3CLFH 4O4YL 4DCQA 1QRKA 3THMH 3VI3E 5ADOH 1SBSH 3KPRE 1QEWA 1UM6H 3MV7D 3WNLA 2NTFA 2BY1A 5EWIL 5JPMB 4I18A 4JB9H 5IHUL 5IVNA 3H9YA 2LAGB 3QUZC 5DHYA 4A6YB 1A6ZA 4Y19B 5EU7C 2DWDA 4POZC 4X4YB 2ZUXA 2ADIA 1E4XI 2BXYA 4JFHE 2RJMA 2Z8VC 5JQ6L 2QSCL 1I8IB 1FORH 3DSFH 1MJ8H 1WFOA 4PRIA 3GZKA 3RP1A 2C3WA 3OJDB 1A7RL 3S4SA 3T4AA 3RWCB 3UYRL 1OQOA 4E41A 1VKXA 3IFOA 4ZFOB 2D0GA 4HF5L 3HC0A 3WS3A 4JFEB 4M9PA 1GGIH 5F7UA 3EYSL 4ZMAT 2E3VA 4WNQA 5HDBF 3CXDH 4YX2H 4OF8A 5D1XA 4WFGE 5DQDL 4N8PA 1UXSB 5FFLA 1T7XA 5C0IB 1TCRA 4Q9BA 2O5XL 4DN3H 4Y1AD 1TNNA 4DK6A 3C2AH 5ESAB 4HIIB 3K2MC 5HBBA 5CUSL 4X5WA 4AIZB 1NGXB 3HKFA 1YECH 4LMQI 4QRPA 4YDJA 3MRCB 3UJJH 1KC5H 5IFAL 43CAB 3RVTD 2BNRD 3IXTB 4X6CF 4OCWH 4PV9B 5F3HA 1Z0NA 4HUKB 4Q0XL 1NBQA 1CYGA 1J8HE 2R69L 4WW1A 5D7LB 4PJDB 2XY2A 1YN6A 1KYOK 2CSPA 3VXQA 2BNQB 3FRUB 2WZPD 4R7NA 1AR1C 3NCBB 4G8EB 4R6UA 1U92B 4MAYD 2ITDB 5AD0B 4TUJA 1A4JB 1DN0A 1BIIB 1S5HB 4LKXB 4A2MA 2BK8A 1EEZB 4U1NB 3N85L 4K8RC 1MOEA 4OFPA 4ZYKA 3KYOA 1MCRA 1GGCH 1XGTB 3B3IA 4U33A 3O0RL 4H0HB 3QG6B 3WIHH 4BA8A 5EO1B 4YK4C 1H0DB 4P9HC 1FNGB 2PYEB 5F7LB 4EXPX 4R9HA 5DUMH 4XVUC 3RTQC 3GNML 1GGYA 3S97C 3MUHL 3GJFH 2OBGA 1RZKL 4YDIL 2XQBL 4I3SL 1HEZA 2YA2A 3I3DA 4G6AC 3D9AL 1BQHB 3HHRB 4LAQL 1KELL 3Q6FB 4HKXB 5HHMD 3EDJA 4P2OB 1J0JA 4PRPB 3TV3L 5D2NC 1T0NA 5K59E 3IDIB 1YEHL 4M7KL 3O3EA 1AR2A 2ZCLL 3DUUB 3U1SH 4NZRH 3V6ZB 3QQ4B 4IMKA 1I9JH 4FQXA 4F37K 5JW3H 2OP4H 4WW2B 4P23A 2BVOB 1VEPA 4JO1L 2KQNA 5JW4M 1LDSA 1NAMB 3IYLW 4RFOL 1R3HB 1D5IH 1NBYB 5T1MA 3LS5H 4PRBA 3W0WA 3FT3A 4OCRH 3VFGH 4WDIB 5I9QB 1XH3B 2FGZA 3QXUA 1AO7E 2ICWA 3CPLA 5KW9H 4DVRL 4FQHA 3QH3A 5E8PB 2AEPL 5JNYA 3OGCB 4X0KA 2NX5E 2V2WB 3HFML 9CGTA 4NFCA 3O45B 3AC0A 3VG9C 2E27L 5GS2H 1L0QA 2BHZA 1RJCA 3A67L 1DE4A 5LXGL 4EI5C 4IDJL 1NGZA 4TSBL 2JJWA 1E4XL 5J6HB 1JJUA 3VA6A 2EYTB 1DQLL 2VDMH 1XT5A 4KK5D 4G9FB 4MDJA 3AREC 3DOSA 2H3NA 2XA8L 1RUPH 1LHZA 1GZPB 5CEYA 1F45A 3Q6GH 3EO1B 4LCIL 1TVHB 3K1KC 2DQDL 1WCQA 3MMEB 3BKYL 4NDMB 4RAUB 1FVEA 3U9UA 3EOBB 1WIOA 1MJUH 1JPGA 5H37G 1G7IB 1MIML 2GSIB 3U7WH 5KAQG 1FE8H 3NOIA 3VXRA 1M6OB 3MODL 4FQQB 4XNUL 5I1AA 2CK2A 2P42B 4PJEA 4ZO8A 2DIJA 1DANT 2HN7A 3O8XC 1CF8L 2BC4B 3MRNB 3BIBX 2J8UE 2LAAA 5IESH 1J8HB 1JZ2A 2R4RL 4YHKL 5LCVL 1WUNT 3X14A 2N4IA 3V5HB 4L9LC 5I76A 3GB7B 2P49B 2J4WL 1MUJA 1IEHA 1NFIB 4PLKD 1AD0B 5JXAH 2P5EE 3TN0C 3I6GB 5HGGS 4FXKB 1MHHA 2R2BA 3VWKC 5IBUG 3I02A 5EU4B 1A3QA 3P73A 1E6JH 4FG6C 4LSSH 2AERT 2NXYD 1MFBH 1DSFH 5TGBB 3FOMB 3RWIB 1C12A 4KHXL 4K55A 1TVBB 5IHLB 3BN3B 1OM3H 2HRPL 5KVEH 2C1PA 5E0QA 5F96H 3CAFA 1KYOJ 3JV6B 4N0FA 1RK0A 5SWZD 4F15B 1UYWH 1NMAH 1FV1A 4I48A 3SKJL 4OZIF 4XWOC 1DBAL 3WLBB 3IU3A 3O9WD 4OQ1A 4PRHD 1OWRM 3FO2A 3QHFL 2ESVE 1CICD 2BNUA 3D0LA 3QJFA 2ICCA 2EDXA 4OCYH 3FFCD 5E6ID 1DLFL 2ZCKL 4ODVH 4O2EA 4LL9A 3GHEL 1GC1C 2R2CA 3EDEA 2XKNA 5JDJA 2Z8SA 1SYVB 3QXAB 4Z7VF 3SGKC 2DYPD 3WFDL 1CQKA 5E9DE 4RFNB 3MJ8B 5BVJA 3U30C 3KLHD 1R5IB 1T3FB 3UTZB 5FDYA 3HI5H 1T20B 4NWTH 3ZL4L 2FYYA 2BMKB 4ELMA 6CGTA 1BVKA 4JRYB 4BELD 4C56A 3BUTA 1U93A 4EN3C 1NSNL 3GSWB 4V1DE 1NFDE 2YKLH 2B4CL 1JTTA 4HS8L 4MA1C 4OGXL 1I85A 4MA8H 1FYTB 4UB0H 3WXVH 4ZUVA 1AXTH 4L1DA 5GJSH 1BD2D 4M8QB 3NPSC 1G7QB 3PQYE 4XNXL 1WWAX 2FWOB 1DBKH 2DIBA 4IRSD 5F9OL 4AK1A 5HYSB 2JLLA 2RCSL 4YUEL 1DVFD 1B0GB 4JFYA 2VLLB 2CH8A 2UWEB 3JWNC 5T3XE 2NNAB 1B4RA 1ZLSH 5IP4A 1L7IL 2CR3A 3FCTA 1RUKL 2K7QA 3ARWA 2VOTA 4PJBE 3EYOA 2E9BA 5ISZE 1YY8B 3GMLA 4RDQG 1V3KA 5C09B 1C16B 4K7PY 4YC2C 3RL2A 1JTPA 3UTTB 2BP3A 3T0DA 4Y16A 1U3HD 1NJ9B 1NCWL 1JI2A 3IAQA 3I6KA 5K33A 1IC5L 1CE6B 1B0RB 3B9EA 3QG7H 4N8CH 4MJIE 5I1DB 1P4IL 3U7YH 3DUHA 1G9NL 1EEYA 2A6DA 5KS9F 1K2DB 3CFKA 3LSOA 1AKJD 3CLEH 4HT1H 4PJ9D 4U6TA 1I7ZA 5ADPH 5CLWA 4QRQA 1WC7A 1JGDB 2IH1B 3IDMA 2XXCB 4LPVA 1HKLH 5C0DA 4P4KA 5ACZB 1IGFL 3Q48A 5SX4H 3QCVH 5F21B 1T1WA 2C4XA 3L5WA 5ESVB 1R5WA 2R1WA 3X3FL 3QFJD 1VFUA 5I8EB 3S3PA 3WS6C 1N59B 2OS7A 3WDIA 2DL9A 1I7RB 3WFHA 1A21A 1HSAA 5EPMA 1L0XA 3DXAE 4C83B 4QHNB 3K0WA 1Q0XL 1K6QH 4ERSH 2UYLA 4I0KA 3O2VH 2XZQL 2QSTA 2OJZL 5IROC 3SOBL 1BF2A 1IGTB 1BECA 3M1BA 1QUNA 2ADGA 2GK0A 3CFCH 4PGCB 3ZYJA 2IQAA 1D5BA 1MAJA 1SM3H 4WHTB 2P5WE 1AHWA 1PFCA 2OTPA 5GGQH 5GGTA 4PGEB 2R0ZH 1F58L 3TJHD 5J6GA 4QT5B 1QFOA 2PW1A 4W6YB 1ZK9A 4R96B 2DQIL 2PW2B 5LBSH 5IB4A 5DEFB 4HWBH 5B8CB 1TETH 4JFFB 2FR4A 2FJHA 3GSRB 3GUTA 2NYYC 3MJ9A 5FO8A 1PX3A 1JWMA 2DTSA 3GMMA 4CJ1A 3LV3A 1YEDA 2P8LB 5IEHB 2GAZB 4NO5A 4YK4B 5IR1A 4QHMA 1ZT4A 1KJ2H 1I1CA 5L9DH 1FAIH 1HHIA 3F7YB 5JIIA 5HHPA 1P9MA 4X9GA 3P40A 3IF1A 3GBLA 2C3VA 4U6VH 1RURH 3BEVB 1PQZA 5DK0B 2QR0A 2FLRT 1U8MA 3FONB 4XCNA 4U3HA 3DHMA 3I9GL 4N8VA 5CEXA 5D2NB 2D03L 3BXNB 4GAYA 4NNYA 1F4WL 1EJOH 3FO0H 1KTLB 1KG0B 4Z7OF 3RZCC 3ARFD 3NACL 3SBWA 1MJJB 4OV6F 1PD6A 2EXWC 5DVOA 4JDTH 1KTDB 2HAZA 2ADJB 5MEPA 1ADQL 1S7QA 2Z9TA 4JKKA 4PJBB 3RL1B 3WN5A 4E5XB 2V2XA 4X5LA 1AQKH 1WJ3A 3O41B 1HI6A 1YEGH 4MCYA 2ZZUT 4Z7UB 4PJ7E 1MWAL 3DURB 1PEWA 1I75A 1GHFL 4NPYA 1X7QA 4X6BB 3QEHB 3VG9B 1DBMH 2ERJB 1WICA 4PG9B 5ICZB 3N1MC 4EI5B 3HZYB 2YOCA 2YMXH 5D7IA 5DFVC 1YEKH 1RFDL 3RVXC 1KPVB 4Y7MA 3NGBC 3ROOB 4KUCD 4XNZB 4IM8A 4QRTB 1IBGL 3SO5A 2CXGA 3AREB 1DUYB 2Y07H 4Z7UF 4ZOEA 4LSQL 2VDOL 3D18B 4L4VB 3B9VA 5DD5L 4Z5RA 3MROA 5I1LA 4KFZC 3H7BA 4BZ1H 1IC1A 2E7LA 1X5YA 5I66B 3TBWB 4G8GB 1YN7B 2CLRA 3I84A 5EZIH 1JP5A 4OKVA 3IJHB 4NZUL 4NQDA 4U6XA 3L3HB 1I8MB 5C0BE 2PTVA 2VSDA 1MRDL 3FT2B 4U1GB 3RKPA 4ETQB 2PO6A 3ABZA 2ENSA 5CD5D 3NH7L 3QJHA 1PAMA 1Y18A 3MLVH 2OJEA 4YEFA 1M71B 1AD9A 5KSAD 4BSVB 5LGHL 3TVMC 2YUXA 2K9UA 2H32B 1ZA6B 3BD4A 4L9LB 3VFWB 3BPLC 1S7UA 1ZANL 4HKZA 32C2A 2IEPA 4R26L 4G8IA 1MCCA 3TN0B 1KCLA 5GS1A 3WNPA 1MFCH 1JF5A 1KFAH 2C7UB 3QCTH 4WGVB 3BP4A 1A7OH 3VWKB 2O5YL 2FIKB 1K9TA 5KBNC 4NUGH 5JHDD 1LD9B 2EC8A 4QTHA 2BVEA 4PUBH 3QUMH 4X7TA 4OD3L 5H2BB 3L95A 4NBZB 4ZUTB 1FFOA 1UCBL 1DL7L 3NAAL 3VXUA 1CTOA 4G42A 1AXIB 4YFLI 4J8RB 1I8LA 1XR8B 5EIIB 2VLRD 2XFXA 3HG1B 5TFSL 1U58B 2ZSVB 4HJGB 3S7GA 3F7PC 3U2SB 4Y5YA 2EYSB 3FO9B 4KQ4H 3OAYK 1OCWH 4UIMB 4I3GA 1J1XH 4JHBA 3QDMD 4N0YL 3FZUC 4KY1H 1JNNH 4NKMA 2G9HB 1NC4B 4PB9H 3VFNA 4G6FB 1RULL 2FO4B 4PJIB 5FCUL 2BDNH 3D39E 2X4TA 5T1LA 2FECI 4UTBH 2NW2A 3SJVA 2X4RA 1S78D 1JPSL 3CD4A 4ZS7H 4YPGA 2H8PB 1PGRB 1ZLWH 3W11D 1D5MA 1FNEB 3QQ9D 1UH3A 3DBXB 5INDB 5GSRA 3R0MA 4NKOB 1MCHA 1NEUA 4EN3B 3JWOL 3GSNA 3VW3L 2R56L 1R3JB 4PJ7B 4LK4A 4XZUA 2GFBB 3SKOA 2DKSA 3ARUA 2ZWLT 1MI5E 4DOHE 2LVCA 1A5FH 3S6CA 3NPSB 2Z93B 1HHHA 1IGCL 2GI7A 3RY6A 4XP6H 3G6JE 5F7MC 1BP3B 3MSPA 3TIDB 3B9DA 1NBZA 2AJVH 1KSRA 5BRZB 3MO1A 5GISL 4L8CB 1ITCA 1MVUB 3GRWA 3P4LA 3PHOB 4PJAA 3FRPA 4PJXE 3RIFF 4XVSH 1KJMB 4CAGA 2GCYB 4DW2L 3AROA 2JTDA 3D3VA 4GW1A 2ICWI 4YC2B 4G7YH 5A3ID 1M7DB 4JZJC 4XB7A 5I15L 8FABA 3HC4H 3WD5H 5C07D 1F3DJ 4Q97A 1CBVH 3EZ8A 4EDWH 1OSPH 2XWTA 4R4BB 5EUKA 1EO7A 5AZ2H 1Q8MA 3QIWC 2EC9U 3PWPA 2RB8A 4HWEL 4MD0B 3QNXA 2HFFB 2P4AB 2APVA 3IFLH 3LKOA 4XMLH 4QHLA 4L8SA 2EIEA 3STLA 1RSFA 3VFSA 3VXOA 5BXFB 4OI7A 4D9QD 4Y4HA 4YPJA 1ZHBA 3FT4A 1EAPB 3NCYS 4GMSH 5CD3B 5JPMA 4CU7A 4W81A 5FUZH 4PREB 1QVOB 3IFPA 4A6YA 1ZGLM 4Y19A 3RAJL 2JCCF 3CH1A 4OLVH 4X4YA 4U3XA 1MIEL 1A3LL 4C4KO 1OF2B 4K2UH 3WEXA 2FRGP 3OJDA 4ODHH 4AL8L 3RWCA 1A4KB 3RWHA 1FRGL 4ZFOA 1WBYB 1WISA 3FQTA 1BM3L 2FH8A 3LKRB 4JFEA 4XB8A 5GS0C 4D9RE 1GOFA 1NAKL 4M1CC 4J3TA 4ORZC 5FOJA 4MJ2A 1QNZL 5DJ2A 3MV9E 5F1KC 4ZG1A 1UXSA 4KROD 2HLFC 1EGJA 1YEJL 5C0IA 1A0QH 3PXJA 3FFDB 3SGDH 2D7QA 1WTLA 4IMLB 2J8HA 3EYQC 3GMQA 4PJFB 2FH6A 2AABL 2AVGA 2EDFA 3D39B 5ESAA 2GIYA 3C5SB 4XPFH 2VWEE 1WCBA 4AIZA 2AJUH 4KVNH 4DAGH 43CAA 1RZ7H 1RPQA 3IXTA 1CE1H 4LPCA 3E6HA 4PV9A 4PBVC 3KPNA 2AQ1A 2ZG3A 4M1DH 1YY9C 2X7LA 4NO2A 4QRRA 3G5XB 1K5NB 1T7YA 2VDQL 4K3GA 4TVPE 4PJDA 2DQHL 4IRJD 5D7LA 5D2LB 3STZB 1II4E 5BJTB 2BERA 2FECL 1IEBB 3R4DA 3LMJL 3VFVA 4G8EA 1CFSB 1RZGB 2IAND 2ITDA 3MLUL 2OZ4A 2Q6WB 1A4JA 3C8KB 4LLQB 1BIIA 2A2QT 4HZAA 1A02N 1MCWW 1EEZA 4XCFH 3RZCB 5HVGB 3OJVC 4OQTL 5EU6E 3KDMB 5EC1A 4NQEB 4WFEE 1XGTA 4B41A 3WUWG 2BSTA 3QG6A 3UAJD 1U8IB 4HDIB 2V9RA 3GHBH 4AH2B 1MJ7H 1GZQB 3KXFE 5EO1A 5F71A 2DQEH 1G7MA 1H0DA 2PYEA 4JR9L 3RJQB 4OD1L 3BGMA 5JORA 3QULB 1KBGH 3AY4C 5DD1L 4AEHH 2ID5A 5LWYH 1INEH 3E2HB 2YK1L 3VFUA 1OLZA 3KVQA 4PJ5A 5FYJH 1BQHA 4P5KB 3PWUA 1RK1B 4NHCH 3VXMD 4X5XB 3SCMC 3EUUA 4DGYL 4KQ3H 2AJXH 3NFSH 3Q6FA 4HKXA 5CP7B 4QRSB 5CGMA 5K9OA 3MA9L 3IDIA 4RA0C 1J1OH 4JG0H 1SMAA 3BKCH 3QQ4A 4WUUD 3KPLB 5AUMB 3CU1A 4PTUA 4DQOL 4WW2A 1YEFH 4IS6B 2BVOA 1FGNL 5E6ZA 2Y36L 1OAKH 4F9LC 2NR6D 4WI6A 4CMMB 4LQ1A 4UIKH 3CFIC 1R3HA 2B0SL 2PNDA 4GBXC 1T1YA 3RA7L 1KPUB 1YQVH 3IDUA 4WDIA 3MOAH 4OB5H 5C0CB 1NDMB 3ZLQC 7CGTA 5E8PA 1KIQB 1ZS8A 4O58H 4HGWB 3OGCA 1QLFB 1U8OA 3SE4A 4BH8B 1Z2KA 2V2WA 4LNRB 3KNBA 4U0RB 3EHBC 3O45A 4UT6L 4YHNB 4FQ1H 5E1HB 5D1QD 3GIVB 4RWYL 2DJ4A 3HPJB 1CZ8L 4JGJA 3TVMB 3H3PL 1AGDB 3BPLB 5A2IH 5J6HA 4NGHH 4PJCF 2EE6A 3O6FB 3TT1L 2X1WL 2EYTA 1A7NL 3C6LA 5EZOH 3LS4H 4G9FA 4FQJH 4MD5B 1YC7A 1GZPA 3SDDD 3KLAB 2L7UA 1TPXC 4XVJL 1MQKL 1TIUA 1FYHB 4WO4B 4U1JB 1TVHA 4HPYL 3BWAB 1ZTXL 2CK0L 3DUSB 4NDMA 4OBSA 4UTAL 5EOCJ 3T04D 3EOTH 5IVXB 2YRPA 4CW1B 4X6CE 4GAFB 4JQVC 5FYJE 1G7IA 3SDCC 4KI5C 3L5XH 3ULVD 1GH7A 3ARVA 3W39B 4FQQA 1I1YA 2EICA 2NY2D 4KI1A 1I9RH 1MCFA 4WCYH 35C8H 5TQ2L 3CFBB 4Y4FA 4N5EC 2BC4A 1FJ1B 1J8HA 4CBPA 1MFDL 1IJ9A 3CVIL 4RMWA 1U8QA 3V5HA 5MHSE 3AUVA 4DVBA 3GB7A 4XNYL 5F89B 4WHYG 1AD0A 1NAMH 2XQYK 3UBXI 2XZCH 4FXKA 3T3MF 5H35B 4LOUC 4EDXB 2NY1B 5KSVB 3GBNL 3U4BH 3GSUA 4HIEA 5EU4A 1AXSB 3K74B 3DO7B 5EU6B 4EXKA 2VDRL 1LO2L 3LZFH 4Y2OA 5TGBA 3FOMA 5EOQH 4FOMA 4KKAD 3PGFH 4KJYB 4PR5B 4X9IA 4KVCL 3RIFK 4Y5VC 1TVBA 1NCCL 4ZFGL 5FHAL 1F3DH 3OQ3B 3BZ4B 6FABL 5KAQF 3FAXA 2GSGB 4CVXB 4ZUWB 2WUCL 5F1SA 1PKQE 5IBUB 2FD6H 1ORQB 1NLDL 4P59H 1PSKH 1IKNA 3JV6A 3TH3T 1JZ4A 2Y5TB 4NKQB 4QKXB 3RWJB 5E2VH 4OIIH 3AAZA 2M1KA 4UV7L 3UJTL 3EJJX 3CCHB 3WLBA 3H42H 5DMGD 4QTIH 3VI4F 3WXWH 3ZKXC 4KV5F 5CGYC 3CJJA 2F54E 3FJTA 1JTOA 2UVEA 3UDWA 3BDYH 3DGCR 1P53A 2IPTL 2XZAL 5CIPH 4Z8FH 3V0WH 1ZLVK 1FG2A 1JZ5A 1RZKC 1W72L 2R0LL 1JYVA 5DDHB 4AENB 2ATPA 2FBJL 3IDGB 3PNWB 4ZSOB 1FP5A 1NGQL 2K3TA 1MLBB 3QXAA 2BOBB 4JZJB 2FEDC 1R5IA 1T3FA 3UTZA 2EIDA 1T20A 4BH7B 2BMKA 3VXSB 1XF2A 1OTSC 2FGWH 2AK4B 3L3KA 3U4EA 3HMXA 3GSWA 1AO7A 4RZCB 3QIWB 5KSBF 4HZLB 3B6SA 3QNYA 4K3DL 2B1AL 4RMVA 5F44A 2QHLA 3C09C 1AE6H 2WWKT 3RRQA 4M8QA 1G7QA 2DTML 4Y8AA 2VQ1B 1EH9A 1NCDL 1CL7H 5HYSA 5FO9A 4NRZB 5GPRA 2VLLA 2UWEA 3D25B 2F53B 1R5VB 3V4PL 4YXLH 4AEFA 5KTEH 4R0LC 5CZKA 3WHE0 1ZMYA 1YY8A 1MNUH 3MOBH 5C09A 2W9EH 3BWUC 4EOWL 3MRIB 2HTLC 1UM5H 1XIWC 3PDOB 4X6DB 5BVPH 3FQWB 2QHRL 1CGSL 3K81A 5ITBH 4TTDC 2IAMC 4ENED 3P0VL 4O2CB 3BYTA 4N68A 5DRNB 1YMMB 1NJ9A 4NZJA 4H20L 3QIBC 2AXFB 3M45A 2VKWA 3T3PF 2YSSA 2H6PB 2AGJL 2JKXA 2RFXB 3F6LA 5I1DA 1AJ7L 4U2YA 4LCUB 1X44A 2LQRA 4S1RL 1C5DB 3EO9H 1WZLA 2J8UA 1KGCD 1OP3H 1F4YL 3T0AA 3RDTD 2DQFB 3BPOC 4MHHG 3DIFB 2C5DC 4JAMB 3WSQH 1JGDA 4XGZB 5BO1H 2A74B 5IVOA 1BOGB 1BBDL 3NBNA 1E4JA 4ZD3L 5ESVA 3KPRD 2PXYD 4JO4L 1DBJL 4G6JL 1JUFB 5E2TL 4HGKC 4RDQF 5FHBH 5C0GA 3OPZH 3ARXA 1N59A 4Z76B 4YDLB 5D71H 3AGVA 4PG2A 4RFEB 4JFHD 4J3SA 2HFGH 2XRAL 3MLYH 3JTTB 4OZHF 4GQPH 4NNPH 2ZUQB 4W6XB 5D6DA 1A14L 4LFHG 1E6OL 4OZIE 1T5WB 4S10A 3FMGH 2QADC 2XXMB 3KLDA 3FB8B 5JO5B 3LOWA 4P5TD 1BFVH 4RGNE 5FYLH 3QA3B 3DSNA 4NBXB 4N1HB 2EXYD 5IBTH 3MJGX 3MNWA 4PGEA 1CD0A 1S5IH 1WEJH 1CLOL 1VPOL 2ESVA 1RQ5A 4Z7VE 5JW4N 3I75B 4R96A 2ZKHH 2PW2A 5IGXH 4PYHA 5ESQB 2DD8H 1GGTA 4HXAL 5DEFA 5B8CA 4JFFA 3NZHL 2JIXB 2C1OB 2Q8AH 2Y9RT 4B7LA 5IEHA 2GAZA 3LCYA 2LFGA 1W0WB 3T4YA 4NIKB 3OMZA 4C55A 1KT2B 5AYQA 3IDXL 1HINH 2X4NB 3LN5B 1DCLA 2Q7YA 3N50A 4JPKL 4BJLA 3AVEA 3U36B 2X4SB 5HHXH 1RJYB 1PZ5B 2R0KL 3BKJL 2QQNH 4V1DA 1NFDA 3BEVA 4X98A 4F57L 3SCMB 4RRPA 2JJSA 4MXVF 1SBBA 3FONA 3H9SE 2P8PA 1Q1JL 3LHPL 2E7HA 3PQYA 1TNMA 1NCNA 4IJ3B 1Q72H 4U6YB 3S4SG 3HNTH 3T2QA 2QV2A 4HUWB 3F12B 2P24B 1JHTB 5C0AD 1DR9A 5L8JB 5L2KB 1KTLA 1KG0A 5DWUH 2ICEB 5I8CB 1RIUH 2ITCB 5KJRL 4BQBA 1G0XA 1KTDA 5A1AA 1BOYA 2ADJA 5DD3L 4PJBA 4ZS6C 3RL1A 1OTUC 4E5XA 3DV6B 3LN4A 4ZQKB 1T03H 4TUKH 5EOCH 1YYLL 1ZSDB 2I27N 3O41A 4GBXB 4TQEL 4S0SD 3P4OB 1MSPA 1GGBL 5FYLE 4HV8A 3DURA 4PRNA 4NQTA 3OTTA 3AS3A 1N8ZB 1OSZB 1NFKA 5KS9E 4ZO9A 5FM5M 4X6BA 3LD8C 1HCFX 2VITA 2C3XA 3QEQE 2ZCHL 3MUGB 4PG9A 3OB8A 4RNRB 5IMLB 4MJIA 3L9RB 4HXBL 2D0HA 3HZYA 4B0MM 3V4UL 5I1EH 1BREA 3ROOA 4J23A 4QRTA 3QSKB 1S9WB 3AREA 3WKNA 1YPZF 1TPXB 1N2RB 2FX8H 1FAKT 3D18A 5IQ7L 4Y4KD 1PW3A 4LRIA 4MNGB 2VYRE 4RAVB 1IKFH 1F6LL 4XNMA 4Z7WB 4U1LB 1P2CB 5I66A 3L6FA 3L7FA 3TBWA 4G8GA 1YN7A 4G6KH 3SDCB 2J1KA 5IF0B 3BH8B 3W81A 1I3VA 12E8L 3IJHA 4WJ5B 1CDIA 1AO7D 3DXAA 3FT2A 5ILTH 1HNFA 4O5LL 4ETQA 1UADC 2X1XR 5ID1B 5FUOL 3O2DH 4P46C 2NX5D 1XF4B 1RZFL 5EO9B 3RWFA 3T0EE 5C7XH 3TIEA 2VDPH 2B2XH 4OT1L 4I77H 1M71A 3R1GH 1YJDC 4BSVA 2Q8BH 3A6BH 2H32A 2R0WL 5CJQL 3VFWA 4UINL 5T5FH 5IFHH 5HHOD 3R0NA 2P5WA 2X4QB 3TN0A 2P47B 4KRPD 5CJ8A 2EDJA 5CKAA 3OAZK 2C7UA 2FIKA 3LEVL 1U8JB 1MHCB 3ARGA 4NUJB 4LCYB 1LD9A 4L8BA 4OUUB 4MLIA 2Y06L 5E99H 1KTRL 2CXKA 4U3CA 3ESUF 4ZUTA 3IAPA 5F7YC 4KJWC 4WWKD 3KYKH 5DVNA 3LDBC 2HWZL 1HE7A 4J8RA 1P1ZB 4DZBA 5EIIA 1U58A 4LEXH 2ZSVA 2ORBH 4FNLH 3S8WA 4LQFH 3S96B 4HJGA 1NANH 2CDGB 4XP5H 2R2EB 4ISVB 4JQIH 1ES0A 2ED7A 3R06A 5MENE 2BY2A 2FL5B 4D9LH 4EVNA 1X4ZA 3ZKXB 1KCKA 2EYSA 3FO9A 1GGUA 1NCAL 3HUJF 3RUGF 5IEKA 1A47A 2HT2C 1OAUL 3D2UD 2HT3D 4KPHH 2P5ED 2G9HA 1NC4A 5DFWH 3QEGL 3V8CA 3OAUL 1UM4H 4CVUA 2R1XA 3DVIA 4FMFA 2A73B 4PJIA 1IGYB 2A9MH 2FO4A 4CRPA 1I1AD 3QIUC 1MCWM 4OSUL 2H8PA 5ETUA 2V5MA 1DLHB 5JXED 3DBXA 5INDA 1WQVT 5GS2D 3R8BB 4EN3A 4XAKE 2V6HA 4L1HA 1R3JA 4NJAL 4PJ7A 4UQ3B 5HPMA 1KN2H 3UC0H 2W07A 3C09B 4CN6A 1W0YT 1JFQL 1X6NA 4UU9B 4MMXC 1FNLA 5K9QI 3ULVL 2FATL 3OR6B 4AG4H 5ANMB 2OX5A 4M5ZL 3TIDA 4HX1B 5D6CA 3SKNB 2Y7QB 4AMKH 4GFTB 1X5KA 1A2YA 4KKBD 1A7PH 3PHOA 1MVUA 3FN3A 3BH9B 2V5TA 3FQXA 3IDJB 5IW3A 4Z0XB 1KJMA 2GCYA 1NEZB 1S7XA 1BZ9B 4KMTL 2HKFH 1LILA 3DX7B 1NMCB 2EZ0D 3P30L 1A9EB 5E9DD 2VO5A 4M43H 4URTB 4MJ6B 3QIBB 5KOVC 3MGOB 1R3IH 4QCIB 4R4BA 4U4BA 4YGAB 4PTTA 4UZGA 5SWQB 2BVTA 1D9KB 2VLKB 5C0BA 2DWEA 5C0RL 5GRXG 3SE3A 3L1OH 1MCKA 3QUYD 2QTEA 4XPTL 3T0EB 3D69B 1HDMB 3ZDZF 4L9DA 1GC1H 3BPOB 1A6TB 5BXFA 4MNQE 3KR3H 5TE6H 4BFIB 1SY6H 2AEQH 1A6UH 1BEYL 4ONGL 3PV6A 4D3CL 4L3EE 1MF2H 4KZEL 4MVBD 1CR9L 2IPKB 3MXVH 4HJJL 5CD3A 1EPFA 3D85A 5ISZD 4NKIL 5L7XH 3ARTA 4OZGB 1QVOA 4N90D 1F90L 5HPOA 5BS0E 4GJTB 2NY4C 4LKCB 4PIRF 5I1IL 1OGAD 3MYJB 2EDQA 4OV5A 5BV7L 3S98A 1BJ1J 1T0MB 1TJGL 3NA9H 1ACYL 4GG8B 2VL5B 5IROA 1FDLL 5CSGA 5DEGB 2QADB 4WVRA 1A4KA 2X4PB 4JM2C 1QSEE 4MJID 2WBJC 1HKFA 2CLZB 3BGFC 5GRJL 3O6LL 3QEUA 2EDYA 5MENB 4XPHL 2IGFL 4X7FC 1ZLVH 5D72H 2OR7A 4GW4A 4LCWB 3V4VH 3IU4L 5I1GL 1J12A 3PABA 3UO1H 2JJVA 5JIHA 3VD5A 3VFRB 2DOCA 5E5MB 4HFUH 5EBGA 3KYMB 2V2TB 1K4CB 3N1GC 4LHUD 3D39A 3C5SA 3BAEL 3C60D 3BPNB 5DVKA 3P4NB 4J4PC 3BDXA 2R29L 3AXLA 1KN4H 1IFHL 1MVFA 4D0DA 1RVFL 3G5XA 3V52L 4H1LB 4GKNB 3HE7A 2EEDA 4ODSL 5BJTA 4P2RB 2VABB 4YBHA 1RZGA 1QKZH 2OI9C 3G5ZA 1CD8A 3DRTB 4JRXD 2Q6WA 4LLQA 1S7VA 5DR5H 4DKFL 5D7JC 3RZCA 3HLAB 4HFWB 4PJHB 5TF1H 4WU7A 3OJ2C 2B7DT 2WWMC 3KDMA 3LRSA 2GITB 4PJXA 4JLRA 5IW6A 4NQEA 5BOZG 4MGXA 3UTPD 1U8NA 1U8IA 1GIGH 3DYOA 4AH2A 1GZQA 5E8NB 3IDYC 2CRMA 4P9ML 1TENA 4M48H 4X80H 5T1KD 4O2FB 1ND0A 1XF1A 3HZKB 4GRWB 4XT1C 4H0IA 2B5IB 3LD8B 4OCXL 3HI6H 4P5KA 3WUWB 4NP4L 1RK1A 4YBQC 4PFEA 4X5XA 4CDHA 2F58L 1J7VR 3MBXL 4Z95H 1F8TL 4QRSA 3P11H 4UV4L 5EORL 5CBAB 3L3JB 4P48A 2NW3A 1QR4A 1ERNA 4Y1AE 4O02L 5I8KH 1E4WL 2ADFL 2B1HL 4MQSB 2J6EL 1DBBH 3IJYB 1QA9A 1KULA 2V7HB 3MA7B 4IS6A 4FTVB 3BD3A 3BIKB 1OD7A 1KUMA 4BYHA 4CMMA 4OLXL 2BNRE 5BZWB 4MNHB 3MCLL 4LPYA 1KIRB 3GMPA 2VDNL 1KPUA 4UAOC 2VXSH 5HY9B 1QFWM 3U6RB 5C0CA 3VU2A 1NDMA 5EDXA 2XTJC 5DJZB 1KIQA 2D31A 1YYMH 5A2LH 1QLFA 2ATKB 4BH8A 4PLJD 5F93C 3RNQB 4YHNA 2VZVA 3MLSH 4Z7QF 3GIVA 3HPJA 5D1XC 1CICC 1QSEB 2FX9H 3ETBF 1KCUH 2RHEA 1MCPH 1S7WB 1N0LA 3GGWB 5FUCC 3UP1A 5E6IC 2DQJH 4XWGH 2D0FA 3O6FA 3BKMH 5C6TH 3RBGA 4WTWA 1UWEH 1BAFH 1Y0LB 1FL6B 2HVJA 3CLFL 2VERN 3MV9A 5HHVH 3KLAA 3THML 5HGBA 2R1YB 3TLRA 4K23H 4PYGA 4WO4A 2VLJE 4G80B 4U1JA 1EERB 3REVA 3KLHC 3BWAA 4N8VG 1I8KA 4JB9L 3AFLA 3MBED 2C3GA 4YHLH 5HYJD 4CW1A 1JZ6A 1SYSB 1R0AH 4AM0B 4DTGH 3LDBB 1CN4A 3W39A 4DK3A 3C87A 1MEXH 2NY7H 1FORL 3DSFL 5HHME 2NQCA 1MJ8L 4LSRH 1ZLUK 4IRSC 1FJ1A 3MUJA 4UILH 4FFYH 3V0AC 5K9KB 3VMPA 5IMKB 5FO7B 3MV7B 5KZCD 1F5WA 1GGIL 5GZNC 3F6IA 1W8NA 3PWJB 3IRZA 3CXDL 4YX2L 4EDXA 4H26B 3H3KA 3HZMB 5KSVA 3WYRA 5KG9B 5ITFB 3DO7A 5EU6A 4DN3L 4MWFB 3K80A 3MLTA 1C7TA 5DRZB 4PR5A 3L3OA 1UA6H 4F33A 1WITA 3G6AB 2YN5A 3C2AL 1CK0H 4OGZA 4S1SH 2F5AH 1YNKH 1FQ9C 4AT6B 3BZ4A 1QSFB 2GSGA 4ZUWA 3WKMH 1JHLH 1KC5L 1WZMA 5GGVH 3UJJL 3UJIH 4BK5A 2NY0D 4OCWL 3SGEH 1C7SA 2Y5TA 3VE0A 3RWJA 3GIZL 4CN4A 2IMMA 2HFTA 4IMKC 5C8JB 2NTSP 2EC9T 3VFPA 3EAKA 4P23C 3AS2A 5DFTA 4LSTL 1JNLH 2ED8A 1CXEA 4X4XB 3V0VB 4AENA 3IDGA 1ORSB 3PNWA 5FK9B 1J0YA 1JPFB 5D1ZD 2BOBA 2WIIB 5GSVB 3MRMB 4JZJA 1OB1B 4U1MB 2YD5A 3TCLB 1GGCL 1LE9A 4BH7A 3VXSA 1HWGB 4MYWB 3WIHL 1BJ1H 3E3QC 5EZLA 2F5BH 1BF8A 1F11A 4RZCA 3QIWA 4UBDC 5H37H 4F7CB 4J6RH 5DUML 3ZE0E 3MRQB 5E8DH 3V7MA 4PJCE 1MI5D 1E28B 2VZSA 1UXWA 4LRNH 4PP2B 2XWJB 3TJHC 2VQ1A 3TO4D 5FA3B 4UUJB 3JWDC 3D25A 1RZJL 2P1YA 1BPVA 3HR6A 1KEGH 4R2GD 4KK8D 4NZRL 3U1SL 3WLWD 5M7QA 5TQ0H 1ZWIA 1I9JL 3BVNB 5JW3L 2OP4L 2R2HB 1XZ0B 4MSWA 3MRIA 5IHZB 2WQ8A 3PDOA 4X6DA 5IB3B 2NY4B 3ARSA 3O3UN 1D5IL 3DJ9A 3LS5L 1A7QH 5DRNA 1AGCB 5SWZE 2AXFA 4X6CA 3QUKB 3BP6B 4NHUA 4OCRL 4UI2A 1Q9LA 2F8VA 2H6PA 2V7NB 3CX5K 5KW9L 3PL6A 2RFXA 3ZTJG 1MRFH 2I5YH 4JM2B 4TTGA 5HHMB 2YD8A 3BZDA 5E08H 3K1DA 2X2YA 4WENB 1G9MC 3FFCE 4WFFD 5FAAA 1FVDA 1C5DA 2I9LB 1G7JA 1BWWA 3MLZH 1JVKA 2XNAB 2DQFA 4XBEH 5FF6B 3T3ME 3DIFA 4XPGH 3QCUH 4JAMA 1OD9A 4XGZA 3I2CH 2A74A 2EH8L 3FQRB 4F2MB 2MPAH 2Y1VA 1UZ6F 4DGVH 1Z6JT 2FBOJ 4P2QE 1JUFA 4NQUA 4W68A 3BSZL 1FIGH 3WL9B 3Q2CA 2LTQB 3GI9H 2P8MB 3Q6GL 4RX4D 4JM2F 4Z76A 3SGJA 2BZDA 1DQJB 3FRPG 4G7VH 4KMLB 3C5ZD 1T22A 1SEBB 1WBZB 4U6HB 15C8L 3U7AA 4NCC2 3U7WL 5GRWA 1FE8L 1G6RA 1T5WA 1B4JH 5SX4I 4LVHC 4Y8DC 3FB8A 1NKOA 4LF3A 1T6VN 2DM2A 3FOLB 1QYGH 5SX5K 1T21B 3OZ9H 2EDOA 3QA3A 5IESL 5F1IB 4NT6B 5DA0B 4OGAD 4OZFB 2E5EA 3VMOA 3EOAB 1BX2B 2F54A 4FFWD 5DXWA 1LK2B 5JXAL 1RIHH 3G08B 5DURD 5ESQA 5ACMA 4ZDHA 4M3JA 1FCGA 1OP5K 4YDVB 2C1OA 1S7SA 4LSSL 5HYEA 5JDSB 2E7MA 5EU5B 2DLIA 5KSBE 1W0WA 3IDYB 1I85C 3EJZC 3AY4A 1CFQA 3QQNA 3LN5A 5GS0H 3OR7B 1MAMH 4HC1A 5IBLC 5EA0H 3ZT7A 2X4SA 1RJYA 4UDTB 1OM3L 5KSAC 5KVEL 1RHFA 5F96L 4DCQB 2XKSA 4LPTA 4X8XA 1UYWL 1NMAL 2MTPA 5KSUB 3ARBD 2NTFB 4U6YA 3QFJE 1SJXA 2X1OA 4S11A 4HUWA 3QISA 3DMMD 3F12A 2P24A 4R90H 1JHTA 5C08E 2DWDB 4HMCA 3SDAD 2OL3H 5I8CA 5IMOA 4OCYL 4ODVL 5IB1B 3MFGB 4Y16C 2BFVH 5IWLA 2V9QA 3DV6A 2X4UA 5CHNB 3WDJA 4Y2DA 4ALAH 4OD2A 4PRIB 3KS0J 1TQBB 1ZSDA 3CK0H 4TUOA 1OAXH 4M7ZC 3T4AB 3P4OA 3RHWF 4FQ2H 3MV8E 2XTJB 3V5KA 3KXFD 4JG1H 4NWTL 5SWZB 1N8ZA 3HC0B 4JE4B 2F15A 3WFEH 4NSKB 4K3HA 4TYUA 5IV2B 4PRHB 2YKLL 5IMLA 4MA8L 4XP9H 4UB0L 5D1XB 1CICB 5GXBB 1AXTL 3L9RA 3O4OC 5GJSL 2W0PA 1A1MB 5E6IB 2OLDA 4G6MH 5JIPA 1RD6A 1DBKL 3E1F1 5J56B 1MHEA 3OBAA 2A77H 1OHQA 3T8XB 5JUEH 2J12B 4XX1E 5C0EB 4HWZB 1ZLSL 2DYPB 1N2RA 4LCCC 5I2IB 4XMKH 4MNGA 4CGTA 4LARH 4QRPB 4YDJB 5SV4A 3HE6A 3CFEA 4OZHE 4M4PA 5F3BB 4KKLD 5GJTL 2EDHA 2DICA 3BH8A 3CX5J 4WW1B 4WJ5A 4EUPB 4MDIB 1YN6B 5C0NC 1BD2B 3NCYP 2YWYA 5ID1A 4R7NB 5J0BA 3T0WA 2M8XA 4OZIA 4IRSB 2VE6B 1CXHA 1DVFB 1EO8H 4TUJB 3QG7L 1ZT1A 4N8CL 2XTLA 3RNKA 3BZEB 3U7YL 3CZFA 2KPNA 1H8SA 1ZGLA 4BFBD 3EYVB 3LH2H 5CZVH 4F7TB 2I07A 2X4QA 3CLEL 4HT1L 4B5EA 2EKSA 1B9ZA 3PWNB 4ZYKB 5ADPL 3KYOB 1BQHG 1QLRA 2YHGA 4M7LH 5B39B 1HKLL 5A3IC 1F4AA 4NUJA 3QCVL 3EDFA 4OUUA 3PGDB 3JV4A 3ARDA 4HEPG 4R3SB 1LGVA 3L7EB 4KK6D 2JE8A 3K8KA 5CEZH 1P9MC 1VFAB 5EWIH 4KUZH 1LP9F 5FYJD 3E0GA 5B4MD 1CWVA 2NY6D 5JMOC 1O7VA 4PLOB 1FNFA 4PRDB 5ECJE 1BBJB 1HQ4B 3ROLB 1J87A 1QHOA 1WWWX 5L6YH 4WU5B 1K6QL 1JGUH 1HH9B 4JFDE 4ERSL 3O2VL 4M61B 3B2VH 4ORGA 1GPOH 4ZTOH 2IFGA 4XP1H 3S35H 1IC4H 3TA3A 2FL5A 1G0YR 4K3EL 2YN3A 4KRLB 3CFCL 4P23B 5I75C 3SBWC 2EDWA 5MHSD 3NABH 4I9WD 1ONQB 1J10A 3O3DA 4JKPH 3QFJB 4GRMB 5A43C 1VB9A 5GGQL 3WN5C 2R0ZL 5T1MB 4WWID 3QDGE 3QRGH 3OKLB 3TJEH 3W0WB 4CNIA 3FT3B 5HD8C 4BSJA 2EE2A 1ZV5A 5LBSL 2ICWB 3CPLB 4ZXBD 1KB5A 1S8DA 4HWBL 1TETL 2BNQD 1TJHH 5DA4A 5JNYB 1EUUA 4JCMA 5IT2H 2X42A 2CLVA 1CI5A 2CDFB 3DVGB 4N0CD 3A6CH 1DE4B 4UQ3A 1KJ2L 5L9DL 1FAIL 1RI8A 1YC8A 4RIRB 5KS9A 1NLBH 1FLRH 4UU9A 3L5IA 1TTUA 1MH5B 1AY1H 4U6VL 3QEQA 3H7LA 4MDJB 1RURL 1U8HB 5ANMA 1HHGB 1YPZE 4KROC 5JPNB 5JHDE 2A1WH 4HX1A 2IC2A 4OM1H 2Y7QA 5F7EH 4LP4A 1IAIM 1EJOL 4U1IA 1CVRA 3ZKNC 1FVEB 3U9UB 3FO0L 5EBLB 1PZUB 1JPGB 1NEZA 5FGCB 1BZ9A 3E6FA 2VLRE 3VXRB 5HGAB 4XMPH 4I5BA 4HIXH 4PJEB 3MLXH 3JV0A 3QDJE 4P2OD 1OTTC 3GBMH 4PRPD 1AQKL 1QLEH 2HN7B 3QIBA 1IARB 2DS4A 3MGOA 4WEMB 5HSFA 4QCIA 1YEGL 1JK8A 3ALPA 3N1PC 1V3LA 1D9KA 2VLKA 5CJOH 3O81A 4JM4H 3MCKA 3RY4A 5I76B 2AXJA 3QDME 2Y25A 1MUJB 3CX2A 4KKCC 1F13A 5GS1C 1DBML 4IOFC 3T0EA 1QPXA 1HDMA 3D69A 2XQBH 1MHHB 1G1CA 1A6TA 1X4YA 2YMXL 1LNUB 1YEKL 3I02B 1LO4H 1Z9LA 2D9QB 4LLUB 4TNVF 1KJ3H 2IPKA 1PG7H 1Z9MA 2Y07L 2VXVL 3I50H 4M7KH 5F72S 2W38A 2DF3A 3CDFA 1I8LC 3ULUC 3F5WB 4BZ1L 3P9MA 4HLZG 1JN6A 4LSPH 2HMIC 3KG5A 4WFHE 5EZIL 1FV1B 1F42A 2VL5A 4LVHB 5DEGA 3JSSA 2UVFA 2AW2A 3HUJE 3RUGE 2BNUB 4NQCD 3D0LB 3DRQB 3C2SA 2CLZA 1EZVX 3VRJB 5KVMC 3MLVL 5MENA 2VDKH 5LQBH 4PD4K 4MJ5B 1IMHC 1WFUA 3R8QA 2R23B 4LLDB 1TFHA 4LCWA 3QPQD 2DBLH 4FQLL 1LO0H 3NTCL 3MQIA 5BVJB 3VFRA 3O6MH 1MFCL 4MXWH 1KFAL 3QCTL 5C07E 5GRZA 5HYSG 1A7OL 2V2TA 1BVKB 1K4CA 3Q1SH 5D8JH 4C56B 4NUGL 4PY8I 3KS0H 1A1OB 1K4DA 2CJUH 5I0ZA 2OR9H 4BZ2H 4PUBL 4DKDC 5B38B 1CXLA 3P4NA 3W82A 4HS3B 3HC3H 4ZUVB 4CMHC 2PKDA 4F7EB 4MS8D 2DMBA 1N5AB 1W72B 3RY6C 2OXGA 2VLMD 2VISB 3RHWK 5KSAB 5CCKH 4D9QE 4QXTB 1J9CT 3SGDI 3FO1A 4RGND 3FCTB 5HI3C 4ELMF 1T0PB 3QI9A 3EYOB 2XIDA 1QBLH 3GMLB 3SDDC 3OF6A 4KQ4L 5HYIA 1OCWL 2CKBH 2AI0L 1XCQB 2IH3B 3RL2B 1J1XL 3HRZB 4HFWA 1CFNA 4PJHA 43C9A 3OKOB 4KY1L 1JNNL 3DROB 2GITA 1G84A 4PB9L 4OKDA 2BDNL 3ULVC 4M7ZB 1X5HA 3RWEA 4UTBL 2NY2C 1QRNE 2VJXA 4X6EA 5KANI 4ZS7L 3EYUH 4X7EC 1A6VH 4O2FA 3GJFK 3BRDA 3HZKA 1EEYB 3B2UD 4M4RA 4EIZC 1JZ7A 3LSOB 2YC1B 2ZUVA 1I7ZB 4QRQB 4NZTL 1S7TB 4Y4HC 3O4OB 1A5FL 5C0DB 3QDMB 1YA5A 1T1WB 4XP6L 3H9SD 5AG9A 1R5WB 5CBAA 3L3JA 2R1WB 4JRYD 3CUPB 1PVHA 2AJVL 3IJYA 4WI8A 2V7HA 3MA7A 4U49A 4FTVA 4LCCB 3BIKA 4Z7NF 4L3EA 2XV6B 3WFHB 3TESA 1HSAB 5EPMB 1FYTD 1XGRB 3DV4B 3UEZA 5F8QC 2UYLB 3N9GH 1KIRA 4G7YL 4OJFH 5HY9A 3IFNH 4DUXA 5GRYA 5FYLD 2ADGB 4H1LH 3HC4L 2GTZB 1PJ9A 3WD5L 2GK0B 2ATKA 3AMKA 2IANE 1CBVL 4EDWL 1OSPL 5AZ2L 1N3NA 5EH1A 1A6PA 3RNQA 1AQDB 3QQ3B 3QUZD 3RGVA 2WNGA 3ECBB 3UTTD 1QSEA 3QWOB 5GRUH 3RVUD 1S7WA 4POYA 5I8OH 4P57A 2X41A 4LSUH 3IFLL 4XMLL 1DEEB 2HJFB 5BV7C 4GKOA 1BGXH 5J8OA 2FR4B 3UBXB 4D0CB 1Y0LA 4HK3N 1FL6A 3UTQA 3G9VA 5F9OH 1F3JB 2BY3A 2CMRH 2R1YA 4TVPL 4RRPG 3LIZH 1OP5H 3GMMB 1YEDB 4G80A 1KF9B 1LO3H 4NO5B 4GMSL 2N7BA 5IR1B 5FUZL 1ZT4B 1FIEA 2HYMA 2BHYA 3EJYC 4P5MB 3NCMA 5C07B 1RUKH 1ZAGA 1SJVA 1FHGA 2YPLE 1SYSA 4HCRH 4YHYC 4OLVL 5E5RB 5ENWB 3VXME 5B3JF 4K2UL 4X83A 4S1DC 5H8DA 4JN1H 1U8MB 1QFHA 2F8OA 4LLYA 4XCNB 2E6PA 1IQWH 1NC2D 1VEOA 1NCWH 1IQDB 4YQXH 1BHGA 5J1TC 3GMRB 4PD4J 3CXHK 2MKWA 2WLYA 5HI4D 5I75B 5IMKA 3EKCA 4YFDB 4XC3H 3MV7A 2HTKC 5FO7A 3TBVB 5FOBB 3ZKMC 5MEPB 3WN5B 1UG9A 4H8WC 1NGYB 5KG9A 5ITFA 4GUPB 4MCYB 1A0QL 4V2CB 4IRZH 4OFDA 2MQ3A 4D94A 5DO2C 3C5JB 1AR1D 1TJIL 3G6AA 4NNXA 4PBXA 3ZDYF 3I3BA 1G7PA 3H9ZA 4XPFL 1JPST 2ARJB 2JK5B 4JKMA 2AJUL 4KVNL 1YJDH 4DAGL 3NCCB 1RZ7L 3OKNB 5D7IB 1CE1L 2DKMA 4YIQB 1ADQA 4I2XB 3W9EA 4M1DL 1CU4H 4R4FH 3KPOA 3B8SA 4KROB 4WW2C 4Q2ZB 5HDQH 1IAIH 1MWAA 2H2PC 1QG3A 3HAEA 5I1LB 2R8SH 1B6UA 4XVUD 4Y1AA 3BP7A 5DMJB 3RTQD 4XCEA 4RGOH 1CIDA 4X4XA 4XCFL 1OL0A 5FK9A 3PWLA 1OW0C 4G6AD 5CWSB 1FSKB 5I9QC 2OM5A 4OKVB 1XGQA 3SDYH 2WIIA 4NQDB 3MRMA 2FB4H 4TNVK 3TCLA 2BNRA 1HXYA 3O6KL 5CP3H 3VFMB 1L7TH 3GHBL 1MJ7L 2DQEL 4IRJB 2BHUA 4Z7QE 4P5TC 2LU7A 1AD9B 2ZUWA 4FQIH 4F7CA 1VGKA 3G6DH 1FNSH 1KBGL 3ALXA 4PP1C 4AEHL 5LWYL 3WIIH 3MRQA 1INEL 5A16A 3GI8H 4MAYA 1GAFH 4HKZB 1E28A 5DMYA 1TVDA 3C6LC 4H88H 4JJHA 4PP2A 5GS1B 5FYJL 4K94C 3VDAA 5FA3A 3N1FC 4NHCL 3BP4B 2AJXL 3NFSL 4KQ3L 4GLRH 2MCPH 5TE7H 1MY5A 4UNTA 3S37H 3JZ7A 1J1OL 3GSQB 4U1KB 3E8UH 3BKCL 4EIGB 4X7TB 2MQ0A 5F9JA 3BVNA 4WHYH 1YEFL 2R2HA 5IHZA 1MCBA 1OAKL 5IB3A 3OXSB 2VLJA 1NCBH 4UIKL 3RI5F 5LAXB 4D8PB 1FC1A 5T1DH 1CL7I 5D96C 3VGEA 4OLUH 1S9YA 4Y4FC 3WIFB 3QUKA 3BP6A 1YQVL 3F62A 3MOAL 4OB5L 2A9NH 3VD3A 4NO0D 1DDHB 4JJ5B 4O58L 4K7FB 3ZE1F 2YD9A 2X05A 1L0YA 2I9LA 4NKMB 1QBMH 4WUUB 3HRPA 4FQ1L 1ZHNA 2O5ZH 1G6RL 1A6AA 2FJGB 2XNAA 3GMNB 3ULUF 5EFIA 4MNQD 3FQRA 2X4TB 4NGHL 2HVKB 4Q6IA 4F2MA 1Q9KB 2NW2B 4ETYA 5EZOL 1KLFA 2QQKH 2X4RB 1RFDH 2DLTA 4JGMA 4YAQB 3QHTC 1D5MB 3O8XD 4KKNA 1IBGH 2P8MA 4TSAL 1RAMA 3QBTB 5BS0D 1DQJA 4XZUB 3TYFB 4HS6B 1MCSA 1S9VA 2CGRL 3JV5A 3O2WL 3SKOB 1G7HB 3EOTL 4OFIA 5JOFA 5DD5H 1IKNC 1WBZA 1X3DA 4CMHB 2CUIA 3QUXD 1QQDB 3L5XL 1FGVH 1HHHB 2ZPKH 4HW6A 3X13A 3VMNA 3T77A 3VWKD 1I9EA 1I9RL 2COQA 4WCYL 4BKLB 3MLRH 1NBZB 5FM4A 35C8L 4HKBB 3CXHJ 4FG6D 3VDCA 3UDWC 1Z3GH 4XRCA 1IL1B 3RKDC 4MQXC 4PJAB 4R4NC 4NT6A 3NH7H 3SDDB 4OZFA 3ZKSD 5L8LB 3EOAA 3SDXE 4JFZH 3D3VB 1OLLA 3DHJA 3VWJD 5JMRA 5DUPL 5I16B 3HG1D 3DGGA 3NZ8B 4XPAH 1P6AB 2XZCL 1TCMA 2BVUA 4Z78B 3U4BL 1U41A 4RGMC 1P7QD 4ONHA 1FZJB 4YDVA 1XCTA 3LEXA 2NY2B 5JDSA 2CIIA 1OT1A 4M8VA 5EU5A 3PWPB 1NUNB 3LZFL 5EOQL 3PGFL 3QNXB 4PJAF 4OM0H 1D6VH 1X6LA 2GTWB 2VKXA 2KUTA 3MGAA 4KZDL 1MCNA 4QHLB 3WHXA 1NCTA 4UDTA 4NRYA 2FD6L 1N7MH 3VXOB 5I1HH 4P59L 5ID0B 1PSKL 4Y4HB 5I0DA 1ZHBB 5E2VL 1I1FB 4OIIL 3FT4B 4TULH 5KSUA 3H42L 5HHNB 4QTIL 3NMEA 3WXWL 3IFPB 3LEYH 3BDYL 4M62H 3CH1B 5IB1A 4Z8FL 3V0WL 1WAAE 4JPIB 2APWA 5CHNA 5CSBA 3WEXB 4KJPC 3VFOB 1T5XA 4B50A 4DEPB 3GSXB 5J12C 1FFRA 1RZJC 3RWHB 4AQ1B 5BRZD 4HUNB 5SWZA 2MNUA 3FQTB 2FGWL 3U9PH 2OSLA 4NSKA 2AXGB 3O9WA 5IV2A 4PRHA 1BZ7A 5DJ2B 1URLA 1CICA 4KMQA 1AE6L 1A1MA 3FFCA 5E6IA 1J0IA 1M1SA 1UZ6E 5BV7B 2IWGA 4J3VA 1XAUA 1CL7L 1FVCB 5FECA 3T8XA 3GMQB 5C0EA 4GAGH 1IZKA 4YXLL 1XGUA 4HWZA 2DYPA 4LGPB 4L5FH 4F7PB 5I2IA 1WCBB 4PG2C 4PJGE 5KTEL 3OKDB 1OARH 2WSKA 1MNUL 3MOBL 5K9JH 5F3BA 2W9EL 2KZ1B 2QSQA 3NCJH 3P0YH 5D6DC 4CUCA 3E6HB 1UM5L 4LVNC 5AWNL 3S36H 3KPNB 5BVPL 3SQOH 4YHYB 3DYPA 2X7LB 4NO2B 4QRRB 5ITBL 1FO0H 2PTUA 4EUPA 4MDIA 3ULSB 3BX7C 1BD2A 5GRVK 4LHQB 3VFVB 4HGMA 4IRSA 3TFKD 2VE6A 2XN9E 5EC2B 4WI4A 1DVFA 5C0AE 3IB4A 3BZEA 2ZUUA 1FNAA 3QT2A 1M05A 4F9PA 4C57C 3BP5A 2DQCL 3EYVA 5IMMA 1V3JA 1X5GA 4F7TA 5EC1B 5B8CC 1KPRB 3PWNA 1F6FB 1S3KH 1HYSD 1WWBX 3WCYA 3WSQL 3SDXB 2BSTB 2VUOA 5SWSE 5B39A 4XXCA 2VMFA 4PJDF 4XCCH 5L88H 3BIAX 3FQNA 3PGDA 4WY7H 4R3SA 1G7MB 1U3HA 2VLJD 1YQ2A 5GZOC 1FZKB 5F7KC 5JORB 3BGMB 3L7EA 5FHBL 3OPZL 4X9FA 1VFAA 2R4SH 3TNMB 2L4OA 3VFUB 5D71L 2IALB 4PJ5B 2HFGL 3MLYL 1BBJA 3PWUB 4PRDA 3VH8A 1O5DT 1HQ4A 5KSBA 3ROLA 2JB5H 4NNPL 4WU5A 1KB5L 2JJSC 1HH9A 2CKNA 4OQTA 4M61A 1IC7L 1EHXA 4G3YH 4E0RB 1AKJA 5D5ME 5K9OB 3FMGL 4PJ9A 4YWGH 3B9AA 2WBWB 2WUBH 3I6LE 4PTUB 2NYYD 2UZIH 1BFVL 1Z9SA 1F97A 5FYLL 4L4TE 3S5LB