2OK0H

Fab ed10-dna complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
216
Chain Sequence
EVQLEESGPELVKPGASVKISCKASGYTFTDYYMNWLRQKPGQGLEWIGWVYPGSIKYNEKFKDKATLTADTSSSIVYMHLSSLTSDDNAVYFCTRWTYGSSFDYWGEGTLLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/dna
molecule keywords 5'-D(*TP*C)-3'
publication title Specific recognition of a DNA immunogen by its elicited antibody
pubmed doi rcsb
total genus 42
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2007-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ok0H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ok0H02
2EZ0D 2CSPA 3UAJC 1OGAA 3F12B 3BT2H 4Q0XH 5HI3D 4XH2A 1INEH 2B39A 4Q2ZB 5M95B 2AJUH 4NZTH 4RDQG 3QQ3B 3MUGA 5KTEH 1NH6A 1T0MB 5KVDH 4P46C 3OR6A 3QIUD 3GSRA 2MCPL 3CC5A 1X3DA 4JGMA 5GRYA 1A6WL 4H25B 4Z5RB 1S7SA 2V6HA 3EYFA 4QHLB 3O6KL 3MRQB 2Z93A 1CGXA 4U31A 1YN7A 5GRJL 3LKPB 3ZTNH 4LSSL 5D2LF 2EIEA 1MLCA 5CGMA 5HDQL 5JQ6H 1T7YA 3O3EA 2R0ZL 4I2XB 4XZUA 1ZE3C 5DJ6A 4RFEA 2UWEB 1BD2A 5HHQA 5C0FA 1CIDA 1Q0YH 4LARH 4QHNA 5GIRA 1KCSH 3BFOA 2Y06L 5C92A 4N8CH 4M43H 4XVUC 3ARGD 3SDCD 1HHKA 1PVHA 2V2XA 5FF6B 5I30H 1U3HA 4HIXH 4K7FB 4M6OH 4ZDHA 2QHRL 1FGVL 4S10A 5ICXA 4F15C 3V6FA 1FIGH 1ZHKB 4KKLD 4QOKE 3T04D 5AZ2L 4LVNB 4OCMC 5DA0B 4XNUL 1MY5A 4XHJD 4OZIE 2CMRL 1U92B 4PJGF 5A2KH 3WO4B 5BZWB 2UZYB 4M1GL 1U8JB 1IL1B 2H32H 2YZ8A 1S5HB 1YEHL 4LSVH 3Q5YA 2DMCA 2CIIA 4M6NL 4L3CA 5GHWL 3M8OL 4YX2L 6CGTA 1J0ZA 5F70A 3QH3B 1DCLA 1TETL 4QLRA 4MMZC 1QLRB 4NRXA 3T0AA 4GH7B 3O2DH 1FCGA 1NAMH 2NXZD 4KI1A 2NX5D 4PJHF 1LO4H 4KI5C 1ZV5A 1JGUL 4KVCL 3V7MA 4C83B 2WV3A 5HVGB 4MJ5A 2VDNH 4HKXA 5CEXA 1MCPH 4O9HH 2DB8A 5FYKD 3S5LB 2BSSB 3B9KA 2EDNA 4ZOBA 1UXSB 4OKDA 5H94B 5LCVH 3PGFH 4Z9KB 4K3EH 3KS0H 4XAKD 1FAIL 2DQCL 1MI5A 3S96A 4AM0B 4EI6A 3WNLA 4MNGE 1F6LL 1UG9A 3IFOA 4X8XA 4XNZB 2MHAB 3IS1X 3D2UB 1LO3L 5CJ5A 4LASL 1B9ZA 3KPRB 1S78C 1DLFH 5DJ2B 3O9WB 4U6HA 3MMEA 4S2SA 3P4MA 2RR3A 2J88L 5C0IA 2EXYD 3SDXF 4BK5A 4YHYB 1X5KA 3C5ZA 1ZT1A 5DWUH 2EDEA 1DBKH 1GSMA 1KB5L 1P4IH 4K3DL 1JGEA 2IAMC 1GOGA 2YKLH 1NGPH 3EKCA 4ZYKA 1PAMA 4U6XA 5CP7B 4DZBB 1O7SA 3L3HA 5E0QA 3LH2L 1VPOL 4BZ1H 5INCA 2W91A 2UY7A 4ZAKB 1OD9A 3VXRA 3TN0A 3TCLA 1CK0L 1FC1A 4LCYA 4ZO8A 3HUJE 2ICCA 4G9DA 1NFIA 3WFHA 1D9KD 4X4MA 5GS0D 2B0SL 5MP6L 4DUWA 1GOFA 3S37H 3FB6A 4OJFH 5ECJE 4KUZH 4YAQB 4RGND 2YD8A 2OSLB 2CDGB 5DVLA 4HW6A 3SCMC 4IHOB 2G75A 2W60A 1V5JA 5E6IC 2ILLA 1FVEA 1S9YA 5HHNB 2P7TA 2APXA 4MLIA 4XBGB 3CDYA 2ICWA 4JRXB 4M9OA 5TFSL 2DQTL 3GBML 3SGEH 4LLQA 5DUBB 2HFGH 4H0GA 5E03A 2ADIA 3LPGA 3KXFB 1YYMH 5T5FH 4DGIL 3NCCB 5B39B 3GMMB 3DIFA 3KPQA 3LZFL 5IP4A 3X13A 2DI9A 1JRHI 1BAFL 2CLVA 3AU1B 5KJRL 5I1EH 4YNYA 4IMLB 4ODSH 3DSFH 3SE4A 1EO8L 4IJ3C 4Y2DC 1R5VA 5I9QC 4XMKL 1EUUA 2XNAB 4WI5A 2CRZA 1Y18A 5I1CL 4A2LA 4ZUTB 4BSVB 3P4NA 2IH3B 4X6CB 1A22B 1DANT 2EH8L 4I5BB 4J3VA 2ZZUT 4JAMA 5IFHL 1ACYL 3TV3H 2XFXA 2IPKA 2Y25A 5GGVY 3RWGA 2H2SC 2QJDA 1AGCB 1OAQH 3BE1L 3HR5A 2FH8A 5LG1A 5F3HA 2IWGA 4GAGL 4OCSL 2O5XH 1T7ZA 2OL3A 2ZP0T 2BY1A 3O2WL 3VGBA 3QJFA 5EN2B 5DMKB 1OGAD 2DQUH 1UENA 3MPCA 1A7QL 5K59F 2AK4A 3HPJA 3U36A 4FFZH 2I9LA 5A2JH 5AYUL 2A38A 4RMQA 2QSCH 3ALPA 4LRNL 1YNLL 1MJUH 1WBXB 5FM8A 1T7VA 2FR4B 3D39E 1SVCP 1MRDL 2HKFL 1NEUA 4U7KA 5F7EH 2JJSC 3BX7C 1BWWA 4HPOH 1UH4A 3DV4A 1I8KB 3IKKA 1J88A 4WUUE 1X5LA 5JUEL 5C6TH 2GIYA 1HINL 1NMAH 1MCOL 4UDUB 2JB6A 4YZFE 5FK9B 1NFKA 4M7LH 3K0WA 4Z7OE 1M6OA 1RIUH 5DD5H 2R0LH 5KS9B 1G7HA 1S7RA 2X9YA 1F45A 1N6QH 1DL7H 1LO2H 1FNGA 2FIRT 4MX7A 2E3VA 3QEUB 3RQ3A 5CBAB 5HYJB 5C2BL 3U9UA 1BD2D 4U1LA 4UINH 1QSEB 2IG2L 4U1MB 4Z7VB 5DMYA 4PJXE 1S7TB 1CCZA 4GO6B 4CJ0A 2PO6A 3CH1B 1D6EB 1X7QB 5IVNA 1U3HD 1CYGA 3OJDB 4P2QE 2Q86B 3MLSL 4MQ7A 3MO1A 3O6FB 5EORH 1OAYL 1EJOL 2UYLA 4R4BA 4R8WH 1XGYL 5IWLC 1PY9A 3QSKB 5K9QI 2F54A 4HWUA 4OGXH 1S9XA 4PJFB 3LEVL 5D6CA 3LKRB 4UB0L 4I1NB 1TCMA 3RY6C 4AIZA 5GZNC 3OKNB 2VLKE 3BQUA 3MRLA 5DFTA 3PGDA 5I8KL 5DRWA 1FBIL 5HGHB 4YIQA 5D2NB 1EFQA 4N68A 4TSBL 1G7JB 1OTUD 4PREA 4PV8B 5KVEL 3ULUD 3TGXA 3BPNC 1BQHG 1CZ8L 1N3NB 2XWJB 2C4FU 5E5RB 4AY0A 2NY2C 3HC0B 1RUQL 3RY4A 5J11B 4F2MB 3UTTE 4AZ8A 2NTFA 1JZ7A 3CPLA 1EX0A 2DTSA 4PRHB 3D87B 1T66D 2Y36H 5EU4A 5H2BB 3SKMA 3NCFB 4LVEA 5ESQA 2UZIL 2DQIH 1WEJH 1IGYB 4GBXC 4Y5XC 2LFGA 4HKJA 3DHJA 1YEIH 4LCCA 4NYLB 3B9KD 5F9DC 2Z35A 1KGCE 3QWRA 2VIRB 2VZ3A 2YRPA 1OL0A 2E27L 4HC1H 3AAZA 5DMGD 4JR9H 2OTWA 5C2UB 2YPLB 3ETBF 3S37X 3BD5A 4KTEL 1EVUA 1ZANL 4LCIL 1MI5D 1PSKH 2KQNA 4GOSA 4FABL 3LKNA 2VR4A 2A73B 2RBLA 3HE6B 4PRIA 5TPWL 5D1XB 3O3AA 4X80L 2EE3A 4JQVA 1EERB 1QUNA 3MRDB 3V7AG 5CLWA 4IRJC 2XQBH 2FO1A 1FLRL 2CRIA 4JB9L 2F53A 3PQYB 3B3IB 3QDMA 5KSUB 3ZKQD 1RUKH 3RIFF 4HUXA 4P2RE 1CU4L 4LCWE 1YY8A 1EZVX 2AKRA 1YPZA 5ILTH 1CIUA 4MAUL 4EI5B 4KK8C 3C5ZD 2DQHH 2VDLL 3BO8A 3O41B 4NJAH 1VGEL 1ZLUH 4OM0L 2C3VB 4NCDA 2H32A 2XZCL 3V0WL 1A7RL 3MYZA 4RQQA 3VXUA 1IAKA 3QZWA 4Y5VB 4PUBL 4QY8A 5AG9A 1Z6JT 4WW1B 4U2ZA 4FXKB 2ZNWA 3JV6B 1T3FB 2DKUA 3CDCA 3PDDA 4UT9H 5ERWA 5A2FA 3BZFA 1QBLL 1MAJA 4CU6A 4NKMA 2BVEA 4WW2F 1HEZB 1NCCL 3O2DA 1A6UL 1OP5H 3FQNB 1NAMA 4WWKB 4TRPH 1FZOA 5DJXB 5D1QC 3TN0D 3VXRD 2MQ0A 4M7KL 3MLUH 4FXGB 4ONHB 4RWHA 1A14H 3KPPA 3E0GA 3ZYZA 1TQBB 2BNQE 2R29H 2Z92B 5DD6B 3O6MH 2P45B 2JB5H 2X4NB 5I1IL 4UT7L 1ZGLB 4PJ8A 2Q76A 1U8MA 5F96H 4P9MH 2FYYA 2BX5A 1DBAL 3REVA 3E8UH 1G0XA 1BVLB 1R24B 1TCRB 4Y4KD 3TBSA 2WSKA 4NNYB 3NTCL 4UU9A 4PB9L 4XTRD 4UNVA 1HQRB 1QFWL 2VDPH 2ZWLT 4ZPTB 1BECA 3OXRB 4CVWA 2FX9L 3P77A 1OWRM 4JFFB 5CSBA 3K8MA 2QQNL 1N5YL 5C09E 1VFOA 2AQ2A 2EYTA 4KMTH 2APFA 4LLWB 4BSWA 1I4FA 3E6HB 2WIIA 4A6YH 4O5LL 2AXJA 3EZ8A 3VGFA 3ZSSA 1T0PB 4MA7H 1IGMH 1V7MH 2W0FB 1I7TB 2P8MB 3EHBD 2B2XL 4Y1AB 2Y7QA 1YNKH 1GGBL 4L5FL 1HK6A 2DMKA 4JFEE 3AM8C 2UUDH 1NMCC 3F65A 2JTDA 1KEMH 4J2XA 3TLRA 4F7TB 1KJ2H 4R2GB 2DKMA 3UPCA 4XMPL 4ONGL 2FL5B 1A9EA 3G5YB 5IR1A 4FN0A 5AZEL 4AENA 3HI5H 2NXYC 4F3FB 2HVJA 4HT1L 3V5DA 5ICZA 1BOGA 3RDTA 1XF5A 2NY0C 1EHLL 3ES6A 1EGJA 1JMZA 3R1GL 1U2HA 5EC1A 3HS0B 2D0HA 5C08E 3MNVA 2W9LA 4I3SL 2AK4D 4AEIL 1K6QH 3DX6B 1HWHB 1TPXC 3SKOA 1GIGL 3LRSB 5HYQA 2Z4QB 2XZQL 4RAVA 4S1SL 4OGAD 5JDSA 1PZUB 3U9PH 2AP2A 3O4OB 4BQ9A 5B3JF 5J56B 1KOAA 2DQDL 3FQRB 2BOBA 5JHDD 3ZDXF 4ETYA 4P23A 4PJHA 3MJ9H 1WGOA 4K9EL 2C3HA 1CLOH 5EZLB 1U0QA 5IHBA 3BJLA 4DEPB 4RWYL 3MA7B 3Q6GL 1Z9MA 1I3VA 2R56H 1V3LA 3CLFH 2GCYB 5C0ND 4YO0B 1IBGH 2AABH 4ONOA 5KSAD 5J12C 2CPCA 3HR6A 3MJ7B 4MB3A 3TA3C 4Q58C 4M6ML 3KWWA 4TN9A 3LKOB 5EBMA 1XCTB 2ICES 4P5MB 2H2PC 4N0UB 4W6WB 3OV6A 3VH8A 4I77H 3QUXC 4OCLC 2VB5A 3GB7B 3QISA 2HN7B 1HSBA 2PO6D 1A0QH 3BRDA 4I0CC 2IGFL 5I8EB 1KJVB 3I02A 2VQTA 3QEGL 4HIJA 1OB1B 3FRPA 1G7PB 2J6EL 1FFQA 2DM4A 2F54D 4X9BA 3S35L 3SDXA 1BM3L 5HGGS 4JRYE 4OFKA 3UDWA 4WUKH 1RZIB 1YEKH 5I15H 4PP2A 3BQUD 1AQKL 1G7MB 2ADJA 2ADFH 4OLUL 1QFWM 5GSRB 3BAEH 3NCBB 4JO4H 2Y5TA 3BDYH 5D1ZB 4WHTA 5DJZA 1C5DB 1RJLA 5HPOA 4QYOB 3RPIA 4QRPA 4KAQH 1MQKL 5FHBH 2Z31D 4ODBD 3WCYA 1I8MB 2ZKHL 4HK3J 3DTXA 1FNSL 3ME0A 3QNZA 3QQ4A 5D5MB 1A8JH 3CK0L 4IS6B 5A2IH 3ZL4L 2XWBA 5D6DA 4LKXB 3QUKB 3AMKA 1MJ8L 4NSKA 4P5TA 1HOCB 4LDEB 5JW4N 3L3IA 4IOFC 5CILH 2RFXA 4MCZB 1D5MB 2OJZL 5K9JL 1LEGB 2ZUWA 4J4PA 2ARJA 1UJ3A 3QWRD 4Z0XB 4R9HA 2WMPA 4PPTA 3E3QE 4OBRA 3VI4F 5KSBB 2YXMA 3UJTL 2VSCA 3MRNB 3NCJL 4KJYA 1I8LA 5EWIH 5C0AA 2M26A 1JK8B 4OZGB 3KGRA 1ZWIA 2P5EB 2VZTA 4N8VA 1RIHL 4PRID 3QNYA 2KQMA 4GKNB 1FDLH 4NQCB 3SDDA 4Q6YA 4XCFH 4E41B 1V3JA 4LVHC 3MJ8A 4PLJC 1M7XA 3EYSL 3HB3C 4PTTB 1UH2A 2QSVA 3U7YH 4BKLA 4Y19E 2NY4D 1A7OH 1PG7W 5JO5A 2F53D 3QDMD 4JO2H 4KGJA 5K9QG 4Z7UB 4KKCD 4YHIA 3P9MA 3WFDH 4U1SB 2N7AA 4P4RB 3T0WA 1SBSL 4L8SA 5F88B 2H26B 4OLXL 3RNQA 1HILA 3EFDL 5FYJU 2PCPB 3VXUD 2ITDA 1NUDA 5FUCC 5TGBA 4EN3A 3ISWA 3UXFA 5CAYB 5SV4A 4ODHL 3BP7B 4MD5A 3WHE1 1H15A 5FGBC 4L9LC 1ZLWH 3F6IA 3QWOA 4BFIB 1XGUB 3B83A 3CDGA 3PG2A 5JW5B 1JZ4A 2CLZA 2HH0H 4XC1H 4I18A 4G42B 4XX1E 4LAJH 4GS7C 1B0RB 1TMCB 5ESAA 4GXUM 5IK3B 3SE3C 3NFNB 1H3WM 3HI6H 3QO0B 1JGDB 3FB8B 5DJDA 4F7MB 1A47A 4PJ8D 4CBPA 4P5KB 2AEPH 1G6RL 4FQHA 4Q6IA 5HDLA 3EJJX 4Z0BH 2IFFH 4GRLB 3HRZB 3JBG7 1QFUH 2J8HA 5BRZB 4HC1A 4ZD3H 4YDKL 4XMLH 2J1KA 3RUGB 3GUTA 3QCTL 3RZCA 4XP5H 2YK1H 5TQ2L 3C6SB 4NNPL 4MXWH 4I2XE 4DFIA 4LMQI 4G43A 5BV7C 1UCBH 1BOYA 4PYGA 3OKOA 3UTSA 4G6MH 35C8L 2UWEE 4FMFA 4U6VL 3O9WC 4RX4A 3WL9A 4OCNC 1BF2A 1QSFB 4L8DB 3VW3L 1PZ5A 4J1UA 4F58L 1GZPB 3FO9A 2OP4L 3OWEA 4ONFH 5I16B 1FFOA 3P73B 2OK0H 3PP4H 3O3BA 1F4AA 1UA6H 4PJCF 4LRIA 1LVEA 5GISL 1U6AL 2VDOL 1JN6B 2A6IA 3Q3GA 3TH2T 3VA2C 1J5OH 4XPHL 5BVJB 3DVGA 5EIIA 1VACA 2DM2A 4LLMB 4NZUL 1RHHA 3FONB 4OIIL 4RNRA 5FO9A 3ALXA 2H8PA 4OT1L 4U7SA 4HEME 3F58L 2AV7A 3GJFH 1DN0B 3VFWB 3G04A 3AY4C 1NGXB 2VISA 4TTDD 4WFGD 5GSVA 1N8ZB 3AXLA 3VRJB 2J5LC 1CFVH 2VLLA 3AS1A 5GGQH 3RDTD 1I9IH 3QFJA 3RWDB 1ZHLB 5GGUA 4OD2A 2V2WA 4LL9A 1H5BB 1JPGA 4KJQD 1QOKA 5AG8A 4NQSB 1VKXB 1AXTH 2R9HD 1ETZB 1T1YB 3C09C 4JFQB 5C3TA 1YY9D 1YMHB 1I75A 1KENL 4M48L 4GKZB 1K5NA 5IMKB 5DK0B 3A6CH 3EYQC 2JJVA 3H0TA 4JJ5B 2KZ1B 4QXGH 3MXWH 4JVWA 4P23D 3VXNA 2VQUA 1ZS8B 4YHOL 5E00B 3BKMH 2DIBA 4NM8L 3WSQH 1R3KA 4KXZI 1QTYT 3KYKH 4O4YH 5DSCB 3MBEB 1V7NL 1P53A 1X5XA 2KZWA 3UTZB 3TEUA 2X4OA 2FCBA 3VWJA 3VD7A 3IDJB 1UM6L 4A6YA 1BLNB 4MZ2A 5CJXC 3UPRA 1PEWA 3MLRH 5C9JA 2Y4SA 3RNKA 5ICYB 5ITBL 3GMOA 3QHTC 5F1IA 3KPRE 1Q72L 1KNOA 1Q1JH 2FH6A 3TH3T 1JPFA 2GQHA 4MCYB 3S3JA 3ZDZE 5CZXD 2A74B 2FX8L 5CBEB 5J3HD 3ECBA 4F33A 2HRPH 2P49B 5JA8B 4U2YA 3NN8B 1WZLA 1TVDA 4QOKD 4JHWH 3LKQA 5I8CB 4YDJA 3SHSA 1KJ2A 4OF8A 2V5SA 4FQLL 3UJJH 5FUOH 3DMMB 4JQIH 3TPUB 3BHBB 1INQB 4X5WB 5FA3A 5JOFB 5K9OA 1I1CA 1UYWL 2NNAB 4GLRH 1RJYB 4H5SA 2VXTL 3MV7B 1C12B 1KCUL 4N0RA 4YQXL 2Q7NA 1DVFA 1EBAA 1OW0C 1XCQA 5LGJB 25C8L 2XG4A 2FEEI 2FIKA 4FQQB 3WNNA 2F58H 3DV6A 4HUWB 1JGLH 2XPGA 4KRLB 1IGIH 5DC4B 2VH5L 1H3UA 2ZOLA 3DUUB 5B38G 3MJ9A 4X5XB 3DI3B 4YBLC 1MHEA 4P5TD 1AO7B 4I8DA 3SQOH 5C7XL 5J06A 3O0RL 3WUWB 4QKXB 3I6KA 3M17B 3PDOA 3CVHB 3CGTA 4JRXE 4LHUA 4JY5H 1U8OA 2K9UA 5GRUH 4YHNA 1AGEA 2D4DA 1C08A 5B4MC 4J6RH 1FVDA 4J4PD 1KJMB 3W81A 5HI4C 4FMKA 2HLAA 1PW3A 2AEQL 5E6YA 4K8RC 3K1DA 1A4JA 1A1OA 5BV7L 5C0AD 3Q6FB 2RCSL 1KLGB 5CSZB 1I1RA 3O6FC 3SDDD 1QBML 1FNFA 1UGNA 5A3ID 2UVFA 3QIUB 5HPMB 2D7QA 3RU8H 4NRZA 2RIKA 2XTJD 1EFXB 3ARXA 4R7NB 4P2RA 3EO9L 1LDPL 3HZKB 4X6CE 3FFDA 4LCWA 3MRPA 3CD4A 5TE6H 1WBYA 2HT4C 3HZVA 2H6PB 5SX5H 2VWEE 1IE5A 5F6IB 2VL5A 4OAWB 4FQJL 2AJVH 5D2NC 4OB5H 3M45A 4J8RB 5E8OA 5KSVA 3GSQB 4LEOA 3EO1B 4FZEL 1BIHA 5GJSL 3I50L 1G7QB 1F4WH 3IDNB 3JXAA 4EN3D 1NGZA 2Q8AL 5GGSA 1MEXH 2R2BA 2JF1A 3CFCH 2X05A 3V5HA 3WNOA 4CVXA 2VAJA 1PBYA 3MNZB 4J3UA 1F8TL 4UV4H 3SDCB 1IAOB 3SEPA 4DKEL 1XGTB 4XP9H 4LEXL 3EOBA 4Y88A 2ORBL 3HNTL 5DHVH 2Q87A 2AJYH 2XN9A 5J7CC 4RMWA 5IF0B 3DYMA 1IQDA 2C9AA 1MRFL 3S4SA 4Y5YC 1J9CT 2D03L 3RHWK 2OJEA 5LKNA 3QQNA 3UTPE 4ZMAT 5I1DB 2AK1L 2GITB 3IKCB 2ZSWB 3RJDA 1MFDH 2NY7L 4CNIB 1VFAA 1T83A 3CMOH 2IMMA 2X70A 1C5BL 2QADD 3LS4H 4JO3L 4ZOAA 3W9EA 3RZCD 2H1PH 4I3RH 3EUUA 3V8CA 4ZTPH 4XVSH 5D1XC 3P2TA 5KS9E 3RVTC 2VN7A 5E70A 1MPAH 1OCWH 2FRGP 1DTUA 3BSZL 3RVWC 3UTSD 3I6GB 2GTWA 5HYJE 5DYOB 5IW1A 3QUMB 3BPLB 3LHPH 4RX4D 2GFBB 4XP1L 1WAAE 3L6FA 2D0FA 4JREC 1UZ6E 2WUCL 1QSEE 2NXZB 1S7UB 4Z7VE 3RWJA 4NBYB 3H3KA 2RHEA 3EYVB 2E6PA 4JZJB 5EG6C 2X4SA 3WJLC 1RJZB 3HG1B 3DURB 4GAFB 4PJEB 5CJBA 1I9RL 1SEQL 4G80A 4JZOA 1GYAA 1SJXA 4Y5VC 2ZPKL 1MCFA 1UM4H 2ARWA 3HPLB 3IJYA 5GS1B 4UOW1 5EU3B 3LS5L 2IFGA 4PJFE 4UIMB 1E4WL 3BIKB 5GGTL 5J0BA 4LSTL 3WDHA 3CFIC 5FUZH 4U1NA 1W0YT 1F58H 1NAKL 1QBAA 5DEGB 4BZYA 4MYWB 4I0PC 1L9MA 1W0WB 5HVWA 5B3NA 1MSPA 4U6YB 1ZA3A 2AV1A 2MCG1 4J3SA 4QWWC 2IQ9H 2E7LA 3FT4A 3L7FB 4MD0B 5C70A 1CE1L 4ODTL 3QG7H 3LCYA 4WY7L 4G6JL 1SJEB 1E6JH 3VGDA 3EJYC 1N6UA 4CADB 4OTXH 5F7NC 3DRQA 3TYGH 4PRHE 3SKJH 3TT1H 4ELKB 1JNLL 2O5YH 2L7UA 4CKVX 3NAAL 4Z7WB 5IEKB 3F7RA 4R4FH 5IIEB 1TZGL 1FPTL 3BISA 5JLZA 3VXPA 5L6YL 1JHKH 4GMTL 2C3GA 4LSSH 4XB7A 2D7TL 1JJUA 2HT3D 1PLGH 3VE0B 2KL6A 4APQA 5HDQH 3BKYL 3ZLQC 1BVKA 2R0ZH 2A6KB 1NMBL 4FFWD 5FYJL 2E9IA 3DRTB 2AGJH 1GAFH 3I2CL 3OAYK 2YPLE 5FFLA 1ZT7A 1V3KA 4AL8L 1HXMB 2BOCA 3GSVB 2Y06H 4XPFL 2WBJA 4GRMA 3TBYA 3P0VL 3VWJD 4ZTOL 1LNUA 4HAFA 4K8RL 5EU7C 5I75B 5IROC 1UEYA 4U1KB 3TJHD 4XCCL 1D9KB 3V6OC 1FGVH 1I85C 1T5WA 2Q1EA 4LAQH 4HULB 3RKDC 2PXYD 3CUPB 4RGNB 2O5ZH 3C5JB 4K7PL 1PFCA 1NGYA 4K94C 5J8OA 3PQYE 1VFBB 1FFNB 5HVHB 4JFHE 6FABL 4XNUH 5IB4A 4WEBL 5HHOA 5CWSB 3QG6A 3EGSA 5CGYD 3GMPA 1NSNH 3TM6A 4KWUA 3SKNA 3QI9B 2V7HA 5HBBA 4I0KA 4Y0GA 3GJFA 4TSCL 1DBBL 2BMKA 2EIZA 4LSRL 4ISVB 4HDIB 2CKBB 1XR8B 3DI2B 4O2CA 5DQDL 4KTDL 1Q9KB 3B4NA 3N9GH 5GRVL 3FO2A 1BIIA 4ZS6C 2W9EL 3MUZ1 5E2UL 1VADB 3T0XA 1JNJA 1PEZA 4OQ1A 4UDTA 2GK0B 2EC9T 3KPLA 1JBJA 1DVFD 4PRAB 1Y6KR 4Y7MA 1NFDF 4WFFD 3GM8A 2V2TA 3NFPB 2APWA 1RZFL 3VWKA 3QIBC 5CD5C 3O3DB 1FNAA 4RCAA 4KVCH 1JGVL 2VAAA 4PGDB 2HTKC 2OX5A 3O2VL 1ZMYA 4IDJL 2VRAA 5F72S 3DETD 4DEPC 3TBVB 1NJ9B 1IC7L 1YJDL 1E27A 2GY5A 3TWCH 4ALAH 4R4NC 3L95A 1BFVH 4YFDB 4ACPA 1FZMB 2DQCH 4LHUD 1RJCA 2B7DT 2XKNA 5A16A 4NKDB 1OTSC 2P8LB 1K85A 5L8JB 1XF3B 1P7KB 2DMBA 4MJIA 5SWQB 4FZ8H 1H0DA 2J12B 2EE9A 3U7AA 2E6JA 3NGBB 1OGAB 4KH2A 1LO3H 4HUUA 1QRKA 4XH2B 3EJZD 1S9WA 2ZOKB 4JPWL 2QQLL 1F97A 1F13A 4EUPH 3AUVA 3MUGB 4FQXC 5F7WC 4YK4C 3WYRA 2VYRE 3UBXG 4C58B 1X44A 5FCUL 3OR6B 3HFMH 3GSRB 3V6OE 3CC5B 1FRGL 4Y1AE 1EAPA 4L4JA 1S7SB 4P2RD 3F7QA 4LCWD 1L9NA 3WKNA 2DN7A 4PY8I 4FNLL 2E8ZA 2W07A 2D3VA 4K3DH 2HMIC 1OGTA 3T77B 2WNGA 1YN7B 4YHLH 2Q7YA 1MLCB 2ADGA 2OR7A 2GSIA 4P3DA 3L9RA 1JIBA 3NFSH 5L8LB 3O3EB 1FG2A 1BQSA 4RFOH 3PWNA 3OR7B 4N9OB 5DJ6B 3BDXA 2YPKA 5D93B 4N90E 2DQGL 3MC0A 3MUHL 4KI5F 1AR1C 1JTPA 1MRCL 4RFEB 3FFCA 1BD2B 1SJHA 5C0FB 4QHNB 5GIRB 4MWFA 4JFPA 2V2XB 2BNQD 3CNKA 1CFTA 1S5IH 1U3HB 4ZDHB 1I3GL 1FG9C 2XN9D 3V6FB 3L5XH 4YHZL 4RISL 1NBVH 1EMTL 3RGHA 2ZJSH 5B21A 3IF1A 5MI0B 4RMVA 3GBMH 4NUJA 1UWGL 5DRZA 1E6OH 3H6JA 1FZJA 4JEGB 1KBGH 4YE4L 4Z78A 4XCYA 5D4QA 5T5NF 5JXAH 2KUTA 3VGAB 1FNEB 2NR6D 3T0DA 3LZFH 4NQVA 5FDYA 3GRWL 2F9BT 4BFGA 2CIIB 3JTTA 3ZTJH 1W8NA 5E2VH 1J1OL 2VZVA 3B2VL 2BJMH 4R96A 4TPRL 3ZO0A 5B8CA 5C09D 1EO8H 5KAQF 2JJTC 4NRXB 3WKMH 4LOUC 3RWIA 4EVNA 1SEBA 1I1FA 2I60L 1RMFL 4N0UE 4OM1L 4FOMA 4H1LH 4K7FA 4X7EC 2AJXL 5DO2C 1U93A 4HBCH 4WCYL 4HWBL 4PLKD 2DRUA 2EH8H 5D7SH 1CG9A 1NDMA 4G8FA 3W11D 4MJ5B 1QRNA 4NHCH 4DQOH 4DUXA 1OAUL 2HT2D 4HKXB 5CEXB 1FSKB 3C87A 1RAMA 3SE8H 1YECL 3B9KB 4P4KA 2B20A 5EBGA 4TQEL 5DHYA 5EIQA 3MJGX 1UVQB 1CF8L 4FG6C 3H9HA 1B2WL 2IJ0C 5IM7B 1YYLL 1MI5B 2BNRA 3S96B 4EI6B 3IFOB 1BJ1J 1N26A 4LGSB 5CEZE 4LRNH 1T6VN 3IFLL 4B7IA 3O11A 1NCDL 1LEKA 1XIWA 3VXTB 2ZCKH 4YHKH 5GRZA 4R90L 5DHVA 5ADPL 4UTAL 2CD0A 1TTGA 3CFDA 1N5AA 5L7XL 1G0DA 3D48R 4U6HB 5D5ME 4M1CD 1FO0A 4GRLC 5HD8D 5ENWA 3P4MB 4NZRH 4DN3L 5CJOH 5C0IB 1B6DA 4X0KA 1B4RA 4WHCA 2EDKA 5HHPA 5JUEH 2WWKO 3C5ZB 5DDHA 1ZT1B 2I5YL 3QUYC 4X7SL 4XWOC 4RGMB 1AKJA 4APQD 5CKAA 1JGEB 1U41A 4G6AC 4ZYKB 3M1BA 1QACA 4U6XB 4ZS7L 4U0RC 1J0KA 2XKUA 3L3HB 3MRGA 3KDMA 5KSBE 3SJVA 5INCB 4MAYC 1SM3L 4KKBC 4D0CB 4Y8AA 5E95B 3VXRB 3U4BL 3TN0B 4OZGE 3TCLB 5I76A 1DANU 2WBJD 5BW7A 4LCYB 4F57L 3TFKC 4G9DB 3VG0H 5MERA 1NFIB 5I1JH 3KPRA 3WFHB 4NQCE 1FN4A 3NABH 2ID5A 2Q8BH 1OT1A 3FB6B 3WEXB 4P3CL 1OAYH 4C4KO 1ZGLM 4ODUA 4OI9A 4Z95H 2P46B 2G75B 4Z7UE 2W60B 1FVEB 1S9YB 5HHOD 3LEVH 2P7TB 4OSUL 4UB0H 1DSFL 4I9WD 1IEHA 2D4FA 2ICWB 3U0WL 2NY1D 5HVFB 1P4LB 4LLQB 4JRYD 4OCYL 3KR3H 4MSWA 1J1PH 4OZFG 1GGUA 3KLAA 2ADIB 1T2QL 4ZUWA 5L9DH 1LE9A 1CZ8H 3A6BL 3BPOB 5JIIA 3BGAA 5DJ8A 3DIFB 3KPQB 3BD4A 3OZ9L 2PW1A 4KHTH 3X13B 2CLVB 5EUOF 4D9QE 3M07A 3KYNA 2DIAA 2GUOA 4YNYB 4F80A 4LGPB 4F7CA 1U58A 1R5VB 1U91A 3EOYG 3ARQA 1FORL 1R3HA 3VWKD 2QKIA 4K3JL 3QIWA 3SO3C 5SWZB 5L88L 1Y18B 2BXYA 3ALWA 5I1GL 2I26N 3P4NB 1U42A 4HK3N 1WITA 2DAVA 1HYSD 2X10A 4XBGA 2MKWA 4JAMB 4HJ0C 5FXCH 4N1HB 1KIPA 2XFXB 2IPKB 4QXTA 5BRZE 3RWGB 4QGYA 3HI1A 4GUPA 5T3ZL 3RUGE 4OCWL 2X42A 1I9JH 1GGIL 1MFEH 2GJZB 4LU5L 4E5XA 3HR5B 5F3HB 1J86A 4KTEH 3SDYL 1ZANH 1DBJH 4LCIH 2R0KL 4FQ2L 4MNQA 3ZT7A 3GMMA 1QQDB 2IH1B 3ZYJA 2OL3B 5FGRA 3DSNA 5IJKA 1RIVL 4Q7DA 3QJFB 3MRRA 1WIUA 2R0WL 2R1YA 3TO4A 2AK4B 3HPJB 3LN4A 5DXWA 3JV4B 3U36B 1QSFE 3MV11 2I9LB 4GG6F 2O61A 4M5YH 4HFWA 3VU2A 3C6LA 2DBLL 4ZUTA 4BSVA 5IB5A 4HCRH 3GGWA 2ZUYA 3ZZ1A 3MFGB 2Y07L 3BEVA 5F1KC 4PJ9D 3DV4B 4GXVL 4QF1B 4UNTA 4XPGH 1IGCL 4WHYH 4D0BA 4KK5C 4IIQC 5T1KA 1E4KA 1UWEL 2JB6B 3ARBA 4OZHF 4NQXA 1A9BA 5JXEC 2XA8H 1M6OB 1UFUA 1G7HB 4PTUA 1S7RB 5DRXA 4CN1A 5HYSA 2CKNA 2F15A 2ZG1A 4L8CA 1NANI 3VFMA 4W4OA 1MFCH 5EN2A 4MX7B 1FNGB 1TJIL 4MXVF 4O00A 4ZXBA 3FFCD 3U9UB 4C59B 4U1LB 4DKDC 5EBLA 2YD7A 1SY6H 4KMQA 4BUGA 3T0EA 3UYRL 2L7JA 4Y16A 1K8DB 1U8HA 2PO6B 4X6FA 4M02A 4MQ7B 3WXWH 3NPSB 2V7NA 3MO1B 1BEYH 4R4BB 3WNKA 2UYLB 5C0GB 3G6JF 4HWZA 5LWYH 3OJMB 2F54B 4XVJH 3ROLA 1S9XB 4OF0A 5D6CB 2DDQL 3T1FA 2QSTA 1JVKA 2YD1A 4AIZB 4GG8A 7FABL 5D8JH 3BQUB 3MRLB 1IGFL 3QBTB 1CICC 2EXWD 5HI3C 3WHXA 3PGDB 5SX4H 5DRWB 4QRUA 4PJIB 4YIQB 2QQNH 5KS9A 1D3CA 2IBBA 3OB0H 1W0VA 4PREB 3MUJA 5DTFA 2DM3A 4XP6L 4JHBA 3QEUA 1QG3A 5HYJA 1C1EH 1JHTA 4EUPA 1KXQE 5EO1A 5I8OH 12E8H 1F5WA 2NTFB 4Z7VA 3CPLB 4HJJL 5FB8A 2B1HH 1MHHA 4QNPF 3EDJA 2B2XH 5DZNA 5EU4B 2I9TA 4L5FH 3SKMB 4PV9A 3QWQB 4JCLA 5F6IC 1J1XH 1IAIL 2CJUH 3KPSE 2VOTA 5DJCA 4L8BB 4HX1A 3QXWA 4HKJB 2DLFL 4LCCB 5GJTL 4P4KD 2OMNA 2RB8A 3QJHA 1NKRA 1D5ZA 3Q1SL 1TFHA 2LAGB 3GI9L 1YQ2A 2OTWB 1BMGA 1EHLH 1NLDH 3ARGC 3MV7E 4P3WA 1N7MH 4NBZB 5JW3L 4DTGH 4ZG1A 2EICA 2W0LA 3HTLX 1G7LA 4XI5D 5I74C 4M7ZB 1WWBX 3ZE2F 2M2DA 3JWNC 4PRIB 4JKLA 3QR2A 3O3AB 2XZQH 4LSQL 4P46A 3FQXA 1XIWD 2LABA 3SGJC 5IVXA 3T2QA 2XWTB 1V05A 1DQDH 2XXCB 1NFDA 4XHJC 4JKPL 2F53B 3QDMB 1AJ7H 5GRVK 1EDQA 3N1MC 4HUXB 3VCLA 4H88L 4MJ2A 1AO7E 1OAZH 4N0CC 1AQDA 1R5IA 4RWYH 2AKRB 3Q6GH 1YPZB 3VXSA 3BO8B 3JUYA 1G1CA 4KROD 5F7DA 2H32B 1AKJD 2ATPA 2VIRA 3QRGL 4RQQB 3TVMB 3VRLF 3VXUB 1IAKB 4BFEA 3QZWB 1QNZL 4QY8B 3SY0A 4S1QL 1CDYA 3DVIA 2ICEA 2W0PA 1A3LH 5IFAL 5ERWB 1AC6A 5E4EC 3BZFB 4YFEA 1Y6MR 5JW4R 4NP4L 1HXYA 3STLA 4LCUA 4YC2B 2GJ6A 4KK9D 1NUFA 5FM4A 2RGSA 3UYOD 1NAMB 3QPXH 1FZOB 1U8IB 4H1LA 3V2AR 3KPPB 2QQQA 4JHAL 1VEMA 3KPRD 2DJUA 1MNUH 4OLWL 3RY5A 2AJ3A 1MCLA 1YQVL 4MDJA 3PQYA 4EBQL 2NZIA 4PJ8B 3S3SA 2Q76B 1U8MB 4ENED 4PJBF 2FYYB 3REVB 2LQRA 4F9PC 1WC7B 3SKUD 4TUKH 4HPYL 3TBSB 5FHAL 3MCKA 4UU9B 1RQ5A 4G5ZH 4WGWB 1CGSL 1O7VA 4OLUH 1PYWA 4MB5A 4LF3A 2HTLD 1AY1L 3LN5A 3P77B 4L3EA 5D2LB 2G60L 2BVOA 3G6DL 5EZIH 1HEZA 4LQFH 3OKEB 3QQ9D 1MQKH 4ZAKD 2YHGA 5DJXA 1NGQH 2KBGA 3BP6A 4PRPA 1QFWI 4BSWB 1I4FB 1NCWL 2EXYC 2WIIB 3CK0H 1CDIA 1S7VA 1MJ8H 2FB4L 2Z91A 3VFTA 3QIWD 3WBDA 3V4VH 2P5WA 4M8QA 4M5ZH 4OFIA 2MQ3A 2Y7QB 3ZSTA 3S88L 1CGTA 3CU7A 3CVHL 1IAIM 3MRFA 2PR4H 5KVMC 3VXMA 5DUML 5L2JB 3GIZL 3CX5K 3FRPG 4JRXD 5DR5L 2X4QA 5IMOA 1MELA 2Z0BA 3MUY1 3P4OA 2Y23A 1RU9L 2HWZL 1A9EB 5JW4M 5IR1B 3NCJH 1XGRA 3TZVC 2EYSA 2HVJB 4MVBD 4LIQL 3V5DB 5ICZB 3OXSA 1BOGB 5GS0C 4MNQD 3RDTB 1KN2L 2APVA 3O81A 1DEEA 2ERJB 1XF5B 3ES6B 4BH8A 5EC1B 2VXVL 3MNVB 3TO4D 3E6HA 3EYSH 3V4PL 1BGXL 4IMKC 5HVHC 5GRWA 3SKOB 5HYQB 1A7PL 4OGYH 4RAVB 5JDSB 2A6JA 3BP5B 2P8MA 1GHFL 3HG1E 5ACZA 1DBML 4PJEE 4UT6L 3FOMA 1EAJA 4UV7L 2IAMA 2MJWA 4PJHB 5FYKE 3BRGC 4W6YB 3PE9A 3W82A 3QCVH 5JR1H 2Q6WB 5T1KD 4DW2L 1NCAL 4ODHH 4DKAA 2H41A 5AD0A 4Q9QL 3IDYC 2ZUTA 4XAKE 1XGPB 3ARBD 4F3FA 2JCCA 3GNML 4WFEE 3KWWB 4PRNB 3NIGF 5JOPE 5EBMB 3O8XC 3GHEL 3TCXA 4AQOA 3NIDF 1KG0A 3VH8B 1B4JL 1ZLVK 3T0ED 3SCMA 4Y16D 3MV8A 4H0HB 3RWEA 1I1AC 1B90A 4Z7WE 2X09A 1HNGA 4W4NA 2CGRL 3I02B 4WEUD 4WDIA 5D72L 5E8DH 1MFBL 3OB8A 4NKOA 4YDKH 4JFDA 4GSDL 1SYSA 4HIJB 3QCTH 5FOBA 3QPQD 3UTPD 1X6NA 1Z3GL 3SDXB 4G7YL 1KJ3H 4RFNB 3O4LA 3T3PE 4Y4FB 2IQAA 5EA0L 4OF5A 1NEZA 4PP2B 4Y4HA 2OI9B 2X1XR 2ADJB 3I75A 5DS8A 4M03A 4NN7B 4C55A 4WHTB 1UWXK 2OP4H 5HYJD 3ARPA 3RPIB 1YEJL 4QRPB 1FYTA 4LLYA 4ZO7A 4LLUB 3L7EA 4Z77A 4M1DL 1F00I 4DN4L 5A1AA 3DTXB 1OAXH 1HHGA 3QQ4B 4RGNE 1A7NH 4XPHH 4NSKB 5LXGL 5ANMA 1ZHBA 4P5TB 1YMMA 4BH7A 1RHFA 2EH7L 4RDQF 2AJSL 4OIIH 3L3IB 3LDBC 2RFXB 4OLVL 1JV5A 1A6PA 3MOAH 4GKSA 3ILQD 3OG6B 3U4EA 1UJTA 1ZTXH 4JZNA 4KUCF 1A64A 2A9ML 2ARJB 2GEEA 3NCYS 1UJ3B 1MY7A 4Z18A 1AIFB 3PIQA 5LJYH 3VXQB 1BREA 1IFHL 4M7JH 1U8NA 1CT8A 3MTRA 2VDQH 1X5JA 3F6LA 5D1ZA 4QHKJ 1SY6A 5C0AB 4DOHB 1ZWIB 1IQWL 3BUTA 4N8VB 1U3HC 3AREA 1JI2A 4BYHA 3P40A 3QNYB 1MOEA 2JJSA 1DP0A 2E9JA 3E2HB 2XTJB 4BKLB 5INDB 5CCKH 3BD3A 4NOBA 3X3GH 5DQJB 1ZEAL 5JO5B 2XIDA 5ALBH 3JWOC 4YHIB 3P9MB 4HS8L 3VA6A 4H26A 3VGAC 3RTQC 3AC0A 4L8SB 3VXSD 3WHE0 1HWGB 3RNQB 1OTUC 1VB9A 3MRKA 1HILB 3MODL 4JQXC 1P69B 3ULUC 1N64L 4RIRA 3MXVL 5TGBB 4EN3B 4UILL 1K3ZA 1ADQH 4MD5B 4JFOA 1H15B 2CUMA 3EOTL 2VDML 3MA9L 3UROR 4M62L 1E4JA 5GS0L 2GJ6D 4XVUD 3CDGB 1T66C 4P9HH 3B9VA 4JN1L 2CLZB 3IU4H 1T1XA 3G6AA 4I18B 4MQXD 5D7LA 3WS3A 1MUJA 3RL2A 2FX8H 4M3JA 3LV3B 5IWLA 1TNNA 3T8XA 2GKIA 3OX8A 4GG6A 3CVIL 3CJJA 5DJDB 3PQYD 3B9KC 4JFHD 4CVZA 3LN9A 3IDUA 3IETA 4FQLH 4P4RA 4FQHB 4Q6IB 3RY6A 2PTTA 1F6AA 2A9NH 5DMGC 3U30B 2H26A 4EI5D 2CKBL 3IS0X 1JWSA 3Q5OA 5EOCL 3GUTB 1WIOA 4WU5A 2QADB 3RZCB 3CX5J 2ZUQC 3MX0A 2VXTH 4IBLT 1KCUH 1A5FL 3MLXH 4JFXA 4YQXH 3NH7H 4R0LC 5KG9A 3INUH 4OZHA 3QCUH 3UTSB 2W9DL 3NCMA 4KV5F 4JDTL 1BD2E 4R26H 3WL9B 3BESR 4M93B 2NW2A 2ZCHL 5DD1L 2OR9H 1PZ5B 4J1UB 4PRPD 3FO9B 3EYUL 5I1HL 1FFOB 2IANA 2K1MA 3TC9A 3DLQR 2FATL 4U1JA 3C5ZC 1IT9L 1HZHL 2FX7L 3OAUL 2A6IB 3Q3GB 2A0LD 4XPBL 3DVGB 5EIIB 1VACB 4Z7NF 3ABZA 1JNNL 2QBWA 5EC2A 1RHHB 4RNRB 5FO9B 4KVNL 4I3GA 3VXMD 3G6JA 3NIFE 2H8PB 3WFEL 1FL3A 3D5OF 4G9FA 3WXVL 2AV7B 3HZYA 5F1OB 4POYA 3G04B 5IT2H 2VISB 2XACC 5GSVB 1OSPH 4G6FB 3AXLB 2VLLB 3L5JA 4IRZL 3N1PC 1IC4L 3QFJB 5GGUB 1F2QA 4OD2B 2V2WB 4KY1H 3ZHKA 4BK4A 1JPGB 3ORJA 3ARFB 4FP8L 4HH9A 4RZCA 4U1IA 1CFNA 3LD8C 3GO1H 2LTQC 5E94A 3EO9H 4Y4KC 3QDHA 3GI8L 5EU6A 1Q9WA 1HN1A 1TQCB 1K5NB 3HCVA 5ISZA 5TH2A 4FQJH 3H0TB 3V4UL 3W0WE 4ZFGH 2IAMD 3VXNB 3WNPA 1KELL 4YXHL 5D96B 1ZSDA 2DI8A 2E7HA 3BPOC 4X4ZA 2R2HA 2IALA 3GKZA 5BO1H 1R3KB 4X6EA 4D9LH 2FO4A 2FZ3A 4TVPE 5D1QA 4N90D 1RUPL 2X4OB 4ZO9A 3VWJB 3BJ91 5JZ7C 4MA1B 3UPRB 1AC0A 4DGYL 1TJHL 3H7BB 5DFVC 5C9JB 3RNKB 3GMOB 1PKQA 5F1IB 1KNOB 4NQSA 1KIQB 4ORGB 1KSRA 2BXZA 1GGYA 2WBWB 2MMXA 3SCMD 3ZDYF 3MV8D 2DQJH 1YNTA 4XNMA 5T33H 3ECBB 3VRIA 4F33B 3QRFM 1WIPA 3K80A 1WFTA 4LDLB 5IKCB 4YDJB 3JWOL 1Q94A 1WAAF 1KJ2B 4N8PA 4NC0B 5IG7A 4FQCH 3BZEA 4LSUL 4RGOL 1UACL 2Z8WC 5FA3B 5LBSH 3QEQA 5K9OB 3QUZA 5E08L 2JE8A 3ULUL 5GZOD 4Y4HD 4H5SB 3BSZH 4X7DC 2F8VA 3IDJA 1I3RA 3TIEA 4XP1H 1DVFB 3IFNL 3R8BB 4OGAC 4HXBL 1XCQB 4N5ED 3VXRE 5MEPA 2NY6B 3PP3K 2FIKB 1FYTD 4X4ME 4XCEA 1CBVH 3ZKXC 3TH4T 4PJ5A 1T7WA 4I13B 3DV6B 5C0CA 3QDGA 4MCYA 2XPGB 5CUSL 3FN9A 2ZOLB 4GRWF 2C4XA 5F7MC 2H9GA 2GI7A 3KPSA 1YMMD 4HJGA 3BKCH 5C0NC 2B5IC 3ARVA 1E4WH 1ORSA 5KSAC 3MLPA 4O02L 3I6KB 3RX8A 3QXDA 4PJBA 3BHBA 2QQKH 3PDOB 3RA7L 2R2CA 5F89A 4LHUB 4BELD 5HDBE 3BVNB 1U8OB 4YHNB 1AGEB 3HMXL 1C08B 4K71B 1FVDB 2WLZA 3EO0A 2YA1A 4H8WC 1QLEH 4ODTH 4KHXL 5FKAA 4G6JH 4NWUL 2DLTA 1A4JB 3G5VA 5D1ZD 3D9AL 3S36H 4YWGH 2PO6C 3FT2A 3HE7C 3U6RA 3VI3F 3RKPA 3ARED 3LEXA 3NPSC 1KYOJ 1D7FA 4U1HA 5SWZE 3WN5A 3L5HA 3FCTA 1TZGH 3PXHA 4NRZB 4YPJA 2R15A 1CS6A 2FLBT 3KJ4B 4K7PY 4P2RB 4RBPK 1A6AA 3FFDB 4LCWB 4HLZG 3MRPB 5DC0A 5IEHA 1WBYB 3HZVB 1GPOL 2J8UF 4XPAL 1J05A 2VL5B 3M17A 2I07A 5E8OB 5HJ3A 5KSVB 2X4UA 3TA3A 2BY3A 1X5HA 4LEOB 1G9MH 1OAKL 2YUXA 3BI9X 4U1GC 3MLYH 3ULVC 3MACH 1NGZB 4XPFH 1BFOA 1A3QA 4WEMB 4K8RH 4ZOCA 5GGSB 3UCRA 3UEZA 2Z31C 2R2BB 3T65A 2OM5A 3C2AL 4E42A 2AK4E 2PTUA 4CMHC 5SWSA 1JWMA 1LP9F 3EOBB 1RUAH 2CK2A 2Z9TA 3IDXH 5D7LD 5C8JA 3WIIH 1SMAA 3LY6A 5I66A 2XN9B 1EFXA 3AFLA 2ITCA 3MSPA 2BDNH 1GVIA 5EU5A 4NN5B 5JMRA 1HIMH 4JM2C 1IQDB 4OV5A 1OPGL 5ID0A 1JCKA 5C6WH 3S4SB 4BSJA 3JVGA 1NC4A 1X6LA 4HXAL 1BQUA 4G3YH 5GZND 3K7UA 5DQDH 4KTDH 3IU3A 1VFAB 3CZFA 4XAWL 4BZ2L 2X70B 4YHML 2W9EH 3SDAA 5FOJA 2C7UA 4FQIL 3W9EB 2VZ1A 4M7ZC 4NIKB 5HHXH 1LK3H 4ZNCD 4TVPH 3QNXA 4JQVC 3HA0A 5TQ0L 1CL7H 2Y72A 1KB9K 2BVPA 5CD3A 4D9QD 1K4CA 5IW1B 3K1KC 3L6FB 2NY4C 1JGVH 1XGTA 2FHCA 4TNWK 4XWGL 3SE9L 3RWJB 3U7WL 4L9DA 1G9NC 4NM4H 2IAND 2X4SB 2XZAL 2XRAL 3LPFA 3THMH 4G80B 4JZOB 4NWTL 1A2YA 1TTFA 3IJYB 2YUZA 5BRZD 3FQTB 3IKCA 1T21B 1EO5A 4AEHL 2BK8A 5FO7A 3MGTA 1ADQA 1NPUA 3OAZK 4U1NB 4G9FD 1JPSH 5KW9L 1P84J 4PJIE 1R3IH 1SMOA 1ZA3B 4HIEA 2AV1B 5C0JA 3ARUA 5DVMA 3FT4B 3P0GB 4P2YA 2QQLH 1DQLL 4YLQT 3CH8A 4PB0L 3B5GA 5JA9A 1FGNL 3QHFL 3DRQB 4QCIA 3K8KA 2WZPD 3T3ME 1E4XL 2X89A 5EU6D 5JLZB 3UJIH 1IKFH 3CXHK 5ISZD 1IMHC 1RZJC 1EXUA 5GS1A 2YC1A 3MRIA 2YPVH 2EC9U 1Z0NA 3BIKA 1WT5C 4APQB 2DWDA 1LD9A 4J3TA 1BVKB 1W72L 4UQ2A 1C8PA 4YEEA 1BQLL 5LGHL 4L9LA 1KTDB 3W39A 2VUYA 3NZHL 3HC4L 5TDOA 2YBRA 1ZT7B 4H8WL 3VJ6A 1J8HA 5D1QD 1MIML 2BOCB 2WBJB 3TBYB 1LNUB 5IESH 2VXQL 3GHBH 3SE3A 4PRIE 3UTOA 4HQQH 5C86A 2R1WA 4O58L 1N0XL 2WUBH 2FBJH 3MQIA 1T5WB 1U8LA 4K23H 4ELKA 4KRPD 4UBDD 4YHZH 1CD1A 4XP4H 1I7ZA 2HJFA 1NGYB 2YA0A 2F5BL 3BH8A 1RFDH 2F53E 3QDME 4NGHH 1KTRL 5IB4B 5HHOB 4HZLB 1DUZA 4XVTL 4XRCA 3QG6B 1A02N 3BP4A 3NACH 3EGSB 1KCVL 1YPZE 2W1NA 3GMPB 1T04B 1YEEL 3SKNB 5TJWK 1DLHA 2NY1B 2V7HB 5E8PB 4LLDA 3MZGB 3GJFB 4JG1H 2BMKB 2EIZB 3VXUE 4HK0B 3S36X 4O2CB 2ERJC 3QUZD 1J1OH 3B2VH 1INEL 2IBZX 2HKHH 4TPRH 1BIIB 2AJUL 4KJQC 4NZTL 3V6ZA 3ULVL 1BFTA 4UDTB 5KTEL 2R9HC 5TE7L 5D7IF 5KVDL 4OM1H 3DUHA 1YY9C 2X6MA 3VWKB 4HWBH 2G5BA 5F9JA 4XX1G 3N1QC 3WIHH 4PJ5D 5E2WH 4P23C 4K94H 3D3VE 1AGBA 3ZTNL 5HXMA 3JWDC 3P0YH 3KPSD 1YECH 4DGVH 4XBEH 3BYTA 1SJVA 1E27B 2CO7B 4U49A 3KHOA 2BSRA 4WIQA 2XI9A 3DMMD 4QHKI 3L95B 1F4XH 3AY4A 3GSNL 1HKLH 1XR8A 2NXYD 2XKNB 5A16B 5C0RH 2YWYA 2D31A 4LARL 1CXLA 1KCSL 4MJIB 3VD3A 2NY0D 4M43L 1H0DB 4FQPA 5D2LE 3MV7D 1EHNA 5JIPA 4JGJA 3ZE0E 2BC4A 2PW2A 1NCDH 1MIEH 5I30L 4HIXL 4M6OL 3AB0B 4HUUB 4X5LA 5CZXC 1S9WB 1WF5A 5J3HC 1M7DA 1FIGL 3IGAA 5F9WC 1ORQA 5KSBF 1G9NL 3GSWA 3EDKA 2NY5C 2G5RA 3SOBL 2NTSP 4NQEE 1EAPB 3TF7C 5CINH 4KKAD 1OGTB 2BNUA 3MNWA 3C5SA 4ZS7H 1WCBA 2Q7YB 2ADGB 2VDKH 1UQSA 2GSIB 4P3DB 3L9RB 4NO2A 4NN7C 1XF3A 2NCMA 4PJGE 1FG2B 2VDRH 4LHJB 3C9NA 1JHLH 3PWNB 4WFGE 4OFPA 2F74A 4LSPL 1NAML 2YPKB 1TVBB 4N5UA 1L7TL 2H2PD 4RA0C 3G9VA 4HMCA 5DLMH 3FFCB 1A21A 1SJHB 1KB9J 1WLHA 4ODWA 2ZOKA 4MWFB 5I73C 4JFPB 1WTLA 2C5DC 4X9GA 4P5TC 1T6WA 2VDNL 1IILE 2COQA 5SWSD 1CFTB 4OQTL 1MCPL 4O9HL 3L3GA 4Y8DC 2VXUH 4POUB 4XBPA 1EFXD 3MFFA 5GGTA 5LCVL 2NY3B 3U83A 3DNKA 1OLZA 3IF1B 1F4YH 4J4PC 4XXDA 4PJHE 4K3EL 5DK2A 2OYPA 1UJ3C 2W0KA 4HIIA 3T77A 1NC4D 1RZJL 4NUJB 5DRZB 1FZJB 4Z78B 3S5LG 3K3QA 4XCYB 2YUWA 4EZMA 3BGFC 3IB4A 3SDAD 4E0RA 2EC8A 2OTUB 4NQVB 3OZ9H 1OW0A 3QAZB 3OR7A 2Y6SC 3JTTB 4R96B 5B8CB 3SDDC 1DLFL 1P6FA 5DT1H 4M8VA 5A3IC 4YBHA 4NNXA 2JIXA 4WNQA 3RWIB 4EVNB 2FD6H 3MRBA 4YDLB 1SEBB 1I1FB 4O2FA 3K4DA 1KLFA 4FQ1L 1OY3B 5TE4H 3RWCA 4HBQA 4I48A 1U93B 4AMKL 4WI2A 3QEHA 5DWUL 1MCWW 3A67L 1CG9B 3S34H 1HHIA 1NDMB 1P4IL 4G8FB 2YKLL 4JHZA 1QRNB 1JRHH 1NGPL 4Z6AT 4QRQB 4F37K 3CXHJ 2R4SH 3BEWA 3LIZL 5T3ZH 4BZ1L 1N59A 4P4KB 3SDXE 5IGXL 3PWUB 1BJMA 1NUNB 1OP3K 5DHYB 2R0KH 3N85H 1FNEA 4MS8D 5EFIA 4U33A 4LP5A 1O0VA 4HUNB 3H9HB 2N56A 3W5MA 5KANG 1KPVA 4I18C 3IDGA 2BNRB 4QXUL 3S37L 5KVFH 4OJFL 3WNMA 4G6KH 4KUZL 2EDDA 2J4WL 3O11B 4PLJD 1LEKB 4QRPE 1XIWB 3WD5L 1HE7A 5T3XH 5DHVB 1K4DA 4TULH 3CFDB 1N5AB 3H42H 3STBA 4HGMA 4Q6IC 4XGZA 5C0EA 1FO0B 5ENWB 3U30C 4GXVH 3HG1D 5E7FA 4X0KB 4PJDA 3JWDL 2X89D 3W0WA 1C7SA 5HHPB 2HFGL 4UAOB 3KLDA 3RZCC 4ERSH 4NCC2 5DDHB 4KROB 1UWEH 1YYML 1KCKA 5T5FL 1AKJB 3T4AA 4ORZC 3HAEH 3MLWH 1UVQA 1QBBA 3M1BB 5I1EL 4S0SD 4AEEA 4ODSL 4JN2A 3MRGB 2APTA 2GYSA 3KDMB 5IM7A 4WFED 3SJVB 3PWPA 5JOPD 5B39G 5C0AE 5F3BA 4PBWD 4DOHE 5I76B 3UYRH 4LVOC 3VXTA 5MERB 3Q2CA 4EIZC 4PLNC 4WI7A 3OQ3B 1FN4B 2HP4A 4N0YH 1OSZA 4PJ7F 5AEAA 3QB7C 1QVOA 4Y5YA 2XTJE 3JUZA 3TV3L 3H8NA 4JVUA 5ABDE 4ODUB 2BVUA 5AWNH 1L0XA 4CW1A 1T03H 1ZKAA 3B6SA 1OAQL 3GZKA 4D8PB 1MF2L 2CR3A 2NY5L 5JPNB 2DDQH 1QA9A 1PD6A 2ZCLL 4AEFA 1X9QA 2IPUG 2O5XL 5E8NA 2BHUA 3K2MC 4ODXA 2J8UA 1MQ8A 3BWAA 2DQUL 4MSWB 3KLAB 5I71B 4UOJA 4ZUWB 1LE9B 1ES0A 1XF1A 3X17A 3FB5A 4GFTB 5DJ8B 5FAAA 4D0CA 2PW1B 1MJUL 2MWCA 2WM0A 4BUHA 5HYSG 3KYNB 2XXMB 2GUOB 1EGJH 4F7CB 1U58B 5H37G 1U91B 4JPIA 3WJLA 4WU7B 1DFBL 1TQCC 1R3HB 4HPOL 2QKIB 3QIWB 5HGAA 5I0DA 4IM8A 3WEXA 5K59E 5DI8A 2HT3C 3LVEA 5EOCJ 1OOAA 4TOYH 1LP9A 5C6TL 2CQVA 3MV9A 1NMAL 2WW8A 4NOFA 3ZE1F 4NFBA 5A40E 5DJ0A 4FFWC 1BQHA 4M7LL 4W68A 1U8QA 4HV8A 15C8H 1RIUL 4TYUA 5DD5L 1KIPB 2R0LL 4QXTB 3QI9D 5BZDA 4I0PA 1P4LA 1N6QL 3HI1B 4GUPB 1F42A 1DL7L 4E5XB 1LO2L 3ZYIA 1RK1A 4UINL 1INDH 1BBJA 4MNQB 4PLOB 4NHUA 5H8DA 4YGVA 4X6DF 2UY6A 2PXYC 4XT1C 4R7DA 3UTSE 1XH3A 3MRRB 4LSQH 2R1YB 1TZIB 5EDXA 3TO4B 1CLZH 3LN4B 1UB5A 3G5XA 4GKOA 2O61B 4HFWB 5EORL 1MWAH 3C6LB 4R8WL 5SWZA 4JKPH 4NQTA 5HDOA 3IJSA 5ACLA 5IB5B 3EYQD 2XY2A 4OGXL 5TF1H 3GGWB 1NLBH 3BEVB 1GGCH 3F8UB 3WDJA 4AT6A 4D0BB 1XFPA 4IRSC 4CN6A 4G8EA 4S1QH 3JV0A 5T1KB 2GJZA 2CLRA 3ARBB 4NQXB 2VUOA 1A9BB 1DVFC 5IFJA 1FVCA 1FP5A 1Y0LB 3KLHC 1QQDA 2IH1A 4PTUB 3KLSA 5DRXB 5HYSB 4L8CB 3VFMB 4JDZA 4KKNA 1J0HA 3DPBA 1SHMA 1HH9A 1I85A 2HA1A 4ZXBB 4DCQA 1N0LA 2Y36L 4HWBA 2JJWA 3QFJE 3JV4A 5AAMA 5EBLB 3WIHA 1U9KA 2Y1VA 3DETC 1XF4A 2DQIL 3T0EB 1WEJL 4WGVB 4Y16B 2JELH 4OLEA 1U8HB 5CP3H 4X6FB 1GC1H 1D5BA 1YEIL 3CFKB 3ILPA 4Y2OA 5JNYA 1R3LA 5GGVH 3P11H 2V7NB 3OPZH 4HPYH 5E7BA 1T4KA 4QF1A 4HC1L 5MEQA 3PHOB 1ITBB 1ZVHA 2ZG3A 4HWZB 5J57B 2MPAH 4K71C 4JR9L 3ROLB 1TJGH 1BBDL 1FL6A 1JPTH 3T1FB 4GG8B 1AY1H 2DD8H 1QSVA 4KFZC 3WHXB 5F9OH 1AE6H 3G6DH 3FRUA 4QRUB 1AD9B 3ZTJG 1W0VB 3RVUD 3P30H 4FXLA 5DTFB 2YMXH 3PWVA 1KFAL 3I6LE 1NCWH 1JHTB 5IW6A 1LE5A 4EUPB 5EO1B 1HH6A 2IEPA 1I8IA 2JIXD 1RUKL 4QRRE 2X40A 3KJ4C 5FB8B 1MHHB 4KPHL 1K8DA 2E5EA 1BX2A 2DQHL 4NJAL 2I9TB 4PV9B 5IQ7H 1EEQA 1YZZA 5C0GA 1BVZA 5CJ8A 3BIBX 3RAJH 2J2ZA 4EXPX 1NDGA 5DJCB 4UT9L 2NLJA 4HX1B 3TBWA 1QO3A 5IW3A 2HWZH 5HI4D 3QJHB 2VC2L 3IXAA 1IAII 4LIQH 3TBTA 1D5ZB 2ESVA 4TRPL 4PJIA 4K8RD 1KN2H 1A3RH 4XNYH 2FSEA 2GT9A 3MLUL 4LLVA 3D6GA 2AEIT 4HUVA 3HNVL 2W92A 1G7LB 2P4AB 3O6ML 1BGXH 2JB5L 4FQXA 4WFFE 4WTWA 1YEFH 4JY4B 4P46B 5M7QA 2R4RL 5F96L 3FQXB 4H20L 5D7IA 2HLFD 3E8UL 1GHFH 5IVXB 3VG9C 4M4RA 1NFDB 4XXCA 4BQCA 5IB2A 7CGTA 1ZHNA 4K9EC 3VCLB 4X7TA 3TNMA 4QO1A 1T83C 1QR1A 2VDPL 2X1PA 1AQDB 1R5IB 1A4KB 4L8BA 3W0WD 2NR6C 3VXSB 5BQ7A 3WV0A 1NCAH 5F7DB 1NCTA 2A83A 2ATPB 3SY0B 4NQDA 2ICEB 3IVKA 4TVPD 4V2BA 4RRPG 4LNRA 5DGRA 2R69H 1AFVH 5GPRA 4A6YL 4JFYA 1HXYB 3STLB 4LCUB 5EO0A 3D69A 2GJ6B 1EBPA 4Q9RH 4MA7L 1J0YA 1IGML 1V7ML 3BUYB 1S7QA 5D70L 4H1LB 3OHXA 1FAKT 4P2CG 1YNKL 3BN9D 4F15B 5I18H 2OZ4H 2GY7B 1MHCA 1OTTD 2HT2C 1I1YA 2XWTA 2AJ3B 4IEFB 3O45A 1NBZA 5F71A 4MDJB 3RX5A 1MFBH 1KEML 3K81A 4ZSOE 2EDFA 3DVNA 3ELAT 2AEWA 3HI5L 1FNLA 3WFZA 1SVZA 4HF5H 1P7HL 4ODVL 3MCKB 3TVMA 3OKDA 4P48A 4YR6A 4X7FC 1OQXA 1ZXQA 3RVTD 1PYWB 3QFDA 4LF3B 3LN5B 4L3EB 4X7CC 3WIFA 1IM9A 5IBLC 2MNUA 4L29A 1RV6X 2BVOB 3DBXA 3H9SA 4V1DE 4XNXH 4JFZH 3U9PL 3ZT6A 4M1DH 3BP6B 5HD8C 1U8IA 4L1HA 4PRPB 3UZEA 4DN4H 3HC3H 2ICWJ 2EYRA 4PR5A 3AS0A 1S7VB 2FLRT 4G8GB 1VDGA 5LXGH 1UM5H 2Z91B 3VFTB 3D3VA 3G5ZA 3OJVC 1CLOL 2P5WB 2XN9E 4M8QB 5LVEA 3I3EA 5JMOC 1LO0H 2R56L 3G08A 3MV9D 4KZDH 3CLFL 1RURH 5IVOA 1WC7A 2AABL 3AS2A 3H9ZA 3MRFB 3GK8H 5B3JE 3HAEA 1QPXA 4AH2A 1UKTA 2VMFA 3VXMB 3BXNB 1SBBA 4MXQC 4CN4A 2EO1A 3ZDXE 2X4QB 5IMOB 4HG4K 4I0PD 3P4OB 3WMSA 1IEAB 2V9QA 1IFHH 2W65A 2WBJC 3N1GC 5D2LA 1XGRB 2E8YA 1G7IB 4B5EA 2EYSB 3ZKND 3OXSB 4YXLH 1XZ0A 3OKEA 4XPTH 1DEEB 4I77L 4BH8B 5F6HJ 1A0QL 5IMLA 2DS4A 2CK0H 4NO3A 2GAZA 1EUTA 4B53A 5SWZD 2GTZB 1ZEAH 5C0BA 4LLAA 2A6JB 5IVZA 5FKPB 3HLAA 4NQEA 5ACZB 3QUYA 4X9FA 3HNSH 1FE8L 1PGRB 3C60C 4WUKL 3FOMB 5I15L 2IAMB 4HEPG 1ZLSH 3BKJL 5L2JA 1YN6A 1Y6NR 4NZJA 5CZVH 3DGGA 1X4XA 4KQ4L 4UILH 3BDYL 1TLKA 4PJGA 4MAYA 5AD0B 4JKWA 2IMNA 3MA9H 4KAQL 2JCCB 5FHBL 3T2PA 4JN1H 1Q0XH 1U3ZA 4NKIH 5MENA 5J9PA 2AVGA 4OZ4A 5J4MA 4PRDA 1KG0B 1PX4A 1HYSC 4OF7A 1F3JA 3SCMB 4NUGL 3BP5A 4LPVA 3MV8B 4OFVA 3RWEB 3CLEH 1WZKA 5ADOH 4G7VH 3NA4A 4KJWC 4L4TA 4OCXL 5T1DL 3RWFA 3ZKMD 2P42B 4WDIB 4NKOB 1MAKA 5EB9A 4JFDB 2R2EA 1SYSB 3E3QC 3B5TA 1NGWA 5FOBB 4YDIL 1NKOA 5DMIH 2Q6WA 2D7MA 3O4LB 3BRFA 4AG4L 4ZS6D 1DUYA 2IQAB 1XGPA 1NEZB 4Y4HB 3SQBA 3AB0C 4UTBH 3I75B 1LMKA 1FZKB 3FHQA 5DS8B 4M6AA 5TDNA 4PRNA 4M4PA 4IJ3B 4Y2DB 5I9QB 5DD1H 3FAXA 2VLRA 2P44B 5I1HH 3VI4E 1CVSC 1MWAA 5CD5D 1FYTB 4LLYB 1A7OL 2R1XA 4JO2L 2HTKD 3L7EB 4Z77B 3D85A 1HZHH 3KYOA 2FX7H 1M7IA 4PJ9C 1HHGB 3PF2A 3UO1L 4O51A 3ULUF 5ANMB 1ZHBB 4PJ7A 1JTOA 1YMMB 2A77H 4JPVL 4BH7B 4UI2A 5HHOE 4OD1H 5EOTA 1S9VA 1V8HA 1JV5B 4I9WE 4GKSB 3GKWH 3U4EB 4JZNB 4JG0H 4Y4FA 3RZWA 2X1QA 2YS4A 3OMZA 1FCCA 3P4LA 4J12A 1YEGH 2HH0L 4XC1L 3F7VA 3PIQB 4DVRH 2ESVD 4ZUSA 3V79C 1IC4H 1CT8B 1U8NB 2PTVA 3NA9H 4HUKB 5IQ9A 1AHWA 3AREB 1IJ9A 1U2CA 4KJPC 4LLUA 5CP3A 2AI0H 4J3XA 1P9MC 1RVFL 2YR3A 1LQSR 4Z0BL 2IFFL 5F7KC 4FTVA 3WE6A 1R3JA 4XMLL 3KJ6H 4S1RH 3LB6D 4HMDA 2HMID 2HFEA 3IRZA 4IIQA 4D3CL 2YK1L 1KELH 4H26B 4ZFFA 1KN4H 1MFAH 1MCWM 3DXAE 3WLBA 5EH1A 4MXWL 4NO0A 5JXEA 3MRKB 1UCBL 2NMSA 1DQQA 4RIRB 5B8CC 1F4HA 1ZT4A 4PS4H 1AIFA 3WLWD 4NQDD 3VXQA 1RUPH 4DWHA 4MJIE 4ONFL 2NYYC 4JFOB 4DGYH 4YDLC 1TJHH 3C08L 5KOVC 2OK0L 3PP4L 1EK3A 1D5XA 1UA6L 4GAJH 1XGQA 3DX8A 1T1XB 3G6AB 3BIAX 2YRLA 4DVBA 4X6DA 4HLJA 5D7LB 5BS0A 5FIEA 3WS3B 4OFDA 1MUJB 3RL2B 4LVNC 4KXZH 3WFCH 5KN5A 1HI6A 5INDA 3T8XB 4GG6B 3OX8B 5DQJA 3V0VA 2MQCA 3JWOH 3WO4C 2F19H 4CVZB 3RBSA 4OD3H 3IETB 4PJCE 1RD6A 5T3ZD 2V5MA 2PTTB 1F6AB 2VO5A 4RGOH 3RJQB 1CICA 1JWSB 3MLZH 1QEWA 1UEMA 1UXWA 2PYFA 1CXIA 1CFVL 4WU5B 5F9AC 3TVMD 5GGQL 1MREH 1I9IL 3QXVA 4HG4J 1G1YA 3VXOA 5C9KA 3BPNB 4JFXB 4CMMA 3IFNH 1KC5L 3OGCA 3CMGA 5KG9B 4OZHB 4LOUD 2VL4A 3H9SD 3FFCE 3PNWA 2EEBA 5T3XD 2NW2B 5F1NA 3A6CL 3UMTA 3KS0J 4QXGL 3MXWL 4ELMF 2IANB 2XQYG 4YBQD 3RL1A 3LV3A 4U1JB 5C71A 3D3VD 3STZA 4KROC 2HG5A 3EAKA 3SGDI 5HYIA 3BKML 1KIUA 3WSQL 2CIKA 1B0GB 3RA7H 3KYKL 4O4YL 3U0TB 2GHWB 1MCBA 5BMFH 1CLYH 2WK2A 4W81A 4X6BA 5EC2B 4U05A 4PGZA 3G6JB 4FG6D 2LE9A 1FL3B 3D0VA 5HHME 3ARGA 4G9FB 4NC1E 3VGGA 1CXHA 2C1OA 4KZEH 3LQAH 3CCHA 4XNZC 3RPKA 2DQEH 2W38A 4EDWH 4KHXH 3LKSA 3MLRL 1OARH 3HZYB 5BW7C 2APBA 2FWOA 5B38A 3L3KA 1VESA 5I17A 3TO2A 5EOQH 1Q1JL 1BZQK 5B22A 2ZUUA 4ZQKA 1CQYA 1LK2A 2OZ4A 2X41A 2WBKA 1OM3H 1EVTC 1FH5H 2HRPL 1QFOA 4ZNEE 4HH9B 4U1IB 4RZCB 5DQ9A 1A6VH 4YHYC 1CFNB 5E94B 1U8PA 5C0BD 3UJJL 5FUOL 4JQIL 5EU6B 1Q9WB 1H8OA 4QT5A 4NQED 3HCVB 5ISZB 5TH2B 1HSAA 3QUYD 3FN0H 3R06A 2B1AL 1QRNE 1CGVA 1KCRL 3GFUA 5GQBA 2HTLC 1BF8A 4G6AD 4MJ6B 4AJ0A 2XKSA 1JNHA 3MCLH 1UH3A 1OAKH 1IGJA 4XC3H 1ZSDB 1WZ1H 4WI6A 2ED8A 2R2HB 3LMJH 2IALB 3QQ9C 1O5DT 3MLVH 4ZAKC 4X6EB 3PV7A 2FO4B 2FZ3B 3IRPX 4KKBD 3C2AH 4YFLF 5D1QB 2B8OT 1ZLUK 2BNRE 5HTSA 4WO4A 1M71A 3U1SL 3EIFA 1JGLL 2DLHA 2WIMA 3QIWC 2EDQA 3DX7A 1IGIL 4OUUB 3H9YA 2FNBA 3RFZC 3ARFA 5IHUL 1II4E 1PKQB 3ARTA 4I4WA 4KRPB 4HS6A 3KYMA 43C9A 5T1LA 2E7CA 2FHBA 2BSTA 4F9PA 2P48B 1OP5K 2G9HA 1YNTB 4XNMB 3VRIB 1J87A 3DO3A 1QFHA 5GRUL 3VFOA 4L4TD 4F9LC 4J6RL 1Q94B 5IG7B 4U4BA 3GJEA 3DVFA 4MVBC 1WUNT 3VFGH 4FS0A 3WUWG 3BZEB 3PABB 1ND0A 3QEQB 3TT3H 3QUZB 5IJKC 3MV01 4QRTA 3T09A 3CAFA 3X3FH 1MJ7H 2LVCA 3SJVE 3F7YA 1I3RB 3TIEB 1P7QA 3FO0H 4XWGH 3H7BA 3FAWA 3RU8L 5MEPB 2VLRD 4TVSa 4QRRA 1PJ9A 5HSFA 3I3BA 2LU3A 1CDUA 1KIQA 4XCEB 5TE6L 4ORGA 3S98A 5E99H 3D85D 4PJ5B 5HGDA 5C0CB 3QDGB 2VWEC 5DD3L 2AJVL 4OB5L 2EDYA 1NMCB 5EIVA 2H9GB 3KPSB 3UBXI 4HJ0D 1QKZH 5IKCA 3FB7A 5ALCH 4B41A 4HJGB 3ULVF 4JANA 4F7PA 1ORSB 4OI7A 3MRMA 1F4WL 4EOWH 3QXDB 4PJBB 1QLFA 4AQ1B 5F89B 4P2OA 3TZVA 2NXYB 1MEXL 5KW9H 1R0AH 3CFCL 4Y4FD 2XTLA 2NY0B 1OWWA 3EO0B 1RK0A 4UV4L 2F5AH 4E9LA 2UUDK 3BW9B 4HHAA 3W9DA 3H3PH 4NPYA 4UUJA 1DQLH 2VZUA 5FKAB 1F6FB 3BN3B 2IPTH 2X44D 3SGKC 1S8DA 4IMKA 3G5VB 1TPXB 2J3SA 2AJYL 4JM2F 3RIFK 4WW2A 3FT2B 3WJJA 2BVTA 3U6RB 3KHQA 4QRPD 3LEXB 3MJ6A 4PJAF 4ZFOA 4U1HB 3WN5B 3FCTB 3B43A 4Z8FH 3QPQC 2OXGA 4FTVD 2QTEA 1MFDL 5CSGA 1A6AB 4OZFH 5IEHB 1XF2A 4M61A 4WTZG 5JOEA 3LS4L 3ARSA 2H1PL 4I3RL 1J05B 4ZTPL 5HY9A 4XVSL 2FJGA 2I07B 4NO0D 5HJ3B 3BVNA 2X4UB 5I19H 3FOLA 5CZKA 3TA3B 5JXED 4DKFH 1OCWL 5GS2H 4GQ9H 2G2RA 3LHPL 5D71H 4YUEH 1BFOB 3O8XA 3W2DH 4MNQE 1YPZF 3T65B 1N0XH 2XY1A 4E42B 3RBGA 2OQJA 2YXFA 5DURB 2LU4A 1I1AA 4NC2B 5SWSB 1JWMB 2YD4A 5C8JB 1YA5A 1RZKC 1UM4L 5I66B 1P4BL 3ILQC 4YDVB 3ARWA 4ZSOA 5CJQH 2ITCB 4XVTH 5EU5B 1JFQL 5DUPH 4OV5B 5FUZL 5ID0B 1F58L 5GXBB 1NC4B 2AXFA 1NBYA 1KEGL 3GSOA 1CICD 3IU3B 2WWMD 2IQ9L 3CZFB 4P57A 4JDVA 3SDAB 2C7UB 1OT2A 1MAML 3QG7L 4QHMA 3ULVH 2ICWI 5J11C 1E6JL 3SBWA 5TE7H 1D5IH 4OTXL 3QNXB 4V1DA 5EO9A 3TYGL 3HMWH 3SKJL 4Z7QF 3TT1L 2BVPB 5CD3B 4MLSA 2O5YL 1K4CB 4O2EA 1N2RA 4R4FL 5FYLH 4NN6B 4WFHD 3T0EE 4W70A 1JHKL 3WFBH 2R8SH 4WJ5A 2BFVH 2DIJA 3EW3B 1F3DH 1PLGL 1L7IH 1NL0H 4RMTA 2VXSL 3ZE0F 1YJDC 1FO0H 4CGTA 1A2YB 4FFYL 5GRXG 3GSNH 2AGJL 2B4CC 1KLUA 2HFFA 1GAFL 1H3PH 1K9TA 3DROA 5FO7B 4BQ8A 3MGTB 5F6HI 4PG2C 1MHPL 4K3HA 3HE6C 5DVKA 4MQXC 4HIEB 4YJZL 5C0JB 1EH9A 4DJMA 2HJKA 4LPUA 4LAQL 3MCG1 1MCEA 2O5ZL 5DHXB 4LVHB 4CJ1A 1QSZA 3L1OL 2FECL 3V52H 3V6BR 4K3GA 1S3KL 4L4VE 5ITFB 1YEDB 1G9NH 1J0JA 4QCIB 4RAUA 4LNVA 1NSNL 3SOBH 4U3HA 4EI5C 4JJHA 1BJ8A 1TTUA 4N0CD 2BRRH 5IBTL 3RTQA 2VR9A 2SEBA 5DD0H 3ULSA 4M9PA 4CL7A 4NJ9H 4JPKH 4PGCA 2OS7A 3LRGA 1EXUB 4GW5A 3N9GL 4JQXA 4LKCA 3MRIB 2YC1B 1FIEA 3FQTA 1T21A 4QTIH 2VN4A 2ENSA 2DWDB 1LD9B 1MCDA 4CUCA 1E4XI 4UQ2B 1WBZA 4YFLI 1D6VH 3FTGA 4LSPH 4L9LB 3W39B 4WWKC 1L7TH 3UBXA 1ITCA 5TDOB 2YBRB 3VJ6B 1J8HB 2HAZA 4G6FD 1TQBC 2MTPA 4GS7B 4WO4D 3Q5TA 3MRCB 1P5UA 5C0DA 3PWLA 3UTQA 3QFJD 3OTTA 2R1WB 4OQTH 3ARFD 2A0LC 2FEDD 1U8LB 3KNBA 2MCPH 2ZG2A 1CD1B 5IVXE 1EEYA 1A6WH 1ZLWK 3IJHA 1I7ZB 5T1LD 1NFDE 2HJFB 3O6KH 3TWCL 4ALAL 2VKXA 2IF7A 3BH8B 1YDPA 4AYFA 1BFVL 1WWWX 5GRJH 1RZJH 3HMXA 1DUZB 4XRCB 3U2SA 3BP4B 3OGOE 2A6DA 3VXSE 4FZ8L 3MLTA 1DLHB 4CVUA 5CS7A 3C8DA 4LLDB 4R0LA 4PD4J 1KTDA 5BV7B 5JTWA 1RZ8A 4M7LT 2JK5A 2MOVA 1EHAA 3EFFA 4LPCA 3V6ZB 2R23A 3LQMA 4OZIF 2GJ6E 4XB8A 3I6LD 2D2OA 4GJTB 4R6UA 1P7QD 4OIAA 5DVNA 1WISA 3HFML 1XR9A 4FQ1H 4JY6A 4P0DA 4KRNA 4QRRD 2QHRH 4JO1L 2AQ3A 4AMKH 2G5BB 5F9JB 3WS6A 3A67H 1L6ZA 3K4ZA 1RZKL 2WINB 1AGBB 5AZ2H 5IV2A 2FBOJ 4QEGA 4YHLL 4PBVC 1PG7L 4HZLA 3LIZH 4KDWA 4R2GC 2CMRH 3NFSL 5IGXH 1I7RA 1T04A 4M1GH 4RFOL 2VITA 4JM4L 3GSXB 3OKMA 1EZVY 2BSRB 5E8PA 4OF6A 4HK0A 1YEHH 4P2OD 1K8IA 3TZVD 1JP5A 3E6FA 4M6NH 2J5LB 2D31B 3ZHDA 3MR9A 5GHWH 3QXAA 3M8OH 4YX2H 4QXUH 1X5GA 1H3XA 4L3EE 5E9DB 2VZOA 1TETH 4CDGC 5CHNA 4BQBA 2QL1A 1GGTA 2IADA 1UKQA 3UYPA 2BC4B 2PW2B 2J4WH 5EZOL 5BVPL 2F8XC 1S5IL 3WD5H 5J1TC 3ARDA 3O4OC 3L5XL 2NY6D 2X4RA 3C09B 4PRPE 4Y4KA 1M7DB 3GJFK 1NBVL 3IGAB 2EKJA 1U95A 4KI5E 4XCNA 9CGTA 1JGUH 2N1KA 5BOZG 1ORQB 2ZJSL 2VR5A 3A0OA 4G8GE 4JLRA 1MJJA 1IVLA 1IARB 3JWDH 1E6OL 5C07B 2P5WE 2V17L 3BZ4A 1BFSA 3GSWB 1KBGL 3MRHA 4ELMA 1VEPA 3TNNA 5JXAL 1ZVSA 3DXAA 2FJFA 5L2KA 1BZ9A 3ZMRA 3ZHLA 5GZOC 4LPWA 2BNUB 4Y4HC 1QPPA 3MNWB 1CLCA 3VXME 3C5SB 3NMEA 5E2VL 1WCBB 2B4CL 1FAIH 2BJML 3K2UL 4PBXA 4QXWA 1UQSB 3ARRA 1WVZA 4NO2B 4N5EC 4FFVD 4TNVK 3WKML 43CAA 2QR0A 3C9NB 2Z8RA 2F74B 1TZHA 3OKLA 3O8XD 5AUMA 5FECB 4LASH 1M05A 2WWKT 4HBCL 2YZ1A 4ODWB 1ED3A 5D7SL 3OF6A 1I1AD 1J11A 4NHCL 1B88A 4DQOL 1NCBL 2J88H 4X99A 3CDFA 3L3GB 3UC0L 1MF2H 3SE8L 4XBPB 2NY5H 4CAGA 3MFFB 1KUMA 2ZCLH 4PJCA 1JF1A 2KPNA 3HUJF 1KB5H 3OKKA 4XXDB 5DK2B 3IDIA 4HIIB 1T89C 4JVPA 2NZ9C 3LH2H 1VPOH 5D1ZC 3JTSA 4F7EA 2E7BA 4NRYA 4E0RB 3MOBL 4C4KT 1JUFA 3AREC 2JCCE 2ZCKL 4YHKL 1TVBA 4POZC 1CK0H 4V1DD 2GW5A 5JHDA 4DK6A 4NNXB 2B0SH 5MP6H 1BP3B 1DFBH 2JIXB 4HMEA 4NZRL 3MBXL 4WNQB 5CJOL 3MRBB 4O2FB 3RWCB 2ATKA 4YBLB 4I48B 3MV8E 3QEHB 4OZFA 3CFJA 5KSAA 2CDFB 1HHIB 2ZUXA 1W72A 1J12A 4UQ3B 5TFSH 5HYEA 2DQTH 4JFDE 3BEWB 2A2QT 1N59B 1HNFA 4JCMA 2AW2A 3O4LE 3QDJE 4DGIH 2C26A 1I7UB 5EFIB 2OTUA 4KGLA 1OLLA 1BAFH 3VG0L 5I1JL 1KPVB 1FV1A 5KJRH 3IDGB 4BM7A 3HE7A 1GOHA 3NABL 5BJTA 2Q8BL 1A6ZA 2D7PA 4XMKH 3FO1B 2YA2A 4Z95L 5I1CH 1FYTE 4ZNEA 1K4DB 1LILA 2X7LA 1DDHA 4XGZB 5C0EB 5H35A 5ANME 1T1WA 1ERNA 1ACYH 5IFHH 4PJDB 3RTQD 1YMME 3W0WB 3KR3L 4QRQA 3TYFB 1J1PL 4LPTA 3BE1H 3GMNA 4GRWB 1T20A 1UT9A 5L9DL 2Q3AA 1NC2A 3PWUA 4GAGH 4YXKL 3T4AB 2WAHA 3D1MC 1KPUA 4KHTL 4OCSH 4P59L 5ETUB 2Z31A 3SGEI 3O2WH 3WUZA 3LEYL 5SX5K 4JN2B 3QXUA 1A7QH 4H0IA 3PWPB 5AYUH 5F3BB 1YNLH 2ENYA 3F5WA 3RP1A 4MA8L 4PG9A 4YZFF 1MRDH 1IM3A 4Z7OF 2HKFH 5FGCB 2CDEA 1OSZB 5EUOE 1YC8A 4JM2A 1P1ZA 4NZDA 1QVOB 4Y5YB 1T5XB 3GEWB 4PJAA 4CW1B 3B6SB 1NANH 3GSNA 1I9JL 1MFEL 1BBDH 3PV6A 3RVVD 1HINH 1QA9B 1MCOH 4YH6A 1DBJL 4BA8A 4PJXF 3DJ9A 5E8NB 4ODXB 2J8UB 3BWAB 4LPXA 5ID1A 2VLJA 1KFAH 1ES0B 5C2BH 4M5YL 5IB1A 3FB5B 4JREB 2IG2H 3RGVA 1QYGL 3B8YA 4HCRL 4KPHH 3H7LA 3NZ8A 5D7LE 4JPIB 5E8EA 2EDJA 3MLSH