2OK2A

Muts c-terminal domain fused to maltose binding protein
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
402
structure length
402
Chain Sequence
MIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTHMEETSPAVEALENLDPDSLTPRQALEWIYRLKSLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein, DNA mismatch repair pro
publication title Escherichia coli MutS Tetramerization Domain Structure Reveals That Stable Dimers but Not Tetramers Are Essential for DNA Mismatch Repair in Vivo.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Sugar binding protein
total genus 132
structure length 402
sequence length 402
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2ok2A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2ok2A01
2HZLA 5H8NB 2Z8FA 2DQVA 4G68B 1PB9A 1MQJA 4ZEKA 1JEVA 3FD3A 4GRKA 1OQGA 3U1OA 2AIXA 1ZJLA 2O1LA 3H6UA 2O69A 2ZYMA 2RCAA 4KHZE 4TQUQ 2ZMBA 4G2ZA 4P0IA 5CMMA 5TU0A 5ISUA 4AB5A 1DTGA 3EPEA 2I0CA 1FCKA 1MH4A 4RXLA 2R6GE 1DPPA 3U72A 3TTRA 1Q1KA 2AL5A 4ZEIA 2V84A 2DE2A 4RY1A 3A09A 5IAIA 5H8FB 4R6HA 2M8CA 3CI8A 1OMPA 2ZYNA 3U8QA 4G4PA 5I57A 4X48A 1UIVA 1FTOA 3TZAA 4IO3A 4RA1A 1UTBB 2IEEA 4YAHX 3TKDA 2Z8EA 3UA8A 3RGYA 2PYYA 1H76A 5TP9A 3K4UA 1B2HA 2O1MA 3O9PA 1B3GA 1M5BA 2ZYOA 2HAUA 1N76A 3H03A 3D4GA 4PFTA 1B46A 3E9XA 3OO8A 4P11A 3KBRA 4HW8A 3T93B 4JSOA 3IB1A 1JW4A 2GFEA 2DXYA 5IKBA 1QKBA 3KJ7A 3IO4A 1XVYA 1Y9UA 2GH9A 1IUDA 2QSXA 1I6AA 3K6UA 3R26A 3IOTA 4H8JA 4F3BA 1S50A 1QKAA 1RKMA 5LOMA 1D9VA 4NF8A 4KR5A 2QMXA 2XX7A 4YKPA 3K2DA 4IO7A 4ZE9A 3TYHA 3S9NC 5A5XB 4OMBA 1RYOA 3DP6A 1XVXA 1TWYA 5AE4A 3PMWA 4KI0E 4F22A 4LQ2A 5TP9B 3PUYE 4XKPA 1D3KA 4NF4A 3VVDA 4ONYA 1TT1A 2WKYA 2Z8DA 2W7YA 4OESA 3M3KA 5KDTA 4U22A 1I6BA 1R1NA 4I8CA 4WKMA 3VV5A 3OEMA 2UXAA 4ESXA 1POY1 4EQBA 1N7WA 5F1QA 3S9MC 2D21A 2FA7A 3QUJA 2Q88A 3IOWA 3VLVA 1PBPA 1N0TA 3VXBA 5I58B 3O6IA 4OENA 4KPTA 1FQDA 1II5A 3Q26A 2ESNA 3KJTA 5I59A 2OLBA 5B70A 5AA4B 4NF5A 5B7DA 1LCFA 4U1OA 4HTGA 1MXXA 4OZ9A 3IORA 2F7AA 2NVUB 1PBQA 3IB0A 4LP2B 4DXBA 4F3GA 4Z0IA 1S9TA 4ND9A 4IGTA 3RPWA 3V8XB 3RQTA 4JDFA 5I2NB 2QRYA 4ISUA 1B4ZA 1JETA 2XXHA 3PUWE 1EU8A 1P1NA 4MLQA 3RT6B 3CFZA 2DP8A 1H3DA 3CSBA 4QHQA 4OETA 3C34A 1R6ZA 3MVXA 1XT8A 3IR1A 5CBRA 2V3TA 1R9QA 3B6TA 3CSGA 4POXA 3ZKKA 3CG3A 4FE8A 3N5LA 4LZ5A 2Z22A 3SEUA 5I59B 1FQEA 4DE8A 4GL8A 3VLUA 2D5WA 5I56B 4PFYA 1UTHA 4U21A 4ZEBA 1AOVA 3VDFA 1Y20A 3FXRA 1B7ZA 1B05A 1QW0A 4MLVA 1B3HA 3FVKA 2DE4A 1NNTA 3CRBA 3W9WA 1DTZA 3KN3A 1LGBC 2ABHA 4H5GA 3K6XA 3USDA 3FIRA 1POTA 3TQLA 2XXWA 1OVBA 4N13A 4YKKA 2A5TB 3FJ7A 1SYIA 3C4MA 4R72A 3O28A 4U2RA 1B52A 1H43A 3WAFA 1SQYA 3EF7A 2B65A 4R2BA 1O7TA 4ESWA 3V5AA 1LBCA 2YJPA 2F6GA 1IXCA 4FJPA 1A55A 4ZECA 3HPIA 4EF2A 3PU5A 2KLFA 4O3BA 5I2KA 1M5DA 2XD2A 1R9LA 1ZIUA 4DXCA 4F2OA 2GHBA 2UVHA 2ZXTA 4EF1A 1Y3NA 4GXSB 4H67A 3EHTA 1O63A 1N04A 2X7QA 2Z23A 3EN3A 1NNKA 1BTJA 1B3EA 2XXPA 4WEPA 3N94A 4QSDA 3ZS6A 1A54A 1AH5A 3PD8A 3FUZA 5BWJA 5FHOA 1LAFE 1A8FA 3TMGA 1H45A 4R9GA 1MPBA 1OIBA 2DOJA 2Q2CA 4DLDA 1NNFA 2RKMA 3IAZA 5H8NA 4G68A 3KOTA 2ONSA 4RK9A 1B9JA 4YB6A 2D3IA 3R6UA 2PBWA 2REJA 3M3LA 1QULA 2ZNTA 1B51A 1SD3A 3I3VA 1QUJA 2Y84A 3LR1A 4KCDA 2H25A 5ITPA 3OMBA 4YB5A 2OJTA 3Q28A 1MXYA 1D4NA 4M1VA 5I84A 1FQCA 3PMVA 3Q29A 3UIFA 5CBSA 1MPCA 5L9OA 2V3QA 3SDFA 2I6EA 3MWBA 3MQ9A 2PMSA 3C36A 4Q0CA 5KZTA 2UVGA 4NMYA 2OWSA 3C35A 3C31A 4EXLA 4H65A 1SBPA 3SETA 2PT2A 3E3KA 5H8FA 4XKRA 2XXVA 3MZ1A 5JTYB 2Q8JA 1YCJA 3VFJA 5HBCA 5CC2A 3FV2A 3F11A 4OHNA 4G68C 2P1SA 1UTBA 3G7WA 1CB6A 4GOTA 3HV1A 3FV1A 3HSTA 1QUKA 3H7MA 2ZNSA 1SW1A 4HCYA 3PUXE 2OZZA 1J1NA 2GHAA 1LSTA 1F9BA 2QJEA 4YMAA 4KD5A 1ZLQA 3UGWA 3QUFA 2CZLA 3T9HB 4NWCA 3FVGA 1VFEA 1B5HA 4ZS9A 1B32A 1RYXA 4LQ5A 1TFAA 1IXIA 4N07A 1N3XA 1XOCA 4JWXA 3OO7A 2VGQA 1PEBA 1LB9A 1B40A 1FQFA 2I3VA 5A5XA 4NTLA 3DLNA 4F3PA 4C1TA 4UACA 2DVCA 5ELVA 4R74A 3OENA 2IA4A 4G77A 3W15C 1NH7A 4LVQA 1DPEA 3T9XB 3FATA 4DZ1A 5DVJA 2G93A 4LZ8A 2DWAA 1M5FA 2NOOA 4DCXA 1VFDA 3LSXA 3FJMA 5I58A 3VVFA 1GV8A 3IOVA 3U94A 2THIA 4F18A 2XXXA 4JSDA 3OXNA 2H5YA 2XXIA 3L6GA 5AA4A 1P1WA 4Q30B 4P0GA 3FVNA 1YPNA 5K2XA 4NEDA 5KCJB 1YTVA 1N3WA 2PVUA 3VVEA 4QF9A 3RNNA 1QUIA 4OEVA 2HQ0A 5HPQA 1FTKA 5DT6A 5TPAB 2RC8A 1IEJA 2ANJA 5I2NA 1MH3A 4DXUA 1LB8A 5ITOA 4Q5TA 4AQ4A 4BDMA 4YB7A 1VR5A 5K2YA 4ZE8A 4PETA 3MP6A 5H8HB 1FQBA 2I4CA 1A99A 4LONB 5EHSA 1MXVA 3PUZE 1L5TA 2I0BA 1GVCA 3QK6A 1JW5A 1US4A 2PT1A 2YLNA 2VHAA 3TUSA 3A3UA 1B6HA 3B6QA 4I9DA 5I56A 2YPNA 2O7UA 5F7VA 4PFWA 5DEXB 3TELA 2I58A 3H06B 3H3GA 4BDRA 1MY3A 1Z7ME 2HXWA 1H44A 4ELPA 3B6WA 2R9JA 3BFUA 4OQOA 1SW5A 4ZEFA 2QS2A 3N6TA 1MS7A 4RPNA 3IJOB 3JZJA 3HO7A 1ZKBA 1JEUA 3K01A 3FZVA 4OVJA 2Y7RA 3O2AA 4TOZA 3PPNA 4X9TA 2F97A 4EXKA 3E13X 5L9SA 4QFOA 1IQ7A 1WDNA 4IGRA 2XXTA 4TLLB 3ZSFA 1SVXB 3ILTB 3THIA 2A5TA 3TTLA 4NF6B 4POWA 4LZ7A 3IK6B 4QRZA 1US5A 2F7CA 4ELOA 4IB2A 1SI0A 3RY3A 5AA3A 2XHDA 3ILUB 2Y7IA 3U93A 4THIA 2NXOA 2Y7PA 1CE2A 1D9YA 1EZOA 3QSLA 4I1DA 2CMOA 3U92A 3BKIB 4H5FA 1MM7A 2VD3A 2REGA 3VXCA 3H6VA 1MY2A 3G3HA 1MG1A 1UIUA 5DVIA 1FW0A 1P1QA 2HCAA 3IO6A 5FTIA 3T66A 1MQHA 2Q9TA 4GD5A 2H9BA 3IOUA 4FECA 4FORA 3BBRA 4QFLA 4F3SA 3K1PA 5HM4B 3MPKA 4RPOA 1PDAA 3JYRA 5CM6A 1BKAA 3TCHA 4RNSA 1B1HA 4NE4A 3CG1A 3LSFB 2QL3A 3T22A 2PX1A 3MZ9A 1JQFA 1URGA 2DYXA 2VOZA 3CVGA 4XTCQ 1FTJA 1SDXA 4FAJA 4GQOA 4I62A 4ZDMA 3G3IA 3TCGA 2AL4A 4ELQA 4NWDA 1SI1A 4LATA 4Q8RA 4U23A 1JVXA 1B4HA 3CR9A 4FEBA 4XKNA 1NKXA 3V89B 4UA8A 3OD7A 2E0SA 4R2FA 3GBAA 3G3GA 5CMKA 3ECRA 4F1UA 3FASA 3OELA 1MQIA 3RTFB 2A5SA 2ONKE 1PC3A 3N26A 5CMBA 3D4CA 1JVYA 3VE1B 5ICTA 3Q27A 5JTYA 1ZMGA 2VP1A 3TCFA 1AMFA 1BP5A 4JXIA 5AA2D 4MFIA 3SESA 3TTNA 3SEWA 5EHMA 2P0SA 4O3CA 4DCYA 4PQJA 3T9VA 3MW0A 4E0WA 4ZZEA 3PUVE 3K6WA 4H6DA 1GGGA 2ALUA 2B3BA 4F2QA 1B0HA 4H8IA 1FTLA 3BFTA 1LFGA 3K0VA 2FYIA 3KN7A 3MZBA 1GR2A 1LAXA 4KYDA 3C9HA 3MAMA 2RC7A 1NL5A 1IITA 1SW2A 2OWTA 3TFLA 3QXMA 4KYEA 2DS9A 1OLAA 1Y1ZA 3ODBA 3LBSA 3SKPA 2AYSA 5CI5A 5H8QB 3K00A 3KN8A 4HS7A 3RUMA 3UK4A 3HHGA 1DSNA 1EH3A 2HFBA 1VE4A 1VSOA 3S4UA 5CMCA 3IJXB 3MBPA 3JV9A 3KSJA 4M4GA 3SERA 2Y7KA 4G8MA 2F35A 4JBZA 4H1XA 3VLWA 2I3WA 1IXGA 4K3FA 4BDOA 5J1DA 3SEVA 1GTKA 3SEYA 4R6KA 3H6WA 1B7HA 2E1SA 1WVJA 3OO9A 2QS3A 5FHNA 2DSFA 3OO6A 3H6TA 5DVFA 1S7YA 3GBBA 4MF3A 4AB6A 3SEXA 3I5OA 1I6QA 2V3UA 4QSEA 1BLFA 5DTBA 3KSXA 4R9FA 2HEUA 1B3LA 2RCBA 3TEPA 4ZEDA 3HHFA 2DE3A 1N84A 3C32A 1OVTA 3MVWA 3PD9A 4R73A 2X7PA 1LAHE 2XX9A 3TDJA 5JEIA 3B7DA 4QFKA 1Q35A 4G8NA 3EQ1A 4OFJA 4EQ7A 2GRVA 3DELB 3ONMA 4YKJA 3KZGA 3GXAA 3O29A 5KCJA 5AA2B 3TTMA 2QS4A 3FXQA 4OEUA 1QVSA 4YICA 3T9UA 1XS5A 1M5EA 5TPAA 3MP1A 4X1DA 2RF1A 3FGSA 1MDQA 4QSCA 2XXQA 4BDNA 4RK2A 5DYHA 3G3FA 2UVJA 1LFHA 1SW4A 4IY5A 4U4XA 1MY4A 1FQAA 2XXRA 1MDP1 2Q89A 5H8HA 4GWOA 1XHYA 4F29A 3IB2A 3K1NA 3WAEA 4RJZA 1MQDA 4YU0A 3V83A 2O84X 4HCWA 3RN8A 2F6PA 4BDLA 5FHMA 2QPQA 3LSWA 1O64A 1NFTA 1Y4TA 3T96B 2V93A 4RYAA 5AA1A 2P2AA 5DEXA 3RT8A 4OWDA 4F39A 4FIMA 4YZZA 4OERA 3OSQA 3P7IA 1A40A 4O3AA 4PFUA 4F1YA 1ZU0A 3DM0A 5I57B 3KOSA 2DXRA 1MXUA 3I6VA 1T0KA 3A3CA 3G3KA 3OOAA 3AXFA 2OCUA 3QAXA 3PPQA 1MRPA 1MY1A 3IL1B 1IXHA 1IIWA 1EZ9A 1JW1A 1N7XA 2B3FA 1B7UA 2I4BA 4NF6A 3KGCA 3OSRA 2F78A 3FVOA 3TODA 1AL3A 2XD3A 3EHSA 1B5IA 4XXUA 3S9EA 4OFOA 2NWJA 3PV0E 4JWOA 3MVZA 1Y1MA 2O51A 3TQWA 3N6UA 1PB7A 2XX8A 4BDQA 1URDA 3IX1A 2OBGA 1MM6A 4FEDA 4NF8B 1NNPA 1HSJA 4X1BA 3EHUA 5FTHA 1A7LA 3OEKA 3L6HA 4JB7A 3H4ZA 4FATA 3K02A 3TTKA 4NF4B 2UYFA 3LSLA 2HZKA 2X26A 1LCTA 3FXUA 2DWJA 2I49A 4IY6A 3G3JA 1USYE 5KDTB 1ZTYA 4R75A 2V25A 4GXAA 1QJMA 1I69A 4IO2A 2O7IA 3GZGA 4QFPA 4U1ZA 3MC2A 2QMWA 1Z7NE 4EQ9A 2XXYA 3S9LC 2H4IA 1TXFA 4Z7EA 4IO6A 4YMBA 3PGFA 3O66A 2ZYKA 2HAVA 3E4RA 4GVOA 1Y3QA 4NF5B 4GL0A 3KG2A 3LUYA 1LAGE 2DWHA 3TPAA 4H0WA 3PMXA 4E0XA 1LFIA 4MBPA 1AIVA 3MVYA 3PPOA 5L9MA 2RC9A 3O6GA 2XXUA 1Y3PA 1XC1A 1LLSA 1B58A 2VD2A 4G8HA 4OXVA 1Y4CA 1URSA 4EDPA 1IZ1A 1NH8A 4C1UA 3LC8A 1UQWA 2UYEA 2Y7WA 4PE5B 1MPDA 3DP8A 2ZNUA 4F31B 1FTMA 4EUOA 1TFDA 3M8UA 2F36A 1LBBA 1B5JA 4LA9A 1B3FA 5CRYA 4GIZA 4DDDA 2O6AA 2F7BA 3K6VA 3FJGA 1B1XA 4R6YA 2I48A 3RLFE 1P1UA 2DWIA 2F8DA 4C0RA 2DVZA 2G29A 1JNFA 1HSEA 1UTHB 3RTWB 3UORA 1SYHA 1ANFA 3MP8A 3TAJA 5BUUA 3UN6A 4L17A 4IO4A 2O68A 3MJNA 4GFRA 2UVIA 4QFNA 2QS1A 2Q2AA 3DP4A 3CFLA 4BLAA 5ICQA 1A8EA 4ECFA 2NUVA 4KFQA 5H8QA 4OYVA 3QYTA 3S2VA 4WXJA 4PP0A 1B0LA 1P1OA 5L8DA 3UP9A 4KCCA 2R71A 5H8SA 2BJJX 3KEIA 3O97A 4XKQA 3HCQA 3PPPA 4F19A 4XIGQ 1WODA 1EZPA 3K1MA 5M2VA 1ATGA 1ELJA 3Q25A 4YKIA 4LUBA 4GLIA 1HSLA 3R7XA 4KQPA 4ZZAA 3KFMA 2LAOA 4ELRA 2FNCA 2H99A 3CIJA 1MY0A 3C33A 5I2KB 2ONRA 4TLMB 4WEDA 4GF8A 4OTEA 4F1VA 1DOTA 1KWHA 4MH5A 1P99A 1YAEA 4DIGA 3MPLA 1DMBA 3HN0A 2F34A 1OQHA 1ZBMA 4N6PA 3ZKLA 1OLCA 3MUQA 1USYH 3QIMA 3GLBA 3O6HA 3W9VA 3M3FA 3CFXA 4IO5A 4JWYA 1PB8A 5EYFA 5AA2A 1MQGA 4U4SA 1BIYA 1NMUA 2OK2A 5JK4A 1MXZA 2F5XA 4OFLA 1MXWA 1M5CA 3PPRA 2H98A 2RINA 4KYSA
chains in the Genus database with same CATH superfamily
2HZLA 5H8NB 2Z8FA 2DQVA 4P3LA 4G68B 1NUWA 1PB9A 1MQJA 4ZEKA 1JEVA 3FD3A 4GRKA 1OQGA 3U1OA 2AIXA 1ZJLA 2O1LA 3H6UA 4PGPA 2O69A 2ZYMA 2RCAA 4KHZE 4TQUQ 1YYZA 2ZMBA 4G2ZA 4P0IA 5CMMA 4P47A 5TU0A 5ISUA 4AB5A 5EQ8A 1DTGA 3EPEA 2I0CA 1FCKA 1MH4A 4RXLA 2R6GE 1DPPA 3U72A 3TTRA 1Q1KA 2AL5A 4ZEIA 2V84A 2DE2A 4RY1A 4OANA 2P3NA 3A09A 5IAIA 5H8FB 4R6HA 2M8CA 3CI8A 1OMPA 2ZYNA 3U8QA 4G4PA 5I57A 4X48A 1UIVA 1FTOA 3CHGA 3TZAA 4IO3A 4RA1A 1UTBB 1FBFA 2IEEA 4YAHX 3ROJA 3TKDA 2Z8EA 3UA8A 3RGYA 2PYYA 1H76A 5TP9A 3K4UA 1B2HA 2O1MA 1IMFA 3O9PA 1B3GA 5ET6A 4PF6A 1M5BA 4XEQA 2ZYOA 2HAUA 1N76A 3H03A 3D4GA 4PFTA 1B46A 3E9XA 5ET5A 2Q74A 3OO8A 4P11A 1NI9A 3KBRA 2WYKA 4H45A 4HW8A 3T93B 4JSOA 3IB1A 1JW4A 2GFEA 2DXYA 5IKBA 4PCDA 1QKBA 3KJ7A 3IO4A 1XVYA 1Y9UA 2GH9A 1IUDA 2QSXA 1I6AA 3K6UA 3R26A 3IOTA 4H8JA 1YXIA 4F3BA 1S50A 1QKAA 1RKMA 1NUXA 5LOMA 1D9VA 4NF8A 4KR5A 4I3EA 2QMXA 2XX7A 4YKPA 3K2DA 4IO7A 4X04A 4ZE9A 3TYHA 2FIEA 3S9NC 5A5XB 4OMBA 1RYOA 3DP6A 1XVXA 1TWYA 5AE4A 3PMWA 4KI0E 4F22A 4LQ2A 5TP9B 4KXPA 3PUYE 4XKPA 1D3KA 4NF4A 3VVDA 4ONYA 1TT1A 2WKYA 2Z8DA 2W7YA 4OESA 3M3KA 5KDTA 4U22A 4AS4A 1I6BA 1R1NA 4PFIA 4I8CA 4WKMA 3VV5A 3OEMA 4MJOA 2UXAA 4ESXA 1POY1 4EQBA 1N7WA 5F1QA 3S9MC 2D21A 2FA7A 3QUJA 4NQ8A 2Q88A 3IOWA 3VLVA 1PBPA 1N0TA 3VXBA 1FPLA 4MNIA 5I58B 3O6IA 4OENA 4KPTA 1FQDA 1II5A 3Q26A 2ESNA 2HHMA 3KJTA 5I59A 3LV0A 2OLBA 5B70A 5AA4B 1KA1A 4NF5A 5B7DA 1LCFA 4U1OA 4JVCA 4HTGA 3RPLA 4PBQA 3KBZA 1MXXA 4OZ9A 3IORA 2F7AA 2NVUB 1PBQA 3IB0A 4LP2B 4DXBA 4F3GA 4Z0IA 1S9TA 4ND9A 4IGTA 3RPWA 1LEVA 3V8XB 3RQTA 4JDFA 5I2NB 2QRYA 4ISUA 5IZ3B 1B4ZA 1JETA 2XXHA 3PUWE 1EU8A 1P1NA 4MLQA 3RT6B 3CFZA 2DP8A 1H3DA 3CSBA 4QHQA 4OETA 3C34A 1R6ZA 3MVXA 4OVQA 1XT8A 3IR1A 5CBRA 2XWIA 2V3TA 1R9QA 3B6TA 3CSGA 4POXA 3ZKKA 3CG3A 4FE8A 3N5LA 4LZ5A 2Z22A 4N6DA 5ET7A 3SEUA 5I59B 1FQEA 4DE8A 4GL8A 3VLUA 2D5WA 5A5LA 5I56B 4PFYA 1UTHA 4U21A 4ZEBA 1AOVA 3VDFA 1Y20A 3FXRA 4N91A 1B7ZA 1B05A 1QW0A 4MLVA 1B3HA 5IGAA 3FVKA 2DE4A 3KC1A 1NNTA 4HE2A 3CRBA 3W9WA 1DTZA 3KN3A 1LGBC 2ABHA 4H5GA 3K6XA 3USDA 3FIRA 1POTA 3TQLA 2XXWA 4DI4B 1OVBA 4MMPA 4N13A 3FBPA 4YKKA 4H46A 2A5TB 3FJ7A 1SYIA 3C4MA 4R72A 3O28A 4U2RA 1B52A 4PE3A 1H43A 2FVZA 3WAFA 1SQYA 3EF7A 2B65A 4R2BA 1O7TA 4ESWA 3V5AA 1LBCA 2YJPA 4PGNA 5J16A 2F6GA 1IXCA 4FJPA 1A55A 5T3JA 4ZECA 3HPIA 4EF2A 3PU5A 2KLFA 4O3BA 5I2KA 1M5DA 2XD2A 1R9LA 3T1BA 1ZIUA 4DXCA 2XXKA 4F2OA 2GHBA 2UVHA 2QFLA 2ZXTA 4EF1A 1Y3NA 4GXSB 4H67A 1G0HA 3EHTA 1O63A 1N04A 4N81A 2X7QA 2Z23A 3EN3A 4GBVA 2CZKA 1NNKA 1BTJA 1B3EA 2XXPA 4WEPA 3N94A 4QSDA 3ZS6A 1A54A 1AH5A 1BK4A 3PD8A 3BIHA 3FUZA 5BWJA 5FHOA 1LAFE 2CEXA 1A8FA 3TMGA 1H45A 4R9GA 1MPBA 2QVVA 1OIBA 2B4MA 3HFUA 2DOJA 2Q2CA 4DLDA 1NNFA 2RKMA 3IAZA 5H8NA 4G68A 3KOTA 2ONSA 4RK9A 1DK4A 4NGUA 1B9JA 4YB6A 2D3IA 3R6UA 2PBWA 2REJA 3IFAA 3M3LA 4P9KA 1QULA 3MYUA 2ZNTA 1B51A 1SD3A 2F3BA 3I3VA 1QUJA 2Y84A 3LR1A 4KCDA 2H25A 5ITPA 3OMBA 4YB5A 4FBPA 4NG7A 2OJTA 3Q28A 1MXYA 1FBPA 1D4NA 1FRPA 4OVTA 5I3SA 4M1VA 5I84A 1FQCA 3PMVA 3Q29A 4O7MA 3UIFA 5CBSA 1MPCA 5L9OA 2V3QA 3SDFA 2I6EA 2KQZA 3MQ9A 3MWBA 2PMSA 3C36A 4MNCA 4Q0CA 5KZTA 2UVGA 5IM2A 4NMYA 2OWSA 3C35A 3EKIA 3C31A 4EXLA 4H65A 1SBPA 3SETA 2PT2A 1IMBA 3E3KA 5H8FA 4XKRA 2XXVA 3MZ1A 5JTYB 2Q8JA 1NUZA 1YCJA 3VFJA 5HBCA 5CC2A 3FV2A 3F11A 4OHNA 4G68C 2P1SA 1UTBA 3G7WA 1CB6A 4PF8A 4GOTA 3HV1A 3FV1A 3HSTA 1QUKA 3H7MA 2ZNSA 1SW1A 4IR8A 4HCYA 3PUXE 2OZZA 1J1NA 1NV1A 2GHAA 1LSTA 1F9BA 1Q9DA 2QJEA 4YMAA 4KD5A 1ZLQA 3UGWA 1EYIA 3QUFA 2CZLA 3T9HB 4NWCA 3FVGA 1VFEA 1B5HA 4ZS9A 1B32A 1RYXA 4MIJA 4LQ5A 1TFAA 2VPOA 1IXIA 1LBVA 4N07A 1N3XA 4QXDA 1XOCA 4JWXA 4MAGA 3OO7A 4NHBA 2VGQA 1PEBA 1LB9A 1B40A 1FQFA 2I3VA 5A5XA 1NUYA 4NTLA 1JP4A 3DLNA 4F3PA 4C1TA 4UACA 2DVCA 5ELVA 4R74A 3OENA 2IA4A 4GBWA 2ZZVA 4DI3D 4G77A 1RDYA 3W15C 1NH7A 4LVQA 1DPEA 3T9XB 3FATA 4DZ1A 5DVJA 2G93A 4LZ8A 2DWAA 1M5FA 4NN3A 2NOOA 4DCXA 5EQ7A 1VFDA 3LSXA 3FJMA 5I58A 3VVFA 1GV8A 3IOVA 3U94A 2THIA 4OVPA 4F18A 2XXXA 4JSDA 4XF5A 3OXNA 2H5YA 2XXIA 3L6GA 5AA4A 2XWKA 1P1WA 4Q30B 4P0GA 3FVNA 1YPNA 5K2XA 2DDKA 4NEDA 5KCJB 4MEVA 1YTVA 1N3WA 3B8BA 2PVUA 3VVEA 4QF9A 3RNNA 1QUIA 4OEVA 2HQ0A 5HPQA 1FTKA 5DT6A 5TPAB 2RC8A 1IEJA 2ANJA 5I2NA 1MH3A 4DXUA 5IZ3A 1FBDA 1NV7A 1LB8A 5ITOA 5ESYA 4Q5TA 4AQ4A 4BDMA 4YB7A 1KZ8A 1VR5A 5K2YA 4ZE8A 4PETA 3MP6A 5H8HB 5F24A 1FQBA 2I4CA 1A99A 4N15A 4LONB 5EHSA 1MXVA 3PUZE 1L5TA 2I0BA 3U65A 1GVCA 3QK6A 1JW5A 2ZZXA 1US4A 2PT1A 2YLNA 2VHAA 3TUSA 1NV0A 3A3UA 1B6HA 3B6QA 4I9DA 5IZ1A 5I56A 1RDZA 2YPNA 2O7UA 4UABA 4PAIA 4NF0A 5F7VA 4PFWA 5DEXB 3TELA 2I58A 3H06B 3H3GA 4BDRA 1MY3A 1Z7ME 2HXWA 1H44A 5EQAA 4ELPA 3B6WA 2R9JA 3BFUA 3GYYA 4G61A 4OQOA 1SW5A 4ZEFA 2QS2A 4LN5A 3N6TA 1MS7A 4RPNA 3IJOB 3JZJA 3HO7A 2Y5KA 3NOHA 1ZKBA 4OA4A 1JEUA 3K01A 3FZVA 5FBPA 4OVJA 2Y7RA 3O2AA 4TOZA 3PPNA 4X9TA 2F97A 4EXKA 3E13X 5L9SA 4QFOA 1IQ7A 1LBZA 1WDNA 4IGRA 2XXTA 4I3YA 1FBEA 1FTAA 4TLLB 3ZSFA 1SVXB 3ILTB 1FPJA 3THIA 4JVDA 2A5TA 1FJ9A 3TTLA 4NF6B 1SPIA 4POWA 4LZ7A 3IK6B 4QRZA 1US5A 2F7CA 4ELOA 4IB2A 1SI0A 3RY3A 5AA3A 2XHDA 3ILUB 2Y7IA 3U93A 2R8TA 4THIA 2NXOA 2Y7PA 1CE2A 1D9YA 1FPEA 1EZOA 4P56A 3QSLA 4I1DA 2CMOA 3U92A 3BKIB 4H5FA 1MM7A 2VD3A 2REGA 5EQ9A 3VXCA 3H6VA 1MY2A 3G3HA 1MG1A 1UIUA 5DVIA 1FW0A 1P1QA 2HCAA 3IO6A 5FTIA 3T66A 1MQHA 2Q9TA 4GD5A 2H9BA 3IOUA 4FECA 4FORA 3BBRA 4HXVA 4QFLA 4F3SA 3K1PA 5HM4B 3MPKA 4RPOA 3E78A 1IMEA 1PDAA 3JYRA 2CZHA 5CM6A 1BKAA 2WBBA 3TCHA 4RNSA 1B1HA 4NE4A 4HE0A 3CG1A 3LSFB 2QL3A 3T22A 2PX1A 1FPDA 3MZ9A 2HXRA 1JQFA 1URGA 2DYXA 2VOZA 3CVGA 4XTCQ 1FTJA 1SDXA 4FAJA 4MHFA 4GQOA 4I62A 2L5VA 4ZDMA 2F3DA 3G3IA 3TCGA 2AL4A 4ELQA 4NWDA 1NV5A 1SI1A 4LATA 4Q8RA 4U23A 1JVXA 1B4HA 4GWZA 3CR9A 2CZIA 4FEBA 4XKNA 2Q8MA 1NKXA 3V89B 4UA8A 3PTYA 3OD7A 2E0SA 4R2FA 3A29A 3GBAA 5LTCA 3G3GA 5CMKA 3ECRA 4F1UA 3FASA 3OELA 1MQIA 4N6KA 2A5SA 3RTFB 3E79A 2ONKE 1PC3A 3N26A 5CMBA 3D4CA 1JVYA 3VE1B 5ICTA 3Q27A 4N8YA 5JTYA 1ZMGA 2VP1A 3TCFA 1AMFA 1BP5A 4JXIA 5AA2D 3LUZA 4MFIA 1CNQA 3SESA 3TTNA 3SEWA 5EHMA 4GWYA 2P0SA 4O3CA 4DCYA 4P1LA 4PQJA 3T9VA 3MW0A 4E0WA 4ZZEA 3PUVE 3K6WA 4H6DA 2FBPA 1GGGA 2ALUA 4PBHA 2B3BA 4F2QA 1B0HA 4H8IA 1FTLA 3BFTA 1LFGA 3K0VA 2FYIA 1IMDA 3KN7A 3MZBA 3D1RA 1GR2A 1LAXA 4KYDA 3C9HA 4JVIA 3MAMA 2RC7A 1NL5A 1IITA 1SW2A 1FPBA 2OWTA 3TFLA 3QXMA 4QBAA 4KYEA 2DS9A 1OLAA 2HPGA 1Y1ZA 3ODBA 3LBSA 3SKPA 2AYSA 5CI5A 5H8QB 3K00A 3KN8A 4HS7A 3RUMA 3UK4A 3HHGA 1DSNA 1EH3A 2HFBA 1VE4A 1VSOA 3S4UA 5CMCA 3RYDA 3IJXB 3MBPA 3JV9A 3KSJA 4M4GA 3SERA 2Y7KA 4G8MA 5I5PA 2F35A 4JBZA 2VT5A 1AWBA 4PAFA 4H1XA 3VLWA 2I3WA 5EYHA 1IXGA 4K3FA 4BDOA 5J1DA 3SEVA 1GTKA 3SEYA 4R6KA 3H6WA 2FIXA 1B7HA 2E1SA 2OX3A 1WVJA 3OO9A 2QS3A 5FHNA 2DSFA 3OO6A 3H6TA 5DVFA 1S7YA 3GBBA 4MF3A 4AB6A 3SEXA 3I5OA 1I6QA 2V3UA 4QSEA 1BLFA 3FXBA 5DTBA 3KSXA 4R9FA 4PC9A 2HEUA 1B3LA 2RCBA 3TEPA 4ZEDA 3HHFA 2DE3A 1FPFA 4PDHA 1N84A 3C32A 1OVTA 1FSAA 3MVWA 3PD9A 4R73A 2X7PA 1LAHE 2XX9A 3TDJA 5JEIA 3B7DA 4QFKA 1Q35A 4G8NA 3EQ1A 4OFJA 1D9QA 4EQ7A 2GRVA 3DELB 3ONMA 4YKJA 3KZGA 3GXAA 3O29A 5KCJA 5AA2B 2XWVA 3TTMA 2QS4A 3FXQA 4OEUA 4GWUA 1QVSA 4YICA 1LBWA 3T9UA 1XS5A 1M5EA 5TPAA 3MP1A 4X1DA 2RF1A 4MNPA 3FGSA 1MDQA 4QSCA 2XXQA 4BDNA 4RK2A 5DYHA 3G3FA 3KC0A 4GWWA 4MX6A 2UVJA 1LFHA 1SW4A 4IY5A 2XWOA 4U4XA 1MY4A 1FQAA 2XXRA 1MDP1 2Q89A 5H8HA 4GWOA 1XHYA 4F29A 3IB2A 3K1NA 3WAEA 2Y5LA 1K9YA 4RJZA 1MQDA 4YU0A 3V83A 2O84X 4HCWA 2MKZA 3RN8A 2F6PA 4BDLA 4GX4A 5FHMA 4PDDA 4MCOA 2QPQA 3B50A 3LSWA 1O64A 1NFTA 1Y4TA 3T96B 2V93A 4RYAA 5AA1A 2P2AA 5DEXA 3RT8A 4OWDA 4F39A 1EYJA 4FIMA 2QVUA 4YZZA 2FHYA 4OERA 3OSQA 3P7IA 1A40A 4O3AA 2WX9A 4PFUA 4F1YA 3BIGA 1ZU0A 3DM0A 2OWZA 4I40A 5I57B 3KOSA 2DXRA 1MXUA 5I7IA 3I6VA 4GWSA 1T0KA 3A3CA 3G3KA 4O8MA 3OOAA 3AXFA 1FJ6A 2OCUA 3QAXA 3PPQA 1DCUA 1LBXA 1MRPA 1FPKA 1MY1A 3IL1B 1IXHA 1IIWA 1EZ9A 1FBGA 1JW1A 1N7XA 2B3FA 1B7UA 2I4BA 4NF6A 3KGCA 3OSRA 2BJIA 2CEYA 2F78A 3FVOA 3TODA 1AL3A 2XD3A 4X8RA 3EHSA 1B5IA 4XXUA 3S9EA 4OFOA 2NWJA 4GX6A 1NV6A 3PV0E 4JWOA 2PFYA 3MVZA 1Y1MA 1FBCA 2O51A 3TQWA 3N6UA 1PB7A 2XX8A 4BDQA 1URDA 1YZ0A 1QGXA 3IX1A 4N17A 2OBGA 2GQ1A 1MM6A 4FEDA 4NF8B 4PAKA 1INPA 1RDXA 2WBDA 1NNPA 2V4CA 1HSJA 4X1BA 3EHUA 5FTHA 1A7LA 4PTKA 3OEKA 3L6HA 4JB7A 3H4ZA 4FATA 3K02A 3TTKA 4O94A 4NF4B 2UYFA 3LSLA 2HZKA 2X26A 1LCTA 3FXUA 2DWJA 2I49A 4IY6A 3G3JA 1USYE 5KDTB 1ZTYA 3T0JA 4R75A 2V25A 4GXAA 1QJMA 1I69A 4PFBA 4IO2A 4HE1A 2O7IA 3GZGA 1LBYA 4QFPA 4U1ZA 5DW8A 3MC2A 2QMWA 1Z7NE 4EQ9A 2XXYA 3S9LC 4NAPA 2H4IA 1TXFA 4Z7EA 4IO6A 5EYGA 4YMBA 3ISPA 3PGFA 4OVRA 1K9ZA 3O66A 2ZYKA 4O7IA 2HAVA 3E4RA 4GVOA 1Y3QA 4NF5B 4GL0A 3KG2A 3LUYA 3QMFA 3RPLB 1LAGE 2DWHA 3TPAA 4H0WA 3PMXA 1DBZA 1NV2A 4E0XA 1LFIA 4MBPA 1AIVA 3MVYA 3PPOA 5L9MA 2RC9A 3O6GA 2XXUA 4GX3A 1Y3PA 1XC1A 1LLSA 1B58A 4AS5A 2QVRA 2VD2A 1EYKA 1FPGA 4G8HA 4OVSA 4OXVA 1Y4CA 1URSA 4EDPA 1FBHA 1IZ1A 1NH8A 4C1UA 3LC8A 1UQWA 2UYEA 5LDZA 2Y7WA 4PE5B 1MPDA 3DP8A 2ZNUA 4F31B 1FTMA 4EUOA 2PCRA 1TFDA 1XI6A 3M8UA 2F36A 1LBBA 1B5JA 4LA9A 4N8GA 1B3FA 5CRYA 5IZZA 4GIZA 1KA0A 4DDDA 2O6AA 2F7BA 3K6VA 3FJGA 1B1XA 4R6YA 2I48A 3RLFE 1P1UA 2DWIA 2F8DA 4C0RA 1IMCA 2DVZA 2G29A 1JNFA 3IFCA 1HSEA 4NX1A 1UTHB 4N4UA 3RTWB 3UORA 1SYHA 1ANFA 3MP8A 3TAJA 5BUUA 3UN6A 2WYPA 4L17A 4IO4A 2KR0A 2O68A 3MJNA 4GFRA 2UVIA 4QFNA 2QS1A 2Q2AA 3DP4A 3CFLA 4BLAA 5ICQA 1NV4A 1A8EA 2B4LA 4ECFA 2NUVA 4KFQA 5H8QA 4OYVA 3QYTA 3S2VA 4WXJA 2ZZWA 4PP0A 1B0LA 2PFZA 1P1OA 3SZPA 5L8DA 3UP9A 4KCCA 2R71A 5H8SA 2BJJX 3KEIA 3O97A 4XKQA 3HCQA 3PPPA 4F19A 4XIGQ 1WODA 1EZPA 3K1MA 1NV3A 5M2VA 1ATGA 1ELJA 3Q25A 4YKIA 4LUBA 2JJKA 4GLIA 1HSLA 3R7XA 4KQPA 1FPIA 4ZZAA 3KFMA 4PFRA 2LAOA 4ELRA 2FNCA 2H99A 4GWXA 3CIJA 1MY0A 4XFEA 3C33A 1VDWA 2ONRA 4TLMB 4WEDA 5I2KB 4GF8A 4OTEA 4P1EA 4F1VA 1DOTA 1KWHA 4P8BA 4MH5A 1P99A 1YAEA 4DIGA 3MPLA 1DMBA 3HN0A 2F34A 1OQHA 1ZBMA 4N6PA 3ZKLA 1OLCA 2P3VA 3MUQA 1USYH 2VPNA 3MSTA 3QIMA 3GLBA 3O6HA 3W9VA 3M3FA 3CFXA 4IO5A 2WEFA 4JWYA 1PB8A 5EYFA 5ET8A 5AA2A 1MQGA 4U4SA 1BIYA 1NMUA 1IMAA 2OK2A 5JK4A 1MXZA 2F5XA 4OFLA 1G0IA 1MXWA 1M5CA 2XA5A 3PPRA 2H98A 2RINA 4KYSA
chains in the Genus database with same CATH topology
2HZLA 5H8NB 2Z8FA 2DQVA 4G68B 1PB9A 1MQJA 4ZEKA 1JEVA 3FD3A 4GRKA 1OQGA 3U1OA 2AIXA 1ZJLA 2O1LA 3H6UA 2O69A 2ZYMA 2RCAA 4KHZE 4TQUQ 2ZMBA 4G2ZA 4P0IA 5CMMA 5TU0A 5ISUA 4AB5A 1DTGA 3EPEA 2I0CA 1FCKA 1MH4A 4RXLA 2R6GE 1DPPA 3U72A 3TTRA 1Q1KA 2AL5A 4ZEIA 2V84A 2DE2A 4RY1A 3A09A 5IAIA 5H8FB 4R6HA 2M8CA 3CI8A 1OMPA 2ZYNA 3U8QA 4G4PA 5I57A 4X48A 1UIVA 1FTOA 3TZAA 4IO3A 4RA1A 1UTBB 2IEEA 4YAHX 3TKDA 2Z8EA 3UA8A 3RGYA 2PYYA 1H76A 5TP9A 3K4UA 1B2HA 2O1MA 3O9PA 1B3GA 1M5BA 2ZYOA 2HAUA 1N76A 3H03A 3D4GA 4PFTA 1B46A 3E9XA 3OO8A 4P11A 3KBRA 4HW8A 3T93B 4JSOA 3IB1A 1JW4A 2GFEA 2DXYA 5IKBA 1QKBA 3KJ7A 3IO4A 1XVYA 1Y9UA 2GH9A 1IUDA 2QSXA 1I6AA 3K6UA 3R26A 3IOTA 4H8JA 4F3BA 1S50A 1QKAA 1RKMA 5LOMA 1D9VA 4NF8A 4KR5A 2QMXA 2XX7A 4YKPA 3K2DA 4IO7A 4ZE9A 3TYHA 3S9NC 5A5XB 4OMBA 1RYOA 3DP6A 1XVXA 1TWYA 5AE4A 3PMWA 4KI0E 4F22A 4LQ2A 5TP9B 3PUYE 4XKPA 1D3KA 4NF4A 3VVDA 4ONYA 1TT1A 2WKYA 2Z8DA 2W7YA 4OESA 3M3KA 5KDTA 4U22A 1I6BA 1R1NA 4I8CA 4WKMA 3VV5A 3OEMA 2UXAA 4ESXA 1POY1 4EQBA 1N7WA 5F1QA 3S9MC 2D21A 2FA7A 3QUJA 2Q88A 3IOWA 3VLVA 1PBPA 1N0TA 3VXBA 5I58B 3O6IA 4OENA 4KPTA 1FQDA 1II5A 3Q26A 2ESNA 3KJTA 5I59A 2OLBA 5B70A 5AA4B 4NF5A 5B7DA 1LCFA 4U1OA 4HTGA 1MXXA 4OZ9A 3IORA 2F7AA 2NVUB 1PBQA 3IB0A 4LP2B 4DXBA 4F3GA 4Z0IA 1S9TA 4ND9A 4IGTA 3RPWA 3V8XB 3RQTA 4JDFA 5I2NB 2QRYA 4ISUA 1B4ZA 1JETA 2XXHA 3PUWE 1EU8A 1P1NA 4MLQA 3RT6B 3CFZA 2DP8A 1H3DA 3CSBA 4QHQA 4OETA 3C34A 1R6ZA 3MVXA 1XT8A 3IR1A 5CBRA 2V3TA 1R9QA 3B6TA 3CSGA 4POXA 3ZKKA 3CG3A 4FE8A 3N5LA 4LZ5A 2Z22A 3SEUA 5I59B 1FQEA 4DE8A 4GL8A 3VLUA 2D5WA 5I56B 4PFYA 1UTHA 4U21A 4ZEBA 1AOVA 3VDFA 1Y20A 3FXRA 1B7ZA 1B05A 1QW0A 4MLVA 1B3HA 3FVKA 2DE4A 1NNTA 3CRBA 3W9WA 1DTZA 3KN3A 1LGBC 2ABHA 4H5GA 3K6XA 3USDA 3FIRA 1POTA 3TQLA 2XXWA 1OVBA 4N13A 4YKKA 2A5TB 3FJ7A 1SYIA 3C4MA 4R72A 3O28A 4U2RA 1B52A 1H43A 3WAFA 1SQYA 3EF7A 2B65A 4R2BA 1O7TA 4ESWA 3V5AA 1LBCA 2YJPA 2F6GA 1IXCA 4FJPA 1A55A 4ZECA 3HPIA 4EF2A 3PU5A 2KLFA 4O3BA 5I2KA 1M5DA 2XD2A 1R9LA 1ZIUA 4DXCA 4F2OA 2GHBA 2UVHA 2ZXTA 4EF1A 1Y3NA 4GXSB 4H67A 3EHTA 1O63A 1N04A 2X7QA 2Z23A 3EN3A 1NNKA 1BTJA 1B3EA 2XXPA 4WEPA 3N94A 4QSDA 3ZS6A 1A54A 1AH5A 3PD8A 3FUZA 5BWJA 5FHOA 1LAFE 1A8FA 3TMGA 1H45A 4R9GA 1MPBA 1OIBA 2DOJA 2Q2CA 4DLDA 1NNFA 2RKMA 3IAZA 5H8NA 4G68A 3KOTA 2ONSA 4RK9A 1B9JA 4YB6A 2D3IA 3R6UA 2PBWA 2REJA 3M3LA 1QULA 2ZNTA 1B51A 1SD3A 3I3VA 1QUJA 2Y84A 3LR1A 4KCDA 2H25A 5ITPA 3OMBA 4YB5A 2OJTA 3Q28A 1MXYA 1D4NA 4M1VA 5I84A 1FQCA 3PMVA 3Q29A 3UIFA 5CBSA 1MPCA 5L9OA 2V3QA 3SDFA 2I6EA 3MWBA 3MQ9A 2PMSA 3C36A 4Q0CA 5KZTA 2UVGA 4NMYA 2OWSA 3C35A 3C31A 4EXLA 4H65A 1SBPA 3SETA 2PT2A 3E3KA 5H8FA 4XKRA 2XXVA 3MZ1A 5JTYB 2Q8JA 1YCJA 3VFJA 5HBCA 5CC2A 3FV2A 3F11A 4OHNA 4G68C 2P1SA 1UTBA 3G7WA 1CB6A 4GOTA 3HV1A 3FV1A 3HSTA 1QUKA 3H7MA 2ZNSA 1SW1A 4HCYA 3PUXE 2OZZA 1J1NA 2GHAA 1LSTA 1F9BA 2QJEA 4YMAA 4KD5A 1ZLQA 3UGWA 3QUFA 2CZLA 3T9HB 4NWCA 3FVGA 1VFEA 1B5HA 4ZS9A 1B32A 1RYXA 4LQ5A 1TFAA 1IXIA 4N07A 1N3XA 1XOCA 4JWXA 3OO7A 2VGQA 1PEBA 1LB9A 1B40A 1FQFA 2I3VA 5A5XA 4NTLA 3DLNA 4F3PA 4C1TA 4UACA 2DVCA 5ELVA 4R74A 3OENA 2IA4A 4G77A 3W15C 1NH7A 4LVQA 1DPEA 3T9XB 3FATA 4DZ1A 5DVJA 2G93A 4LZ8A 2DWAA 1M5FA 2NOOA 4DCXA 1VFDA 3LSXA 3FJMA 5I58A 3VVFA 1GV8A 3IOVA 3U94A 2THIA 4F18A 2XXXA 4JSDA 3OXNA 2H5YA 2XXIA 3L6GA 5AA4A 1P1WA 4Q30B 4P0GA 3FVNA 1YPNA 5K2XA 4NEDA 5KCJB 1YTVA 1N3WA 2PVUA 3VVEA 4QF9A 3RNNA 1QUIA 4OEVA 2HQ0A 5HPQA 1FTKA 5DT6A 5TPAB 2RC8A 1IEJA 2ANJA 5I2NA 1MH3A 4DXUA 1LB8A 5ITOA 4Q5TA 4AQ4A 4BDMA 4YB7A 1VR5A 5K2YA 4ZE8A 4PETA 3MP6A 5H8HB 1FQBA 2I4CA 1A99A 4LONB 5EHSA 1MXVA 3PUZE 1L5TA 2I0BA 1GVCA 3QK6A 1JW5A 1US4A 2PT1A 2YLNA 2VHAA 3TUSA 3A3UA 1B6HA 3B6QA 4I9DA 5I56A 2YPNA 2O7UA 5F7VA 4PFWA 5DEXB 3TELA 2I58A 3H06B 3H3GA 4BDRA 1MY3A 1Z7ME 2HXWA 1H44A 4ELPA 3B6WA 2R9JA 3BFUA 4OQOA 1SW5A 4ZEFA 2QS2A 3N6TA 1MS7A 4RPNA 3IJOB 3JZJA 3HO7A 1ZKBA 1JEUA 3K01A 3FZVA 4OVJA 2Y7RA 3O2AA 4TOZA 3PPNA 4X9TA 2F97A 4EXKA 3E13X 5L9SA 4QFOA 1IQ7A 1WDNA 4IGRA 2XXTA 4TLLB 3ZSFA 1SVXB 3ILTB 3THIA 2A5TA 3TTLA 4NF6B 4POWA 4LZ7A 3IK6B 4QRZA 1US5A 2F7CA 4ELOA 4IB2A 1SI0A 3RY3A 5AA3A 2XHDA 3ILUB 2Y7IA 3U93A 4THIA 2NXOA 2Y7PA 1CE2A 1D9YA 1EZOA 3QSLA 4I1DA 2CMOA 3U92A 3BKIB 4H5FA 1MM7A 2VD3A 2REGA 3VXCA 3H6VA 1MY2A 3G3HA 1MG1A 1UIUA 5DVIA 1FW0A 1P1QA 2HCAA 3IO6A 5FTIA 3T66A 1MQHA 2Q9TA 4GD5A 2H9BA 3IOUA 4FECA 4FORA 3BBRA 4QFLA 4F3SA 3K1PA 5HM4B 3MPKA 4RPOA 1PDAA 3JYRA 5CM6A 1BKAA 3TCHA 4RNSA 1B1HA 4NE4A 3CG1A 3LSFB 2QL3A 3T22A 2PX1A 3MZ9A 1JQFA 1URGA 2DYXA 2VOZA 3CVGA 4XTCQ 1FTJA 1SDXA 4FAJA 4GQOA 4I62A 4ZDMA 3G3IA 3TCGA 2AL4A 4ELQA 4NWDA 1SI1A 4LATA 4Q8RA 4U23A 1JVXA 1B4HA 3CR9A 4FEBA 4XKNA 1NKXA 3V89B 4UA8A 3OD7A 2E0SA 4R2FA 3GBAA 3G3GA 5CMKA 3ECRA 4F1UA 3FASA 3OELA 1MQIA 3RTFB 2A5SA 2ONKE 1PC3A 3N26A 5CMBA 3D4CA 1JVYA 3VE1B 5ICTA 3Q27A 5JTYA 1ZMGA 2VP1A 3TCFA 1AMFA 1BP5A 4JXIA 5AA2D 4MFIA 3SESA 3TTNA 3SEWA 5EHMA 2P0SA 4O3CA 4DCYA 4PQJA 3T9VA 3MW0A 4E0WA 4ZZEA 3PUVE 3K6WA 4H6DA 1GGGA 2ALUA 2B3BA 4F2QA 1B0HA 4H8IA 1FTLA 3BFTA 1LFGA 3K0VA 2FYIA 3KN7A 3MZBA 1GR2A 1LAXA 4KYDA 3C9HA 3MAMA 2RC7A 1NL5A 1IITA 1SW2A 2OWTA 3TFLA 3QXMA 4KYEA 2DS9A 1OLAA 1Y1ZA 3ODBA 3LBSA 3SKPA 2AYSA 5CI5A 5H8QB 3K00A 3KN8A 4HS7A 3RUMA 3UK4A 3HHGA 1DSNA 1EH3A 2HFBA 1VE4A 1VSOA 3S4UA 5CMCA 3IJXB 3MBPA 3JV9A 3KSJA 4M4GA 3SERA 2Y7KA 4G8MA 2F35A 4JBZA 4H1XA 3VLWA 2I3WA 1IXGA 4K3FA 4BDOA 5J1DA 3SEVA 1GTKA 3SEYA 4R6KA 3H6WA 1B7HA 2E1SA 1WVJA 3OO9A 2QS3A 5FHNA 2DSFA 3OO6A 3H6TA 5DVFA 1S7YA 3GBBA 4MF3A 4AB6A 3SEXA 3I5OA 1I6QA 2V3UA 4QSEA 1BLFA 5DTBA 3KSXA 4R9FA 2HEUA 1B3LA 2RCBA 3TEPA 4ZEDA 3HHFA 2DE3A 1N84A 3C32A 1OVTA 3MVWA 3PD9A 4R73A 2X7PA 1LAHE 2XX9A 3TDJA 5JEIA 3B7DA 4QFKA 1Q35A 4G8NA 3EQ1A 4OFJA 4EQ7A 2GRVA 3DELB 3ONMA 4YKJA 3KZGA 3GXAA 3O29A 5KCJA 5AA2B 3TTMA 2QS4A 3FXQA 4OEUA 1QVSA 4YICA 3T9UA 1XS5A 1M5EA 5TPAA 3MP1A 4X1DA 2RF1A 3FGSA 1MDQA 4QSCA 2XXQA 4BDNA 4RK2A 5DYHA 3G3FA 2UVJA 1LFHA 1SW4A 4IY5A 4U4XA 1MY4A 1FQAA 2XXRA 1MDP1 2Q89A 5H8HA 4GWOA 1XHYA 4F29A 3IB2A 3K1NA 3WAEA 4RJZA 1MQDA 4YU0A 3V83A 2O84X 4HCWA 3RN8A 2F6PA 4BDLA 5FHMA 2QPQA 3LSWA 1O64A 1NFTA 1Y4TA 3T96B 2V93A 4RYAA 5AA1A 2P2AA 5DEXA 3RT8A 4OWDA 4F39A 4FIMA 4YZZA 4OERA 3OSQA 3P7IA 1A40A 4O3AA 4PFUA 4F1YA 1ZU0A 3DM0A 5I57B 3KOSA 2DXRA 1MXUA 3I6VA 1T0KA 3A3CA 3G3KA 3OOAA 3AXFA 2OCUA 3QAXA 3PPQA 1MRPA 1MY1A 3IL1B 1IXHA 1IIWA 1EZ9A 1JW1A 1N7XA 2B3FA 1B7UA 2I4BA 4NF6A 3KGCA 3OSRA 2F78A 3FVOA 3TODA 1AL3A 2XD3A 3EHSA 1B5IA 4XXUA 3S9EA 4OFOA 2NWJA 3PV0E 4JWOA 3MVZA 1Y1MA 2O51A 3TQWA 3N6UA 1PB7A 2XX8A 4BDQA 1URDA 3IX1A 2OBGA 1MM6A 4FEDA 4NF8B 1NNPA 1HSJA 4X1BA 3EHUA 5FTHA 1A7LA 3OEKA 3L6HA 4JB7A 3H4ZA 4FATA 3K02A 3TTKA 4NF4B 2UYFA 3LSLA 2HZKA 2X26A 1LCTA 3FXUA 2DWJA 2I49A 4IY6A 3G3JA 1USYE 5KDTB 1ZTYA 4R75A 2V25A 4GXAA 1QJMA 1I69A 4IO2A 2O7IA 3GZGA 4QFPA 4U1ZA 3MC2A 2QMWA 1Z7NE 4EQ9A 2XXYA 3S9LC 2H4IA 1TXFA 4Z7EA 4IO6A 4YMBA 3PGFA 3O66A 2ZYKA 2HAVA 3E4RA 4GVOA 1Y3QA 4NF5B 4GL0A 3KG2A 3LUYA 1LAGE 2DWHA 3TPAA 4H0WA 3PMXA 4E0XA 1LFIA 4MBPA 1AIVA 3MVYA 3PPOA 5L9MA 2RC9A 3O6GA 2XXUA 1Y3PA 1XC1A 1LLSA 1B58A 2VD2A 4G8HA 4OXVA 1Y4CA 1URSA 4EDPA 1IZ1A 1NH8A 4C1UA 3LC8A 1UQWA 2UYEA 2Y7WA 4PE5B 1MPDA 3DP8A 2ZNUA 4F31B 1FTMA 4EUOA 1TFDA 3M8UA 2F36A 1LBBA 1B5JA 4LA9A 1B3FA 5CRYA 4GIZA 4DDDA 2O6AA 2F7BA 3K6VA 3FJGA 1B1XA 4R6YA 2I48A 3RLFE 1P1UA 2DWIA 2F8DA 4C0RA 2DVZA 2G29A 1JNFA 1HSEA 1UTHB 3RTWB 3UORA 1SYHA 1ANFA 3MP8A 3TAJA 5BUUA 3UN6A 4L17A 4IO4A 2O68A 3MJNA 4GFRA 2UVIA 4QFNA 2QS1A 2Q2AA 3DP4A 3CFLA 4BLAA 5ICQA 1A8EA 4ECFA 2NUVA 4KFQA 5H8QA 4OYVA 3QYTA 3S2VA 4WXJA 4PP0A 1B0LA 1P1OA 5L8DA 3UP9A 4KCCA 2R71A 5H8SA 2BJJX 3KEIA 3O97A 4XKQA 3HCQA 3PPPA 4F19A 4XIGQ 1WODA 1EZPA 3K1MA 5M2VA 1ATGA 1ELJA 3Q25A 4YKIA 4LUBA 4GLIA 1HSLA 3R7XA 4KQPA 4ZZAA 3KFMA 2LAOA 4ELRA 2FNCA 2H99A 3CIJA 1MY0A 3C33A 5I2KB 2ONRA 4TLMB 4WEDA 4GF8A 4OTEA 4F1VA 1DOTA 1KWHA 4MH5A 1P99A 1YAEA 4DIGA 3MPLA 1DMBA 3HN0A 2F34A 1OQHA 1ZBMA 4N6PA 3ZKLA 1OLCA 3MUQA 1USYH 3QIMA 3GLBA 3O6HA 3W9VA 3M3FA 3CFXA 4IO5A 4JWYA 1PB8A 5EYFA 5AA2A 1MQGA 4U4SA 1BIYA 1NMUA 2OK2A 5JK4A 1MXZA 2F5XA 4OFLA 1MXWA 1M5CA 3PPRA 2H98A 2RINA 4KYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HZL A;  5H8N B;  2Z8F A;  2DQV A;  4G68 B;  1PB9 A;  1MQJ A;  4ZEK A;  1JEV A;  3FD3 A;  4GRK A;  1OQG A;  3U1O A;  2AIX A;  1ZJL A;  2O1L A;  3H6U A;  2O69 A;  2ZYM A;  2RCA A;  4KHZ E;  4TQU Q;  2ZMB A;  4G2Z A;  4P0I A;  5CMM A;  5TU0 A;  5ISU A;  4AB5 A;  1DTG A;  3EPE A;  2I0C A;  1FCK A;  1MH4 A;  4RXL A;  2R6G E;  1DPP A;  3U72 A;  3TTR A;  1Q1K A;  2AL5 A;  4ZEI A;  2V84 A;  2DE2 A;  4RY1 A;  3A09 A;  5IAI A;  5H8F B;  4R6H A;  2M8C A;  3CI8 A;  1OMP A;  2ZYN A;  3U8Q A;  4G4P A;  5I57 A;  4X48 A;  1UIV A;  1FTO A;  3TZA A;  4IO3 A;  4RA1 A;  1UTB B;  2IEE A;  4YAH X;  3TKD A;  2Z8E A;  3UA8 A;  3RGY A;  2PYY A;  1H76 A;  5TP9 A;  3K4U A;  1B2H A;  2O1M A;  3O9P A;  1B3G A;  1M5B A;  2ZYO A;  2HAU A;  1N76 A;  3H03 A;  3D4G A;  4PFT A;  1B46 A;  3E9X A;  3OO8 A;  4P11 A;  3KBR A;  4HW8 A;  3T93 B;  4JSO A;  3IB1 A;  1JW4 A;  2GFE A;  2DXY A;  5IKB A;  1QKB A;  3KJ7 A;  3IO4 A;  1XVY A;  1Y9U A;  2GH9 A;  1IUD A;  2QSX A;  1I6A A;  3K6U A;  3R26 A;  3IOT A;  4H8J A;  4F3B A;  1S50 A;  1QKA A;  1RKM A;  5LOM A;  1D9V A;  4NF8 A;  4KR5 A;  2QMX A;  2XX7 A;  4YKP A;  3K2D A;  4IO7 A;  4ZE9 A;  3TYH A;  3S9N C;  5A5X B;  4OMB A;  1RYO A;  3DP6 A;  1XVX A;  1TWY A;  5AE4 A;  3PMW A;  4KI0 E;  4F22 A;  4LQ2 A;  5TP9 B;  3PUY E;  4XKP A;  1D3K A;  4NF4 A;  3VVD A;  4ONY A;  1TT1 A;  2WKY A;  2Z8D A;  2W7Y A;  4OES A;  3M3K A;  5KDT A;  4U22 A;  1I6B A;  1R1N A;  4I8C A;  4WKM A;  3VV5 A;  3OEM A;  2UXA A;  4ESX A;  1POY 1;  4EQB A;  1N7W A;  5F1Q A;  3S9M C;  2D21 A;  2FA7 A;  3QUJ A;  2Q88 A;  3IOW A;  3VLV A;  1PBP A;  1N0T A;  3VXB A;  5I58 B;  3O6I A;  4OEN A;  4KPT A;  1FQD A;  1II5 A;  3Q26 A;  2ESN A;  3KJT A;  5I59 A;  2OLB A;  5B70 A;  5AA4 B;  4NF5 A;  5B7D A;  1LCF A;  4U1O A;  4HTG A;  1MXX A;  4OZ9 A;  3IOR A;  2F7A A;  2NVU B;  1PBQ A;  3IB0 A;  4LP2 B;  4DXB A;  4F3G A;  4Z0I A;  1S9T A;  4ND9 A;  4IGT A;  3RPW A;  3V8X B;  3RQT A;  4JDF A;  5I2N B;  2QRY A;  4ISU A;  1B4Z A;  1JET A;  2XXH A;  3PUW E;  1EU8 A;  1P1N A;  4MLQ A;  3RT6 B;  3CFZ A;  2DP8 A;  1H3D A;  3CSB A;  4QHQ A;  4OET A;  3C34 A;  1R6Z A;  3MVX A;  1XT8 A;  3IR1 A;  5CBR A;  2V3T A;  1R9Q A;  3B6T A;  3CSG A;  4POX A;  3ZKK A;  3CG3 A;  4FE8 A;  3N5L A;  4LZ5 A;  2Z22 A;  3SEU A;  5I59 B;  1FQE A;  4DE8 A;  4GL8 A;  3VLU A;  2D5W A;  5I56 B;  4PFY A;  1UTH A;  4U21 A;  4ZEB A;  1AOV A;  3VDF A;  1Y20 A;  3FXR A;  1B7Z A;  1B05 A;  1QW0 A;  4MLV A;  1B3H A;  3FVK A;  2DE4 A;  1NNT A;  3CRB A;  3W9W A;  1DTZ A;  3KN3 A;  1LGB C;  2ABH A;  4H5G A;  3K6X A;  3USD A;  3FIR A;  1POT A;  3TQL A;  2XXW A;  1OVB A;  4N13 A;  4YKK A;  2A5T B;  3FJ7 A;  1SYI A;  3C4M A;  4R72 A;  3O28 A;  4U2R A;  1B52 A;  1H43 A;  3WAF A;  1SQY A;  3EF7 A;  2B65 A;  4R2B A;  1O7T A;  4ESW A;  3V5A A;  1LBC A;  2YJP A;  2F6G A;  1IXC A;  4FJP A;  1A55 A;  4ZEC A;  3HPI A;  4EF2 A;  3PU5 A;  2KLF A;  4O3B A;  5I2K A;  1M5D A;  2XD2 A;  1R9L A;  1ZIU A;  4DXC A;  4F2O A;  2GHB A;  2UVH A;  2ZXT A;  4EF1 A;  1Y3N A;  4GXS B;  4H67 A;  3EHT A;  1O63 A;  1N04 A;  2X7Q A;  2Z23 A;  3EN3 A;  1NNK A;  1BTJ A;  1B3E A;  2XXP A;  4WEP A;  3N94 A;  4QSD A;  3ZS6 A;  1A54 A;  1AH5 A;  3PD8 A;  3FUZ A;  5BWJ A;  5FHO A;  1LAF E;  1A8F A;  3TMG A;  1H45 A;  4R9G A;  1MPB A;  1OIB A;  2DOJ A;  2Q2C A;  4DLD A;  1NNF A;  2RKM A;  3IAZ A;  5H8N A;  4G68 A;  3KOT A;  2ONS A;  4RK9 A;  1B9J A;  4YB6 A;  2D3I A;  3R6U A;  2PBW A;  2REJ A;  3M3L A;  1QUL A;  2ZNT A;  1B51 A;  1SD3 A;  3I3V A;  1QUJ A;  2Y84 A;  3LR1 A;  4KCD A;  2H25 A;  5ITP A;  3OMB A;  4YB5 A;  2OJT A;  3Q28 A;  1MXY A;  1D4N A;  4M1V A;  5I84 A;  1FQC A;  3PMV A;  3Q29 A;  3UIF A;  5CBS A;  1MPC A;  5L9O A;  2V3Q A;  3SDF A;  2I6E A;  3MWB A;  3MQ9 A;  2PMS A;  3C36 A;  4Q0C A;  5KZT A;  2UVG A;  4NMY A;  2OWS A;  3C35 A;  3C31 A;  4EXL A;  4H65 A;  1SBP A;  3SET A;  2PT2 A;  3E3K A;  5H8F A;  4XKR A;  2XXV A;  3MZ1 A;  5JTY B;  2Q8J A;  1YCJ A;  3VFJ A;  5HBC A;  5CC2 A;  3FV2 A;  3F11 A;  4OHN A;  4G68 C;  2P1S A;  1UTB A;  3G7W A;  1CB6 A;  4GOT A;  3HV1 A;  3FV1 A;  3HST A;  1QUK A;  3H7M A;  2ZNS A;  1SW1 A;  4HCY A;  3PUX E;  2OZZ A;  1J1N A;  2GHA A;  1LST A;  1F9B A;  2QJE A;  4YMA A;  4KD5 A;  1ZLQ A;  3UGW A;  3QUF A;  2CZL A;  3T9H B;  4NWC A;  3FVG A;  1VFE A;  1B5H A;  4ZS9 A;  1B32 A;  1RYX A;  4LQ5 A;  1TFA A;  1IXI A;  4N07 A;  1N3X A;  1XOC A;  4JWX A;  3OO7 A;  2VGQ A;  1PEB A;  1LB9 A;  1B40 A;  1FQF A;  2I3V A;  5A5X A;  4NTL A;  3DLN A;  4F3P A;  4C1T A;  4UAC A;  2DVC A;  5ELV A;  4R74 A;  3OEN A;  2IA4 A;  4G77 A;  3W15 C;  1NH7 A;  4LVQ A;  1DPE A;  3T9X B;  3FAT A;  4DZ1 A;  5DVJ A;  2G93 A;  4LZ8 A;  2DWA A;  1M5F A;  2NOO A;  4DCX A;  1VFD A;  3LSX A;  3FJM A;  5I58 A;  3VVF A;  1GV8 A;  3IOV A;  3U94 A;  2THI A;  4F18 A;  2XXX A;  4JSD A;  3OXN A;  2H5Y A;  2XXI A;  3L6G A;  5AA4 A;  1P1W A;  4Q30 B;  4P0G A;  3FVN A;  1YPN A;  5K2X A;  4NED A;  5KCJ B;  1YTV A;  1N3W A;  2PVU A;  3VVE A;  4QF9 A;  3RNN A;  1QUI A;  4OEV A;  2HQ0 A;  5HPQ A;  1FTK A;  5DT6 A;  5TPA B;  2RC8 A;  1IEJ A;  2ANJ A;  5I2N A;  1MH3 A;  4DXU A;  1LB8 A;  5ITO A;  4Q5T A;  4AQ4 A;  4BDM A;  4YB7 A;  1VR5 A;  5K2Y A;  4ZE8 A;  4PET A;  3MP6 A;  5H8H B;  1FQB A;  2I4C A;  1A99 A;  4LON B;  5EHS A;  1MXV A;  3PUZ E;  1L5T A;  2I0B A;  1GVC A;  3QK6 A;  1JW5 A;  1US4 A;  2PT1 A;  2YLN A;  2VHA A;  3TUS A;  3A3U A;  1B6H A;  3B6Q A;  4I9D A;  5I56 A;  2YPN A;  2O7U A;  5F7V A;  4PFW A;  5DEX B;  3TEL A;  2I58 A;  3H06 B;  3H3G A;  4BDR A;  1MY3 A;  1Z7M E;  2HXW A;  1H44 A;  4ELP A;  3B6W A;  2R9J A;  3BFU A;  4OQO A;  1SW5 A;  4ZEF A;  2QS2 A;  3N6T A;  1MS7 A;  4RPN A;  3IJO B;  3JZJ A;  3HO7 A;  1ZKB A;  1JEU A;  3K01 A;  3FZV A;  4OVJ A;  2Y7R A;  3O2A A;  4TOZ A;  3PPN A;  4X9T A;  2F97 A;  4EXK A;  3E13 X;  5L9S A;  4QFO A;  1IQ7 A;  1WDN A;  4IGR A;  2XXT A;  4TLL B;  3ZSF A;  1SVX B;  3ILT B;  3THI A;  2A5T A;  3TTL A;  4NF6 B;  4POW A;  4LZ7 A;  3IK6 B;  4QRZ A;  1US5 A;  2F7C A;  4ELO A;  4IB2 A;  1SI0 A;  3RY3 A;  5AA3 A;  2XHD A;  3ILU B;  2Y7I A;  3U93 A;  4THI A;  2NXO A;  2Y7P A;  1CE2 A;  1D9Y A;  1EZO A;  3QSL A;  4I1D A;  2CMO A;  3U92 A;  3BKI B;  4H5F A;  1MM7 A;  2VD3 A;  2REG A;  3VXC A;  3H6V A;  1MY2 A;  3G3H A;  1MG1 A;  1UIU A;  5DVI A;  1FW0 A;  1P1Q A;  2HCA A;  3IO6 A;  5FTI A;  3T66 A;  1MQH A;  2Q9T A;  4GD5 A;  2H9B A;  3IOU A;  4FEC A;  4FOR A;  3BBR A;  4QFL A;  4F3S A;  3K1P A;  5HM4 B;  3MPK A;  4RPO A;  1PDA A;  3JYR A;  5CM6 A;  1BKA A;  3TCH A;  4RNS A;  1B1H A;  4NE4 A;  3CG1 A;  3LSF B;  2QL3 A;  3T22 A;  2PX1 A;  3MZ9 A;  1JQF A;  1URG A;  2DYX A;  2VOZ A;  3CVG A;  4XTC Q;  1FTJ A;  1SDX A;  4FAJ A;  4GQO A;  4I62 A;  4ZDM A;  3G3I A;  3TCG A;  2AL4 A;  4ELQ A;  4NWD A;  1SI1 A;  4LAT A;  4Q8R A;  4U23 A;  1JVX A;  1B4H A;  3CR9 A;  4FEB A;  4XKN A;  1NKX A;  3V89 B;  4UA8 A;  3OD7 A;  2E0S A;  4R2F A;  3GBA A;  3G3G A;  5CMK A;  3ECR A;  4F1U A;  3FAS A;  3OEL A;  1MQI A;  3RTF B;  2A5S A;  2ONK E;  1PC3 A;  3N26 A;  5CMB A;  3D4C A;  1JVY A;  3VE1 B;  5ICT A;  3Q27 A;  5JTY A;  1ZMG A;  2VP1 A;  3TCF A;  1AMF A;  1BP5 A;  4JXI A;  5AA2 D;  4MFI A;  3SES A;  3TTN A;  3SEW A;  5EHM A;  2P0S A;  4O3C A;  4DCY A;  4PQJ A;  3T9V A;  3MW0 A;  4E0W A;  4ZZE A;  3PUV E;  3K6W A;  4H6D A;  1GGG A;  2ALU A;  2B3B A;  4F2Q A;  1B0H A;  4H8I A;  1FTL A;  3BFT A;  1LFG A;  3K0V A;  2FYI A;  3KN7 A;  3MZB A;  1GR2 A;  1LAX A;  4KYD A;  3C9H A;  3MAM A;  2RC7 A;  1NL5 A;  1IIT A;  1SW2 A;  2OWT A;  3TFL A;  3QXM A;  4KYE A;  2DS9 A;  1OLA A;  1Y1Z A;  3ODB A;  3LBS A;  3SKP A;  2AYS A;  5CI5 A;  5H8Q B;  3K00 A;  3KN8 A;  4HS7 A;  3RUM A;  3UK4 A;  3HHG A;  1DSN A;  1EH3 A;  2HFB A;  1VE4 A;  1VSO A;  3S4U A;  5CMC A;  3IJX B;  3MBP A;  3JV9 A;  3KSJ A;  4M4G A;  3SER A;  2Y7K A;  4G8M A;  2F35 A;  4JBZ A;  4H1X A;  3VLW A;  2I3W A;  1IXG A;  4K3F A;  4BDO A;  5J1D A;  3SEV A;  1GTK A;  3SEY A;  4R6K A;  3H6W A;  1B7H A;  2E1S A;  1WVJ A;  3OO9 A;  2QS3 A;  5FHN A;  2DSF A;  3OO6 A;  3H6T A;  5DVF A;  1S7Y A;  3GBB A;  4MF3 A;  4AB6 A;  3SEX A;  3I5O A;  1I6Q A;  2V3U A;  4QSE A;  1BLF A;  5DTB A;  3KSX A;  4R9F A;  2HEU A;  1B3L A;  2RCB A;  3TEP A;  4ZED A;  3HHF A;  2DE3 A;  1N84 A;  3C32 A;  1OVT A;  3MVW A;  3PD9 A;  4R73 A;  2X7P A;  1LAH E;  2XX9 A;  3TDJ A;  5JEI A;  3B7D A;  4QFK A;  1Q35 A;  4G8N A;  3EQ1 A;  4OFJ A;  4EQ7 A;  2GRV A;  3DEL B;  3ONM A;  4YKJ A;  3KZG A;  3GXA A;  3O29 A;  5KCJ A;  5AA2 B;  3TTM A;  2QS4 A;  3FXQ A;  4OEU A;  1QVS A;  4YIC A;  3T9U A;  1XS5 A;  1M5E A;  5TPA A;  3MP1 A;  4X1D A;  2RF1 A;  3FGS A;  1MDQ A;  4QSC A;  2XXQ A;  4BDN A;  4RK2 A;  5DYH A;  3G3F A;  2UVJ A;  1LFH A;  1SW4 A;  4IY5 A;  4U4X A;  1MY4 A;  1FQA A;  2XXR A;  1MDP 1;  2Q89 A;  5H8H A;  4GWO A;  1XHY A;  4F29 A;  3IB2 A;  3K1N A;  3WAE A;  4RJZ A;  1MQD A;  4YU0 A;  3V83 A;  2O84 X;  4HCW A;  3RN8 A;  2F6P A;  4BDL A;  5FHM A;  2QPQ A;  3LSW A;  1O64 A;  1NFT A;  1Y4T A;  3T96 B;  2V93 A;  4RYA A;  5AA1 A;  2P2A A;  5DEX A;  3RT8 A;  4OWD A;  4F39 A;  4FIM A;  4YZZ A;  4OER A;  3OSQ A;  3P7I A;  1A40 A;  4O3A A;  4PFU A;  4F1Y A;  1ZU0 A;  3DM0 A;  5I57 B;  3KOS A;  2DXR A;  1MXU A;  3I6V A;  1T0K A;  3A3C A;  3G3K A;  3OOA A;  3AXF A;  2OCU A;  3QAX A;  3PPQ A;  1MRP A;  1MY1 A;  3IL1 B;  1IXH A;  1IIW A;  1EZ9 A;  1JW1 A;  1N7X A;  2B3F A;  1B7U A;  2I4B A;  4NF6 A;  3KGC A;  3OSR A;  2F78 A;  3FVO A;  3TOD A;  1AL3 A;  2XD3 A;  3EHS A;  1B5I A;  4XXU A;  3S9E A;  4OFO A;  2NWJ A;  3PV0 E;  4JWO A;  3MVZ A;  1Y1M A;  2O51 A;  3TQW A;  3N6U A;  1PB7 A;  2XX8 A;  4BDQ A;  1URD A;  3IX1 A;  2OBG A;  1MM6 A;  4FED A;  4NF8 B;  1NNP A;  1HSJ A;  4X1B A;  3EHU A;  5FTH A;  1A7L A;  3OEK A;  3L6H A;  4JB7 A;  3H4Z A;  4FAT A;  3K02 A;  3TTK A;  4NF4 B;  2UYF A;  3LSL A;  2HZK A;  2X26 A;  1LCT A;  3FXU A;  2DWJ A;  2I49 A;  4IY6 A;  3G3J A;  1USY E;  5KDT B;  1ZTY A;  4R75 A;  2V25 A;  4GXA A;  1QJM A;  1I69 A;  4IO2 A;  2O7I A;  3GZG A;  4QFP A;  4U1Z A;  3MC2 A;  2QMW A;  1Z7N E;  4EQ9 A;  2XXY A;  3S9L C;  2H4I A;  1TXF A;  4Z7E A;  4IO6 A;  4YMB A;  3PGF A;  3O66 A;  2ZYK A;  2HAV A;  3E4R A;  4GVO A;  1Y3Q A;  4NF5 B;  4GL0 A;  3KG2 A;  3LUY A;  1LAG E;  2DWH A;  3TPA A;  4H0W A;  3PMX A;  4E0X A;  1LFI A;  4MBP A;  1AIV A;  3MVY A;  3PPO A;  5L9M A;  2RC9 A;  3O6G A;  2XXU A;  1Y3P A;  1XC1 A;  1LLS A;  1B58 A;  2VD2 A;  4G8H A;  4OXV A;  1Y4C A;  1URS A;  4EDP A;  1IZ1 A;  1NH8 A;  4C1U A;  3LC8 A;  1UQW A;  2UYE A;  2Y7W A;  4PE5 B;  1MPD A;  3DP8 A;  2ZNU A;  4F31 B;  1FTM A;  4EUO A;  1TFD A;  3M8U A;  2F36 A;  1LBB A;  1B5J A;  4LA9 A;  1B3F A;  5CRY A;  4GIZ A;  4DDD A;  2O6A A;  2F7B A;  3K6V A;  3FJG A;  1B1X A;  4R6Y A;  2I48 A;  3RLF E;  1P1U A;  2DWI A;  2F8D A;  4C0R A;  2DVZ A;  2G29 A;  1JNF A;  1HSE A;  1UTH B;  3RTW B;  3UOR A;  1SYH A;  1ANF A;  3MP8 A;  3TAJ A;  5BUU A;  3UN6 A;  4L17 A;  4IO4 A;  2O68 A;  3MJN A;  4GFR A;  2UVI A;  4QFN A;  2QS1 A;  2Q2A A;  3DP4 A;  3CFL A;  4BLA A;  5ICQ A;  1A8E A;  4ECF A;  2NUV A;  4KFQ A;  5H8Q A;  4OYV A;  3QYT A;  3S2V A;  4WXJ A;  4PP0 A;  1B0L A;  1P1O A;  5L8D A;  3UP9 A;  4KCC A;  2R71 A;  5H8S A;  2BJJ X;  3KEI A;  3O97 A;  4XKQ A;  3HCQ A;  3PPP A;  4F19 A;  4XIG Q;  1WOD A;  1EZP A;  3K1M A;  5M2V A;  1ATG A;  1ELJ A;  3Q25 A;  4YKI A;  4LUB A;  4GLI A;  1HSL A;  3R7X A;  4KQP A;  4ZZA A;  3KFM A;  2LAO A;  4ELR A;  2FNC A;  2H99 A;  3CIJ A;  1MY0 A;  3C33 A;  5I2K B;  2ONR A;  4TLM B;  4WED A;  4GF8 A;  4OTE A;  4F1V A;  1DOT A;  1KWH A;  4MH5 A;  1P99 A;  1YAE A;  4DIG A;  3MPL A;  1DMB A;  3HN0 A;  2F34 A;  1OQH A;  1ZBM A;  4N6P A;  3ZKL A;  1OLC A;  3MUQ A;  1USY H;  3QIM A;  3GLB A;  3O6H A;  3W9V A;  3M3F A;  3CFX A;  4IO5 A;  4JWY A;  1PB8 A;  5EYF A;  5AA2 A;  1MQG A;  4U4S A;  1BIY A;  1NMU A;  2OK2 A;  5JK4 A;  1MXZ A;  2F5X A;  4OFL A;  1MXW A;  1M5C A;  3PPR A;  2H98 A;  2RIN A;  4KYS A; 
#chains in the Genus database with same CATH topology
 2HZL A;  5H8N B;  2Z8F A;  2DQV A;  4P3L A;  4G68 B;  1NUW A;  1PB9 A;  1MQJ A;  4ZEK A;  1JEV A;  3FD3 A;  4GRK A;  1OQG A;  3U1O A;  2AIX A;  1ZJL A;  2O1L A;  3H6U A;  4PGP A;  2O69 A;  2ZYM A;  2RCA A;  4KHZ E;  4TQU Q;  1YYZ A;  2ZMB A;  4G2Z A;  4P0I A;  5CMM A;  4P47 A;  5TU0 A;  5ISU A;  4AB5 A;  5EQ8 A;  1DTG A;  3EPE A;  2I0C A;  1FCK A;  1MH4 A;  4RXL A;  2R6G E;  1DPP A;  3U72 A;  3TTR A;  1Q1K A;  2AL5 A;  4ZEI A;  2V84 A;  2DE2 A;  4RY1 A;  4OAN A;  2P3N A;  3A09 A;  5IAI A;  5H8F B;  4R6H A;  2M8C A;  3CI8 A;  1OMP A;  2ZYN A;  3U8Q A;  4G4P A;  5I57 A;  4X48 A;  1UIV A;  1FTO A;  3CHG A;  3TZA A;  4IO3 A;  4RA1 A;  1UTB B;  1FBF A;  2IEE A;  4YAH X;  3ROJ A;  3TKD A;  2Z8E A;  3UA8 A;  3RGY A;  2PYY A;  1H76 A;  5TP9 A;  3K4U A;  1B2H A;  2O1M A;  1IMF A;  3O9P A;  1B3G A;  5ET6 A;  4PF6 A;  1M5B A;  4XEQ A;  2ZYO A;  2HAU A;  1N76 A;  3H03 A;  3D4G A;  4PFT A;  1B46 A;  3E9X A;  5ET5 A;  2Q74 A;  3OO8 A;  4P11 A;  1NI9 A;  3KBR A;  2WYK A;  4H45 A;  4HW8 A;  3T93 B;  4JSO A;  3IB1 A;  1JW4 A;  2GFE A;  2DXY A;  5IKB A;  4PCD A;  1QKB A;  3KJ7 A;  3IO4 A;  1XVY A;  1Y9U A;  2GH9 A;  1IUD A;  2QSX A;  1I6A A;  3K6U A;  3R26 A;  3IOT A;  4H8J A;  1YXI A;  4F3B A;  1S50 A;  1QKA A;  1RKM A;  1NUX A;  5LOM A;  1D9V A;  4NF8 A;  4KR5 A;  4I3E A;  2QMX A;  2XX7 A;  4YKP A;  3K2D A;  4IO7 A;  4X04 A;  4ZE9 A;  3TYH A;  2FIE A;  3S9N C;  5A5X B;  4OMB A;  1RYO A;  3DP6 A;  1XVX A;  1TWY A;  5AE4 A;  3PMW A;  4KI0 E;  4F22 A;  4LQ2 A;  5TP9 B;  4KXP A;  3PUY E;  4XKP A;  1D3K A;  4NF4 A;  3VVD A;  4ONY A;  1TT1 A;  2WKY A;  2Z8D A;  2W7Y A;  4OES A;  3M3K A;  5KDT A;  4U22 A;  4AS4 A;  1I6B A;  1R1N A;  4PFI A;  4I8C A;  4WKM A;  3VV5 A;  3OEM A;  4MJO A;  2UXA A;  4ESX A;  1POY 1;  4EQB A;  1N7W A;  5F1Q A;  3S9M C;  2D21 A;  2FA7 A;  3QUJ A;  4NQ8 A;  2Q88 A;  3IOW A;  3VLV A;  1PBP A;  1N0T A;  3VXB A;  1FPL A;  4MNI A;  5I58 B;  3O6I A;  4OEN A;  4KPT A;  1FQD A;  1II5 A;  3Q26 A;  2ESN A;  2HHM A;  3KJT A;  5I59 A;  3LV0 A;  2OLB A;  5B70 A;  5AA4 B;  1KA1 A;  4NF5 A;  5B7D A;  1LCF A;  4U1O A;  4JVC A;  4HTG A;  3RPL A;  4PBQ A;  3KBZ A;  1MXX A;  4OZ9 A;  3IOR A;  2F7A A;  2NVU B;  1PBQ A;  3IB0 A;  4LP2 B;  4DXB A;  4F3G A;  4Z0I A;  1S9T A;  4ND9 A;  4IGT A;  3RPW A;  1LEV A;  3V8X B;  3RQT A;  4JDF A;  5I2N B;  2QRY A;  4ISU A;  5IZ3 B;  1B4Z A;  1JET A;  2XXH A;  3PUW E;  1EU8 A;  1P1N A;  4MLQ A;  3RT6 B;  3CFZ A;  2DP8 A;  1H3D A;  3CSB A;  4QHQ A;  4OET A;  3C34 A;  1R6Z A;  3MVX A;  4OVQ A;  1XT8 A;  3IR1 A;  5CBR A;  2XWI A;  2V3T A;  1R9Q A;  3B6T A;  3CSG A;  4POX A;  3ZKK A;  3CG3 A;  4FE8 A;  3N5L A;  4LZ5 A;  2Z22 A;  4N6D A;  5ET7 A;  3SEU A;  5I59 B;  1FQE A;  4DE8 A;  4GL8 A;  3VLU A;  2D5W A;  5A5L A;  5I56 B;  4PFY A;  1UTH A;  4U21 A;  4ZEB A;  1AOV A;  3VDF A;  1Y20 A;  3FXR A;  4N91 A;  1B7Z A;  1B05 A;  1QW0 A;  4MLV A;  1B3H A;  5IGA A;  3FVK A;  2DE4 A;  3KC1 A;  1NNT A;  4HE2 A;  3CRB A;  3W9W A;  1DTZ A;  3KN3 A;  1LGB C;  2ABH A;  4H5G A;  3K6X A;  3USD A;  3FIR A;  1POT A;  3TQL A;  2XXW A;  4DI4 B;  1OVB A;  4MMP A;  4N13 A;  3FBP A;  4YKK A;  4H46 A;  2A5T B;  3FJ7 A;  1SYI A;  3C4M A;  4R72 A;  3O28 A;  4U2R A;  1B52 A;  4PE3 A;  1H43 A;  2FVZ A;  3WAF A;  1SQY A;  3EF7 A;  2B65 A;  4R2B A;  1O7T A;  4ESW A;  3V5A A;  1LBC A;  2YJP A;  4PGN A;  5J16 A;  2F6G A;  1IXC A;  4FJP A;  1A55 A;  5T3J A;  4ZEC A;  3HPI A;  4EF2 A;  3PU5 A;  2KLF A;  4O3B A;  5I2K A;  1M5D A;  2XD2 A;  1R9L A;  3T1B A;  1ZIU A;  4DXC A;  2XXK A;  4F2O A;  2GHB A;  2UVH A;  2QFL A;  2ZXT A;  4EF1 A;  1Y3N A;  4GXS B;  4H67 A;  1G0H A;  3EHT A;  1O63 A;  1N04 A;  4N81 A;  2X7Q A;  2Z23 A;  3EN3 A;  4GBV A;  2CZK A;  1NNK A;  1BTJ A;  1B3E A;  2XXP A;  4WEP A;  3N94 A;  4QSD A;  3ZS6 A;  1A54 A;  1AH5 A;  1BK4 A;  3PD8 A;  3BIH A;  3FUZ A;  5BWJ A;  5FHO A;  1LAF E;  2CEX A;  1A8F A;  3TMG A;  1H45 A;  4R9G A;  1MPB A;  2QVV A;  1OIB A;  2B4M A;  3HFU A;  2DOJ A;  2Q2C A;  4DLD A;  1NNF A;  2RKM A;  3IAZ A;  5H8N A;  4G68 A;  3KOT A;  2ONS A;  4RK9 A;  1DK4 A;  4NGU A;  1B9J A;  4YB6 A;  2D3I A;  3R6U A;  2PBW A;  2REJ A;  3IFA A;  3M3L A;  4P9K A;  1QUL A;  3MYU A;  2ZNT A;  1B51 A;  1SD3 A;  2F3B A;  3I3V A;  1QUJ A;  2Y84 A;  3LR1 A;  4KCD A;  2H25 A;  5ITP A;  3OMB A;  4YB5 A;  4FBP A;  4NG7 A;  2OJT A;  3Q28 A;  1MXY A;  1FBP A;  1D4N A;  1FRP A;  4OVT A;  5I3S A;  4M1V A;  5I84 A;  1FQC A;  3PMV A;  3Q29 A;  4O7M A;  3UIF A;  5CBS A;  1MPC A;  5L9O A;  2V3Q A;  3SDF A;  2I6E A;  2KQZ A;  3MQ9 A;  3MWB A;  2PMS A;  3C36 A;  4MNC A;  4Q0C A;  5KZT A;  2UVG A;  5IM2 A;  4NMY A;  2OWS A;  3C35 A;  3EKI A;  3C31 A;  4EXL A;  4H65 A;  1SBP A;  3SET A;  2PT2 A;  1IMB A;  3E3K A;  5H8F A;  4XKR A;  2XXV A;  3MZ1 A;  5JTY B;  2Q8J A;  1NUZ A;  1YCJ A;  3VFJ A;  5HBC A;  5CC2 A;  3FV2 A;  3F11 A;  4OHN A;  4G68 C;  2P1S A;  1UTB A;  3G7W A;  1CB6 A;  4PF8 A;  4GOT A;  3HV1 A;  3FV1 A;  3HST A;  1QUK A;  3H7M A;  2ZNS A;  1SW1 A;  4IR8 A;  4HCY A;  3PUX E;  2OZZ A;  1J1N A;  1NV1 A;  2GHA A;  1LST A;  1F9B A;  1Q9D A;  2QJE A;  4YMA A;  4KD5 A;  1ZLQ A;  3UGW A;  1EYI A;  3QUF A;  2CZL A;  3T9H B;  4NWC A;  3FVG A;  1VFE A;  1B5H A;  4ZS9 A;  1B32 A;  1RYX A;  4MIJ A;  4LQ5 A;  1TFA A;  2VPO A;  1IXI A;  1LBV A;  4N07 A;  1N3X A;  4QXD A;  1XOC A;  4JWX A;  4MAG A;  3OO7 A;  4NHB A;  2VGQ A;  1PEB A;  1LB9 A;  1B40 A;  1FQF A;  2I3V A;  5A5X A;  1NUY A;  4NTL A;  1JP4 A;  3DLN A;  4F3P A;  4C1T A;  4UAC A;  2DVC A;  5ELV A;  4R74 A;  3OEN A;  2IA4 A;  4GBW A;  2ZZV A;  4DI3 D;  4G77 A;  1RDY A;  3W15 C;  1NH7 A;  4LVQ A;  1DPE A;  3T9X B;  3FAT A;  4DZ1 A;  5DVJ A;  2G93 A;  4LZ8 A;  2DWA A;  1M5F A;  4NN3 A;  2NOO A;  4DCX A;  5EQ7 A;  1VFD A;  3LSX A;  3FJM A;  5I58 A;  3VVF A;  1GV8 A;  3IOV A;  3U94 A;  2THI A;  4OVP A;  4F18 A;  2XXX A;  4JSD A;  4XF5 A;  3OXN A;  2H5Y A;  2XXI A;  3L6G A;  5AA4 A;  2XWK A;  1P1W A;  4Q30 B;  4P0G A;  3FVN A;  1YPN A;  5K2X A;  2DDK A;  4NED A;  5KCJ B;  4MEV A;  1YTV A;  1N3W A;  3B8B A;  2PVU A;  3VVE A;  4QF9 A;  3RNN A;  1QUI A;  4OEV A;  2HQ0 A;  5HPQ A;  1FTK A;  5DT6 A;  5TPA B;  2RC8 A;  1IEJ A;  2ANJ A;  5I2N A;  1MH3 A;  4DXU A;  5IZ3 A;  1FBD A;  1NV7 A;  1LB8 A;  5ITO A;  5ESY A;  4Q5T A;  4AQ4 A;  4BDM A;  4YB7 A;  1KZ8 A;  1VR5 A;  5K2Y A;  4ZE8 A;  4PET A;  3MP6 A;  5H8H B;  5F24 A;  1FQB A;  2I4C A;  1A99 A;  4N15 A;  4LON B;  5EHS A;  1MXV A;  3PUZ E;  1L5T A;  2I0B A;  3U65 A;  1GVC A;  3QK6 A;  1JW5 A;  2ZZX A;  1US4 A;  2PT1 A;  2YLN A;  2VHA A;  3TUS A;  1NV0 A;  3A3U A;  1B6H A;  3B6Q A;  4I9D A;  5IZ1 A;  5I56 A;  1RDZ A;  2YPN A;  2O7U A;  4UAB A;  4PAI A;  4NF0 A;  5F7V A;  4PFW A;  5DEX B;  3TEL A;  2I58 A;  3H06 B;  3H3G A;  4BDR A;  1MY3 A;  1Z7M E;  2HXW A;  1H44 A;  5EQA A;  4ELP A;  3B6W A;  2R9J A;  3BFU A;  3GYY A;  4G61 A;  4OQO A;  1SW5 A;  4ZEF A;  2QS2 A;  4LN5 A;  3N6T A;  1MS7 A;  4RPN A;  3IJO B;  3JZJ A;  3HO7 A;  2Y5K A;  3NOH A;  1ZKB A;  4OA4 A;  1JEU A;  3K01 A;  3FZV A;  5FBP A;  4OVJ A;  2Y7R A;  3O2A A;  4TOZ A;  3PPN A;  4X9T A;  2F97 A;  4EXK A;  3E13 X;  5L9S A;  4QFO A;  1IQ7 A;  1LBZ A;  1WDN A;  4IGR A;  2XXT A;  4I3Y A;  1FBE A;  1FTA A;  4TLL B;  3ZSF A;  1SVX B;  3ILT B;  1FPJ A;  3THI A;  4JVD A;  2A5T A;  1FJ9 A;  3TTL A;  4NF6 B;  1SPI A;  4POW A;  4LZ7 A;  3IK6 B;  4QRZ A;  1US5 A;  2F7C A;  4ELO A;  4IB2 A;  1SI0 A;  3RY3 A;  5AA3 A;  2XHD A;  3ILU B;  2Y7I A;  3U93 A;  2R8T A;  4THI A;  2NXO A;  2Y7P A;  1CE2 A;  1D9Y A;  1FPE A;  1EZO A;  4P56 A;  3QSL A;  4I1D A;  2CMO A;  3U92 A;  3BKI B;  4H5F A;  1MM7 A;  2VD3 A;  2REG A;  5EQ9 A;  3VXC A;  3H6V A;  1MY2 A;  3G3H A;  1MG1 A;  1UIU A;  5DVI A;  1FW0 A;  1P1Q A;  2HCA A;  3IO6 A;  5FTI A;  3T66 A;  1MQH A;  2Q9T A;  4GD5 A;  2H9B A;  3IOU A;  4FEC A;  4FOR A;  3BBR A;  4HXV A;  4QFL A;  4F3S A;  3K1P A;  5HM4 B;  3MPK A;  4RPO A;  3E78 A;  1IME A;  1PDA A;  3JYR A;  2CZH A;  5CM6 A;  1BKA A;  2WBB A;  3TCH A;  4RNS A;  1B1H A;  4NE4 A;  4HE0 A;  3CG1 A;  3LSF B;  2QL3 A;  3T22 A;  2PX1 A;  1FPD A;  3MZ9 A;  2HXR A;  1JQF A;  1URG A;  2DYX A;  2VOZ A;  3CVG A;  4XTC Q;  1FTJ A;  1SDX A;  4FAJ A;  4MHF A;  4GQO A;  4I62 A;  2L5V A;  4ZDM A;  2F3D A;  3G3I A;  3TCG A;  2AL4 A;  4ELQ A;  4NWD A;  1NV5 A;  1SI1 A;  4LAT A;  4Q8R A;  4U23 A;  1JVX A;  1B4H A;  4GWZ A;  3CR9 A;  2CZI A;  4FEB A;  4XKN A;  2Q8M A;  1NKX A;  3V89 B;  4UA8 A;  3PTY A;  3OD7 A;  2E0S A;  4R2F A;  3A29 A;  3GBA A;  5LTC A;  3G3G A;  5CMK A;  3ECR A;  4F1U A;  3FAS A;  3OEL A;  1MQI A;  4N6K A;  2A5S A;  3RTF B;  3E79 A;  2ONK E;  1PC3 A;  3N26 A;  5CMB A;  3D4C A;  1JVY A;  3VE1 B;  5ICT A;  3Q27 A;  4N8Y A;  5JTY A;  1ZMG A;  2VP1 A;  3TCF A;  1AMF A;  1BP5 A;  4JXI A;  5AA2 D;  3LUZ A;  4MFI A;  1CNQ A;  3SES A;  3TTN A;  3SEW A;  5EHM A;  4GWY A;  2P0S A;  4O3C A;  4DCY A;  4P1L A;  4PQJ A;  3T9V A;  3MW0 A;  4E0W A;  4ZZE A;  3PUV E;  3K6W A;  4H6D A;  2FBP A;  1GGG A;  2ALU A;  4PBH A;  2B3B A;  4F2Q A;  1B0H A;  4H8I A;  1FTL A;  3BFT A;  1LFG A;  3K0V A;  2FYI A;  1IMD A;  3KN7 A;  3MZB A;  3D1R A;  1GR2 A;  1LAX A;  4KYD A;  3C9H A;  4JVI A;  3MAM A;  2RC7 A;  1NL5 A;  1IIT A;  1SW2 A;  1FPB A;  2OWT A;  3TFL A;  3QXM A;  4QBA A;  4KYE A;  2DS9 A;  1OLA A;  2HPG A;  1Y1Z A;  3ODB A;  3LBS A;  3SKP A;  2AYS A;  5CI5 A;  5H8Q B;  3K00 A;  3KN8 A;  4HS7 A;  3RUM A;  3UK4 A;  3HHG A;  1DSN A;  1EH3 A;  2HFB A;  1VE4 A;  1VSO A;  3S4U A;  5CMC A;  3RYD A;  3IJX B;  3MBP A;  3JV9 A;  3KSJ A;  4M4G A;  3SER A;  2Y7K A;  4G8M A;  5I5P A;  2F35 A;  4JBZ A;  2VT5 A;  1AWB A;  4PAF A;  4H1X A;  3VLW A;  2I3W A;  5EYH A;  1IXG A;  4K3F A;  4BDO A;  5J1D A;  3SEV A;  1GTK A;  3SEY A;  4R6K A;  3H6W A;  2FIX A;  1B7H A;  2E1S A;  2OX3 A;  1WVJ A;  3OO9 A;  2QS3 A;  5FHN A;  2DSF A;  3OO6 A;  3H6T A;  5DVF A;  1S7Y A;  3GBB A;  4MF3 A;  4AB6 A;  3SEX A;  3I5O A;  1I6Q A;  2V3U A;  4QSE A;  1BLF A;  3FXB A;  5DTB A;  3KSX A;  4R9F A;  4PC9 A;  2HEU A;  1B3L A;  2RCB A;  3TEP A;  4ZED A;  3HHF A;  2DE3 A;  1FPF A;  4PDH A;  1N84 A;  3C32 A;  1OVT A;  1FSA A;  3MVW A;  3PD9 A;  4R73 A;  2X7P A;  1LAH E;  2XX9 A;  3TDJ A;  5JEI A;  3B7D A;  4QFK A;  1Q35 A;  4G8N A;  3EQ1 A;  4OFJ A;  1D9Q A;  4EQ7 A;  2GRV A;  3DEL B;  3ONM A;  4YKJ A;  3KZG A;  3GXA A;  3O29 A;  5KCJ A;  5AA2 B;  2XWV A;  3TTM A;  2QS4 A;  3FXQ A;  4OEU A;  4GWU A;  1QVS A;  4YIC A;  1LBW A;  3T9U A;  1XS5 A;  1M5E A;  5TPA A;  3MP1 A;  4X1D A;  2RF1 A;  4MNP A;  3FGS A;  1MDQ A;  4QSC A;  2XXQ A;  4BDN A;  4RK2 A;  5DYH A;  3G3F A;  3KC0 A;  4GWW A;  4MX6 A;  2UVJ A;  1LFH A;  1SW4 A;  4IY5 A;  2XWO A;  4U4X A;  1MY4 A;  1FQA A;  2XXR A;  1MDP 1;  2Q89 A;  5H8H A;  4GWO A;  1XHY A;  4F29 A;  3IB2 A;  3K1N A;  3WAE A;  2Y5L A;  1K9Y A;  4RJZ A;  1MQD A;  4YU0 A;  3V83 A;  2O84 X;  4HCW A;  2MKZ A;  3RN8 A;  2F6P A;  4BDL A;  4GX4 A;  5FHM A;  4PDD A;  4MCO A;  2QPQ A;  3B50 A;  3LSW A;  1O64 A;  1NFT A;  1Y4T A;  3T96 B;  2V93 A;  4RYA A;  5AA1 A;  2P2A A;  5DEX A;  3RT8 A;  4OWD A;  4F39 A;  1EYJ A;  4FIM A;  2QVU A;  4YZZ A;  2FHY A;  4OER A;  3OSQ A;  3P7I A;  1A40 A;  4O3A A;  2WX9 A;  4PFU A;  4F1Y A;  3BIG A;  1ZU0 A;  3DM0 A;  2OWZ A;  4I40 A;  5I57 B;  3KOS A;  2DXR A;  1MXU A;  5I7I A;  3I6V A;  4GWS A;  1T0K A;  3A3C A;  3G3K A;  4O8M A;  3OOA A;  3AXF A;  1FJ6 A;  2OCU A;  3QAX A;  3PPQ A;  1DCU A;  1LBX A;  1MRP A;  1FPK A;  1MY1 A;  3IL1 B;  1IXH A;  1IIW A;  1EZ9 A;  1FBG A;  1JW1 A;  1N7X A;  2B3F A;  1B7U A;  2I4B A;  4NF6 A;  3KGC A;  3OSR A;  2BJI A;  2CEY A;  2F78 A;  3FVO A;  3TOD A;  1AL3 A;  2XD3 A;  4X8R A;  3EHS A;  1B5I A;  4XXU A;  3S9E A;  4OFO A;  2NWJ A;  4GX6 A;  1NV6 A;  3PV0 E;  4JWO A;  2PFY A;  3MVZ A;  1Y1M A;  1FBC A;  2O51 A;  3TQW A;  3N6U A;  1PB7 A;  2XX8 A;  4BDQ A;  1URD A;  1YZ0 A;  1QGX A;  3IX1 A;  4N17 A;  2OBG A;  2GQ1 A;  1MM6 A;  4FED A;  4NF8 B;  4PAK A;  1INP A;  1RDX A;  2WBD A;  1NNP A;  2V4C A;  1HSJ A;  4X1B A;  3EHU A;  5FTH A;  1A7L A;  4PTK A;  3OEK A;  3L6H A;  4JB7 A;  3H4Z A;  4FAT A;  3K02 A;  3TTK A;  4O94 A;  4NF4 B;  2UYF A;  3LSL A;  2HZK A;  2X26 A;  1LCT A;  3FXU A;  2DWJ A;  2I49 A;  4IY6 A;  3G3J A;  1USY E;  5KDT B;  1ZTY A;  3T0J A;  4R75 A;  2V25 A;  4GXA A;  1QJM A;  1I69 A;  4PFB A;  4IO2 A;  4HE1 A;  2O7I A;  3GZG A;  1LBY A;  4QFP A;  4U1Z A;  5DW8 A;  3MC2 A;  2QMW A;  1Z7N E;  4EQ9 A;  2XXY A;  3S9L C;  4NAP A;  2H4I A;  1TXF A;  4Z7E A;  4IO6 A;  5EYG A;  4YMB A;  3ISP A;  3PGF A;  4OVR A;  1K9Z A;  3O66 A;  2ZYK A;  4O7I A;  2HAV A;  3E4R A;  4GVO A;  1Y3Q A;  4NF5 B;  4GL0 A;  3KG2 A;  3LUY A;  3QMF A;  3RPL B;  1LAG E;  2DWH A;  3TPA A;  4H0W A;  3PMX A;  1DBZ A;  1NV2 A;  4E0X A;  1LFI A;  4MBP A;  1AIV A;  3MVY A;  3PPO A;  5L9M A;  2RC9 A;  3O6G A;  2XXU A;  4GX3 A;  1Y3P A;  1XC1 A;  1LLS A;  1B58 A;  4AS5 A;  2QVR A;  2VD2 A;  1EYK A;  1FPG A;  4G8H A;  4OVS A;  4OXV A;  1Y4C A;  1URS A;  4EDP A;  1FBH A;  1IZ1 A;  1NH8 A;  4C1U A;  3LC8 A;  1UQW A;  2UYE A;  5LDZ A;  2Y7W A;  4PE5 B;  1MPD A;  3DP8 A;  2ZNU A;  4F31 B;  1FTM A;  4EUO A;  2PCR A;  1TFD A;  1XI6 A;  3M8U A;  2F36 A;  1LBB A;  1B5J A;  4LA9 A;  4N8G A;  1B3F A;  5CRY A;  5IZZ A;  4GIZ A;  1KA0 A;  4DDD A;  2O6A A;  2F7B A;  3K6V A;  3FJG A;  1B1X A;  4R6Y A;  2I48 A;  3RLF E;  1P1U A;  2DWI A;  2F8D A;  4C0R A;  1IMC A;  2DVZ A;  2G29 A;  1JNF A;  3IFC A;  1HSE A;  4NX1 A;  1UTH B;  4N4U A;  3RTW B;  3UOR A;  1SYH A;  1ANF A;  3MP8 A;  3TAJ A;  5BUU A;  3UN6 A;  2WYP A;  4L17 A;  4IO4 A;  2KR0 A;  2O68 A;  3MJN A;  4GFR A;  2UVI A;  4QFN A;  2QS1 A;  2Q2A A;  3DP4 A;  3CFL A;  4BLA A;  5ICQ A;  1NV4 A;  1A8E A;  2B4L A;  4ECF A;  2NUV A;  4KFQ A;  5H8Q A;  4OYV A;  3QYT A;  3S2V A;  4WXJ A;  2ZZW A;  4PP0 A;  1B0L A;  2PFZ A;  1P1O A;  3SZP A;  5L8D A;  3UP9 A;  4KCC A;  2R71 A;  5H8S A;  2BJJ X;  3KEI A;  3O97 A;  4XKQ A;  3HCQ A;  3PPP A;  4F19 A;  4XIG Q;  1WOD A;  1EZP A;  3K1M A;  1NV3 A;  5M2V A;  1ATG A;  1ELJ A;  3Q25 A;  4YKI A;  4LUB A;  2JJK A;  4GLI A;  1HSL A;  3R7X A;  4KQP A;  1FPI A;  4ZZA A;  3KFM A;  4PFR A;  2LAO A;  4ELR A;  2FNC A;  2H99 A;  4GWX A;  3CIJ A;  1MY0 A;  4XFE A;  3C33 A;  1VDW A;  2ONR A;  4TLM B;  4WED A;  5I2K B;  4GF8 A;  4OTE A;  4P1E A;  4F1V A;  1DOT A;  1KWH A;  4P8B A;  4MH5 A;  1P99 A;  1YAE A;  4DIG A;  3MPL A;  1DMB A;  3HN0 A;  2F34 A;  1OQH A;  1ZBM A;  4N6P A;  3ZKL A;  1OLC A;  2P3V A;  3MUQ A;  1USY H;  2VPN A;  3MST A;  3QIM A;  3GLB A;  3O6H A;  3W9V A;  3M3F A;  3CFX A;  4IO5 A;  2WEF A;  4JWY A;  1PB8 A;  5EYF A;  5ET8 A;  5AA2 A;  1MQG A;  4U4S A;  1BIY A;  1NMU A;  1IMA A;  2OK2 A;  5JK4 A;  1MXZ A;  2F5X A;  4OFL A;  1G0I A;  1MXW A;  1M5C A;  2XA5 A;  3PPR A;  2H98 A;  2RIN A;  4KYS A; 
#chains in the Genus database with same CATH homology
 2HZL A;  5H8N B;  2Z8F A;  2DQV A;  4G68 B;  1PB9 A;  1MQJ A;  4ZEK A;  1JEV A;  3FD3 A;  4GRK A;  1OQG A;  3U1O A;  2AIX A;  1ZJL A;  2O1L A;  3H6U A;  2O69 A;  2ZYM A;  2RCA A;  4KHZ E;  4TQU Q;  2ZMB A;  4G2Z A;  4P0I A;  5CMM A;  5TU0 A;  5ISU A;  4AB5 A;  1DTG A;  3EPE A;  2I0C A;  1FCK A;  1MH4 A;  4RXL A;  2R6G E;  1DPP A;  3U72 A;  3TTR A;  1Q1K A;  2AL5 A;  4ZEI A;  2V84 A;  2DE2 A;  4RY1 A;  3A09 A;  5IAI A;  5H8F B;  4R6H A;  2M8C A;  3CI8 A;  1OMP A;  2ZYN A;  3U8Q A;  4G4P A;  5I57 A;  4X48 A;  1UIV A;  1FTO A;  3TZA A;  4IO3 A;  4RA1 A;  1UTB B;  2IEE A;  4YAH X;  3TKD A;  2Z8E A;  3UA8 A;  3RGY A;  2PYY A;  1H76 A;  5TP9 A;  3K4U A;  1B2H A;  2O1M A;  3O9P A;  1B3G A;  1M5B A;  2ZYO A;  2HAU A;  1N76 A;  3H03 A;  3D4G A;  4PFT A;  1B46 A;  3E9X A;  3OO8 A;  4P11 A;  3KBR A;  4HW8 A;  3T93 B;  4JSO A;  3IB1 A;  1JW4 A;  2GFE A;  2DXY A;  5IKB A;  1QKB A;  3KJ7 A;  3IO4 A;  1XVY A;  1Y9U A;  2GH9 A;  1IUD A;  2QSX A;  1I6A A;  3K6U A;  3R26 A;  3IOT A;  4H8J A;  4F3B A;  1S50 A;  1QKA A;  1RKM A;  5LOM A;  1D9V A;  4NF8 A;  4KR5 A;  2QMX A;  2XX7 A;  4YKP A;  3K2D A;  4IO7 A;  4ZE9 A;  3TYH A;  3S9N C;  5A5X B;  4OMB A;  1RYO A;  3DP6 A;  1XVX A;  1TWY A;  5AE4 A;  3PMW A;  4KI0 E;  4F22 A;  4LQ2 A;  5TP9 B;  3PUY E;  4XKP A;  1D3K A;  4NF4 A;  3VVD A;  4ONY A;  1TT1 A;  2WKY A;  2Z8D A;  2W7Y A;  4OES A;  3M3K A;  5KDT A;  4U22 A;  1I6B A;  1R1N A;  4I8C A;  4WKM A;  3VV5 A;  3OEM A;  2UXA A;  4ESX A;  1POY 1;  4EQB A;  1N7W A;  5F1Q A;  3S9M C;  2D21 A;  2FA7 A;  3QUJ A;  2Q88 A;  3IOW A;  3VLV A;  1PBP A;  1N0T A;  3VXB A;  5I58 B;  3O6I A;  4OEN A;  4KPT A;  1FQD A;  1II5 A;  3Q26 A;  2ESN A;  3KJT A;  5I59 A;  2OLB A;  5B70 A;  5AA4 B;  4NF5 A;  5B7D A;  1LCF A;  4U1O A;  4HTG A;  1MXX A;  4OZ9 A;  3IOR A;  2F7A A;  2NVU B;  1PBQ A;  3IB0 A;  4LP2 B;  4DXB A;  4F3G A;  4Z0I A;  1S9T A;  4ND9 A;  4IGT A;  3RPW A;  3V8X B;  3RQT A;  4JDF A;  5I2N B;  2QRY A;  4ISU A;  1B4Z A;  1JET A;  2XXH A;  3PUW E;  1EU8 A;  1P1N A;  4MLQ A;  3RT6 B;  3CFZ A;  2DP8 A;  1H3D A;  3CSB A;  4QHQ A;  4OET A;  3C34 A;  1R6Z A;  3MVX A;  1XT8 A;  3IR1 A;  5CBR A;  2V3T A;  1R9Q A;  3B6T A;  3CSG A;  4POX A;  3ZKK A;  3CG3 A;  4FE8 A;  3N5L A;  4LZ5 A;  2Z22 A;  3SEU A;  5I59 B;  1FQE A;  4DE8 A;  4GL8 A;  3VLU A;  2D5W A;  5I56 B;  4PFY A;  1UTH A;  4U21 A;  4ZEB A;  1AOV A;  3VDF A;  1Y20 A;  3FXR A;  1B7Z A;  1B05 A;  1QW0 A;  4MLV A;  1B3H A;  3FVK A;  2DE4 A;  1NNT A;  3CRB A;  3W9W A;  1DTZ A;  3KN3 A;  1LGB C;  2ABH A;  4H5G A;  3K6X A;  3USD A;  3FIR A;  1POT A;  3TQL A;  2XXW A;  1OVB A;  4N13 A;  4YKK A;  2A5T B;  3FJ7 A;  1SYI A;  3C4M A;  4R72 A;  3O28 A;  4U2R A;  1B52 A;  1H43 A;  3WAF A;  1SQY A;  3EF7 A;  2B65 A;  4R2B A;  1O7T A;  4ESW A;  3V5A A;  1LBC A;  2YJP A;  2F6G A;  1IXC A;  4FJP A;  1A55 A;  4ZEC A;  3HPI A;  4EF2 A;  3PU5 A;  2KLF A;  4O3B A;  5I2K A;  1M5D A;  2XD2 A;  1R9L A;  1ZIU A;  4DXC A;  4F2O A;  2GHB A;  2UVH A;  2ZXT A;  4EF1 A;  1Y3N A;  4GXS B;  4H67 A;  3EHT A;  1O63 A;  1N04 A;  2X7Q A;  2Z23 A;  3EN3 A;  1NNK A;  1BTJ A;  1B3E A;  2XXP A;  4WEP A;  3N94 A;  4QSD A;  3ZS6 A;  1A54 A;  1AH5 A;  3PD8 A;  3FUZ A;  5BWJ A;  5FHO A;  1LAF E;  1A8F A;  3TMG A;  1H45 A;  4R9G A;  1MPB A;  1OIB A;  2DOJ A;  2Q2C A;  4DLD A;  1NNF A;  2RKM A;  3IAZ A;  5H8N A;  4G68 A;  3KOT A;  2ONS A;  4RK9 A;  1B9J A;  4YB6 A;  2D3I A;  3R6U A;  2PBW A;  2REJ A;  3M3L A;  1QUL A;  2ZNT A;  1B51 A;  1SD3 A;  3I3V A;  1QUJ A;  2Y84 A;  3LR1 A;  4KCD A;  2H25 A;  5ITP A;  3OMB A;  4YB5 A;  2OJT A;  3Q28 A;  1MXY A;  1D4N A;  4M1V A;  5I84 A;  1FQC A;  3PMV A;  3Q29 A;  3UIF A;  5CBS A;  1MPC A;  5L9O A;  2V3Q A;  3SDF A;  2I6E A;  3MWB A;  3MQ9 A;  2PMS A;  3C36 A;  4Q0C A;  5KZT A;  2UVG A;  4NMY A;  2OWS A;  3C35 A;  3C31 A;  4EXL A;  4H65 A;  1SBP A;  3SET A;  2PT2 A;  3E3K A;  5H8F A;  4XKR A;  2XXV A;  3MZ1 A;  5JTY B;  2Q8J A;  1YCJ A;  3VFJ A;  5HBC A;  5CC2 A;  3FV2 A;  3F11 A;  4OHN A;  4G68 C;  2P1S A;  1UTB A;  3G7W A;  1CB6 A;  4GOT A;  3HV1 A;  3FV1 A;  3HST A;  1QUK A;  3H7M A;  2ZNS A;  1SW1 A;  4HCY A;  3PUX E;  2OZZ A;  1J1N A;  2GHA A;  1LST A;  1F9B A;  2QJE A;  4YMA A;  4KD5 A;  1ZLQ A;  3UGW A;  3QUF A;  2CZL A;  3T9H B;  4NWC A;  3FVG A;  1VFE A;  1B5H A;  4ZS9 A;  1B32 A;  1RYX A;  4LQ5 A;  1TFA A;  1IXI A;  4N07 A;  1N3X A;  1XOC A;  4JWX A;  3OO7 A;  2VGQ A;  1PEB A;  1LB9 A;  1B40 A;  1FQF A;  2I3V A;  5A5X A;  4NTL A;  3DLN A;  4F3P A;  4C1T A;  4UAC A;  2DVC A;  5ELV A;  4R74 A;  3OEN A;  2IA4 A;  4G77 A;  3W15 C;  1NH7 A;  4LVQ A;  1DPE A;  3T9X B;  3FAT A;  4DZ1 A;  5DVJ A;  2G93 A;  4LZ8 A;  2DWA A;  1M5F A;  2NOO A;  4DCX A;  1VFD A;  3LSX A;  3FJM A;  5I58 A;  3VVF A;  1GV8 A;  3IOV A;  3U94 A;  2THI A;  4F18 A;  2XXX A;  4JSD A;  3OXN A;  2H5Y A;  2XXI A;  3L6G A;  5AA4 A;  1P1W A;  4Q30 B;  4P0G A;  3FVN A;  1YPN A;  5K2X A;  4NED A;  5KCJ B;  1YTV A;  1N3W A;  2PVU A;  3VVE A;  4QF9 A;  3RNN A;  1QUI A;  4OEV A;  2HQ0 A;  5HPQ A;  1FTK A;  5DT6 A;  5TPA B;  2RC8 A;  1IEJ A;  2ANJ A;  5I2N A;  1MH3 A;  4DXU A;  1LB8 A;  5ITO A;  4Q5T A;  4AQ4 A;  4BDM A;  4YB7 A;  1VR5 A;  5K2Y A;  4ZE8 A;  4PET A;  3MP6 A;  5H8H B;  1FQB A;  2I4C A;  1A99 A;  4LON B;  5EHS A;  1MXV A;  3PUZ E;  1L5T A;  2I0B A;  1GVC A;  3QK6 A;  1JW5 A;  1US4 A;  2PT1 A;  2YLN A;  2VHA A;  3TUS A;  3A3U A;  1B6H A;  3B6Q A;  4I9D A;  5I56 A;  2YPN A;  2O7U A;  5F7V A;  4PFW A;  5DEX B;  3TEL A;  2I58 A;  3H06 B;  3H3G A;  4BDR A;  1MY3 A;  1Z7M E;  2HXW A;  1H44 A;  4ELP A;  3B6W A;  2R9J A;  3BFU A;  4OQO A;  1SW5 A;  4ZEF A;  2QS2 A;  3N6T A;  1MS7 A;  4RPN A;  3IJO B;  3JZJ A;  3HO7 A;  1ZKB A;  1JEU A;  3K01 A;  3FZV A;  4OVJ A;  2Y7R A;  3O2A A;  4TOZ A;  3PPN A;  4X9T A;  2F97 A;  4EXK A;  3E13 X;  5L9S A;  4QFO A;  1IQ7 A;  1WDN A;  4IGR A;  2XXT A;  4TLL B;  3ZSF A;  1SVX B;  3ILT B;  3THI A;  2A5T A;  3TTL A;  4NF6 B;  4POW A;  4LZ7 A;  3IK6 B;  4QRZ A;  1US5 A;  2F7C A;  4ELO A;  4IB2 A;  1SI0 A;  3RY3 A;  5AA3 A;  2XHD A;  3ILU B;  2Y7I A;  3U93 A;  4THI A;  2NXO A;  2Y7P A;  1CE2 A;  1D9Y A;  1EZO A;  3QSL A;  4I1D A;  2CMO A;  3U92 A;  3BKI B;  4H5F A;  1MM7 A;  2VD3 A;  2REG A;  3VXC A;  3H6V A;  1MY2 A;  3G3H A;  1MG1 A;  1UIU A;  5DVI A;  1FW0 A;  1P1Q A;  2HCA A;  3IO6 A;  5FTI A;  3T66 A;  1MQH A;  2Q9T A;  4GD5 A;  2H9B A;  3IOU A;  4FEC A;  4FOR A;  3BBR A;  4QFL A;  4F3S A;  3K1P A;  5HM4 B;  3MPK A;  4RPO A;  1PDA A;  3JYR A;  5CM6 A;  1BKA A;  3TCH A;  4RNS A;  1B1H A;  4NE4 A;  3CG1 A;  3LSF B;  2QL3 A;  3T22 A;  2PX1 A;  3MZ9 A;  1JQF A;  1URG A;  2DYX A;  2VOZ A;  3CVG A;  4XTC Q;  1FTJ A;  1SDX A;  4FAJ A;  4GQO A;  4I62 A;  4ZDM A;  3G3I A;  3TCG A;  2AL4 A;  4ELQ A;  4NWD A;  1SI1 A;  4LAT A;  4Q8R A;  4U23 A;  1JVX A;  1B4H A;  3CR9 A;  4FEB A;  4XKN A;  1NKX A;  3V89 B;  4UA8 A;  3OD7 A;  2E0S A;  4R2F A;  3GBA A;  3G3G A;  5CMK A;  3ECR A;  4F1U A;  3FAS A;  3OEL A;  1MQI A;  3RTF B;  2A5S A;  2ONK E;  1PC3 A;  3N26 A;  5CMB A;  3D4C A;  1JVY A;  3VE1 B;  5ICT A;  3Q27 A;  5JTY A;  1ZMG A;  2VP1 A;  3TCF A;  1AMF A;  1BP5 A;  4JXI A;  5AA2 D;  4MFI A;  3SES A;  3TTN A;  3SEW A;  5EHM A;  2P0S A;  4O3C A;  4DCY A;  4PQJ A;  3T9V A;  3MW0 A;  4E0W A;  4ZZE A;  3PUV E;  3K6W A;  4H6D A;  1GGG A;  2ALU A;  2B3B A;  4F2Q A;  1B0H A;  4H8I A;  1FTL A;  3BFT A;  1LFG A;  3K0V A;  2FYI A;  3KN7 A;  3MZB A;  1GR2 A;  1LAX A;  4KYD A;  3C9H A;  3MAM A;  2RC7 A;  1NL5 A;  1IIT A;  1SW2 A;  2OWT A;  3TFL A;  3QXM A;  4KYE A;  2DS9 A;  1OLA A;  1Y1Z A;  3ODB A;  3LBS A;  3SKP A;  2AYS A;  5CI5 A;  5H8Q B;  3K00 A;  3KN8 A;  4HS7 A;  3RUM A;  3UK4 A;  3HHG A;  1DSN A;  1EH3 A;  2HFB A;  1VE4 A;  1VSO A;  3S4U A;  5CMC A;  3IJX B;  3MBP A;  3JV9 A;  3KSJ A;  4M4G A;  3SER A;  2Y7K A;  4G8M A;  2F35 A;  4JBZ A;  4H1X A;  3VLW A;  2I3W A;  1IXG A;  4K3F A;  4BDO A;  5J1D A;  3SEV A;  1GTK A;  3SEY A;  4R6K A;  3H6W A;  1B7H A;  2E1S A;  1WVJ A;  3OO9 A;  2QS3 A;  5FHN A;  2DSF A;  3OO6 A;  3H6T A;  5DVF A;  1S7Y A;  3GBB A;  4MF3 A;  4AB6 A;  3SEX A;  3I5O A;  1I6Q A;  2V3U A;  4QSE A;  1BLF A;  5DTB A;  3KSX A;  4R9F A;  2HEU A;  1B3L A;  2RCB A;  3TEP A;  4ZED A;  3HHF A;  2DE3 A;  1N84 A;  3C32 A;  1OVT A;  3MVW A;  3PD9 A;  4R73 A;  2X7P A;  1LAH E;  2XX9 A;  3TDJ A;  5JEI A;  3B7D A;  4QFK A;  1Q35 A;  4G8N A;  3EQ1 A;  4OFJ A;  4EQ7 A;  2GRV A;  3DEL B;  3ONM A;  4YKJ A;  3KZG A;  3GXA A;  3O29 A;  5KCJ A;  5AA2 B;  3TTM A;  2QS4 A;  3FXQ A;  4OEU A;  1QVS A;  4YIC A;  3T9U A;  1XS5 A;  1M5E A;  5TPA A;  3MP1 A;  4X1D A;  2RF1 A;  3FGS A;  1MDQ A;  4QSC A;  2XXQ A;  4BDN A;  4RK2 A;  5DYH A;  3G3F A;  2UVJ A;  1LFH A;  1SW4 A;  4IY5 A;  4U4X A;  1MY4 A;  1FQA A;  2XXR A;  1MDP 1;  2Q89 A;  5H8H A;  4GWO A;  1XHY A;  4F29 A;  3IB2 A;  3K1N A;  3WAE A;  4RJZ A;  1MQD A;  4YU0 A;  3V83 A;  2O84 X;  4HCW A;  3RN8 A;  2F6P A;  4BDL A;  5FHM A;  2QPQ A;  3LSW A;  1O64 A;  1NFT A;  1Y4T A;  3T96 B;  2V93 A;  4RYA A;  5AA1 A;  2P2A A;  5DEX A;  3RT8 A;  4OWD A;  4F39 A;  4FIM A;  4YZZ A;  4OER A;  3OSQ A;  3P7I A;  1A40 A;  4O3A A;  4PFU A;  4F1Y A;  1ZU0 A;  3DM0 A;  5I57 B;  3KOS A;  2DXR A;  1MXU A;  3I6V A;  1T0K A;  3A3C A;  3G3K A;  3OOA A;  3AXF A;  2OCU A;  3QAX A;  3PPQ A;  1MRP A;  1MY1 A;  3IL1 B;  1IXH A;  1IIW A;  1EZ9 A;  1JW1 A;  1N7X A;  2B3F A;  1B7U A;  2I4B A;  4NF6 A;  3KGC A;  3OSR A;  2F78 A;  3FVO A;  3TOD A;  1AL3 A;  2XD3 A;  3EHS A;  1B5I A;  4XXU A;  3S9E A;  4OFO A;  2NWJ A;  3PV0 E;  4JWO A;  3MVZ A;  1Y1M A;  2O51 A;  3TQW A;  3N6U A;  1PB7 A;  2XX8 A;  4BDQ A;  1URD A;  3IX1 A;  2OBG A;  1MM6 A;  4FED A;  4NF8 B;  1NNP A;  1HSJ A;  4X1B A;  3EHU A;  5FTH A;  1A7L A;  3OEK A;  3L6H A;  4JB7 A;  3H4Z A;  4FAT A;  3K02 A;  3TTK A;  4NF4 B;  2UYF A;  3LSL A;  2HZK A;  2X26 A;  1LCT A;  3FXU A;  2DWJ A;  2I49 A;  4IY6 A;  3G3J A;  1USY E;  5KDT B;  1ZTY A;  4R75 A;  2V25 A;  4GXA A;  1QJM A;  1I69 A;  4IO2 A;  2O7I A;  3GZG A;  4QFP A;  4U1Z A;  3MC2 A;  2QMW A;  1Z7N E;  4EQ9 A;  2XXY A;  3S9L C;  2H4I A;  1TXF A;  4Z7E A;  4IO6 A;  4YMB A;  3PGF A;  3O66 A;  2ZYK A;  2HAV A;  3E4R A;  4GVO A;  1Y3Q A;  4NF5 B;  4GL0 A;  3KG2 A;  3LUY A;  1LAG E;  2DWH A;  3TPA A;  4H0W A;  3PMX A;  4E0X A;  1LFI A;  4MBP A;  1AIV A;  3MVY A;  3PPO A;  5L9M A;  2RC9 A;  3O6G A;  2XXU A;  1Y3P A;  1XC1 A;  1LLS A;  1B58 A;  2VD2 A;  4G8H A;  4OXV A;  1Y4C A;  1URS A;  4EDP A;  1IZ1 A;  1NH8 A;  4C1U A;  3LC8 A;  1UQW A;  2UYE A;  2Y7W A;  4PE5 B;  1MPD A;  3DP8 A;  2ZNU A;  4F31 B;  1FTM A;  4EUO A;  1TFD A;  3M8U A;  2F36 A;  1LBB A;  1B5J A;  4LA9 A;  1B3F A;  5CRY A;  4GIZ A;  4DDD A;  2O6A A;  2F7B A;  3K6V A;  3FJG A;  1B1X A;  4R6Y A;  2I48 A;  3RLF E;  1P1U A;  2DWI A;  2F8D A;  4C0R A;  2DVZ A;  2G29 A;  1JNF A;  1HSE A;  1UTH B;  3RTW B;  3UOR A;  1SYH A;  1ANF A;  3MP8 A;  3TAJ A;  5BUU A;  3UN6 A;  4L17 A;  4IO4 A;  2O68 A;  3MJN A;  4GFR A;  2UVI A;  4QFN A;  2QS1 A;  2Q2A A;  3DP4 A;  3CFL A;  4BLA A;  5ICQ A;  1A8E A;  4ECF A;  2NUV A;  4KFQ A;  5H8Q A;  4OYV A;  3QYT A;  3S2V A;  4WXJ A;  4PP0 A;  1B0L A;  1P1O A;  5L8D A;  3UP9 A;  4KCC A;  2R71 A;  5H8S A;  2BJJ X;  3KEI A;  3O97 A;  4XKQ A;  3HCQ A;  3PPP A;  4F19 A;  4XIG Q;  1WOD A;  1EZP A;  3K1M A;  5M2V A;  1ATG A;  1ELJ A;  3Q25 A;  4YKI A;  4LUB A;  4GLI A;  1HSL A;  3R7X A;  4KQP A;  4ZZA A;  3KFM A;  2LAO A;  4ELR A;  2FNC A;  2H99 A;  3CIJ A;  1MY0 A;  3C33 A;  5I2K B;  2ONR A;  4TLM B;  4WED A;  4GF8 A;  4OTE A;  4F1V A;  1DOT A;  1KWH A;  4MH5 A;  1P99 A;  1YAE A;  4DIG A;  3MPL A;  1DMB A;  3HN0 A;  2F34 A;  1OQH A;  1ZBM A;  4N6P A;  3ZKL A;  1OLC A;  3MUQ A;  1USY H;  3QIM A;  3GLB A;  3O6H A;  3W9V A;  3M3F A;  3CFX A;  4IO5 A;  4JWY A;  1PB8 A;  5EYF A;  5AA2 A;  1MQG A;  4U4S A;  1BIY A;  1NMU A;  2OK2 A;  5JK4 A;  1MXZ A;  2F5X A;  4OFL A;  1MXW A;  1M5C A;  3PPR A;  2H98 A;  2RIN A;  4KYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...