2OK2A

Muts c-terminal domain fused to maltose binding protein
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
402
structure length
402
Chain Sequence
MIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTHMEETSPAVEALENLDPDSLTPRQALEWIYRLKSLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Escherichia coli MutS Tetramerization Domain Structure Reveals That Stable Dimers but Not Tetramers Are Essential for DNA Mismatch Repair in Vivo.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Sugar binding protein
molecule keywords Maltose-binding periplasmic protein, DNA mismatch repair pro
total genus 132
structure length 402
sequence length 402
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2ok2A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2ok2A01
3JV9A 3OD7A 2O1LA 4NWCA 3M3LA 3G3IA 4RA1A 1SW1A 2YLNA 3HPIA 3LSLA 2M8CA 1O64A 3D4CA 3KSJA 3O6IA 4ELOA 1II5A 1LLSA 2WKYA 5BWJA 3C34A 3IAZA 4C1UA 1HSEA 1H44A 3BBRA 3EN3A 4QHQA 1QW0A 1MY1A 1US4A 3BFTA 3TCFA 4UACA 3T93B 5L9OA 4KD5A 4QSDA 1IQ7A 5H8HB 4JSOA 4EXKA 4HS7A 4ESWA 1MXUA 2NOOA 3RT6B 5A5XB 1NNTA 1Q1KA 1N7WA 3TELA 3Q28A 3RTWB 1VFDA 3N5LA 4YICA 3E3KA 1AIVA 3R6UA 3RPWA 3FVGA 3ZS6A 1TWYA 2A5SA 3SEXA 1H45A 2A5TA 2F34A 2KLFA 1B3FA 2GHBA 3IX1A 2D21A 1FCKA 3CG1A 5DVJA 3ONMA 2B65A 4PFUA 4FECA 4H1XA 4YAHX 1PB8A 4F29A 1UTBB 5FHOA 2OLBA 3FXQA 1GV8A 1QJMA 1POTA 1QUIA 1R1NA 3DLNA 5HBCA 1LBBA 4QFPA 1I69A 5TPAA 1LAFE 3M3KA 4IGRA 1MPDA 1LB9A 3GBAA 2IEEA 4F22A 5I56A 5CI5A 1IXIA 3H6VA 1POY1 2VP1A 4TLLB 3TODA 5AA2D 4OTEA 2F35A 1Y20A 5I59B 1EZPA 4RXLA 1BKAA 2V3QA 4LQ5A 1IZ1A 3TTKA 3U94A 5ITPA 4EF2A 1ANFA 1TFDA 2OK2A 3KOSA 4IO7A 3QYTA 4XKPA 5JTYA 4RPOA 3Q26A 4ZZEA 1LAXA 4YMAA 1PBPA 3VE1B 1DPPA 5ISUA 2OCUA 4YMBA 1UIVA 1I6AA 2F7BA 1MH3A 3GBBA 2PVUA 2I6EA 5AA4B 4WKMA 4G68B 4FIMA 1YPNA 3IO6A 1MY0A 3CIJA 1JW4A 2ESNA 4HW8A 2XXTA 3TFLA 4ZEKA 4IB2A 4BDRA 2E1SA 3KZGA 3CSGA 3O9PA 1ZLQA 5KCJB 1B5JA 3IOWA 1SQYA 1P99A 1USYE 2ABHA 2OWSA 4OERA 3D4GA 2QJEA 3OEMA 1H3DA 1FTMA 2W7YA 3HCQA 2H98A 2HZKA 3K02A 3IB1A 2GH9A 1XC1A 3LSFB 3Q25A 3DP6A 1MXVA 3CFXA 4LVQA 4XTCQ 3KEIA 3E13X 3SKPA 1MM6A 4QFOA 4N13A 4XKRA 2AIXA 1J1NA 2PMSA 3FJGA 2YPNA 3V83A 2CZLA 3LR1A 4IO5A 4RNSA 5I2NA 1A99A 1NNPA 2BJJX 1N84A 2ZNUA 3H6WA 2QMWA 4FJPA 2PBWA 4IY5A 4POWA 4OQOA 4X48A 3WAEA 4ECFA 4FAJA 3TUSA 5TU0A 4RY1A 3HHFA 4OWDA 1PB9A 1Z7NE 2FA7A 2PT1A 2RCAA 3G3GA 2D5WA 4PE5B 3T9UA 3BKIB 2DE2A 4G8HA 1TFAA 2XX9A 1NKXA 1M5FA 1B5IA 5B7DA 4LZ7A 2Z22A 3VVEA 4NF8B 2I49A 4F19A 2GHAA 2V93A 3A09A 3AXFA 3FV2A 3K0VA 3K6VA 4IO6A 2YJPA 3EHSA 1WDNA 3DELB 3TAJA 3MJNA 1S50A 1FQEA 1XVXA 2O1MA 1B40A 2XXQA 4RPNA 1LFIA 2Y7WA 4YB7A 4NTLA 4F3PA 4BDOA 4EQ9A 3U1OA 3RN8A 3IOUA 4GXAA 1B3HA 3ODBA 4RK9A 4YKPA 5TPAB 1USYH 3VLWA 3DM0A 4DXBA 4K3FA 1MXZA 1A55A 1B6HA 4GWOA 4OFJA 3VLUA 1I6BA 2ONRA 5ICQA 2V3UA 4I9DA 5L9SA 3LSXA 4I1DA 3H7MA 1P1WA 4U4XA 1A8EA 1URDA 2XX7A 4R73A 4FATA 4H5GA 5DTBA 3A3CA 2VOZA 3IORA 3PPPA 4JWYA 1BTJA 3H03A 1TXFA 1MQJA 1N3XA 3PUWE 5IKBA 5CMKA 3OMBA 4EDPA 4O3BA 4F1UA 3ILUB 1RYXA 3FUZA 2R71A 4KR5A 3RTFB 4EUOA 5KZTA 2XXXA 1YAEA 1ZIUA 5CM6A 1AMFA 5H8SA 2QS1A 1SDXA 1B3GA 5I58A 1LFHA 2XD2A 1D4NA 3CSBA 4G8NA 4GL8A 4H0WA 1OLAA 2ZNSA 4NF6B 4DCXA 5H8QB 4Z7EA 5H8FB 4ZEIA 5TP9A 3PGFA 4EQ7A 1D9VA 2VGQA 4WEPA 5JEIA 4F18A 4YZZA 3RT8A 2XXYA 3KJ7A 1QKAA 4JBZA 2F7AA 4LATA 1JVXA 4QRZA 1FQAA 4YKKA 1MG1A 3UK4A 2G29A 4ZECA 2OWTA 1XVYA 1B7HA 3K6XA 2UVJA 2ZYMA 4ZEFA 1XT8A 4F1YA 3G7WA 2I3WA 1GTKA 4X1DA 2P2AA 3K6WA 3VV5A 2GFEA 1N04A 2I0CA 1BP5A 4HCWA 1PDAA 1LB8A 5AA1A 4OFOA 3USDA 3S2VA 3KJTA 3TTNA 2DVZA 4IY6A 1LGBC 1NH8A 1B9JA 1LAGE 4XKNA 2RCBA 5IAIA 1UTHA 3U92A 2DWIA 4ONYA 3CI8A 2V3TA 1XOCA 2OJTA 1JW5A 2DWAA 2F97A 1B7ZA 1N0TA 2QSXA 1FQDA 3TEPA 4MH5A 1MXWA 1GR2A 4OMBA 3O29A 4LZ8A 1MXXA 3TPAA 1N3WA 1JW1A 1EZOA 3H3GA 4QFNA 4JDFA 1LCTA 4UA8A 4DZ1A 2H9BA 4OZ9A 3PUZE 5DEXA 4C0RA 2ONKE 2AYSA 4R6YA 3MZ1A 2RC7A 3SERA 3KN8A 3IL1B 3KSXA 3KBRA 4IO2A 3UORA 4GLIA 5I2KA 3GXAA 1VSOA 3O6HA 5KCJA 5FHMA 2Y7PA 4ZS9A 2Q2AA 1Y3QA 4M4GA 3VDFA 2DQVA 4ZDMA 4NF5A 4NF6A 2THIA 1ZTYA 5I57B 1OMPA 5ITOA 1B0LA 3IOVA 1MQHA 3MC2A 4BDNA 4R74A 1PC3A 3T66A 5KDTB 2PYYA 2QS4A 3RUMA 4JB7A 3VFJA 1MM7A 3CRBA 3O66A 3PMWA 3QUJA 1EH3A 1FTLA 3PPQA 4ZEDA 1L5TA 3U93A 2ZNTA 1SW5A 3MVWA 3SESA 3TQWA 4BDLA 5AA3A 5JTYB 4RYAA 1ATGA 4Q30B 5AA2B 4Q0CA 1A8FA 4KYSA 4PQJA 4XIGQ 3C36A 3FD3A 2QS3A 3SEYA 4F3BA 1Y3NA 1FTJA 2VD3A 4XKQA 1SI1A 4ZE9A 3EQ1A 1WODA 1XS5A 1UTHB 3FXUA 4BLAA 4TLMB 3SDFA 2ALUA 3FJMA 1Y4TA 3H6TA 4AB6A 3ILTB 1EU8A 4PFTA 3LBSA 5CC2A 1XHYA 1D9YA 3MAMA 2XD3A 1OIBA 3CG3A 3CVGA 4KQPA 3TTRA 3K4UA 1CE2A 3N26A 3SEUA 4EF1A 1PBQA 4H5FA 4MBPA 5F1QA 4F39A 1N76A 1KWHA 3FVKA 3V8XB 4ZEBA 1B0HA 1DPEA 4X1BA 4OXVA 3RGYA 1IIWA 2UXAA 3IR1A 1MRPA 3C33A 3Q27A 3V89B 4R72A 3TDJA 1H76A 4P11A 3HSTA 1Y1ZA 3W15C 1SW2A 3LUYA 3Q29A 4JXIA 2DWJA 5DVIA 3WAFA 3VVFA 4ZE8A 3T9HB 4H65A 4DCYA 4ELQA 3S9MC 1JEUA 4R9GA 1M5BA 2H5YA 1AH5A 3MP6A 4OYVA 1D3KA 1NL5A 4H6DA 4LONB 1MDP1 1P1OA 2I3VA 2QRYA 4Q5TA 5LOMA 1QULA 5FTIA 5H8FA 3OO8A 1URGA 2RKMA 5BUUA 4KYEA 5DT6A 5L8DA 4KCCA 4IO3A 1ZBMA 3B6QA 1LAHE 1NFTA 5CMCA 3QIMA 3TQLA 5I2NB 2ZMBA 2PX1A 2XXHA 2XX8A 3E9XA 4O3CA 4PFYA 3O2AA 3PU5A 2HAVA 4G68A 2XHDA 3QK6A 3I5OA 3RLFE 3KFMA 2H99A 5J1DA 3OO9A 1OVTA 1SW4A 3OO6A 4OENA 2Y7KA 2NUVA 4BDMA 1M5DA 4GFRA 1JEVA 3L6HA 3QAXA 1H43A 5CBRA 3N94A 1O63A 4LUBA 5CMMA 1FW0A 1A7LA 2O68A 1MDQA 1LCFA 3P7IA 5FTHA 1OLCA 3KOTA 4GL0A 1QKBA 2V25A 3O97A 3H6UA 4KPTA 3S9NC 2DE4A 3A3UA 4ELPA 2REJA 3I3VA 2QL3A 3M8UA 4OFLA 3PUYE 1UQWA 1AL3A 1AOVA 3PUVE 2XXPA 4O3AA 1LSTA 1VE4A 3FVNA 3M3FA 1UTBA 4PFWA 1B51A 4U1ZA 2NVUB 1B1HA 1HSLA 1SI0A 2UVHA 3OEKA 4KI0E 1Y9UA 3LSWA 2P1SA 3GLBA 3LC8A 4LZ5A 2ZYKA 2A5TB 2FNCA 2F6PA 3K00A 3ZKLA 4AQ4A 4F1VA 4KFQA 4P0GA 3UN6A 3MPKA 2AL4A 1Y1MA 4P0IA 2AL5A 3B6WA 1BIYA 4JSDA 3OOAA 1I6QA 4GD5A 5H8HA 2O6AA 1MXYA 2RINA 3MW0A 3MBPA 3T22A 3OXNA 3TZAA 4EXLA 4G8MA 4H8JA 4GVOA 2F8DA 4R2FA 1FQFA 2OBGA 2PT2A 4F2QA 1ZMGA 2IA4A 1JVYA 4THIA 1P1QA 4FEDA 1B2HA 4QFLA 5DYHA 5JK4A 3JYRA 3PMVA 3W9VA 1IEJA 4OESA 4R9FA 2LAOA 2ZYOA 1Z7ME 1BLFA 3V5AA 1B05A 4JWXA 3MVZA 4U2RA 2DP8A 1B46A 3T96B 3VLVA 1MY2A 3S9LC 4RK2A 3TCGA 4AB5A 4DXUA 4Z0IA 2B3FA 4FE8A 4U23A 3MZ9A 5DEXB 3K6UA 2DOJA 4F3GA 2F36A 1VFEA 3FV1A 2QPQA 3DP8A 3EF7A 3K1PA 1OQGA 3K01A 1QUKA 2FYIA 3ZSFA 1GGGA 4ND9A 3MPLA 3MVXA 2DS9A 2HZLA 2HEUA 2R9JA 4NWDA 4YB6A 4DE8A 4F2OA 5CMBA 1P1NA 4OETA 3RY3A 1B7UA 1MH4A 5AA4A 2I0BA 3FASA 2R6GE 3JZJA 4F31B 1ZKBA 2CMOA 2NWJA 4R6HA 1PB7A 5FHNA 2Z23A 3EHUA 3HO7A 4MF3A 4OHNA 3RQTA 1B32A 3THIA 4QSCA 3S9EA 3FXRA 3T9VA 4XXUA 1DTGA 1IXCA 5I59A 5ICTA 2F7CA 2XXUA 4YKJA 4FORA 1N7XA 4HTGA 3CR9A 3T9XB 3ZKKA 3VVDA 1S9TA 1HSJA 1ZU0A 1B3EA 1B5HA 2HXWA 2X7QA 3QSLA 5I56B 4MLQA 3B7DA 5EYFA 1T0KA 4R6KA 4NEDA 1B3LA 3MQ9A 3SEVA 1EZ9A 4ISUA 1RYOA 3PUXE 4TQUQ 5KDTA 4DDDA 3UGWA 2Z8DA 2DXYA 3N6UA 3IJXB 2F5XA 2F78A 4G2ZA 2HAUA 1B1XA 1US5A 2HQ0A 2I48A 3FJ7A 4OEUA 5CRYA 2I58A 2Q88A 1MS7A 3IB2A 4IO4A 3TCHA 3PPRA 5I57A 2ONSA 4YKIA 4N07A 3RNNA 1SBPA 1QUJA 3FGSA 3IK6B 2O7IA 1NMUA 1MQDA 2VD2A 4NF4A 2DVCA 4LP2B 5I58B 1Y3PA 1DSNA 1S7YA 3KN7A 3SEWA 1DOTA 2B3BA 3BFUA 3EPEA 1URSA 4U21A 2V84A 4QSEA 5A5XA 1MY3A 1UIUA 3KG2A 3MP8A 4GOTA 4LQ2A 4G68C 3H06B 3MZBA 4E0XA 3EHTA 1F9BA 4NF4B 3ECRA 1MY4A 3OO7A 4R75A 3G3KA 2Q9TA 5HPQA 3TMGA 1YTVA 3SETA 1GVCA 5I84A 5B70A 2X26A 1R9QA 3K1MA 4N6PA 3PD9A 1FQBA 2UVGA 1FTKA 4ESXA 1DMBA 3MWBA 3UIFA 2VHAA 1VR5A 4MLVA 3K1NA 2F6GA 1A40A 2O51A 4PP0A 3DP4A 3KGCA 3C4MA 3FVOA 3O6GA 1LFGA 2Q8JA 2Z8EA 1M5CA 2DSFA 3S4UA 2E0SA 3N6TA 4OVJA 1B4HA 2P0SA 4X9TA 3IO4A 4QF9A 4BDQA 3F11A 4FEBA 4GXSB 2UVIA 2RC9A 5L9MA 2D3IA 1SD3A 2DXRA 2Q89A 4U22A 2O69A 3HHGA 4JWOA 5AE4A 1NNKA 2QS2A 5HM4B 4GQOA 2I4BA 4H67A 4MFIA 3FZVA 4G4PA 1LBCA 3PPNA 4HCYA 4I8CA 5ELVA 3W9WA 3KN3A 1JQFA 2ANJA 3G3JA 4R2BA 3VXBA 1B52A 1PEBA 3TTMA 1NNFA 1SYIA 3CFZA 3H4ZA 4WEDA 5I2KB 4LA9A 5M2VA 5TP9B 3OELA 1OQHA 2XXRA 3PMXA 1DTZA 3HN0A 4TOZA 5EHMA 2H4IA 3IJOB 3GZGA 4YB5A 2DE3A 2GRVA 4DLDA 3OSRA 3O28A 5AA2A 5CBSA 2Z8FA 4DXCA 4Q8RA 4GIZA 1SYHA 3C35A 2G93A 2RC8A 1M5EA 5K2XA 1R9LA 3TKDA 4GF8A 3PV0E 3PD8A 5H8NA 4U4SA 1A54A 4U1OA 2REGA 3C32A 5H8QA 3C9HA 4YU0A 4NF5B 1TT1A 3QXMA 1B58A 1MPCA 1O7TA 2OZZA 2DWHA 1QVSA 2X7PA 2UYEA 4IGTA 4KHZE 4L17A 1IXHA 3G3HA 4I62A 4NE4A 4OEVA 5H8NB 5F7VA 1FQCA 4DIGA 1FTOA 2DYXA 2HCAA 3CFLA 3TTLA 1RKMA 4C1TA 4POXA 1CB6A 2ZXTA 3R7XA 2UYFA 1R6ZA 2Y7RA 5DVFA 3IB0A 3MUQA 3OSQA 1SVXB 1Q35A 3UA8A 2H25A 1B4ZA 4M1VA 3PPOA 1MQGA 2Y7IA 2XXIA 3MP1A 1ZJLA 3B6TA 2HFBA 1Y4CA 1IITA 4H8IA 3R26A 4WXJA 2XXVA 4PETA 2O84X 4EQBA 2I4CA 4ZZAA 3IOTA 3L6GA 2Q2CA 1IXGA 1P1UA 4QFKA 1OVBA 4KYDA 2RF1A 3I6VA 4G77A 2XXWA 2O7UA 3FATA 3QUFA 2NXOA 3K2DA 4NMYA 4F3SA 3HV1A 3UP9A 3FIRA 2Y84A 3U8QA 1ELJA 3U72A 3C31A 1JETA 1WVJA 1MQIA 2QMXA 2ZYNA 1JNFA 3E4RA 3G3FA 4KCDA 4E0WA 3MVYA 5K2YA 1YCJA 3OENA 3TYHA 1NH7A 4GRKA 4NF8A 1MPBA 3VXCA 5EHSA 4RJZA 4ELRA 1IUDA
chains in the Genus database with same CATH superfamily
3G3IA 2QVUA 2M8CA 3B50A 3O6IA 1LLSA 2WEFA 2WKYA 4C1UA 4QHQA 1QW0A 1US4A 4UACA 1FPDA 4KD5A 1IQ7A 5A5XB 2NOOA 1N7WA 1AIVA 1VFDA 5EQAA 1H45A 2A5TA 2QVRA 4F29A 3ONMA 4DI4B 4PFUA 1UTBB 1R1NA 5HBCA 1I69A 1LAFE 3M3KA 1MPDA 4F22A 4OTEA 4LQ5A 3U94A 3TTKA 4IO7A 4RPOA 4ZZEA 1SPIA 2PVUA 1FPKA 4NG7A 4G68B 3KBZA 5A5LA 1MY0A 2ESNA 2XXTA 3TFLA 3KZGA 4I40A 3O9PA 2PFZA 1P99A 3V89B 4YB5A 4PAIA 4LVQA 3SKPA 1MXVA 4QFOA 3KC1A 1J1NA 3LR1A 4O7IA 1NNPA 2ZNUA 1N84A 2PBWA 4X48A 2HHMA 3HHFA 1FPBA 1Z7NE 3G3GA 4PE5B 3T9UA 1TFAA 2V93A 3K6VA 2YJPA 1WDNA 2BJIA 3TAJA 3MJNA 1XVXA 2XXQA 3S9EA 1LFIA 4BDOA 4EQ9A 4GXAA 1B3HA 3VLWA 4K3FA 1IMEA 3H7MA 4U4XA 2XX7A 4H5GA 5DTBA 2VOZA 1XI6A 1G0HA 3IORA 3PPPA 5IKBA 4MAGA 4X8RA 4F1UA 1RYXA 3FUZA 5KZTA 2ZNSA 5H8QB 5I3SA 1D9VA 2VGQA 4WEPA 4YZZA 1JP4A 4LATA 1MG1A 2VPNA 4ZEFA 1GTKA 1DBZA 2I0CA 1N04A 2B4MA 4OFOA 3E79A 3S2VA 1B9JA 4ONYA 3CI8A 2V3TA 2F97A 1FQDA 3TEPA 1MXWA 5ET6A 2JJKA 4QFNA 4DZ1A 5DEXA 2ONKE 2AYSA 3UORA 3KN8A 2GQ1A 4GLIA 3GXAA 1VSOA 3O6HA 4N8YA 5FHMA 2Q2AA 4M4GA 3MC2A 5KDTB 2QS4A 1IMBA 3O66A 3QUJA 4ZEDA 1L5TA 3U93A 4RYAA 1G0IA 1A8FA 3SEYA 1QGXA 2FHYA 1SI1A 5ESYA 3FJMA 1Y4TA 3HFUA 2PCRA 3CG3A 1OIBA 4H5FA 1N76A 1KWHA 3FVKA 1B0HA 3RGYA 2UXAA 4R72A 3TDJA 1H76A 3HSTA 3Q29A 3WAFA 3VVFA 4ZE8A 3T9HB 4ELQA 4R9GA 1M5BA 1AH5A 3MP6A 1D3KA 4H6DA 2I3VA 2QRYA 4MNIA 4PF8A 5H8FA 2FIXA 5BUUA 1URGA 4IR8A 5L8DA 3D1RA 3U65A 4O3CA 2XHDA 3L6HA 3QAXA 4MNCA 3N94A 1MDQA 5J16A 1OLCA 1QKBA 4KPTA 3H6UA 2DE4A 3RPLA 4ELPA 4OFLA 3M3FA 1HSLA 3OEKA 2P1SA 2ZYKA 2A5TB 3ZKLA 2F6PA 4AQ4A 3UN6A 3MPKA 5EYGA 2AL5A 3B6WA 3TZAA 3MW0A 4G8MA 4GVOA 1FQFA 1ZMGA 1IEJA 1Z7ME 1BLFA 3V5AA 1B05A 3VLVA 4PCDA 1MY2A 3S9LC 4AB5A 3MZ9A 3K6UA 4F3GA 2F36A 3K01A 1QUKA 3MPLA 2DS9A 5AA4A 2I0BA 4F31B 2R6GE 3JZJA 1ZKBA 1PB7A 2Z23A 4MF3A 3HO7A 1B32A 4FORA 4N8GA 3ZKKA 3VVDA 4NQ8A 1B3EA 1CNQA 5EYFA 3PTYA 4NEDA 3SEVA 3MQ9A 4ISUA 3PUXE 4TQUQ 5KDTA 3UGWA 5CRYA 1B1XA 3TCHA 2Q88A 3PPRA 1IMFA 3RNNA 4N07A 3FGSA 3KN7A 1DOTA 3BFUA 4U21A 2V84A 1MY3A 5IZZA 1NV1A 4NF4B 4R75A 5I84A 2Y5KA 1R9QA 4PGNA 2UVGA 1DMBA 3MWBA 2VHAA 3SDFA 3C4MA 3KGCA 3N6TA 4FEBA 4GXSB 2RC9A 5L9MA 2Q89A 4JWOA 2QS2A 4HCYA 4R2BA 3CFZA 1DTZA 5EHMA 3IJOB 2DE3A 3OSRA 3O28A 2Z8FA 4DXCA 5K2XA 3TKDA 4GF8A 1A54A 3C9HA 4NF5B 1TT1A 3ISPA 5IZ3A 4XIGQ 2DWHA 4L17A 2UYEA 2HCAA 4POXA 3R7XA 2UYFA 3MUQA 1EYKA 4M1VA 2HFBA 2O84X 2I4CA 4ZZAA 3IFCA 2O7UA 3QUFA 3K2DA 4NMYA 4F3SA 3HV1A 2Y84A 3U72A 1WVJA 2QMXA 1JNFA 4GRKA 4ELRA 1IUDA 4NWCA 4OANA 5EYHA 2YLNA 3D4CA 1H44A 3EN3A 1NUYA 4QSDA 4PFBA 4JSOA 4HS7A 4ESWA 3RT6B 3BIGA 3Q28A 3RTWB 4YICA 3E3KA 3RPWA 3FVGA 1TWYA 5I59A 3IX1A 2D21A 3CG1A 2OLBA 3FXQA 1QJMA 1POTA 4QFPA 4GWUA 4IGRA 2IEEA 4MX6A 5I56A 2VP1A 4JVDA 5ITPA 2V3QA 1TFDA 3KOSA 2FVZA 4XKPA 2OCUA 4YMBA 1I6AA 1MH3A 1FBDA 2I6EA 4WKMA 4FIMA 3IO6A 3IFAA 4BDRA 3CSGA 3IOWA 2CZKA 2ABHA 2OWSA 3D4GA 2H98A 2HZKA 3K02A 5CBRA 1XC1A 4XTCQ 3CFXA 4F19A 3KEIA 1IMDA 4XKRA 1FBFA 3FJGA 2YPNA 4OVSA 3H6WA 4FJPA 3WAEA 4ECFA 3TUSA 4OWDA 1PB9A 2FA7A 1KZ8A 4G8HA 1NKXA 1M5FA 1B5IA 5B7DA 4NF8B 3AXFA 3FV2A 3K0VA 3ROJA 3DELB 1S50A 1FQEA 2O1MA 4RPNA 4YB7A 3FXBA 1FPLA 3DM0A 4DXBA 1MXZA 4OFJA 1B6HA 3VLUA 2ONRA 4I1DA 1URDA 4FATA 4JWYA 4QBAA 1MQJA 1NV4A 2VT5A 3OMBA 4EDPA 1K9YA 5I58A 2XD2A 1D4NA 1OLAA 3PGFA 4XF5A 2WBDA 2XXYA 3KJ7A 4N91A 1EYIA 4PTKA 4YKKA 1XVYA 3K6XA 2UVJA 1XT8A 4X1DA 3VV5A 4PGPA 4GWWA 1BP5A 5AA1A 2DVZA 4IY6A 1LGBC 5IAIA 2DWIA 5EQ8A 1JW5A 1B7ZA 4LZ8A 1N3WA 4NF0A 1JW1A 4UA8A 2H9BA 4C0RA 4LN5A 4R6YA 2RC7A 3KSXA 3IL1B 2Y7PA 4ZS9A 1Y3QA 3NOHA 5IZ1A 2THIA 1OMPA 5ITOA 1B0LA 1MQHA 4BDNA 1PC3A 3EKIA 1EH3A 3SESA 1ATGA 4HXVA 5AA2B 4Q0CA 4KYSA 4PQJA 1Y3NA 1FTJA 4XKQA 1XS5A 3ILTB 3N26A 4F39A 4MBPA 3V8XB 1MRPA 3FBPA 1Y1ZA 3RYDA 3LUYA 4JXIA 2DWJA 4DCYA 4H65A 5DW8A 4LONB 5FTIA 3OO8A 2RKMA 4KYEA 5DT6A 1IMCA 3B6QA 5I2NB 2XXHA 2XX8A 3E9XA 4PFYA 2CZIA 3I5OA 2H99A 1M5DA 4GFRA 1JEVA 1H43A 4LUBA 4PAFA 4PDHA 2O68A 1NV6A 2CEYA 3O97A 3S9NC 3QMFA 3A3UA 3I3VA 3PUYE 1UQWA 3PUVE 4O3AA 1LSTA 1LBZA 1DCUA 3LSWA 4LZ5A 2FNCA 1FPIA 4F1VA 4KFQA 4P0GA 1Y1MA 1FRPA 1BIYA 3OOAA 5H8HA 2O6AA 2RINA 4P3LA 2F8DA 4PFRA 2IA4A 1B2HA 5DYHA 5JK4A 1Q9DA 4NGUA 4R9FA 2ZYOA 3T96B 5LDZA 4FE8A 5DEXB 2DOJA 2PFYA 4ND9A 2HZLA 4YB6A 2HEUA 1MH4A 2NWJA 3EHUA 3RQTA 4QSCA 3FXRA 5ICTA 2F7CA 2XXUA 4YKJA 1N7XA 4GX4A 3CR9A 2KR0A 2FBPA 2HXWA 2X7QA 5I56B 1NUWA 4R6KA 2Z8DA 4MMPA 3N6UA 3IJXB 4G2ZA 2I48A 4O8MA 3IB2A 5EQ7A 2ZZXA 4HE0A 2ONSA 1QUJA 2L5VA 3IK6B 2O7IA 2VD2A 4NF4A 5I58B 1Y3PA 4MNPA 4GX6A 4QSEA 3KG2A 3ECRA 1MY4A 3OO7A 4GWXA 3PD9A 1A40A 2O51A 4HE1A 2Q8JA 1M5CA 2E0SA 1B4HA 3F11A 4G61A 1IMAA 1SD3A 2D3IA 1NNKA 4GQOA 2I4BA 4G4PA 5ELVA 3KN3A 1PEBA 1NNFA 4LA9A 5TP9B 4N4UA 1YZ0A 2H4IA 4N81A 2HPGA 4GIZA 2RC8A 1M5EA 3PD8A 2REGA 4YU0A 4KXPA 1O7TA 2X7PA 4IGTA 4P47A 5I2KB 2FIEA 4KHZE 1IXHA 3G3HA 4I62A 5H8NB 4DIGA 1FQCA 2DYXA 1RKMA 1NV0A 2ZXTA 1R6ZA 2H25A 2XA5A 3E78A 2Y7IA 3MP1A 4GX3A 1FJ9A 1FBCA 4H8IA 4WXJA 3L6GA 4KYDA 4MJOA 1ELJA 1JETA 2ZYNA 3E4RA 4E0WA 2OX3A 3MVYA 4NF8A 5JEIA 3M3LA 5ET5A 1NUXA 4ELOA 1O64A 3KSJA 4X04A 1YYZA 1HSEA 2CEXA 2CZHA 3T93B 5L9OA 5H8HB 4EXKA 1RDZA 1Q1KA 3R6UA 3ZS6A 3SEXA 2F34A 2GHBA 4YAHX 4FECA 1PB8A 5FHOA 2QFLA 5ET7A 1LBWA 2XXKA 3GBAA 3H6VA 1POY1 3TODA 1Y20A 1EZPA 4RXLA 4EF2A 5JTYA 4YMAA 1DPPA 2F7BA 3GBBA 5AA4B 4OVPA 1YPNA 3CIJA 1JW4A 4IB2A 3T1BA 1DK4A 1ZLQA 3B8BA 1SQYA 1USYE 3OEMA 1H3DA 1FTMA 2W7YA 3HCQA 3LSFB 3DP6A 4N13A 3V83A 4RNSA 4MEVA 1A99A 2QMWA 4FAJA 4OQOA 2PT1A 2V4CA 2XX9A 1NV7A 3VVEA 3A09A 2P3VA 3EHSA 4AS4A 4F3PA 3U1OA 3IOUA 1FPJA 3ODBA 4YKPA 2DDKA 1A55A 1I6BA 4I9DA 1P1WA 5IZ3B 4OA4A 3A3CA 1N3XA 1FJ6A 4KR5A 4EUOA 2XXXA 1ZIUA 1AMFA 2QS1A 1SDXA 4H0WA 4NF6B 4FBPA 3A29A 5I5PA 4EQ7A 4F18A 4P9KA 1QKAA 2F7AA 4QRZA 1JVXA 2G29A 2OWTA 1B7HA 2ZYMA 4F1YA 3G7WA 2I3WA 2P2AA 3K6WA 2GFEA 1PDAA 3KJTA 4P56A 3TTNA 1NH8A 3LUZA 1LAGE 2RCBA 4HE2A 1UTHA 3U92A 4PBHA 4PF6A 1N0TA 4PC9A 1GR2A 4NN3A 4OMBA 3H3GA 4MHFA 2XWKA 1EZOA 2WYKA 1NI9A 5I2KA 2XWIA 3VDFA 2DQVA 4ZDMA 4NF5A 1KA1A 3IOVA 2PYYA 1MM7A 3CRBA 3BIHA 3PMWA 1FTLA 1RDYA 2ZNTA 4BDLA 2XWVA 3FD3A 2QS3A 2VD3A 1WODA 1UTHB 3H6TA 5CC2A 1D9YA 4KQPA 3TTRA 1CE2A 3SEUA 1PBQA 5F1QA 3Q27A 3C33A 4P11A 3W15C 5DVIA 1NL5A 4Q5TA 1MDP1 5LOMA 1QULA 4KCCA 5CMCA 1LAHE 3QIMA 3O2AA 3KFMA 5J1DA 3OO9A 1OVTA 1SW4A 4OENA 2NUVA 4BDMA 1NV2A 1O63A 5CMMA 1A7LA 3P7IA 4P1LA 3MYUA 3GYYA 2QL3A 3M8UA 1AL3A 1AOVA 3FVNA 1VE4A 4PFWA 1UTBA 4N17A 1SI0A 1Y9UA 3LC8A 2AL4A 4P0IA 4JSDA 4GD5A 3T22A 3MBPA 4EXLA 4H8JA 1FPFA 2PT2A 1JVYA 1P1QA 4MIJA 4QFLA 4OESA 2LAOA 4P8BA 3MVZA 2DP8A 4RK2A 4U23A 5ET8A 1YXIA 2QPQA 3EF7A 3K1PA 3ZSFA 1GGGA 3MVXA 4NWDA 4DE8A 2R9JA 4F2OA 2F3BA 5CMBA 4OETA 4NX1A 5FHNA 3T9VA 1DTGA 5IM2A 1S9TA 1ZU0A 1LFHA 1B5HA 3B7DA 4DDDA 2DXYA 2F5XA 4OVQA 1US5A 2I58A 1MS7A 4IO4A 4YKIA 1SBPA 2QVVA 2DVCA 1DSNA 1S7YA 1URSA 5A5XA 1UIUA 3MP8A 4GOTA 4LQ2A 4N15A 3EHTA 5HPQA 3G3KA 2Q9TA 3TMGA 3SETA 1GVCA 5B70A 3K1MA 4N6PA 4ESXA 1FQBA 1VR5A 4MLVA 3K1NA 2B4LA 3FVOA 3S4UA 1LFGA 2DSFA 5EQ9A 4OVJA 2P0SA 4X9TA 4BDQA 4QF9A 4U22A 2O69A 4UABA 2P3NA 3PPNA 3W9WA 3VXBA 3TTMA 1SYIA 1BK4A 5M2VA 2XXRA 4DLDA 5AA2A 2R8TA 4Q8RA 4H45A 2ZZWA 1SYHA 4DI3D 3PV0E 4U1OA 3C32A 5H8QA 3QXMA 4OEVA 4NE4A 1FTOA 3TTLA 5LTCA 1CB6A 2Y7RA 3IB0A 4PE3A 3OSQA 1SVXB 3UA8A 3PPOA 1MQGA 2XXIA 1ZJLA 2WYPA 3B6TA 5F24A 3R26A 3IOTA 5IGAA 2Q2CA 4QFKA 1OVBA 3I6VA 4G77A 2NXOA 3SZPA 3UP9A 1D9QA 3C31A 2VPOA 1MQIA 4GBVA 1YCJA 3OENA 1LEVA 4PDDA 5EHSA 5T3JA 3JV9A 3OD7A 2O1LA 4RA1A 2Y5LA 1SW1A 4GWZA 3HPIA 3LSLA 1II5A 5BWJA 3C34A 3IAZA 3BBRA 3BFTA 1MY1A 3TCFA 2XWOA 4I3EA 1MXUA 1NNTA 3TELA 3N5LA 2A5SA 2KLFA 1B3FA 5DVJA 1FCKA 2B65A 2ZZVA 4H1XA 4N6KA 4GWSA 1GV8A 1FPGA 1QUIA 3DLNA 1LBBA 5TPAA 1LB9A 3RPLB 5CI5A 1IXIA 4TLLB 5AA2D 5I59B 2F35A 1BKAA 1IZ1A 1ANFA 2OK2A 3QYTA 3Q26A 1LAXA 5ISUA 1PBPA 3VE1B 1UIVA 3CHGA 4HW8A 4ZEKA 2E1SA 5KCJB 1B5JA 4OERA 2NVUB 2QJEA 3T9XB 3IB1A 2GH9A 3Q25A 3E13X 1MM6A 2AIXA 2PMSA 4P1EA 2CZLA 4IO5A 5I2NA 4IY5A 2BJJX 4POWA 4PAKA 5TU0A 4RY1A 2RCAA 2D5WA 3BKIB 2DE2A 4LZ7A 2Z22A 2I49A 2GHAA 4IO6A 1B40A 2Y7WA 4NTLA 3RN8A 2Q74A 4RK9A 5TPAB 1USYH 4PFIA 4GWOA 5ICQA 2V3UA 4OVTA 5L9SA 3LSXA 1A8EA 4JVCA 4R73A 4OVRA 1BTJA 3H03A 1TXFA 3PUWE 5CMKA 4O3BA 3ILUB 5I7IA 2R71A 3RTFB 1YAEA 5CM6A 5H8SA 1B3GA 4GL8A 3CSBA 4G8NA 4DCXA 4Z7EA 5H8FB 4ZEIA 5TP9A 1NV3A 3RT8A 3UK4A 4JBZA 1FQAA 4ZECA 4O7MA 4HCWA 1LB8A 3USDA 4XKNA 1XOCA 2OJTA 2DWAA 2QSXA 4MH5A 4I3YA 3O29A 1MXXA 4XFEA 3TPAA 4JDFA 1LCTA 4JVIA 4OZ9A 3PUZE 3MZ1A 3SERA 3KBRA 4IO2A 5KCJA 4NF6A 1AWBA 1ZTYA 1FBPA 4R74A 3T66A 3VFJA 3RUMA 4JB7A 3PPQA 3TQWA 1SW5A 3MVWA 5AA3A 5JTYB 4Q30B 3C36A 4F3BA 4ZE9A 3EQ1A 4BLAA 3FXUA 4TLMB 2ALUA 4AB6A 1EU8A 4PFTA 3LBSA 1XHYA 3MAMA 2XD3A 3CVGA 3K4UA 4EF1A 3T0JA 4ZEBA 1DPEA 4X1BA 4OXVA 1IIWA 3IR1A 1LBXA 1SW2A 3S9MC 1JEUA 2H5YA 1FBHA 4OYVA 1P1OA 4O94A 4IO3A 1ZBMA 1NFTA 3TQLA 2ZMBA 4MCOA 2PX1A 1FSAA 4G68A 3PU5A 2HAVA 3QK6A 3RLFE 3KC0A 2OWZA 3OO6A 2Y7KA 1FW0A 5FTHA 1LCFA 3KOTA 4GL0A 2V25A 1NV5A 2WX9A 4GBWA 2REJA 2XXPA 1B51A 4U1ZA 1B1HA 2UVHA 4KI0E 3GLBA 3K00A 1INPA 1I6QA 1MXYA 3OXNA 4R2FA 2OBGA 4F2QA 4THIA 2KQZA 4FEDA 2F3DA 3JYRA 3PMVA 3W9VA 4JWXA 3MSTA 4U2RA 1B46A 3TCGA 4DXUA 4Z0IA 2B3FA 2Q8MA 1VFEA 3FV1A 3DP8A 1K9ZA 1OQGA 2FYIA 1P1NA 3RY3A 1B7UA 3FASA 2CMOA 4R6HA 4OHNA 3THIA 4XXUA 1IXCA 1KA0A 4HTGA 1HSJA 1FBEA 3QSLA 4MLQA 1T0KA 1B3LA 1EZ9A 1RYOA 4AS5A 2F78A 1VDWA 2HAUA 2HQ0A 3FJ7A 4OEUA 5I57A 1NMUA 1MQDA 4PBQA 4LP2B 3SEWA 2B3BA 3EPEA 1RDXA 4G68C 3H06B 3MZBA 4E0XA 1F9BA 2HXRA 1YTVA 5FBPA 2X26A 1FTKA 3UIFA 1FBGA 2F6GA 4PP0A 1LBYA 3DP4A 3O6GA 2Z8EA 3IO4A 2UVIA 2DXRA 3HHGA 5AE4A 5HM4B 4H67A 4MFIA 3FZVA 1LBCA 1NUZA 4I8CA 1JQFA 2ANJA 3G3JA 1B52A 4H46A 3H4ZA 4WEDA 2MKZA 3OELA 1OQHA 3PMXA 1FTAA 3HN0A 4TOZA 3GZGA 2GRVA 5CBSA 4N6DA 4QXDA 3C35A 4XEQA 2G93A 1R9LA 5H8NA 4U4SA 4NHBA 1B58A 1LBVA 1MPCA 2OZZA 5I57B 1QVSA 2WBBA 5F7VA 1EYJA 3CFLA 4C1TA 5DVFA 1FPEA 1Q35A 1B4ZA 1Y4CA 1IITA 4NAPA 3LV0A 2XXVA 4PETA 4EQBA 1IXGA 1P1UA 2RF1A 2XXWA 3FATA 3FIRA 3U8QA 4KCDA 3G3FA 4GWYA 5K2YA 3TYHA 1NH7A 3VXCA 1MPBA 4RJZA
chains in the Genus database with same CATH topology
3JV9A 3OD7A 2O1LA 4NWCA 3M3LA 3G3IA 4RA1A 1SW1A 2YLNA 3HPIA 3LSLA 2M8CA 1O64A 3D4CA 3KSJA 3O6IA 4ELOA 1II5A 1LLSA 2WKYA 5BWJA 3C34A 3IAZA 4C1UA 1HSEA 1H44A 3BBRA 3EN3A 4QHQA 1QW0A 1MY1A 1US4A 3BFTA 3TCFA 4UACA 3T93B 5L9OA 4KD5A 4QSDA 1IQ7A 5H8HB 4JSOA 4EXKA 4HS7A 4ESWA 1MXUA 2NOOA 3RT6B 5A5XB 1NNTA 1Q1KA 1N7WA 3TELA 3Q28A 3RTWB 1VFDA 3N5LA 4YICA 3E3KA 1AIVA 3R6UA 3RPWA 3FVGA 3ZS6A 1TWYA 2A5SA 3SEXA 1H45A 2A5TA 2F34A 2KLFA 1B3FA 2GHBA 3IX1A 2D21A 1FCKA 3CG1A 5DVJA 3ONMA 2B65A 4PFUA 4FECA 4H1XA 4YAHX 1PB8A 4F29A 1UTBB 5FHOA 2OLBA 3FXQA 1GV8A 1QJMA 1POTA 1QUIA 1R1NA 3DLNA 5HBCA 1LBBA 4QFPA 1I69A 5TPAA 1LAFE 3M3KA 4IGRA 1MPDA 1LB9A 3GBAA 2IEEA 4F22A 5I56A 5CI5A 1IXIA 3H6VA 1POY1 2VP1A 4TLLB 3TODA 5AA2D 4OTEA 2F35A 1Y20A 5I59B 1EZPA 4RXLA 1BKAA 2V3QA 4LQ5A 1IZ1A 3TTKA 3U94A 5ITPA 4EF2A 1ANFA 1TFDA 2OK2A 3KOSA 4IO7A 3QYTA 4XKPA 5JTYA 4RPOA 3Q26A 4ZZEA 1LAXA 4YMAA 1PBPA 3VE1B 1DPPA 5ISUA 2OCUA 4YMBA 1UIVA 1I6AA 2F7BA 1MH3A 3GBBA 2PVUA 2I6EA 5AA4B 4WKMA 4G68B 4FIMA 1YPNA 3IO6A 1MY0A 3CIJA 1JW4A 2ESNA 4HW8A 2XXTA 3TFLA 4ZEKA 4IB2A 4BDRA 2E1SA 3KZGA 3CSGA 3O9PA 1ZLQA 5KCJB 1B5JA 3IOWA 1SQYA 1P99A 1USYE 2ABHA 2OWSA 4OERA 3D4GA 2QJEA 3OEMA 1H3DA 1FTMA 2W7YA 3HCQA 2H98A 2HZKA 3K02A 3IB1A 2GH9A 1XC1A 3LSFB 3Q25A 3DP6A 1MXVA 3CFXA 4LVQA 4XTCQ 3KEIA 3E13X 3SKPA 1MM6A 4QFOA 4N13A 4XKRA 2AIXA 1J1NA 2PMSA 3FJGA 2YPNA 3V83A 2CZLA 3LR1A 4IO5A 4RNSA 5I2NA 1A99A 1NNPA 2BJJX 1N84A 2ZNUA 3H6WA 2QMWA 4FJPA 2PBWA 4IY5A 4POWA 4OQOA 4X48A 3WAEA 4ECFA 4FAJA 3TUSA 5TU0A 4RY1A 3HHFA 4OWDA 1PB9A 1Z7NE 2FA7A 2PT1A 2RCAA 3G3GA 2D5WA 4PE5B 3T9UA 3BKIB 2DE2A 4G8HA 1TFAA 2XX9A 1NKXA 1M5FA 1B5IA 5B7DA 4LZ7A 2Z22A 3VVEA 4NF8B 2I49A 4F19A 2GHAA 2V93A 3A09A 3AXFA 3FV2A 3K0VA 3K6VA 4IO6A 2YJPA 3EHSA 1WDNA 3DELB 3TAJA 3MJNA 1S50A 1FQEA 1XVXA 2O1MA 1B40A 2XXQA 4RPNA 1LFIA 2Y7WA 4YB7A 4NTLA 4F3PA 4BDOA 4EQ9A 3U1OA 3RN8A 3IOUA 4GXAA 1B3HA 3ODBA 4RK9A 4YKPA 5TPAB 1USYH 3VLWA 3DM0A 4DXBA 4K3FA 1MXZA 1A55A 1B6HA 4GWOA 4OFJA 3VLUA 1I6BA 2ONRA 5ICQA 2V3UA 4I9DA 5L9SA 3LSXA 4I1DA 3H7MA 1P1WA 4U4XA 1A8EA 1URDA 2XX7A 4R73A 4FATA 4H5GA 5DTBA 3A3CA 2VOZA 3IORA 3PPPA 4JWYA 1BTJA 3H03A 1TXFA 1MQJA 1N3XA 3PUWE 5IKBA 5CMKA 3OMBA 4EDPA 4O3BA 4F1UA 3ILUB 1RYXA 3FUZA 2R71A 4KR5A 3RTFB 4EUOA 5KZTA 2XXXA 1YAEA 1ZIUA 5CM6A 1AMFA 5H8SA 2QS1A 1SDXA 1B3GA 5I58A 1LFHA 2XD2A 1D4NA 3CSBA 4G8NA 4GL8A 4H0WA 1OLAA 2ZNSA 4NF6B 4DCXA 5H8QB 4Z7EA 5H8FB 4ZEIA 5TP9A 3PGFA 4EQ7A 1D9VA 2VGQA 4WEPA 5JEIA 4F18A 4YZZA 3RT8A 2XXYA 3KJ7A 1QKAA 4JBZA 2F7AA 4LATA 1JVXA 4QRZA 1FQAA 4YKKA 1MG1A 3UK4A 2G29A 4ZECA 2OWTA 1XVYA 1B7HA 3K6XA 2UVJA 2ZYMA 4ZEFA 1XT8A 4F1YA 3G7WA 2I3WA 1GTKA 4X1DA 2P2AA 3K6WA 3VV5A 2GFEA 1N04A 2I0CA 1BP5A 4HCWA 1PDAA 1LB8A 5AA1A 4OFOA 3USDA 3S2VA 3KJTA 3TTNA 2DVZA 4IY6A 1LGBC 1NH8A 1B9JA 1LAGE 4XKNA 2RCBA 5IAIA 1UTHA 3U92A 2DWIA 4ONYA 3CI8A 2V3TA 1XOCA 2OJTA 1JW5A 2DWAA 2F97A 1B7ZA 1N0TA 2QSXA 1FQDA 3TEPA 4MH5A 1MXWA 1GR2A 4OMBA 3O29A 4LZ8A 1MXXA 3TPAA 1N3WA 1JW1A 1EZOA 3H3GA 4QFNA 4JDFA 1LCTA 4UA8A 4DZ1A 2H9BA 4OZ9A 3PUZE 5DEXA 4C0RA 2ONKE 2AYSA 4R6YA 3MZ1A 2RC7A 3SERA 3KN8A 3IL1B 3KSXA 3KBRA 4IO2A 3UORA 4GLIA 5I2KA 3GXAA 1VSOA 3O6HA 5KCJA 5FHMA 2Y7PA 4ZS9A 2Q2AA 1Y3QA 4M4GA 3VDFA 2DQVA 4ZDMA 4NF5A 4NF6A 2THIA 1ZTYA 5I57B 1OMPA 5ITOA 1B0LA 3IOVA 1MQHA 3MC2A 4BDNA 4R74A 1PC3A 3T66A 5KDTB 2PYYA 2QS4A 3RUMA 4JB7A 3VFJA 1MM7A 3CRBA 3O66A 3PMWA 3QUJA 1EH3A 1FTLA 3PPQA 4ZEDA 1L5TA 3U93A 2ZNTA 1SW5A 3MVWA 3SESA 3TQWA 4BDLA 5AA3A 5JTYB 4RYAA 1ATGA 4Q30B 5AA2B 4Q0CA 1A8FA 4KYSA 4PQJA 4XIGQ 3C36A 3FD3A 2QS3A 3SEYA 4F3BA 1Y3NA 1FTJA 2VD3A 4XKQA 1SI1A 4ZE9A 3EQ1A 1WODA 1XS5A 1UTHB 3FXUA 4BLAA 4TLMB 3SDFA 2ALUA 3FJMA 1Y4TA 3H6TA 4AB6A 3ILTB 1EU8A 4PFTA 3LBSA 5CC2A 1XHYA 1D9YA 3MAMA 2XD3A 1OIBA 3CG3A 3CVGA 4KQPA 3TTRA 3K4UA 1CE2A 3N26A 3SEUA 4EF1A 1PBQA 4H5FA 4MBPA 5F1QA 4F39A 1N76A 1KWHA 3FVKA 3V8XB 4ZEBA 1B0HA 1DPEA 4X1BA 4OXVA 3RGYA 1IIWA 2UXAA 3IR1A 1MRPA 3C33A 3Q27A 3V89B 4R72A 3TDJA 1H76A 4P11A 3HSTA 1Y1ZA 3W15C 1SW2A 3LUYA 3Q29A 4JXIA 2DWJA 5DVIA 3WAFA 3VVFA 4ZE8A 3T9HB 4H65A 4DCYA 4ELQA 3S9MC 1JEUA 4R9GA 1M5BA 2H5YA 1AH5A 3MP6A 4OYVA 1D3KA 1NL5A 4H6DA 4LONB 1MDP1 1P1OA 2I3VA 2QRYA 4Q5TA 5LOMA 1QULA 5FTIA 5H8FA 3OO8A 1URGA 2RKMA 5BUUA 4KYEA 5DT6A 5L8DA 4KCCA 4IO3A 1ZBMA 3B6QA 1LAHE 1NFTA 5CMCA 3QIMA 3TQLA 5I2NB 2ZMBA 2PX1A 2XXHA 2XX8A 3E9XA 4O3CA 4PFYA 3O2AA 3PU5A 2HAVA 4G68A 2XHDA 3QK6A 3I5OA 3RLFE 3KFMA 2H99A 5J1DA 3OO9A 1OVTA 1SW4A 3OO6A 4OENA 2Y7KA 2NUVA 4BDMA 1M5DA 4GFRA 1JEVA 3L6HA 3QAXA 1H43A 5CBRA 3N94A 1O63A 4LUBA 5CMMA 1FW0A 1A7LA 2O68A 1MDQA 1LCFA 3P7IA 5FTHA 1OLCA 3KOTA 4GL0A 1QKBA 2V25A 3O97A 3H6UA 4KPTA 3S9NC 2DE4A 3A3UA 4ELPA 2REJA 3I3VA 2QL3A 3M8UA 4OFLA 3PUYE 1UQWA 1AL3A 1AOVA 3PUVE 2XXPA 4O3AA 1LSTA 1VE4A 3FVNA 3M3FA 1UTBA 4PFWA 1B51A 4U1ZA 2NVUB 1B1HA 1HSLA 1SI0A 2UVHA 3OEKA 4KI0E 1Y9UA 3LSWA 2P1SA 3GLBA 3LC8A 4LZ5A 2ZYKA 2A5TB 2FNCA 2F6PA 3K00A 3ZKLA 4AQ4A 4F1VA 4KFQA 4P0GA 3UN6A 3MPKA 2AL4A 1Y1MA 4P0IA 2AL5A 3B6WA 1BIYA 4JSDA 3OOAA 1I6QA 4GD5A 5H8HA 2O6AA 1MXYA 2RINA 3MW0A 3MBPA 3T22A 3OXNA 3TZAA 4EXLA 4G8MA 4H8JA 4GVOA 2F8DA 4R2FA 1FQFA 2OBGA 2PT2A 4F2QA 1ZMGA 2IA4A 1JVYA 4THIA 1P1QA 4FEDA 1B2HA 4QFLA 5DYHA 5JK4A 3JYRA 3PMVA 3W9VA 1IEJA 4OESA 4R9FA 2LAOA 2ZYOA 1Z7ME 1BLFA 3V5AA 1B05A 4JWXA 3MVZA 4U2RA 2DP8A 1B46A 3T96B 3VLVA 1MY2A 3S9LC 4RK2A 3TCGA 4AB5A 4DXUA 4Z0IA 2B3FA 4FE8A 4U23A 3MZ9A 5DEXB 3K6UA 2DOJA 4F3GA 2F36A 1VFEA 3FV1A 2QPQA 3DP8A 3EF7A 3K1PA 1OQGA 3K01A 1QUKA 2FYIA 3ZSFA 1GGGA 4ND9A 3MPLA 3MVXA 2DS9A 2HZLA 2HEUA 2R9JA 4NWDA 4YB6A 4DE8A 4F2OA 5CMBA 1P1NA 4OETA 3RY3A 1B7UA 1MH4A 5AA4A 2I0BA 3FASA 2R6GE 3JZJA 4F31B 1ZKBA 2CMOA 2NWJA 4R6HA 1PB7A 5FHNA 2Z23A 3EHUA 3HO7A 4MF3A 4OHNA 3RQTA 1B32A 3THIA 4QSCA 3S9EA 3FXRA 3T9VA 4XXUA 1DTGA 1IXCA 5I59A 5ICTA 2F7CA 2XXUA 4YKJA 4FORA 1N7XA 4HTGA 3CR9A 3T9XB 3ZKKA 3VVDA 1S9TA 1HSJA 1ZU0A 1B3EA 1B5HA 2HXWA 2X7QA 3QSLA 5I56B 4MLQA 3B7DA 5EYFA 1T0KA 4R6KA 4NEDA 1B3LA 3MQ9A 3SEVA 1EZ9A 4ISUA 1RYOA 3PUXE 4TQUQ 5KDTA 4DDDA 3UGWA 2Z8DA 2DXYA 3N6UA 3IJXB 2F5XA 2F78A 4G2ZA 2HAUA 1B1XA 1US5A 2HQ0A 2I48A 3FJ7A 4OEUA 5CRYA 2I58A 2Q88A 1MS7A 3IB2A 4IO4A 3TCHA 3PPRA 5I57A 2ONSA 4YKIA 4N07A 3RNNA 1SBPA 1QUJA 3FGSA 3IK6B 2O7IA 1NMUA 1MQDA 2VD2A 4NF4A 2DVCA 4LP2B 5I58B 1Y3PA 1DSNA 1S7YA 3KN7A 3SEWA 1DOTA 2B3BA 3BFUA 3EPEA 1URSA 4U21A 2V84A 4QSEA 5A5XA 1MY3A 1UIUA 3KG2A 3MP8A 4GOTA 4LQ2A 4G68C 3H06B 3MZBA 4E0XA 3EHTA 1F9BA 4NF4B 3ECRA 1MY4A 3OO7A 4R75A 3G3KA 2Q9TA 5HPQA 3TMGA 1YTVA 3SETA 1GVCA 5I84A 5B70A 2X26A 1R9QA 3K1MA 4N6PA 3PD9A 1FQBA 2UVGA 1FTKA 4ESXA 1DMBA 3MWBA 3UIFA 2VHAA 1VR5A 4MLVA 3K1NA 2F6GA 1A40A 2O51A 4PP0A 3DP4A 3KGCA 3C4MA 3FVOA 3O6GA 1LFGA 2Q8JA 2Z8EA 1M5CA 2DSFA 3S4UA 2E0SA 3N6TA 4OVJA 1B4HA 2P0SA 4X9TA 3IO4A 4QF9A 4BDQA 3F11A 4FEBA 4GXSB 2UVIA 2RC9A 5L9MA 2D3IA 1SD3A 2DXRA 2Q89A 4U22A 2O69A 3HHGA 4JWOA 5AE4A 1NNKA 2QS2A 5HM4B 4GQOA 2I4BA 4H67A 4MFIA 3FZVA 4G4PA 1LBCA 3PPNA 4HCYA 4I8CA 5ELVA 3W9WA 3KN3A 1JQFA 2ANJA 3G3JA 4R2BA 3VXBA 1B52A 1PEBA 3TTMA 1NNFA 1SYIA 3CFZA 3H4ZA 4WEDA 5I2KB 4LA9A 5M2VA 5TP9B 3OELA 1OQHA 2XXRA 3PMXA 1DTZA 3HN0A 4TOZA 5EHMA 2H4IA 3IJOB 3GZGA 4YB5A 2DE3A 2GRVA 4DLDA 3OSRA 3O28A 5AA2A 5CBSA 2Z8FA 4DXCA 4Q8RA 4GIZA 1SYHA 3C35A 2G93A 2RC8A 1M5EA 5K2XA 1R9LA 3TKDA 4GF8A 3PV0E 3PD8A 5H8NA 4U4SA 1A54A 4U1OA 2REGA 3C32A 5H8QA 3C9HA 4YU0A 4NF5B 1TT1A 3QXMA 1B58A 1MPCA 1O7TA 2OZZA 2DWHA 1QVSA 2X7PA 2UYEA 4IGTA 4KHZE 4L17A 1IXHA 3G3HA 4I62A 4NE4A 4OEVA 5H8NB 5F7VA 1FQCA 4DIGA 1FTOA 2DYXA 2HCAA 3CFLA 3TTLA 1RKMA 4C1TA 4POXA 1CB6A 2ZXTA 3R7XA 2UYFA 1R6ZA 2Y7RA 5DVFA 3IB0A 3MUQA 3OSQA 1SVXB 1Q35A 3UA8A 2H25A 1B4ZA 4M1VA 3PPOA 1MQGA 2Y7IA 2XXIA 3MP1A 1ZJLA 3B6TA 2HFBA 1Y4CA 1IITA 4H8IA 3R26A 4WXJA 2XXVA 4PETA 2O84X 4EQBA 2I4CA 4ZZAA 3IOTA 3L6GA 2Q2CA 1IXGA 1P1UA 4QFKA 1OVBA 4KYDA 2RF1A 3I6VA 4G77A 2XXWA 2O7UA 3FATA 3QUFA 2NXOA 3K2DA 4NMYA 4F3SA 3HV1A 3UP9A 3FIRA 2Y84A 3U8QA 1ELJA 3U72A 3C31A 1JETA 1WVJA 1MQIA 2QMXA 2ZYNA 1JNFA 3E4RA 3G3FA 4KCDA 4E0WA 3MVYA 5K2YA 1YCJA 3OENA 3TYHA 1NH7A 4GRKA 4NF8A 1MPBA 3VXCA 5EHSA 4RJZA 4ELRA 1IUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JV9 A;  3OD7 A;  2O1L A;  4NWC A;  3M3L A;  3G3I A;  4RA1 A;  1SW1 A;  2YLN A;  3HPI A;  3LSL A;  2M8C A;  1O64 A;  3D4C A;  3KSJ A;  3O6I A;  4ELO A;  1II5 A;  1LLS A;  2WKY A;  5BWJ A;  3C34 A;  3IAZ A;  4C1U A;  1HSE A;  1H44 A;  3BBR A;  3EN3 A;  4QHQ A;  1QW0 A;  1MY1 A;  1US4 A;  3BFT A;  3TCF A;  4UAC A;  3T93 B;  5L9O A;  4KD5 A;  4QSD A;  1IQ7 A;  5H8H B;  4JSO A;  4EXK A;  4HS7 A;  4ESW A;  1MXU A;  2NOO A;  3RT6 B;  5A5X B;  1NNT A;  1Q1K A;  1N7W A;  3TEL A;  3Q28 A;  3RTW B;  1VFD A;  3N5L A;  4YIC A;  3E3K A;  1AIV A;  3R6U A;  3RPW A;  3FVG A;  3ZS6 A;  1TWY A;  2A5S A;  3SEX A;  1H45 A;  2A5T A;  2F34 A;  2KLF A;  1B3F A;  2GHB A;  3IX1 A;  2D21 A;  1FCK A;  3CG1 A;  5DVJ A;  3ONM A;  2B65 A;  4PFU A;  4FEC A;  4H1X A;  4YAH X;  1PB8 A;  4F29 A;  1UTB B;  5FHO A;  2OLB A;  3FXQ A;  1GV8 A;  1QJM A;  1POT A;  1QUI A;  1R1N A;  3DLN A;  5HBC A;  1LBB A;  4QFP A;  1I69 A;  5TPA A;  1LAF E;  3M3K A;  4IGR A;  1MPD A;  1LB9 A;  3GBA A;  2IEE A;  4F22 A;  5I56 A;  5CI5 A;  1IXI A;  3H6V A;  1POY 1;  2VP1 A;  4TLL B;  3TOD A;  5AA2 D;  4OTE A;  2F35 A;  1Y20 A;  5I59 B;  1EZP A;  4RXL A;  1BKA A;  2V3Q A;  4LQ5 A;  1IZ1 A;  3TTK A;  3U94 A;  5ITP A;  4EF2 A;  1ANF A;  1TFD A;  2OK2 A;  3KOS A;  4IO7 A;  3QYT A;  4XKP A;  5JTY A;  4RPO A;  3Q26 A;  4ZZE A;  1LAX A;  4YMA A;  1PBP A;  3VE1 B;  1DPP A;  5ISU A;  2OCU A;  4YMB A;  1UIV A;  1I6A A;  2F7B A;  1MH3 A;  3GBB A;  2PVU A;  2I6E A;  5AA4 B;  4WKM A;  4G68 B;  4FIM A;  1YPN A;  3IO6 A;  1MY0 A;  3CIJ A;  1JW4 A;  2ESN A;  4HW8 A;  2XXT A;  3TFL A;  4ZEK A;  4IB2 A;  4BDR A;  2E1S A;  3KZG A;  3CSG A;  3O9P A;  1ZLQ A;  5KCJ B;  1B5J A;  3IOW A;  1SQY A;  1P99 A;  1USY E;  2ABH A;  2OWS A;  4OER A;  3D4G A;  2QJE A;  3OEM A;  1H3D A;  1FTM A;  2W7Y A;  3HCQ A;  2H98 A;  2HZK A;  3K02 A;  3IB1 A;  2GH9 A;  1XC1 A;  3LSF B;  3Q25 A;  3DP6 A;  1MXV A;  3CFX A;  4LVQ A;  4XTC Q;  3KEI A;  3E13 X;  3SKP A;  1MM6 A;  4QFO A;  4N13 A;  4XKR A;  2AIX A;  1J1N A;  2PMS A;  3FJG A;  2YPN A;  3V83 A;  2CZL A;  3LR1 A;  4IO5 A;  4RNS A;  5I2N A;  1A99 A;  1NNP A;  2BJJ X;  1N84 A;  2ZNU A;  3H6W A;  2QMW A;  4FJP A;  2PBW A;  4IY5 A;  4POW A;  4OQO A;  4X48 A;  3WAE A;  4ECF A;  4FAJ A;  3TUS A;  5TU0 A;  4RY1 A;  3HHF A;  4OWD A;  1PB9 A;  1Z7N E;  2FA7 A;  2PT1 A;  2RCA A;  3G3G A;  2D5W A;  4PE5 B;  3T9U A;  3BKI B;  2DE2 A;  4G8H A;  1TFA A;  2XX9 A;  1NKX A;  1M5F A;  1B5I A;  5B7D A;  4LZ7 A;  2Z22 A;  3VVE A;  4NF8 B;  2I49 A;  4F19 A;  2GHA A;  2V93 A;  3A09 A;  3AXF A;  3FV2 A;  3K0V A;  3K6V A;  4IO6 A;  2YJP A;  3EHS A;  1WDN A;  3DEL B;  3TAJ A;  3MJN A;  1S50 A;  1FQE A;  1XVX A;  2O1M A;  1B40 A;  2XXQ A;  4RPN A;  1LFI A;  2Y7W A;  4YB7 A;  4NTL A;  4F3P A;  4BDO A;  4EQ9 A;  3U1O A;  3RN8 A;  3IOU A;  4GXA A;  1B3H A;  3ODB A;  4RK9 A;  4YKP A;  5TPA B;  1USY H;  3VLW A;  3DM0 A;  4DXB A;  4K3F A;  1MXZ A;  1A55 A;  1B6H A;  4GWO A;  4OFJ A;  3VLU A;  1I6B A;  2ONR A;  5ICQ A;  2V3U A;  4I9D A;  5L9S A;  3LSX A;  4I1D A;  3H7M A;  1P1W A;  4U4X A;  1A8E A;  1URD A;  2XX7 A;  4R73 A;  4FAT A;  4H5G A;  5DTB A;  3A3C A;  2VOZ A;  3IOR A;  3PPP A;  4JWY A;  1BTJ A;  3H03 A;  1TXF A;  1MQJ A;  1N3X A;  3PUW E;  5IKB A;  5CMK A;  3OMB A;  4EDP A;  4O3B A;  4F1U A;  3ILU B;  1RYX A;  3FUZ A;  2R71 A;  4KR5 A;  3RTF B;  4EUO A;  5KZT A;  2XXX A;  1YAE A;  1ZIU A;  5CM6 A;  1AMF A;  5H8S A;  2QS1 A;  1SDX A;  1B3G A;  5I58 A;  1LFH A;  2XD2 A;  1D4N A;  3CSB A;  4G8N A;  4GL8 A;  4H0W A;  1OLA A;  2ZNS A;  4NF6 B;  4DCX A;  5H8Q B;  4Z7E A;  5H8F B;  4ZEI A;  5TP9 A;  3PGF A;  4EQ7 A;  1D9V A;  2VGQ A;  4WEP A;  5JEI A;  4F18 A;  4YZZ A;  3RT8 A;  2XXY A;  3KJ7 A;  1QKA A;  4JBZ A;  2F7A A;  4LAT A;  1JVX A;  4QRZ A;  1FQA A;  4YKK A;  1MG1 A;  3UK4 A;  2G29 A;  4ZEC A;  2OWT A;  1XVY A;  1B7H A;  3K6X A;  2UVJ A;  2ZYM A;  4ZEF A;  1XT8 A;  4F1Y A;  3G7W A;  2I3W A;  1GTK A;  4X1D A;  2P2A A;  3K6W A;  3VV5 A;  2GFE A;  1N04 A;  2I0C A;  1BP5 A;  4HCW A;  1PDA A;  1LB8 A;  5AA1 A;  4OFO A;  3USD A;  3S2V A;  3KJT A;  3TTN A;  2DVZ A;  4IY6 A;  1LGB C;  1NH8 A;  1B9J A;  1LAG E;  4XKN A;  2RCB A;  5IAI A;  1UTH A;  3U92 A;  2DWI A;  4ONY A;  3CI8 A;  2V3T A;  1XOC A;  2OJT A;  1JW5 A;  2DWA A;  2F97 A;  1B7Z A;  1N0T A;  2QSX A;  1FQD A;  3TEP A;  4MH5 A;  1MXW A;  1GR2 A;  4OMB A;  3O29 A;  4LZ8 A;  1MXX A;  3TPA A;  1N3W A;  1JW1 A;  1EZO A;  3H3G A;  4QFN A;  4JDF A;  1LCT A;  4UA8 A;  4DZ1 A;  2H9B A;  4OZ9 A;  3PUZ E;  5DEX A;  4C0R A;  2ONK E;  2AYS A;  4R6Y A;  3MZ1 A;  2RC7 A;  3SER A;  3KN8 A;  3IL1 B;  3KSX A;  3KBR A;  4IO2 A;  3UOR A;  4GLI A;  5I2K A;  3GXA A;  1VSO A;  3O6H A;  5KCJ A;  5FHM A;  2Y7P A;  4ZS9 A;  2Q2A A;  1Y3Q A;  4M4G A;  3VDF A;  2DQV A;  4ZDM A;  4NF5 A;  4NF6 A;  2THI A;  1ZTY A;  5I57 B;  1OMP A;  5ITO A;  1B0L A;  3IOV A;  1MQH A;  3MC2 A;  4BDN A;  4R74 A;  1PC3 A;  3T66 A;  5KDT B;  2PYY A;  2QS4 A;  3RUM A;  4JB7 A;  3VFJ A;  1MM7 A;  3CRB A;  3O66 A;  3PMW A;  3QUJ A;  1EH3 A;  1FTL A;  3PPQ A;  4ZED A;  1L5T A;  3U93 A;  2ZNT A;  1SW5 A;  3MVW A;  3SES A;  3TQW A;  4BDL A;  5AA3 A;  5JTY B;  4RYA A;  1ATG A;  4Q30 B;  5AA2 B;  4Q0C A;  1A8F A;  4KYS A;  4PQJ A;  4XIG Q;  3C36 A;  3FD3 A;  2QS3 A;  3SEY A;  4F3B A;  1Y3N A;  1FTJ A;  2VD3 A;  4XKQ A;  1SI1 A;  4ZE9 A;  3EQ1 A;  1WOD A;  1XS5 A;  1UTH B;  3FXU A;  4BLA A;  4TLM B;  3SDF A;  2ALU A;  3FJM A;  1Y4T A;  3H6T A;  4AB6 A;  3ILT B;  1EU8 A;  4PFT A;  3LBS A;  5CC2 A;  1XHY A;  1D9Y A;  3MAM A;  2XD3 A;  1OIB A;  3CG3 A;  3CVG A;  4KQP A;  3TTR A;  3K4U A;  1CE2 A;  3N26 A;  3SEU A;  4EF1 A;  1PBQ A;  4H5F A;  4MBP A;  5F1Q A;  4F39 A;  1N76 A;  1KWH A;  3FVK A;  3V8X B;  4ZEB A;  1B0H A;  1DPE A;  4X1B A;  4OXV A;  3RGY A;  1IIW A;  2UXA A;  3IR1 A;  1MRP A;  3C33 A;  3Q27 A;  3V89 B;  4R72 A;  3TDJ A;  1H76 A;  4P11 A;  3HST A;  1Y1Z A;  3W15 C;  1SW2 A;  3LUY A;  3Q29 A;  4JXI A;  2DWJ A;  5DVI A;  3WAF A;  3VVF A;  4ZE8 A;  3T9H B;  4H65 A;  4DCY A;  4ELQ A;  3S9M C;  1JEU A;  4R9G A;  1M5B A;  2H5Y A;  1AH5 A;  3MP6 A;  4OYV A;  1D3K A;  1NL5 A;  4H6D A;  4LON B;  1MDP 1;  1P1O A;  2I3V A;  2QRY A;  4Q5T A;  5LOM A;  1QUL A;  5FTI A;  5H8F A;  3OO8 A;  1URG A;  2RKM A;  5BUU A;  4KYE A;  5DT6 A;  5L8D A;  4KCC A;  4IO3 A;  1ZBM A;  3B6Q A;  1LAH E;  1NFT A;  5CMC A;  3QIM A;  3TQL A;  5I2N B;  2ZMB A;  2PX1 A;  2XXH A;  2XX8 A;  3E9X A;  4O3C A;  4PFY A;  3O2A A;  3PU5 A;  2HAV A;  4G68 A;  2XHD A;  3QK6 A;  3I5O A;  3RLF E;  3KFM A;  2H99 A;  5J1D A;  3OO9 A;  1OVT A;  1SW4 A;  3OO6 A;  4OEN A;  2Y7K A;  2NUV A;  4BDM A;  1M5D A;  4GFR A;  1JEV A;  3L6H A;  3QAX A;  1H43 A;  5CBR A;  3N94 A;  1O63 A;  4LUB A;  5CMM A;  1FW0 A;  1A7L A;  2O68 A;  1MDQ A;  1LCF A;  3P7I A;  5FTH A;  1OLC A;  3KOT A;  4GL0 A;  1QKB A;  2V25 A;  3O97 A;  3H6U A;  4KPT A;  3S9N C;  2DE4 A;  3A3U A;  4ELP A;  2REJ A;  3I3V A;  2QL3 A;  3M8U A;  4OFL A;  3PUY E;  1UQW A;  1AL3 A;  1AOV A;  3PUV E;  2XXP A;  4O3A A;  1LST A;  1VE4 A;  3FVN A;  3M3F A;  1UTB A;  4PFW A;  1B51 A;  4U1Z A;  2NVU B;  1B1H A;  1HSL A;  1SI0 A;  2UVH A;  3OEK A;  4KI0 E;  1Y9U A;  3LSW A;  2P1S A;  3GLB A;  3LC8 A;  4LZ5 A;  2ZYK A;  2A5T B;  2FNC A;  2F6P A;  3K00 A;  3ZKL A;  4AQ4 A;  4F1V A;  4KFQ A;  4P0G A;  3UN6 A;  3MPK A;  2AL4 A;  1Y1M A;  4P0I A;  2AL5 A;  3B6W A;  1BIY A;  4JSD A;  3OOA A;  1I6Q A;  4GD5 A;  5H8H A;  2O6A A;  1MXY A;  2RIN A;  3MW0 A;  3MBP A;  3T22 A;  3OXN A;  3TZA A;  4EXL A;  4G8M A;  4H8J A;  4GVO A;  2F8D A;  4R2F A;  1FQF A;  2OBG A;  2PT2 A;  4F2Q A;  1ZMG A;  2IA4 A;  1JVY A;  4THI A;  1P1Q A;  4FED A;  1B2H A;  4QFL A;  5DYH A;  5JK4 A;  3JYR A;  3PMV A;  3W9V A;  1IEJ A;  4OES A;  4R9F A;  2LAO A;  2ZYO A;  1Z7M E;  1BLF A;  3V5A A;  1B05 A;  4JWX A;  3MVZ A;  4U2R A;  2DP8 A;  1B46 A;  3T96 B;  3VLV A;  1MY2 A;  3S9L C;  4RK2 A;  3TCG A;  4AB5 A;  4DXU A;  4Z0I A;  2B3F A;  4FE8 A;  4U23 A;  3MZ9 A;  5DEX B;  3K6U A;  2DOJ A;  4F3G A;  2F36 A;  1VFE A;  3FV1 A;  2QPQ A;  3DP8 A;  3EF7 A;  3K1P A;  1OQG A;  3K01 A;  1QUK A;  2FYI A;  3ZSF A;  1GGG A;  4ND9 A;  3MPL A;  3MVX A;  2DS9 A;  2HZL A;  2HEU A;  2R9J A;  4NWD A;  4YB6 A;  4DE8 A;  4F2O A;  5CMB A;  1P1N A;  4OET A;  3RY3 A;  1B7U A;  1MH4 A;  5AA4 A;  2I0B A;  3FAS A;  2R6G E;  3JZJ A;  4F31 B;  1ZKB A;  2CMO A;  2NWJ A;  4R6H A;  1PB7 A;  5FHN A;  2Z23 A;  3EHU A;  3HO7 A;  4MF3 A;  4OHN A;  3RQT A;  1B32 A;  3THI A;  4QSC A;  3S9E A;  3FXR A;  3T9V A;  4XXU A;  1DTG A;  1IXC A;  5I59 A;  5ICT A;  2F7C A;  2XXU A;  4YKJ A;  4FOR A;  1N7X A;  4HTG A;  3CR9 A;  3T9X B;  3ZKK A;  3VVD A;  1S9T A;  1HSJ A;  1ZU0 A;  1B3E A;  1B5H A;  2HXW A;  2X7Q A;  3QSL A;  5I56 B;  4MLQ A;  3B7D A;  5EYF A;  1T0K A;  4R6K A;  4NED A;  1B3L A;  3MQ9 A;  3SEV A;  1EZ9 A;  4ISU A;  1RYO A;  3PUX E;  4TQU Q;  5KDT A;  4DDD A;  3UGW A;  2Z8D A;  2DXY A;  3N6U A;  3IJX B;  2F5X A;  2F78 A;  4G2Z A;  2HAU A;  1B1X A;  1US5 A;  2HQ0 A;  2I48 A;  3FJ7 A;  4OEU A;  5CRY A;  2I58 A;  2Q88 A;  1MS7 A;  3IB2 A;  4IO4 A;  3TCH A;  3PPR A;  5I57 A;  2ONS A;  4YKI A;  4N07 A;  3RNN A;  1SBP A;  1QUJ A;  3FGS A;  3IK6 B;  2O7I A;  1NMU A;  1MQD A;  2VD2 A;  4NF4 A;  2DVC A;  4LP2 B;  5I58 B;  1Y3P A;  1DSN A;  1S7Y A;  3KN7 A;  3SEW A;  1DOT A;  2B3B A;  3BFU A;  3EPE A;  1URS A;  4U21 A;  2V84 A;  4QSE A;  5A5X A;  1MY3 A;  1UIU A;  3KG2 A;  3MP8 A;  4GOT A;  4LQ2 A;  4G68 C;  3H06 B;  3MZB A;  4E0X A;  3EHT A;  1F9B A;  4NF4 B;  3ECR A;  1MY4 A;  3OO7 A;  4R75 A;  3G3K A;  2Q9T A;  5HPQ A;  3TMG A;  1YTV A;  3SET A;  1GVC A;  5I84 A;  5B70 A;  2X26 A;  1R9Q A;  3K1M A;  4N6P A;  3PD9 A;  1FQB A;  2UVG A;  1FTK A;  4ESX A;  1DMB A;  3MWB A;  3UIF A;  2VHA A;  1VR5 A;  4MLV A;  3K1N A;  2F6G A;  1A40 A;  2O51 A;  4PP0 A;  3DP4 A;  3KGC A;  3C4M A;  3FVO A;  3O6G A;  1LFG A;  2Q8J A;  2Z8E A;  1M5C A;  2DSF A;  3S4U A;  2E0S A;  3N6T A;  4OVJ A;  1B4H A;  2P0S A;  4X9T A;  3IO4 A;  4QF9 A;  4BDQ A;  3F11 A;  4FEB A;  4GXS B;  2UVI A;  2RC9 A;  5L9M A;  2D3I A;  1SD3 A;  2DXR A;  2Q89 A;  4U22 A;  2O69 A;  3HHG A;  4JWO A;  5AE4 A;  1NNK A;  2QS2 A;  5HM4 B;  4GQO A;  2I4B A;  4H67 A;  4MFI A;  3FZV A;  4G4P A;  1LBC A;  3PPN A;  4HCY A;  4I8C A;  5ELV A;  3W9W A;  3KN3 A;  1JQF A;  2ANJ A;  3G3J A;  4R2B A;  3VXB A;  1B52 A;  1PEB A;  3TTM A;  1NNF A;  1SYI A;  3CFZ A;  3H4Z A;  4WED A;  5I2K B;  4LA9 A;  5M2V A;  5TP9 B;  3OEL A;  1OQH A;  2XXR A;  3PMX A;  1DTZ A;  3HN0 A;  4TOZ A;  5EHM A;  2H4I A;  3IJO B;  3GZG A;  4YB5 A;  2DE3 A;  2GRV A;  4DLD A;  3OSR A;  3O28 A;  5AA2 A;  5CBS A;  2Z8F A;  4DXC A;  4Q8R A;  4GIZ A;  1SYH A;  3C35 A;  2G93 A;  2RC8 A;  1M5E A;  5K2X A;  1R9L A;  3TKD A;  4GF8 A;  3PV0 E;  3PD8 A;  5H8N A;  4U4S A;  1A54 A;  4U1O A;  2REG A;  3C32 A;  5H8Q A;  3C9H A;  4YU0 A;  4NF5 B;  1TT1 A;  3QXM A;  1B58 A;  1MPC A;  1O7T A;  2OZZ A;  2DWH A;  1QVS A;  2X7P A;  2UYE A;  4IGT A;  4KHZ E;  4L17 A;  1IXH A;  3G3H A;  4I62 A;  4NE4 A;  4OEV A;  5H8N B;  5F7V A;  1FQC A;  4DIG A;  1FTO A;  2DYX A;  2HCA A;  3CFL A;  3TTL A;  1RKM A;  4C1T A;  4POX A;  1CB6 A;  2ZXT A;  3R7X A;  2UYF A;  1R6Z A;  2Y7R A;  5DVF A;  3IB0 A;  3MUQ A;  3OSQ A;  1SVX B;  1Q35 A;  3UA8 A;  2H25 A;  1B4Z A;  4M1V A;  3PPO A;  1MQG A;  2Y7I A;  2XXI A;  3MP1 A;  1ZJL A;  3B6T A;  2HFB A;  1Y4C A;  1IIT A;  4H8I A;  3R26 A;  4WXJ A;  2XXV A;  4PET A;  2O84 X;  4EQB A;  2I4C A;  4ZZA A;  3IOT A;  3L6G A;  2Q2C A;  1IXG A;  1P1U A;  4QFK A;  1OVB A;  4KYD A;  2RF1 A;  3I6V A;  4G77 A;  2XXW A;  2O7U A;  3FAT A;  3QUF A;  2NXO A;  3K2D A;  4NMY A;  4F3S A;  3HV1 A;  3UP9 A;  3FIR A;  2Y84 A;  3U8Q A;  1ELJ A;  3U72 A;  3C31 A;  1JET A;  1WVJ A;  1MQI A;  2QMX A;  2ZYN A;  1JNF A;  3E4R A;  3G3F A;  4KCD A;  4E0W A;  3MVY A;  5K2Y A;  1YCJ A;  3OEN A;  3TYH A;  1NH7 A;  4GRK A;  4NF8 A;  1MPB A;  3VXC A;  5EHS A;  4RJZ A;  4ELR A;  1IUD A; 
#chains in the Genus database with same CATH topology
 3G3I A;  2QVU A;  2M8C A;  3B50 A;  3O6I A;  1LLS A;  2WEF A;  2WKY A;  4C1U A;  4QHQ A;  1QW0 A;  1US4 A;  4UAC A;  1FPD A;  4KD5 A;  1IQ7 A;  5A5X B;  2NOO A;  1N7W A;  1AIV A;  1VFD A;  5EQA A;  1H45 A;  2A5T A;  2QVR A;  4F29 A;  3ONM A;  4DI4 B;  4PFU A;  1UTB B;  1R1N A;  5HBC A;  1I69 A;  1LAF E;  3M3K A;  1MPD A;  4F22 A;  4OTE A;  4LQ5 A;  3U94 A;  3TTK A;  4IO7 A;  4RPO A;  4ZZE A;  1SPI A;  2PVU A;  1FPK A;  4NG7 A;  4G68 B;  3KBZ A;  5A5L A;  1MY0 A;  2ESN A;  2XXT A;  3TFL A;  3KZG A;  4I40 A;  3O9P A;  2PFZ A;  1P99 A;  3V89 B;  4YB5 A;  4PAI A;  4LVQ A;  3SKP A;  1MXV A;  4QFO A;  3KC1 A;  1J1N A;  3LR1 A;  4O7I A;  1NNP A;  2ZNU A;  1N84 A;  2PBW A;  4X48 A;  2HHM A;  3HHF A;  1FPB A;  1Z7N E;  3G3G A;  4PE5 B;  3T9U A;  1TFA A;  2V93 A;  3K6V A;  2YJP A;  1WDN A;  2BJI A;  3TAJ A;  3MJN A;  1XVX A;  2XXQ A;  3S9E A;  1LFI A;  4BDO A;  4EQ9 A;  4GXA A;  1B3H A;  3VLW A;  4K3F A;  1IME A;  3H7M A;  4U4X A;  2XX7 A;  4H5G A;  5DTB A;  2VOZ A;  1XI6 A;  1G0H A;  3IOR A;  3PPP A;  5IKB A;  4MAG A;  4X8R A;  4F1U A;  1RYX A;  3FUZ A;  5KZT A;  2ZNS A;  5H8Q B;  5I3S A;  1D9V A;  2VGQ A;  4WEP A;  4YZZ A;  1JP4 A;  4LAT A;  1MG1 A;  2VPN A;  4ZEF A;  1GTK A;  1DBZ A;  2I0C A;  1N04 A;  2B4M A;  4OFO A;  3E79 A;  3S2V A;  1B9J A;  4ONY A;  3CI8 A;  2V3T A;  2F97 A;  1FQD A;  3TEP A;  1MXW A;  5ET6 A;  2JJK A;  4QFN A;  4DZ1 A;  5DEX A;  2ONK E;  2AYS A;  3UOR A;  3KN8 A;  2GQ1 A;  4GLI A;  3GXA A;  1VSO A;  3O6H A;  4N8Y A;  5FHM A;  2Q2A A;  4M4G A;  3MC2 A;  5KDT B;  2QS4 A;  1IMB A;  3O66 A;  3QUJ A;  4ZED A;  1L5T A;  3U93 A;  4RYA A;  1G0I A;  1A8F A;  3SEY A;  1QGX A;  2FHY A;  1SI1 A;  5ESY A;  3FJM A;  1Y4T A;  3HFU A;  2PCR A;  3CG3 A;  1OIB A;  4H5F A;  1N76 A;  1KWH A;  3FVK A;  1B0H A;  3RGY A;  2UXA A;  4R72 A;  3TDJ A;  1H76 A;  3HST A;  3Q29 A;  3WAF A;  3VVF A;  4ZE8 A;  3T9H B;  4ELQ A;  4R9G A;  1M5B A;  1AH5 A;  3MP6 A;  1D3K A;  4H6D A;  2I3V A;  2QRY A;  4MNI A;  4PF8 A;  5H8F A;  2FIX A;  5BUU A;  1URG A;  4IR8 A;  5L8D A;  3D1R A;  3U65 A;  4O3C A;  2XHD A;  3L6H A;  3QAX A;  4MNC A;  3N94 A;  1MDQ A;  5J16 A;  1OLC A;  1QKB A;  4KPT A;  3H6U A;  2DE4 A;  3RPL A;  4ELP A;  4OFL A;  3M3F A;  1HSL A;  3OEK A;  2P1S A;  2ZYK A;  2A5T B;  3ZKL A;  2F6P A;  4AQ4 A;  3UN6 A;  3MPK A;  5EYG A;  2AL5 A;  3B6W A;  3TZA A;  3MW0 A;  4G8M A;  4GVO A;  1FQF A;  1ZMG A;  1IEJ A;  1Z7M E;  1BLF A;  3V5A A;  1B05 A;  3VLV A;  4PCD A;  1MY2 A;  3S9L C;  4AB5 A;  3MZ9 A;  3K6U A;  4F3G A;  2F36 A;  3K01 A;  1QUK A;  3MPL A;  2DS9 A;  5AA4 A;  2I0B A;  4F31 B;  2R6G E;  3JZJ A;  1ZKB A;  1PB7 A;  2Z23 A;  4MF3 A;  3HO7 A;  1B32 A;  4FOR A;  4N8G A;  3ZKK A;  3VVD A;  4NQ8 A;  1B3E A;  1CNQ A;  5EYF A;  3PTY A;  4NED A;  3SEV A;  3MQ9 A;  4ISU A;  3PUX E;  4TQU Q;  5KDT A;  3UGW A;  5CRY A;  1B1X A;  3TCH A;  2Q88 A;  3PPR A;  1IMF A;  3RNN A;  4N07 A;  3FGS A;  3KN7 A;  1DOT A;  3BFU A;  4U21 A;  2V84 A;  1MY3 A;  5IZZ A;  1NV1 A;  4NF4 B;  4R75 A;  5I84 A;  2Y5K A;  1R9Q A;  4PGN A;  2UVG A;  1DMB A;  3MWB A;  2VHA A;  3SDF A;  3C4M A;  3KGC A;  3N6T A;  4FEB A;  4GXS B;  2RC9 A;  5L9M A;  2Q89 A;  4JWO A;  2QS2 A;  4HCY A;  4R2B A;  3CFZ A;  1DTZ A;  5EHM A;  3IJO B;  2DE3 A;  3OSR A;  3O28 A;  2Z8F A;  4DXC A;  5K2X A;  3TKD A;  4GF8 A;  1A54 A;  3C9H A;  4NF5 B;  1TT1 A;  3ISP A;  5IZ3 A;  4XIG Q;  2DWH A;  4L17 A;  2UYE A;  2HCA A;  4POX A;  3R7X A;  2UYF A;  3MUQ A;  1EYK A;  4M1V A;  2HFB A;  2O84 X;  2I4C A;  4ZZA A;  3IFC A;  2O7U A;  3QUF A;  3K2D A;  4NMY A;  4F3S A;  3HV1 A;  2Y84 A;  3U72 A;  1WVJ A;  2QMX A;  1JNF A;  4GRK A;  4ELR A;  1IUD A;  4NWC A;  4OAN A;  5EYH A;  2YLN A;  3D4C A;  1H44 A;  3EN3 A;  1NUY A;  4QSD A;  4PFB A;  4JSO A;  4HS7 A;  4ESW A;  3RT6 B;  3BIG A;  3Q28 A;  3RTW B;  4YIC A;  3E3K A;  3RPW A;  3FVG A;  1TWY A;  5I59 A;  3IX1 A;  2D21 A;  3CG1 A;  2OLB A;  3FXQ A;  1QJM A;  1POT A;  4QFP A;  4GWU A;  4IGR A;  2IEE A;  4MX6 A;  5I56 A;  2VP1 A;  4JVD A;  5ITP A;  2V3Q A;  1TFD A;  3KOS A;  2FVZ A;  4XKP A;  2OCU A;  4YMB A;  1I6A A;  1MH3 A;  1FBD A;  2I6E A;  4WKM A;  4FIM A;  3IO6 A;  3IFA A;  4BDR A;  3CSG A;  3IOW A;  2CZK A;  2ABH A;  2OWS A;  3D4G A;  2H98 A;  2HZK A;  3K02 A;  5CBR A;  1XC1 A;  4XTC Q;  3CFX A;  4F19 A;  3KEI A;  1IMD A;  4XKR A;  1FBF A;  3FJG A;  2YPN A;  4OVS A;  3H6W A;  4FJP A;  3WAE A;  4ECF A;  3TUS A;  4OWD A;  1PB9 A;  2FA7 A;  1KZ8 A;  4G8H A;  1NKX A;  1M5F A;  1B5I A;  5B7D A;  4NF8 B;  3AXF A;  3FV2 A;  3K0V A;  3ROJ A;  3DEL B;  1S50 A;  1FQE A;  2O1M A;  4RPN A;  4YB7 A;  3FXB A;  1FPL A;  3DM0 A;  4DXB A;  1MXZ A;  4OFJ A;  1B6H A;  3VLU A;  2ONR A;  4I1D A;  1URD A;  4FAT A;  4JWY A;  4QBA A;  1MQJ A;  1NV4 A;  2VT5 A;  3OMB A;  4EDP A;  1K9Y A;  5I58 A;  2XD2 A;  1D4N A;  1OLA A;  3PGF A;  4XF5 A;  2WBD A;  2XXY A;  3KJ7 A;  4N91 A;  1EYI A;  4PTK A;  4YKK A;  1XVY A;  3K6X A;  2UVJ A;  1XT8 A;  4X1D A;  3VV5 A;  4PGP A;  4GWW A;  1BP5 A;  5AA1 A;  2DVZ A;  4IY6 A;  1LGB C;  5IAI A;  2DWI A;  5EQ8 A;  1JW5 A;  1B7Z A;  4LZ8 A;  1N3W A;  4NF0 A;  1JW1 A;  4UA8 A;  2H9B A;  4C0R A;  4LN5 A;  4R6Y A;  2RC7 A;  3KSX A;  3IL1 B;  2Y7P A;  4ZS9 A;  1Y3Q A;  3NOH A;  5IZ1 A;  2THI A;  1OMP A;  5ITO A;  1B0L A;  1MQH A;  4BDN A;  1PC3 A;  3EKI A;  1EH3 A;  3SES A;  1ATG A;  4HXV A;  5AA2 B;  4Q0C A;  4KYS A;  4PQJ A;  1Y3N A;  1FTJ A;  4XKQ A;  1XS5 A;  3ILT B;  3N26 A;  4F39 A;  4MBP A;  3V8X B;  1MRP A;  3FBP A;  1Y1Z A;  3RYD A;  3LUY A;  4JXI A;  2DWJ A;  4DCY A;  4H65 A;  5DW8 A;  4LON B;  5FTI A;  3OO8 A;  2RKM A;  4KYE A;  5DT6 A;  1IMC A;  3B6Q A;  5I2N B;  2XXH A;  2XX8 A;  3E9X A;  4PFY A;  2CZI A;  3I5O A;  2H99 A;  1M5D A;  4GFR A;  1JEV A;  1H43 A;  4LUB A;  4PAF A;  4PDH A;  2O68 A;  1NV6 A;  2CEY A;  3O97 A;  3S9N C;  3QMF A;  3A3U A;  3I3V A;  3PUY E;  1UQW A;  3PUV E;  4O3A A;  1LST A;  1LBZ A;  1DCU A;  3LSW A;  4LZ5 A;  2FNC A;  1FPI A;  4F1V A;  4KFQ A;  4P0G A;  1Y1M A;  1FRP A;  1BIY A;  3OOA A;  5H8H A;  2O6A A;  2RIN A;  4P3L A;  2F8D A;  4PFR A;  2IA4 A;  1B2H A;  5DYH A;  5JK4 A;  1Q9D A;  4NGU A;  4R9F A;  2ZYO A;  3T96 B;  5LDZ A;  4FE8 A;  5DEX B;  2DOJ A;  2PFY A;  4ND9 A;  2HZL A;  4YB6 A;  2HEU A;  1MH4 A;  2NWJ A;  3EHU A;  3RQT A;  4QSC A;  3FXR A;  5ICT A;  2F7C A;  2XXU A;  4YKJ A;  1N7X A;  4GX4 A;  3CR9 A;  2KR0 A;  2FBP A;  2HXW A;  2X7Q A;  5I56 B;  1NUW A;  4R6K A;  2Z8D A;  4MMP A;  3N6U A;  3IJX B;  4G2Z A;  2I48 A;  4O8M A;  3IB2 A;  5EQ7 A;  2ZZX A;  4HE0 A;  2ONS A;  1QUJ A;  2L5V A;  3IK6 B;  2O7I A;  2VD2 A;  4NF4 A;  5I58 B;  1Y3P A;  4MNP A;  4GX6 A;  4QSE A;  3KG2 A;  3ECR A;  1MY4 A;  3OO7 A;  4GWX A;  3PD9 A;  1A40 A;  2O51 A;  4HE1 A;  2Q8J A;  1M5C A;  2E0S A;  1B4H A;  3F11 A;  4G61 A;  1IMA A;  1SD3 A;  2D3I A;  1NNK A;  4GQO A;  2I4B A;  4G4P A;  5ELV A;  3KN3 A;  1PEB A;  1NNF A;  4LA9 A;  5TP9 B;  4N4U A;  1YZ0 A;  2H4I A;  4N81 A;  2HPG A;  4GIZ A;  2RC8 A;  1M5E A;  3PD8 A;  2REG A;  4YU0 A;  4KXP A;  1O7T A;  2X7P A;  4IGT A;  4P47 A;  5I2K B;  2FIE A;  4KHZ E;  1IXH A;  3G3H A;  4I62 A;  5H8N B;  4DIG A;  1FQC A;  2DYX A;  1RKM A;  1NV0 A;  2ZXT A;  1R6Z A;  2H25 A;  2XA5 A;  3E78 A;  2Y7I A;  3MP1 A;  4GX3 A;  1FJ9 A;  1FBC A;  4H8I A;  4WXJ A;  3L6G A;  4KYD A;  4MJO A;  1ELJ A;  1JET A;  2ZYN A;  3E4R A;  4E0W A;  2OX3 A;  3MVY A;  4NF8 A;  5JEI A;  3M3L A;  5ET5 A;  1NUX A;  4ELO A;  1O64 A;  3KSJ A;  4X04 A;  1YYZ A;  1HSE A;  2CEX A;  2CZH A;  3T93 B;  5L9O A;  5H8H B;  4EXK A;  1RDZ A;  1Q1K A;  3R6U A;  3ZS6 A;  3SEX A;  2F34 A;  2GHB A;  4YAH X;  4FEC A;  1PB8 A;  5FHO A;  2QFL A;  5ET7 A;  1LBW A;  2XXK A;  3GBA A;  3H6V A;  1POY 1;  3TOD A;  1Y20 A;  1EZP A;  4RXL A;  4EF2 A;  5JTY A;  4YMA A;  1DPP A;  2F7B A;  3GBB A;  5AA4 B;  4OVP A;  1YPN A;  3CIJ A;  1JW4 A;  4IB2 A;  3T1B A;  1DK4 A;  1ZLQ A;  3B8B A;  1SQY A;  1USY E;  3OEM A;  1H3D A;  1FTM A;  2W7Y A;  3HCQ A;  3LSF B;  3DP6 A;  4N13 A;  3V83 A;  4RNS A;  4MEV A;  1A99 A;  2QMW A;  4FAJ A;  4OQO A;  2PT1 A;  2V4C A;  2XX9 A;  1NV7 A;  3VVE A;  3A09 A;  2P3V A;  3EHS A;  4AS4 A;  4F3P A;  3U1O A;  3IOU A;  1FPJ A;  3ODB A;  4YKP A;  2DDK A;  1A55 A;  1I6B A;  4I9D A;  1P1W A;  5IZ3 B;  4OA4 A;  3A3C A;  1N3X A;  1FJ6 A;  4KR5 A;  4EUO A;  2XXX A;  1ZIU A;  1AMF A;  2QS1 A;  1SDX A;  4H0W A;  4NF6 B;  4FBP A;  3A29 A;  5I5P A;  4EQ7 A;  4F18 A;  4P9K A;  1QKA A;  2F7A A;  4QRZ A;  1JVX A;  2G29 A;  2OWT A;  1B7H A;  2ZYM A;  4F1Y A;  3G7W A;  2I3W A;  2P2A A;  3K6W A;  2GFE A;  1PDA A;  3KJT A;  4P56 A;  3TTN A;  1NH8 A;  3LUZ A;  1LAG E;  2RCB A;  4HE2 A;  1UTH A;  3U92 A;  4PBH A;  4PF6 A;  1N0T A;  4PC9 A;  1GR2 A;  4NN3 A;  4OMB A;  3H3G A;  4MHF A;  2XWK A;  1EZO A;  2WYK A;  1NI9 A;  5I2K A;  2XWI A;  3VDF A;  2DQV A;  4ZDM A;  4NF5 A;  1KA1 A;  3IOV A;  2PYY A;  1MM7 A;  3CRB A;  3BIH A;  3PMW A;  1FTL A;  1RDY A;  2ZNT A;  4BDL A;  2XWV A;  3FD3 A;  2QS3 A;  2VD3 A;  1WOD A;  1UTH B;  3H6T A;  5CC2 A;  1D9Y A;  4KQP A;  3TTR A;  1CE2 A;  3SEU A;  1PBQ A;  5F1Q A;  3Q27 A;  3C33 A;  4P11 A;  3W15 C;  5DVI A;  1NL5 A;  4Q5T A;  1MDP 1;  5LOM A;  1QUL A;  4KCC A;  5CMC A;  1LAH E;  3QIM A;  3O2A A;  3KFM A;  5J1D A;  3OO9 A;  1OVT A;  1SW4 A;  4OEN A;  2NUV A;  4BDM A;  1NV2 A;  1O63 A;  5CMM A;  1A7L A;  3P7I A;  4P1L A;  3MYU A;  3GYY A;  2QL3 A;  3M8U A;  1AL3 A;  1AOV A;  3FVN A;  1VE4 A;  4PFW A;  1UTB A;  4N17 A;  1SI0 A;  1Y9U A;  3LC8 A;  2AL4 A;  4P0I A;  4JSD A;  4GD5 A;  3T22 A;  3MBP A;  4EXL A;  4H8J A;  1FPF A;  2PT2 A;  1JVY A;  1P1Q A;  4MIJ A;  4QFL A;  4OES A;  2LAO A;  4P8B A;  3MVZ A;  2DP8 A;  4RK2 A;  4U23 A;  5ET8 A;  1YXI A;  2QPQ A;  3EF7 A;  3K1P A;  3ZSF A;  1GGG A;  3MVX A;  4NWD A;  4DE8 A;  2R9J A;  4F2O A;  2F3B A;  5CMB A;  4OET A;  4NX1 A;  5FHN A;  3T9V A;  1DTG A;  5IM2 A;  1S9T A;  1ZU0 A;  1LFH A;  1B5H A;  3B7D A;  4DDD A;  2DXY A;  2F5X A;  4OVQ A;  1US5 A;  2I58 A;  1MS7 A;  4IO4 A;  4YKI A;  1SBP A;  2QVV A;  2DVC A;  1DSN A;  1S7Y A;  1URS A;  5A5X A;  1UIU A;  3MP8 A;  4GOT A;  4LQ2 A;  4N15 A;  3EHT A;  5HPQ A;  3G3K A;  2Q9T A;  3TMG A;  3SET A;  1GVC A;  5B70 A;  3K1M A;  4N6P A;  4ESX A;  1FQB A;  1VR5 A;  4MLV A;  3K1N A;  2B4L A;  3FVO A;  3S4U A;  1LFG A;  2DSF A;  5EQ9 A;  4OVJ A;  2P0S A;  4X9T A;  4BDQ A;  4QF9 A;  4U22 A;  2O69 A;  4UAB A;  2P3N A;  3PPN A;  3W9W A;  3VXB A;  3TTM A;  1SYI A;  1BK4 A;  5M2V A;  2XXR A;  4DLD A;  5AA2 A;  2R8T A;  4Q8R A;  4H45 A;  2ZZW A;  1SYH A;  4DI3 D;  3PV0 E;  4U1O A;  3C32 A;  5H8Q A;  3QXM A;  4OEV A;  4NE4 A;  1FTO A;  3TTL A;  5LTC A;  1CB6 A;  2Y7R A;  3IB0 A;  4PE3 A;  3OSQ A;  1SVX B;  3UA8 A;  3PPO A;  1MQG A;  2XXI A;  1ZJL A;  2WYP A;  3B6T A;  5F24 A;  3R26 A;  3IOT A;  5IGA A;  2Q2C A;  4QFK A;  1OVB A;  3I6V A;  4G77 A;  2NXO A;  3SZP A;  3UP9 A;  1D9Q A;  3C31 A;  2VPO A;  1MQI A;  4GBV A;  1YCJ A;  3OEN A;  1LEV A;  4PDD A;  5EHS A;  5T3J A;  3JV9 A;  3OD7 A;  2O1L A;  4RA1 A;  2Y5L A;  1SW1 A;  4GWZ A;  3HPI A;  3LSL A;  1II5 A;  5BWJ A;  3C34 A;  3IAZ A;  3BBR A;  3BFT A;  1MY1 A;  3TCF A;  2XWO A;  4I3E A;  1MXU A;  1NNT A;  3TEL A;  3N5L A;  2A5S A;  2KLF A;  1B3F A;  5DVJ A;  1FCK A;  2B65 A;  2ZZV A;  4H1X A;  4N6K A;  4GWS A;  1GV8 A;  1FPG A;  1QUI A;  3DLN A;  1LBB A;  5TPA A;  1LB9 A;  3RPL B;  5CI5 A;  1IXI A;  4TLL B;  5AA2 D;  5I59 B;  2F35 A;  1BKA A;  1IZ1 A;  1ANF A;  2OK2 A;  3QYT A;  3Q26 A;  1LAX A;  5ISU A;  1PBP A;  3VE1 B;  1UIV A;  3CHG A;  4HW8 A;  4ZEK A;  2E1S A;  5KCJ B;  1B5J A;  4OER A;  2NVU B;  2QJE A;  3T9X B;  3IB1 A;  2GH9 A;  3Q25 A;  3E13 X;  1MM6 A;  2AIX A;  2PMS A;  4P1E A;  2CZL A;  4IO5 A;  5I2N A;  4IY5 A;  2BJJ X;  4POW A;  4PAK A;  5TU0 A;  4RY1 A;  2RCA A;  2D5W A;  3BKI B;  2DE2 A;  4LZ7 A;  2Z22 A;  2I49 A;  2GHA A;  4IO6 A;  1B40 A;  2Y7W A;  4NTL A;  3RN8 A;  2Q74 A;  4RK9 A;  5TPA B;  1USY H;  4PFI A;  4GWO A;  5ICQ A;  2V3U A;  4OVT A;  5L9S A;  3LSX A;  1A8E A;  4JVC A;  4R73 A;  4OVR A;  1BTJ A;  3H03 A;  1TXF A;  3PUW E;  5CMK A;  4O3B A;  3ILU B;  5I7I A;  2R71 A;  3RTF B;  1YAE A;  5CM6 A;  5H8S A;  1B3G A;  4GL8 A;  3CSB A;  4G8N A;  4DCX A;  4Z7E A;  5H8F B;  4ZEI A;  5TP9 A;  1NV3 A;  3RT8 A;  3UK4 A;  4JBZ A;  1FQA A;  4ZEC A;  4O7M A;  4HCW A;  1LB8 A;  3USD A;  4XKN A;  1XOC A;  2OJT A;  2DWA A;  2QSX A;  4MH5 A;  4I3Y A;  3O29 A;  1MXX A;  4XFE A;  3TPA A;  4JDF A;  1LCT A;  4JVI A;  4OZ9 A;  3PUZ E;  3MZ1 A;  3SER A;  3KBR A;  4IO2 A;  5KCJ A;  4NF6 A;  1AWB A;  1ZTY A;  1FBP A;  4R74 A;  3T66 A;  3VFJ A;  3RUM A;  4JB7 A;  3PPQ A;  3TQW A;  1SW5 A;  3MVW A;  5AA3 A;  5JTY B;  4Q30 B;  3C36 A;  4F3B A;  4ZE9 A;  3EQ1 A;  4BLA A;  3FXU A;  4TLM B;  2ALU A;  4AB6 A;  1EU8 A;  4PFT A;  3LBS A;  1XHY A;  3MAM A;  2XD3 A;  3CVG A;  3K4U A;  4EF1 A;  3T0J A;  4ZEB A;  1DPE A;  4X1B A;  4OXV A;  1IIW A;  3IR1 A;  1LBX A;  1SW2 A;  3S9M C;  1JEU A;  2H5Y A;  1FBH A;  4OYV A;  1P1O A;  4O94 A;  4IO3 A;  1ZBM A;  1NFT A;  3TQL A;  2ZMB A;  4MCO A;  2PX1 A;  1FSA A;  4G68 A;  3PU5 A;  2HAV A;  3QK6 A;  3RLF E;  3KC0 A;  2OWZ A;  3OO6 A;  2Y7K A;  1FW0 A;  5FTH A;  1LCF A;  3KOT A;  4GL0 A;  2V25 A;  1NV5 A;  2WX9 A;  4GBW A;  2REJ A;  2XXP A;  1B51 A;  4U1Z A;  1B1H A;  2UVH A;  4KI0 E;  3GLB A;  3K00 A;  1INP A;  1I6Q A;  1MXY A;  3OXN A;  4R2F A;  2OBG A;  4F2Q A;  4THI A;  2KQZ A;  4FED A;  2F3D A;  3JYR A;  3PMV A;  3W9V A;  4JWX A;  3MST A;  4U2R A;  1B46 A;  3TCG A;  4DXU A;  4Z0I A;  2B3F A;  2Q8M A;  1VFE A;  3FV1 A;  3DP8 A;  1K9Z A;  1OQG A;  2FYI A;  1P1N A;  3RY3 A;  1B7U A;  3FAS A;  2CMO A;  4R6H A;  4OHN A;  3THI A;  4XXU A;  1IXC A;  1KA0 A;  4HTG A;  1HSJ A;  1FBE A;  3QSL A;  4MLQ A;  1T0K A;  1B3L A;  1EZ9 A;  1RYO A;  4AS5 A;  2F78 A;  1VDW A;  2HAU A;  2HQ0 A;  3FJ7 A;  4OEU A;  5I57 A;  1NMU A;  1MQD A;  4PBQ A;  4LP2 B;  3SEW A;  2B3B A;  3EPE A;  1RDX A;  4G68 C;  3H06 B;  3MZB A;  4E0X A;  1F9B A;  2HXR A;  1YTV A;  5FBP A;  2X26 A;  1FTK A;  3UIF A;  1FBG A;  2F6G A;  4PP0 A;  1LBY A;  3DP4 A;  3O6G A;  2Z8E A;  3IO4 A;  2UVI A;  2DXR A;  3HHG A;  5AE4 A;  5HM4 B;  4H67 A;  4MFI A;  3FZV A;  1LBC A;  1NUZ A;  4I8C A;  1JQF A;  2ANJ A;  3G3J A;  1B52 A;  4H46 A;  3H4Z A;  4WED A;  2MKZ A;  3OEL A;  1OQH A;  3PMX A;  1FTA A;  3HN0 A;  4TOZ A;  3GZG A;  2GRV A;  5CBS A;  4N6D A;  4QXD A;  3C35 A;  4XEQ A;  2G93 A;  1R9L A;  5H8N A;  4U4S A;  4NHB A;  1B58 A;  1LBV A;  1MPC A;  2OZZ A;  5I57 B;  1QVS A;  2WBB A;  5F7V A;  1EYJ A;  3CFL A;  4C1T A;  5DVF A;  1FPE A;  1Q35 A;  1B4Z A;  1Y4C A;  1IIT A;  4NAP A;  3LV0 A;  2XXV A;  4PET A;  4EQB A;  1IXG A;  1P1U A;  2RF1 A;  2XXW A;  3FAT A;  3FIR A;  3U8Q A;  4KCD A;  3G3F A;  4GWY A;  5K2Y A;  3TYH A;  1NH7 A;  3VXC A;  1MPB A;  4RJZ A; 
#chains in the Genus database with same CATH homology
 3JV9 A;  3OD7 A;  2O1L A;  4NWC A;  3M3L A;  3G3I A;  4RA1 A;  1SW1 A;  2YLN A;  3HPI A;  3LSL A;  2M8C A;  1O64 A;  3D4C A;  3KSJ A;  3O6I A;  4ELO A;  1II5 A;  1LLS A;  2WKY A;  5BWJ A;  3C34 A;  3IAZ A;  4C1U A;  1HSE A;  1H44 A;  3BBR A;  3EN3 A;  4QHQ A;  1QW0 A;  1MY1 A;  1US4 A;  3BFT A;  3TCF A;  4UAC A;  3T93 B;  5L9O A;  4KD5 A;  4QSD A;  1IQ7 A;  5H8H B;  4JSO A;  4EXK A;  4HS7 A;  4ESW A;  1MXU A;  2NOO A;  3RT6 B;  5A5X B;  1NNT A;  1Q1K A;  1N7W A;  3TEL A;  3Q28 A;  3RTW B;  1VFD A;  3N5L A;  4YIC A;  3E3K A;  1AIV A;  3R6U A;  3RPW A;  3FVG A;  3ZS6 A;  1TWY A;  2A5S A;  3SEX A;  1H45 A;  2A5T A;  2F34 A;  2KLF A;  1B3F A;  2GHB A;  3IX1 A;  2D21 A;  1FCK A;  3CG1 A;  5DVJ A;  3ONM A;  2B65 A;  4PFU A;  4FEC A;  4H1X A;  4YAH X;  1PB8 A;  4F29 A;  1UTB B;  5FHO A;  2OLB A;  3FXQ A;  1GV8 A;  1QJM A;  1POT A;  1QUI A;  1R1N A;  3DLN A;  5HBC A;  1LBB A;  4QFP A;  1I69 A;  5TPA A;  1LAF E;  3M3K A;  4IGR A;  1MPD A;  1LB9 A;  3GBA A;  2IEE A;  4F22 A;  5I56 A;  5CI5 A;  1IXI A;  3H6V A;  1POY 1;  2VP1 A;  4TLL B;  3TOD A;  5AA2 D;  4OTE A;  2F35 A;  1Y20 A;  5I59 B;  1EZP A;  4RXL A;  1BKA A;  2V3Q A;  4LQ5 A;  1IZ1 A;  3TTK A;  3U94 A;  5ITP A;  4EF2 A;  1ANF A;  1TFD A;  2OK2 A;  3KOS A;  4IO7 A;  3QYT A;  4XKP A;  5JTY A;  4RPO A;  3Q26 A;  4ZZE A;  1LAX A;  4YMA A;  1PBP A;  3VE1 B;  1DPP A;  5ISU A;  2OCU A;  4YMB A;  1UIV A;  1I6A A;  2F7B A;  1MH3 A;  3GBB A;  2PVU A;  2I6E A;  5AA4 B;  4WKM A;  4G68 B;  4FIM A;  1YPN A;  3IO6 A;  1MY0 A;  3CIJ A;  1JW4 A;  2ESN A;  4HW8 A;  2XXT A;  3TFL A;  4ZEK A;  4IB2 A;  4BDR A;  2E1S A;  3KZG A;  3CSG A;  3O9P A;  1ZLQ A;  5KCJ B;  1B5J A;  3IOW A;  1SQY A;  1P99 A;  1USY E;  2ABH A;  2OWS A;  4OER A;  3D4G A;  2QJE A;  3OEM A;  1H3D A;  1FTM A;  2W7Y A;  3HCQ A;  2H98 A;  2HZK A;  3K02 A;  3IB1 A;  2GH9 A;  1XC1 A;  3LSF B;  3Q25 A;  3DP6 A;  1MXV A;  3CFX A;  4LVQ A;  4XTC Q;  3KEI A;  3E13 X;  3SKP A;  1MM6 A;  4QFO A;  4N13 A;  4XKR A;  2AIX A;  1J1N A;  2PMS A;  3FJG A;  2YPN A;  3V83 A;  2CZL A;  3LR1 A;  4IO5 A;  4RNS A;  5I2N A;  1A99 A;  1NNP A;  2BJJ X;  1N84 A;  2ZNU A;  3H6W A;  2QMW A;  4FJP A;  2PBW A;  4IY5 A;  4POW A;  4OQO A;  4X48 A;  3WAE A;  4ECF A;  4FAJ A;  3TUS A;  5TU0 A;  4RY1 A;  3HHF A;  4OWD A;  1PB9 A;  1Z7N E;  2FA7 A;  2PT1 A;  2RCA A;  3G3G A;  2D5W A;  4PE5 B;  3T9U A;  3BKI B;  2DE2 A;  4G8H A;  1TFA A;  2XX9 A;  1NKX A;  1M5F A;  1B5I A;  5B7D A;  4LZ7 A;  2Z22 A;  3VVE A;  4NF8 B;  2I49 A;  4F19 A;  2GHA A;  2V93 A;  3A09 A;  3AXF A;  3FV2 A;  3K0V A;  3K6V A;  4IO6 A;  2YJP A;  3EHS A;  1WDN A;  3DEL B;  3TAJ A;  3MJN A;  1S50 A;  1FQE A;  1XVX A;  2O1M A;  1B40 A;  2XXQ A;  4RPN A;  1LFI A;  2Y7W A;  4YB7 A;  4NTL A;  4F3P A;  4BDO A;  4EQ9 A;  3U1O A;  3RN8 A;  3IOU A;  4GXA A;  1B3H A;  3ODB A;  4RK9 A;  4YKP A;  5TPA B;  1USY H;  3VLW A;  3DM0 A;  4DXB A;  4K3F A;  1MXZ A;  1A55 A;  1B6H A;  4GWO A;  4OFJ A;  3VLU A;  1I6B A;  2ONR A;  5ICQ A;  2V3U A;  4I9D A;  5L9S A;  3LSX A;  4I1D A;  3H7M A;  1P1W A;  4U4X A;  1A8E A;  1URD A;  2XX7 A;  4R73 A;  4FAT A;  4H5G A;  5DTB A;  3A3C A;  2VOZ A;  3IOR A;  3PPP A;  4JWY A;  1BTJ A;  3H03 A;  1TXF A;  1MQJ A;  1N3X A;  3PUW E;  5IKB A;  5CMK A;  3OMB A;  4EDP A;  4O3B A;  4F1U A;  3ILU B;  1RYX A;  3FUZ A;  2R71 A;  4KR5 A;  3RTF B;  4EUO A;  5KZT A;  2XXX A;  1YAE A;  1ZIU A;  5CM6 A;  1AMF A;  5H8S A;  2QS1 A;  1SDX A;  1B3G A;  5I58 A;  1LFH A;  2XD2 A;  1D4N A;  3CSB A;  4G8N A;  4GL8 A;  4H0W A;  1OLA A;  2ZNS A;  4NF6 B;  4DCX A;  5H8Q B;  4Z7E A;  5H8F B;  4ZEI A;  5TP9 A;  3PGF A;  4EQ7 A;  1D9V A;  2VGQ A;  4WEP A;  5JEI A;  4F18 A;  4YZZ A;  3RT8 A;  2XXY A;  3KJ7 A;  1QKA A;  4JBZ A;  2F7A A;  4LAT A;  1JVX A;  4QRZ A;  1FQA A;  4YKK A;  1MG1 A;  3UK4 A;  2G29 A;  4ZEC A;  2OWT A;  1XVY A;  1B7H A;  3K6X A;  2UVJ A;  2ZYM A;  4ZEF A;  1XT8 A;  4F1Y A;  3G7W A;  2I3W A;  1GTK A;  4X1D A;  2P2A A;  3K6W A;  3VV5 A;  2GFE A;  1N04 A;  2I0C A;  1BP5 A;  4HCW A;  1PDA A;  1LB8 A;  5AA1 A;  4OFO A;  3USD A;  3S2V A;  3KJT A;  3TTN A;  2DVZ A;  4IY6 A;  1LGB C;  1NH8 A;  1B9J A;  1LAG E;  4XKN A;  2RCB A;  5IAI A;  1UTH A;  3U92 A;  2DWI A;  4ONY A;  3CI8 A;  2V3T A;  1XOC A;  2OJT A;  1JW5 A;  2DWA A;  2F97 A;  1B7Z A;  1N0T A;  2QSX A;  1FQD A;  3TEP A;  4MH5 A;  1MXW A;  1GR2 A;  4OMB A;  3O29 A;  4LZ8 A;  1MXX A;  3TPA A;  1N3W A;  1JW1 A;  1EZO A;  3H3G A;  4QFN A;  4JDF A;  1LCT A;  4UA8 A;  4DZ1 A;  2H9B A;  4OZ9 A;  3PUZ E;  5DEX A;  4C0R A;  2ONK E;  2AYS A;  4R6Y A;  3MZ1 A;  2RC7 A;  3SER A;  3KN8 A;  3IL1 B;  3KSX A;  3KBR A;  4IO2 A;  3UOR A;  4GLI A;  5I2K A;  3GXA A;  1VSO A;  3O6H A;  5KCJ A;  5FHM A;  2Y7P A;  4ZS9 A;  2Q2A A;  1Y3Q A;  4M4G A;  3VDF A;  2DQV A;  4ZDM A;  4NF5 A;  4NF6 A;  2THI A;  1ZTY A;  5I57 B;  1OMP A;  5ITO A;  1B0L A;  3IOV A;  1MQH A;  3MC2 A;  4BDN A;  4R74 A;  1PC3 A;  3T66 A;  5KDT B;  2PYY A;  2QS4 A;  3RUM A;  4JB7 A;  3VFJ A;  1MM7 A;  3CRB A;  3O66 A;  3PMW A;  3QUJ A;  1EH3 A;  1FTL A;  3PPQ A;  4ZED A;  1L5T A;  3U93 A;  2ZNT A;  1SW5 A;  3MVW A;  3SES A;  3TQW A;  4BDL A;  5AA3 A;  5JTY B;  4RYA A;  1ATG A;  4Q30 B;  5AA2 B;  4Q0C A;  1A8F A;  4KYS A;  4PQJ A;  4XIG Q;  3C36 A;  3FD3 A;  2QS3 A;  3SEY A;  4F3B A;  1Y3N A;  1FTJ A;  2VD3 A;  4XKQ A;  1SI1 A;  4ZE9 A;  3EQ1 A;  1WOD A;  1XS5 A;  1UTH B;  3FXU A;  4BLA A;  4TLM B;  3SDF A;  2ALU A;  3FJM A;  1Y4T A;  3H6T A;  4AB6 A;  3ILT B;  1EU8 A;  4PFT A;  3LBS A;  5CC2 A;  1XHY A;  1D9Y A;  3MAM A;  2XD3 A;  1OIB A;  3CG3 A;  3CVG A;  4KQP A;  3TTR A;  3K4U A;  1CE2 A;  3N26 A;  3SEU A;  4EF1 A;  1PBQ A;  4H5F A;  4MBP A;  5F1Q A;  4F39 A;  1N76 A;  1KWH A;  3FVK A;  3V8X B;  4ZEB A;  1B0H A;  1DPE A;  4X1B A;  4OXV A;  3RGY A;  1IIW A;  2UXA A;  3IR1 A;  1MRP A;  3C33 A;  3Q27 A;  3V89 B;  4R72 A;  3TDJ A;  1H76 A;  4P11 A;  3HST A;  1Y1Z A;  3W15 C;  1SW2 A;  3LUY A;  3Q29 A;  4JXI A;  2DWJ A;  5DVI A;  3WAF A;  3VVF A;  4ZE8 A;  3T9H B;  4H65 A;  4DCY A;  4ELQ A;  3S9M C;  1JEU A;  4R9G A;  1M5B A;  2H5Y A;  1AH5 A;  3MP6 A;  4OYV A;  1D3K A;  1NL5 A;  4H6D A;  4LON B;  1MDP 1;  1P1O A;  2I3V A;  2QRY A;  4Q5T A;  5LOM A;  1QUL A;  5FTI A;  5H8F A;  3OO8 A;  1URG A;  2RKM A;  5BUU A;  4KYE A;  5DT6 A;  5L8D A;  4KCC A;  4IO3 A;  1ZBM A;  3B6Q A;  1LAH E;  1NFT A;  5CMC A;  3QIM A;  3TQL A;  5I2N B;  2ZMB A;  2PX1 A;  2XXH A;  2XX8 A;  3E9X A;  4O3C A;  4PFY A;  3O2A A;  3PU5 A;  2HAV A;  4G68 A;  2XHD A;  3QK6 A;  3I5O A;  3RLF E;  3KFM A;  2H99 A;  5J1D A;  3OO9 A;  1OVT A;  1SW4 A;  3OO6 A;  4OEN A;  2Y7K A;  2NUV A;  4BDM A;  1M5D A;  4GFR A;  1JEV A;  3L6H A;  3QAX A;  1H43 A;  5CBR A;  3N94 A;  1O63 A;  4LUB A;  5CMM A;  1FW0 A;  1A7L A;  2O68 A;  1MDQ A;  1LCF A;  3P7I A;  5FTH A;  1OLC A;  3KOT A;  4GL0 A;  1QKB A;  2V25 A;  3O97 A;  3H6U A;  4KPT A;  3S9N C;  2DE4 A;  3A3U A;  4ELP A;  2REJ A;  3I3V A;  2QL3 A;  3M8U A;  4OFL A;  3PUY E;  1UQW A;  1AL3 A;  1AOV A;  3PUV E;  2XXP A;  4O3A A;  1LST A;  1VE4 A;  3FVN A;  3M3F A;  1UTB A;  4PFW A;  1B51 A;  4U1Z A;  2NVU B;  1B1H A;  1HSL A;  1SI0 A;  2UVH A;  3OEK A;  4KI0 E;  1Y9U A;  3LSW A;  2P1S A;  3GLB A;  3LC8 A;  4LZ5 A;  2ZYK A;  2A5T B;  2FNC A;  2F6P A;  3K00 A;  3ZKL A;  4AQ4 A;  4F1V A;  4KFQ A;  4P0G A;  3UN6 A;  3MPK A;  2AL4 A;  1Y1M A;  4P0I A;  2AL5 A;  3B6W A;  1BIY A;  4JSD A;  3OOA A;  1I6Q A;  4GD5 A;  5H8H A;  2O6A A;  1MXY A;  2RIN A;  3MW0 A;  3MBP A;  3T22 A;  3OXN A;  3TZA A;  4EXL A;  4G8M A;  4H8J A;  4GVO A;  2F8D A;  4R2F A;  1FQF A;  2OBG A;  2PT2 A;  4F2Q A;  1ZMG A;  2IA4 A;  1JVY A;  4THI A;  1P1Q A;  4FED A;  1B2H A;  4QFL A;  5DYH A;  5JK4 A;  3JYR A;  3PMV A;  3W9V A;  1IEJ A;  4OES A;  4R9F A;  2LAO A;  2ZYO A;  1Z7M E;  1BLF A;  3V5A A;  1B05 A;  4JWX A;  3MVZ A;  4U2R A;  2DP8 A;  1B46 A;  3T96 B;  3VLV A;  1MY2 A;  3S9L C;  4RK2 A;  3TCG A;  4AB5 A;  4DXU A;  4Z0I A;  2B3F A;  4FE8 A;  4U23 A;  3MZ9 A;  5DEX B;  3K6U A;  2DOJ A;  4F3G A;  2F36 A;  1VFE A;  3FV1 A;  2QPQ A;  3DP8 A;  3EF7 A;  3K1P A;  1OQG A;  3K01 A;  1QUK A;  2FYI A;  3ZSF A;  1GGG A;  4ND9 A;  3MPL A;  3MVX A;  2DS9 A;  2HZL A;  2HEU A;  2R9J A;  4NWD A;  4YB6 A;  4DE8 A;  4F2O A;  5CMB A;  1P1N A;  4OET A;  3RY3 A;  1B7U A;  1MH4 A;  5AA4 A;  2I0B A;  3FAS A;  2R6G E;  3JZJ A;  4F31 B;  1ZKB A;  2CMO A;  2NWJ A;  4R6H A;  1PB7 A;  5FHN A;  2Z23 A;  3EHU A;  3HO7 A;  4MF3 A;  4OHN A;  3RQT A;  1B32 A;  3THI A;  4QSC A;  3S9E A;  3FXR A;  3T9V A;  4XXU A;  1DTG A;  1IXC A;  5I59 A;  5ICT A;  2F7C A;  2XXU A;  4YKJ A;  4FOR A;  1N7X A;  4HTG A;  3CR9 A;  3T9X B;  3ZKK A;  3VVD A;  1S9T A;  1HSJ A;  1ZU0 A;  1B3E A;  1B5H A;  2HXW A;  2X7Q A;  3QSL A;  5I56 B;  4MLQ A;  3B7D A;  5EYF A;  1T0K A;  4R6K A;  4NED A;  1B3L A;  3MQ9 A;  3SEV A;  1EZ9 A;  4ISU A;  1RYO A;  3PUX E;  4TQU Q;  5KDT A;  4DDD A;  3UGW A;  2Z8D A;  2DXY A;  3N6U A;  3IJX B;  2F5X A;  2F78 A;  4G2Z A;  2HAU A;  1B1X A;  1US5 A;  2HQ0 A;  2I48 A;  3FJ7 A;  4OEU A;  5CRY A;  2I58 A;  2Q88 A;  1MS7 A;  3IB2 A;  4IO4 A;  3TCH A;  3PPR A;  5I57 A;  2ONS A;  4YKI A;  4N07 A;  3RNN A;  1SBP A;  1QUJ A;  3FGS A;  3IK6 B;  2O7I A;  1NMU A;  1MQD A;  2VD2 A;  4NF4 A;  2DVC A;  4LP2 B;  5I58 B;  1Y3P A;  1DSN A;  1S7Y A;  3KN7 A;  3SEW A;  1DOT A;  2B3B A;  3BFU A;  3EPE A;  1URS A;  4U21 A;  2V84 A;  4QSE A;  5A5X A;  1MY3 A;  1UIU A;  3KG2 A;  3MP8 A;  4GOT A;  4LQ2 A;  4G68 C;  3H06 B;  3MZB A;  4E0X A;  3EHT A;  1F9B A;  4NF4 B;  3ECR A;  1MY4 A;  3OO7 A;  4R75 A;  3G3K A;  2Q9T A;  5HPQ A;  3TMG A;  1YTV A;  3SET A;  1GVC A;  5I84 A;  5B70 A;  2X26 A;  1R9Q A;  3K1M A;  4N6P A;  3PD9 A;  1FQB A;  2UVG A;  1FTK A;  4ESX A;  1DMB A;  3MWB A;  3UIF A;  2VHA A;  1VR5 A;  4MLV A;  3K1N A;  2F6G A;  1A40 A;  2O51 A;  4PP0 A;  3DP4 A;  3KGC A;  3C4M A;  3FVO A;  3O6G A;  1LFG A;  2Q8J A;  2Z8E A;  1M5C A;  2DSF A;  3S4U A;  2E0S A;  3N6T A;  4OVJ A;  1B4H A;  2P0S A;  4X9T A;  3IO4 A;  4QF9 A;  4BDQ A;  3F11 A;  4FEB A;  4GXS B;  2UVI A;  2RC9 A;  5L9M A;  2D3I A;  1SD3 A;  2DXR A;  2Q89 A;  4U22 A;  2O69 A;  3HHG A;  4JWO A;  5AE4 A;  1NNK A;  2QS2 A;  5HM4 B;  4GQO A;  2I4B A;  4H67 A;  4MFI A;  3FZV A;  4G4P A;  1LBC A;  3PPN A;  4HCY A;  4I8C A;  5ELV A;  3W9W A;  3KN3 A;  1JQF A;  2ANJ A;  3G3J A;  4R2B A;  3VXB A;  1B52 A;  1PEB A;  3TTM A;  1NNF A;  1SYI A;  3CFZ A;  3H4Z A;  4WED A;  5I2K B;  4LA9 A;  5M2V A;  5TP9 B;  3OEL A;  1OQH A;  2XXR A;  3PMX A;  1DTZ A;  3HN0 A;  4TOZ A;  5EHM A;  2H4I A;  3IJO B;  3GZG A;  4YB5 A;  2DE3 A;  2GRV A;  4DLD A;  3OSR A;  3O28 A;  5AA2 A;  5CBS A;  2Z8F A;  4DXC A;  4Q8R A;  4GIZ A;  1SYH A;  3C35 A;  2G93 A;  2RC8 A;  1M5E A;  5K2X A;  1R9L A;  3TKD A;  4GF8 A;  3PV0 E;  3PD8 A;  5H8N A;  4U4S A;  1A54 A;  4U1O A;  2REG A;  3C32 A;  5H8Q A;  3C9H A;  4YU0 A;  4NF5 B;  1TT1 A;  3QXM A;  1B58 A;  1MPC A;  1O7T A;  2OZZ A;  2DWH A;  1QVS A;  2X7P A;  2UYE A;  4IGT A;  4KHZ E;  4L17 A;  1IXH A;  3G3H A;  4I62 A;  4NE4 A;  4OEV A;  5H8N B;  5F7V A;  1FQC A;  4DIG A;  1FTO A;  2DYX A;  2HCA A;  3CFL A;  3TTL A;  1RKM A;  4C1T A;  4POX A;  1CB6 A;  2ZXT A;  3R7X A;  2UYF A;  1R6Z A;  2Y7R A;  5DVF A;  3IB0 A;  3MUQ A;  3OSQ A;  1SVX B;  1Q35 A;  3UA8 A;  2H25 A;  1B4Z A;  4M1V A;  3PPO A;  1MQG A;  2Y7I A;  2XXI A;  3MP1 A;  1ZJL A;  3B6T A;  2HFB A;  1Y4C A;  1IIT A;  4H8I A;  3R26 A;  4WXJ A;  2XXV A;  4PET A;  2O84 X;  4EQB A;  2I4C A;  4ZZA A;  3IOT A;  3L6G A;  2Q2C A;  1IXG A;  1P1U A;  4QFK A;  1OVB A;  4KYD A;  2RF1 A;  3I6V A;  4G77 A;  2XXW A;  2O7U A;  3FAT A;  3QUF A;  2NXO A;  3K2D A;  4NMY A;  4F3S A;  3HV1 A;  3UP9 A;  3FIR A;  2Y84 A;  3U8Q A;  1ELJ A;  3U72 A;  3C31 A;  1JET A;  1WVJ A;  1MQI A;  2QMX A;  2ZYN A;  1JNF A;  3E4R A;  3G3F A;  4KCD A;  4E0W A;  3MVY A;  5K2Y A;  1YCJ A;  3OEN A;  3TYH A;  1NH7 A;  4GRK A;  4NF8 A;  1MPB A;  3VXC A;  5EHS A;  4RJZ A;  4ELR A;  1IUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...