2OK7A

Ferredoxin-nadp+ reductase from plasmodium falciparum with 2'p-amp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
312
structure length
262
Chain Sequence
b'NFINLYTVKNPLKCKIVDKINLVRPNSPNEVYHLEINHNGLFKYLEGHTCGIIPYYNKKQRCARLYSISSSNNMENLSVAIKIHKYEQNYGYCSGFIKNLKINDDIYLTGAHGYFNLPNDAIQKNTNFIFIATGTGISPYISFLKKLFAYDKNNLYNSNYTGYITIYYGVYNEDSILYLNELEYFQKMYPNNINIHYVFSYKQNSDATSFYVQDEIYKRKTEFLNLFNNYKCELYICGHKSIRYKVMDILKKKKKRVHVEVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ferredoxin--NADP reductase
molecule tags Oxidoreductase
source organism Plasmodium falciparum 3d7
publication title Ferredoxin-NADP(+) Reductase from Plasmodium falciparum Undergoes NADP(+)-dependent Dimerization and Inactivation: Functional and Crystallographic Analysis.
pubmed doi rcsb
total genus 73
structure length 262
sequence length 312
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2ok7A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2ok7A02
2QMUA 4FN5A 4YAWA 3CCEB 1OGJA 1W35A 1VQ6B 3I1FA 2EIXA 1KC8D 2VNJA 2B5OA 2B7CA 1EFTA 3U6BA 1AMOA 4M53A 3CCQB 3CCMB 4ZGQB 1QH0A 4YAOA 3W5VA 1K9MD 2J7KA 4ZV4A 2QN6A 3WBKA 4G1BA 2YWEA 2BN4A 1VQOB 2PIAA 3VO1A 4RD4A 3AVVA 3E1YE 1G7TA 3AVTA 1F20A 1EFCA 3W2GA 3CW2A 4B48A 1EP2B 3LRXA 2OTLB 4G1VA 1DG1G 1GAWA 1E62A 1XB2A 1CNFA 1GO2A 3AGPA 2ZITA 2VYQA 1VQKB 1KK1A 5GV7A 1XE1A 1J9ZA 1QGYA 2OTJB 2DERA 1KK2A 1JJ2B 5THXA 1SM4A 3QFCA 2FX3A 4MYTA 3WBJA 2BPOA 4TMZA 1QVGB 4Y7CA 1W2BB 1E64A 1A8PA 4QHYA 1F60A 1S0UA 4DQLA 3MHPA 4DQKA 3ZZUA 3FPKA 3LVBA 5GV8A 4TMWA 1Q86D 1ZM2A 3LYUA 1KQSB 1KTVA 1QX4A 1G7CA 3B82A 1GR1A 3MCAA 1OB2A 3E20A 3WNCA 3ZZ0A 1IB0A 4B3XA 3W2HA 5JBQA 2YWFA 2R6HA 5TV2A 1YJNB 4AC9A 4TMTA 2HDNB 1JA1A 2XNCA 1SKQA 3FJOA 4YHBA 1H85A 3QFSA 1S72B 2EFGA 1GAQA 1N8RD 4PGOA 2RC6A 4U9UA 3CXCB 1U2RA 1HA3A 3G6EB 1FDRA 3OZWA 1E63A 4LC0A 1IJEA 1QFYA 3CC7B 3AVXA 4B47A 1YITB 1KK0A 4WQMA 5DSZA 4TMXA 3AVUA 4B44A 3WXMA 1ZM9A 4MYUA 2BVNA 2HCJB 4ZCIA 1KD1D 4RD1A 3OW2B 1VQ8B 2YWHA 1JA0A 4ZCLA 4RD6A 1VQNB 1KK3A 3ZZTA 3JQQA 1DDIA 5HXBA 1BJKA 4G5GA 4K1XA 1BQEA 4RJLA 2DY1A 1YJ9B 1QG0A 4C0SA 3OJWA 4PC6A 1AIPA 1TLLA 2X3UA 3P26A 3P27A 2VNKA 1YIJB 2GQFA 4RD3A 1D8TA 3U2QA 2CRVA 1W87A 1G7SA 1Q81D 3AVYA 2BM1A 3CPWB 1QUFA 1QVFB 4N3NA 4YAUA 4NBSA 3G71B 4ACAA 5FA6A 1R5BA 4LBYA 2QTLA 1OB5A 4PC2A 3W2FA 2HMAA 1DDGA 4TN1A 4RCZA 1CQXA 4PC3A 2NPFA 5TY0A 1KRHA 4TMVA 3CCRB 1EP1B 4RCYA 2QDXA 4ZCMA 1D1NA 1VQ7B 3B8HA 3I55B 1YHQB 2BF4A 4LBZA 3SJZA 1UMKA 1QFZA 1FRNA 3W2EA 2VZLA 1B23P 2BV3A 3AGQA 4P3YA 3ZBTA 4C43A 4YALA 3ZBUA 1QGAA 1YI2B 3ZC3A 1CNEA 1FRQA 1ZM3A 1R5NA 4LBWA 4ZGNB 1VQ5B 3CB4A 5TR9A 3W5HA 3QFTA 1NDHA 1DARA 2GPJA 3CCUB 4EH1A 1YJWB 3VNUA 2BM0A 4M0LA 2CNDA 5H59A 1Q7YD 2QA4B 1N0UA 3WY9A 4F7DA 2DEUA 4QFMA 4B43A 1I7PA 1VQLB 1D2EA 5AN9A 3J81k 1QUEA 1QGZA 2YWGA 4B4DA 3OZUA 4PC7A 4FK8A 4P6VF 3CD6B 3W2IA 3U6KA 1M1KD 3VMFA 3WNBA 1Q82D 4FWTA 1ZM4A 4AF7A 3MMPA 2BMWA 3CRZA 4M2LA 4R71A 2C77A 1IJFA 1FNCA 4HE5A 4N3GA 1K73D 3WYAA 3QSYA 1EP3B 3JQPA 1BX1A 1TVCA 1FNMA 4AF6A 1H42A 3W5UA 4HE6A 3CC4B 1G7RA 1BX0A 2E1RA 2B7BA 1WDTA 2PLFA 3AVWA 3PENA 3B78A 1TUIA 4BPRA 1TTTA 3VNVA 1NJID 5EMNA 1VQ9B 2BGJA 3I56B 2XEXA 4RD0A 3CMAB 3CC2B 1VQ4B 4PC1A 1EXMA 2D74A 1VQMB 2C78A 4YAFA 3CMEB 2RC5A 4H9GA 4J0QA 2XNJA 4IW3B 4Y9RA 3A1FA 2OK7A 1JB9A 2AHOA 3QFRA 4M1KA 2VNHA 3V76A 3CCSB 1ZUNB 1B2RA 3WNDA 2VNIA 4UAJA 2QTZA 1W34A 3VO2A 1N0VC 3ES9A 5KSWB 4ACBA 2BGIA 1K8AD 3JQRA 4Q7JB 3G4SB 1FNDA 1KJZA 1FNBA 3LO8A 1GJRA 4NCNA 2PMDA 4Y9UA 1VQPB 1JNYA 1GVHA 2DETA 2DCUA 5H5JA 1M90D 4RD2A 1OGIA 1EWYA 4M4SA 1QFJA 3CCJB 3CCLB 3OJXA 1R5OA 3OZVA 2OK8A 3QE2A 2QEXB 4LBVA 3CCVB 1EFUA 2BSAA 1ELOA
chains in the Genus database with same CATH superfamily
1NB9A 2OGSA 5COBA 5AJHA 3T3OA 3RRYA 1GADO 4B79A 1A0OA 2IHUA 1RRCA 1NW9B 3K9BA 1SULA 4W7SA 3GMTA 3A0UA 2I4TA 1OFTA 5D5QA 4CFSA 5AVUA 3DMYA 2OOSA 3JYOA 2YV3A 4HZIA 4C4TA 1NM5C 2HBZA 3I2JA 2Y68A 3THXB 2EIXA 2RHMA 4U2CA 3Q5DA 1NGSA 3BTSA 4QBKA 2B5OA 3RNLA 1WORA 4RKWA 5BNTA 2QVZX 3MCWA 3P71T 5EE0A 5LMCA 5LUAA 1KC3A 2WT4A 1HMYA 5IMBA 1XDWA 5IDVA 5JS7A 5JG7A 2ZM6B 5D86A 3E81A 1EFKA 4ICIA 5D87A 4K87A 3R9KA 4YAOA 2VHVA 4KVAA 3RYCA 2Q8PA 3NH9A 5GTDA 1CY7A 4PTZA 4A0HA 4HDKB 2RHDA 4IJVA 3UT5B 4QOEA 2GFHA 1KR5A 1Q44A 3CUSA 4WVFA 5F4OA 1E2MA 3QVTA 2AL7A 4BHTA 3HXMA 2UDPA 5F1OA 3TJZA 4TVSA 3WRVA 1DXOA 1KJYA 4Q4HB 2XUIA 4K2HA 3ZGVA 1RRMA 2UXDB 3C7KA 1RBZA 5FBLB 1KSGA 4GLBA 2GXUA 2Z6BD 2GKOA 3S1AB 4EYSA 3HTXA 1KP9A 1KI8A 2IEDA 4WAUA 3AVTA 4H17A 3UFXA 5A1JA 3AI7A 3QE9Y 2GS9A 5HMLA 1EBFA 3ESCA 2WJGA 2G0NA 4TM8A 3ND9A 4KCGA 4XQCA 3E4DA 1H6BA 3CW2A 1R0BA 4ZZ2A 3MXTA 3RC1A 4S2EA 3EA5A 3JALB 2V8BA 2LKDA 2NG1A 4DLTA 2OC9A 3EJWA 3GOHA 4LZPA 4QXRA 5AK5A 1XF9A 4JP5A 1AGYA 2BWJA 5AHKA 2A6PA 2VTDA 2OPBA 3E05A 3WL3A 3WSTA 5ISMA 1XTVA 1H8HD 4GICA 4YJ2F 5KTKA 3LXRA 1VKOA 2IU4A 4MYSA 4GI2A 4ENVA 3I5YA 1P7WA 1PGJA 3MT0A 1ZNQO 2JAUA 5CFOA 1AURA 3JZFA 2H1VA 1EHIA 4LXQA 5DBFA 4H6VA 2XYRA 2WWVD 1ZK1A 3HXLA 2J3QA 1X38A 5KX5B 1MDFA 3SYRA 1XDSA 5AJVB 3IOEA 4N7MA 2IHTA 2IRWA 2R5NA 3FIJA 3K5WA 4WLOA 1R0XA 4YI3A 1NUAA 1M0TA 2VWPA 5F5NA 2DUUA 2W7TA 3AR5A 4D9IA 3P9XA 3I3OA 1NLZA 4B3BA 1YFZA 5AD1A 4K6OA 3U37A 1UZAA 3CX6A 1NQWA 2IYNA 2I76A 1OWPA 2H92A 2HBQA 3OPNA 1TU3A 3NDIA 4PRLA 1GDTA 2O8EB 4GUAA 5E1DA 3P4UA 3OFNA 2HCRA 2QLTA 1JUDA 2WHQA 3QPAA 1LC3A 2GEBA 3ITEA 5CGQB 5JZSA 3LG2A 2ID7A 4AJ2A 5KNBH 4RVFA 5LQUA 3CZCA 1MP0A 5KOYA 5HE9A 1W2BB 2R66A 4KK3A 4WZBE 1RXCA 3CC8A 2QJWA 3FOAA 4RY9A 4TV9B 3GJ5A 4WZKA 1GT91 3L9WA 3TGWA 2PEYA 4ZI7F 3PYXA 1QG2A 2IW3A 5BURA 1G41A 3AP2A 3CNLA 4NL4H 1VRVA 1YB5A 1GGMA 2FMXA 3DBIA 3K0FA 3QNWA 4CR6A 1T4DA 3I32A 3H99A 3JD0A 4IYRA 1KXZA 2FOIA 2FWBA 1QH8A 3LYUA 4FFNA 4LHEA 1Q0RA 4NWIA 2XWQA 4P84A 4CGZA 1V8BA 1JLMA 1TU0A 3OZEA 3VR3A 2O2YA 4EFKA 1E9CA 2A5JA 2QRQA 3OTQA 1YS7A 4YDHB 1QHHB 1HH4A 1OROA 3N2ZB 4ZOAA 1V5VA 4G8DA 1O6FA 2F3TA 5CA0F 5IWAB 1J2YA 1IXRC 3CPXA 1YJNB 4H27A 3BD6A 4HQLA 5CMLA 3V7YA 1CY2A 4DMLA 2Z58A 1NW8A 1N6HA 5GONF 3QOWA 1ECFA 3DM9B 4LJ6A 4S1PA 4DIMA 3KOWA 3TNJA 2JBAB 3D0QA 3TQRA 5IDYA 2CV1A 2O3RA 2J0UA 1HL3A 4UNPA 5JSZA 1XALA 4JYMA 1AQIA 2UZ3A 4CFYA 3K0FB 2X0NA 3PUZA 2RC6A 5KQSA 3W9YA 4EDHA 4DY4A 5I5EA 1SOVA 1R0CA 1F6BA 3PJEA 1AKEA 3GK3A 4D56A 2G1UA 1DAIA 4LJAA 4D43A 2ZI4A 3F96A 3G49A 4WFKA 3UMSA 3AFIA 4KGZA 1AGNA 3UO8B 3Q3EA 2J4FA 2OENG 5KVAA 3CN7A 4QV2A 2Z04A 1C2TA 3IUSA 3EXIB 2CSUA 3LPMA 3O21A 2CFCA 4GE3A 3WK6A 2JHCA 5B2ZA 1DCFA 2E5WA 3F97A 1ZD9A 3TLKA 1R0RE 5D3MB 4EHAA 5HDQA 4P34A 1KVUA 4BX8A 3AVXA 2RGYA 2FPOA 5FA8A 2H17A 1LXCA 2QPLA 3WJ7A 1VJDA 4B33A 5DSZA 3M70A 3RJ5A 1M2EA 2O7VA 3UXMA 3JQBC 3S81A 5JYCA 4XGQA 3RVPA 1KDYA 5JY1A 2DIEA 1A8QA 2Q46A 4A6XA 3T8YA 1TYZA 3QF4A 4BN4A 5L40A 3FYDA 3VR6H 3QELA 3QVSA 4ZQHA 3T7IA 1OT5A 4BQFA 4YIHA 1DFHA 1IUOA 5TPZA 4U7PB 1T6BY 5TRDA 1FTSA 1U3UA 5F12A 4E21A 1JWLA 2BVNA 2GWHA 5CFRA 3PLAE 4M8KA 1FP4B 1A2KC 1XAHA 4NJEB 1M1NA 1E69A 1TZMA 4Q7LA 1YTLA 3QXHA 5JBNA 2DPGA 2HB6A 4MZXA 3EC1A 2VTVA 4BCCA 1D1QA 1DT3A 2P6OA 2ZU6A 4BIMA 3PNMA 1X9GA 2V03A 4AN0A 1MW9X 5A1TA 4Z0TA 3AY7A 2OLJA 4I1OA 4XX0B 4C4ZA 4Q9KA 2XNDD 4TQUS 1VHTA 3SLNA 3FCOA 1EVKA 2IL1A 4M1YA 2E1BA 2G07A 1JE0A 2GF9A 3IBTA 4UD6A 3LHDA 3W1EA 4A8JC 4NENB 4DIOA 3DMNA 1W581 2XDAA 2R8EA 4J4TA 1Q1QA 2CXQA 3F0TA 1QCZA 5FXMA 2Z3ZA 4P86A 4ZC8A 5LOVA 3LQ4A 3FXAA 5K2OA 5CB8A 3A04A 4DV6B 1V11B 3MJSA 1USUA 1W0KD 1KO8A 4A16A 3MRTA 4CM9D 5ALHA 5P8WA 1OX4A 4ZAXA 3MWDA 2ENWA 1SWVA 3OFND 4C0SA 4PF1A 2Q49A 3OF2A 2RGEA 4GVXA 1DB3A 4JXZA 4YCCA 2WJYA 3QGMA 2I4NA 1IONA 4ZALA 4L95C 4WCFC 1VE3A 5DFAA 5KVQA 1QG4A 2P0AA 1LNSA 2QG4A 2I2CA 3OIDA 4GP9A 4AY2A 4BMXA 3QHAA 5EIHA 3S70A 3L77A 1C14A 4BMZA 5JC8A 4RXUA 2X2PA 4FNMA 4AKTA 1RT9A 3EEOA 1UOOA 3HRIA 3FR8A 4IO1A 3M5PA 1UL1X 4OATA 1M6NA 2J3EA 1LNQA 1NQAO 1CC1S 3D3QA 1R3UA 3BKXA 1GPNA 3LF2A 2UUOA 4LQDA 2HSJA 4QYSA 3VKGA 4TWIA 3L18A 1REQA 1L4KA 1DKOA 1P4HA 2QV7A 3EDCA 1S6YA 5T4EA 4EPXA 2R11A 5DRYA 1NOKA 5KSYA 1YI1A 1ZR2A 1GGFA 3ABSB 1Q17A 1GCOA 2AF4C 2R47A 1EWRA 1AE1A 3RC3A 4PSDA 1Y7LA 3E6AA 1JALA 1U4OA 1V43A 1Z5ZA 2WABA 4LIPD 2NPFA 1MDBA 5A6SB 2FQQA 4JSRA 3T5TA 2P5UA 2QUBA 4MULA 3UGKA 1BXRA 3H8WA 1WXFA 5FL3A 1FX0A 2ZBQA 4NF2A 4E4RA 4ZMRA 3HJNA 4LXIA 4MV4A 4UNIA 2FN3A 4NRDA 5AJUA 4AMYA 1VECA 2M1XA 4TKVA 1ZUWA 1CQPA 3FGNA 1N0HA 3G8DA 4DQVA 4RTRA 4F8YA 4H16A 4YP1A 3T12A 4B74A 2IFTA 3A9WA 3BZUA 3DTYA 1NX9A 1Z7GA 4YCDA 5A05A 3NKVA 4C43A 4Z1MA 3OIVA 4ND7A 1Z13A 3TS1A 4IVNA 3TKYA 4Q7QA 1OX5A 2FCRA 1KMMA 4IXDA 1ZC3A 2BI7A 2XCIA 3CB2A 3ZU2A 3VKHA 4J9UE 2WPDA 4K26A 1L3IA 1EDDA 1XZHA 2FPIB 3P2IA 4YCNA 4LF4B 1LLQA 2XNKA 2L42A 1Z22A 3GVIA 3CNBA 3M9WA 1GRVA 3MMZA 4QRHA 1XTKA 1LQUA 4BZQA 4E31A 1XX6A 3OTWA 3OU6A 3EVAA 1I9GA 1LY1A 3OQJA 2FFBA 5B4TA 1XRMA 1YE8A 4RK5A 1OSNA 4S1NA 2WZQA 1K3UB 3HKDB 4F4DA 1A9ZA 1KYZA 2VBCA 2ZUUA 3PC2A 3ZJTA 2C99A 4M0LA 2GYWA 3LT2A 3TM4A 1RYMA 1J9GA 2VPPA 5ECYA 4EHHA 3MJHA 3HV2A 2G63A 2PUVA 4IF4A 3I2IA 4C78A 4QFMA 2HH9A 2PU5A 2G06A 2WU8A 3PV0A 4PLZA 4D6XA 4WNAB 3RUIA 4KB5A 2IIPA 4ZVKA 3GZJA 3U4QA 3EGVA 1M54A 2B1QA 4O6VA 5K0CA 1LBIA 3WB1A 1MN6A 4RAQA 3EVCA 3ZY5A 1LBEA 1U8YA 1ZD3A 2HXYA 2J0VA 2IYFA 2VP3A 3OSUA 3RWOA 1LJUA 3WGKA 5EQFA 1VA5A 3BKWA 4RZUA 2X0JA 3EZYA 5DOVA 1LDGA 3ECSA 5HUQA 1PR3A 4DSZA 1YASA 3G9XA 3HG7A 3O8LA 1Y82A 3OOJA 4RY2A 4XVHA 2D1YA 3ZJ4A 3GGSA 4B7CA 5JALA 1CSEE 3ANTA 4IDGA 4TXJA 1KZ1A 3FD8A 3JWHA 5FKJA 1T24A 2NU8B 4R2MA 2JJ2D 1AMNA 2YXNA 4KL8S 2L19A 1QIGA 4Q47A 3AUYA 5DT9A 1P61B 3N76A 3KAQA 4OL9A 2ATCA 4K03A 4V0MA 4E03A 5C80A 4U9IS 4BVLA 5B36A 2PQ6A 1U3WA 1XMPA 3NW9A 5L3QA 3I12A 2BFDA 1EQUA 4AB1A 4HAVA 4PY2A 1P3DA 1DJPA 1P8JA 1IE3A 1VC2A 2XWBF 3EZLA 2R65A 1FBNA 2BEJA 3FETA 2DT5A 5LQKA 1DWQA 4MQ5A 5ABPA 4GXNA 1NI4B 5GJWC 1DQNA 1J4AA 1RWOA 1U7WA 1HMPA 1Z5PA 2GSWA 3DYBA 4HE5A 2AEJA 4G1MB 2N75A 5TDHA 2AMLA 4EBBA 1K73D 2HAEA 3A3KA 3N07A 4I0WB 1KOGA 1KAGA 4OHCA 1TQ8A 1U04A 3HB7A 3WADA 5F1PA 4XQGA 1EA7A 3GI1A 3PNYA 4U2DA 1MHTA 4DREA 1L8XA 3LWDA 2IS6A 2XXJA 5LN1A 4J4HA 2IYYA 3R5TA 1XZNA 3SKVA 2WINI 3O4JA 3T41A 3FDXA 3R6KA 1CEXA 2P1ZA 4JQSA 2C0QA 3H4VA 4EW3A 1A72A 2B7LA 1ZOLA 1DWUA 3OLZA 2FEWB 1TUIA 2EFYA 3H2ZA 5HHTA 3GPIA 3BFJA 5AVWA 1SUFA 3D2CA 1N2JA 5BSKA 3K70B 1WNTA 1Y0RA 3FMPB 4BZPA 5IM5A 4JIGA 2FR0A 2PGNA 3E1GA 3QLEA 3DZ8A 4RQAA 1SURA 3QBVA 4F7WA 1LPAB 1NVXQ 1ZAKA 5F76A 5MGNA 3C45A 1XD2B 4WVLA 2O2XA 5F7ZA 4N9QA 4DLPA 2JCVA 3U1VA 2NSDA 3MW8A 2FUG1 1UJ5A 1NT2A 4FC6A 2PWYA 1W5FA 2W2PA 2QZSA 5IBRA 3I6YA 1XMVA 2A0UA 2OXCA 4CN8A 2GAIA 2X2FA 1LC0A 3EDOA 2A35A 2YZGA 2VZ0A 3GA7A 3KJQA 1RLUA 3AR7A 4CKBB 1GZ6A 1MOQA 3NP9A 5I7UA 3U44B 2F3QA 1YGYA 2H5EA 2PX3A 5FBHA 1W4AA 1NNEA 4XN0A 1RXIA 5AJZA 4EVIA 3FLAA 2RJ3A 2OMEA 3E3MA 4W8HA 4J91A 3QUBA 4CG1A 2FRDC 2MSNA 3MBOA 2IVFA 1CF9A 2O2DA 4HN9A 1EFDN 4WA8A 4EZBA 1ESDA 4ED9A 5EG5A 3P0FA 2JLWA 3ZY6A 3HSKA 2FF7A 3STWA 4AU1A 2XMGA 3WLAA 3TEFA 3D7KA 1PG0A 5CB6A 3WBFA 1NW5A 1EFLA 1ZJ4A 2FGJA 2OC4A 4KFCA 3JQ9A 1ORRA 1P80A 1R6XA 3OLXA 4XZ3A 5BSTA 1JQDA 5CURA 4EGAA 4B2PA 4FVTA 3B20A 4PEVA 3ELDA 3KOUA 3CONA 2IZZA 1K4MA 3Q2OA 5EJMA 1E8MA 4KKTA 4YLEA 5JPIA 4DK1A 1K8AD 2AK2A 1QLJA 3N8NA 3PBKA 3BS4A 5HGJA 4ZEOA 5BN5A 2O3JA 3G4SB 4DPLA 5IZCA 1L4HA 3H9CA 3IV9A 1H2ZA 1RXEA 5DHPA 4CXMA 1E5LA 3KDPA 3SZRA 3FVTA 5DB4A 4C3UA 1R8JA 3N0RA 2CXOA 2D5LA 2BH9A 3EISA 1JP7A 1QV6A 3BWDD 3QVGA 2W0SA 4JP1A 4UHEA 2WPNA 4GE0A 4LY9A 3DMTA 3NBXX 3W9UA 5M2QA 1MEOA 4DV3B 4M99A 1KBZA 2ASVA 3A1UA 5DVZA 3BFPA 2FUEA 4E5UA 3VR0A 2E4ZA 3G8BA 2ZB2A 1ULSA 5A4KA 2X9QA 1JDUA 3P20A 3ADKA 1FQWA 4FW8A 1T9CA 4ITVA 1XELA 4O0MA 4RPLA 5DHUA 3W7BA 1K0FA 2BFDB 4MUKA 2W6JD 4DMFA 1YAJA 2I33A 4J16A 4XM2A 1PFVA 4HVCA 2BSAA 4O33A 2ZJ4A 3ETJA 4OXRA 3RIHA 5HR5A 2H11A 1YS2X 4WLNA 4XXHA 2OD2A 3FOCA 2X76A 3N6RA 3MTBA 4JP3A 3GEIA 2R5WA 2WB2A 2K2WA 3HU2A 5L3RA 1KJQA 4WSOA 1CUCA 1P1RA 1AK9A 1PX2A 1SXJC 3D3KA 4MW9A 4RS4A 4XWYA 3S1LA 1B4DA 3H5NA 2J9FA 3CO5A 1HSOA 1OGJA 4MW7A 3QH4A 1M34E 2P4UA 5DHAA 1L0BA 3L82B 3QE4A 3DPSA 4W1QA 4C1BA 2QN1A 5LBUA 1OZ0A 1GU7A 3QOFA 3SJBA 5C5IA 2G4VA 5ESXA 3KTAB 4IXMA 2HU8A 2ZVQX 1U9ZA 5AXDA 5JS6A 1Z62A 4R1OA 4TSFD 3A3OA 3L6UA 3U4QB 4KE8A 3PYLA 1RXSA 3T56B 3KZKA 3RTCA 1VA4A 1HE2A 1RI3A 4FBGA 2ZQYA 2IE8A 4K9DA 3RQIA 3I2GA 4BRSA 4MK4A 2AN5A 3C7CB 3R7FA 1X1CA 4B46A 4LF7B 1TKBA 1U7PA 4WLEA 1SC4A 1Z38A 5DO9A 4Z86A 3G2QA 4JI4B 1FP2A 2NQTA 4DSAA 2AZDA 5KYTA 1MB2A 2X41A 3N2LA 4FGSA 3BWEA 5FTNA 4F4JA 4PLTA 4LRSB 4G0OA 4NBNA 3NEJA 1VCNA 5I7WA 2ZI7A 1TCAA 9ATCA 1KVTA 2W11A 2XHEA 5KVVA 3OUTA 2UVPA 3VJMA 5LC1A 1QZZA 4JVSB 4JR2A 4DF3A 1KQGA 4MPTA 3TBFA 1JKJB 2QI9C 3OOEA 4MMXB 4NBRA 2FFAA 4DAEA 1DRKA 4UMFA 2WKWA 2Z9DA 3QPBA 1YZQA 3QVKA 4A2PA 3LCVB 3NTVA 4GZMA 3DDNA 1P0PA 1PDOA 2BISA 1XCJA 1T0JB 3DLTA 3F5DA 4IHJF 5LB2A 1DWOA 3OHMA 4JVLA 3ZGOA 1N6NA 5CB4F 5G4KB 3VV3A 2F55A 4JVOA 1UAGA 1I2BA 4TRNA 2GESA 3LQYA 4L4SA 3HCFA 3RIEA 1M9NA 4I1VA 4M38A 2I3DA 3LFUA 4QREA 2A92A 4UXJA 1OHHA 4DDMA 5L3ZA 3NT2A 1TVKB 4ZWNA 2YXPX 1VGVA 2J0EA 2ZJFA 4DSUA 1ZIOA 1GQOA 3HAGA 2CEKA 3WL5A 1T34A 2PH5A 5BSFA 3SS7X 4ZTZB 1QIJA 1W9MA 2FP3A 1N5KA 4WESB 5ALYA 1TF7A 3HNPA 4ENRA 4BFXA 2H2HA 4ZFNA 1PG5A 3ZK8A 2AZXA 1BS9A 2BFPA 5LIPA 5H3HA 1W9HA 2DFNA 2FKAA 2V54A 2VH5R 4F04A 2OILA 2DH6A 4YCSA 2VJMB 1FJGB 3HJBA 1IEWA 1BE6A 4LPKA 3S2UA 1B3BA 3BERA 1C2YA 1TD9A 1BO6A 3MQ2A 1KFKB 4GR4A 1J22A 2FVXA 1A69A 2PUWA 2ORIA 4I2VA 2ZZFA 4CMIA 2RONA 2BBWA 2WZDA 5HKOA 1FFHA 1F4LA 2HLPA 2X8AA 4N0MA 5IU6A 4MW2A 2HWYA 4HUQB 1ZBQA 3HM2A 3TE7A 1M74A 1NAHA 4HTFB 4V39A 3S7TA 2QY6A 1W36D 1FJ2A 1R6BX 1VXRA 3T5DA 5JSZB 5SY6A 4ND3A 2BMFA 3UMFA 5K4HA 2P6RA 1RBMA 1SVSA 2C54A 1Q86D 1G8HA 2AN9A 2AFIB 2WMNB 4QYIB 5A4FS 4B17A 1MX3A 2GCOA 3ILSA 2BUAA 4PXSA 4M1SA 4ZCTA 3A2KA 1L5GB 2BFCB 3G8CA 3RKSA 4P82A 3F8TA 1TM3E 2AT1A 4PLVA 2XADA 2XAUA 4WIAA 5AJWA 1EFVB 4NV0A 3V46A 1RQ7A 1ZCBA 2HSGA 4WCVA 4MWGA 2I6GA 2FPKA 4OGLA 4Y2VA 1JSXA 4JUCA 3N0TA 3B7GA 4IDNA 4B6OA 1Q0SA 3SP1A 3I76A 4XUCA 3K09C 3P5SA 1FSZA 1VLQA 1ZL2A 1HPLA 1U81A 2IOFA 2QR5A 2XYGA 3B12A 3PGVA 1Y9DA 4KG7A 1W1WA 3NVMB 4UAUA 1O0CA 1P7VA 4O4LA 1PYOA 4RV5A 4YVFA 1XROA 2Q5FA 4E33A 4E2FA 1QRSA 4P8RA 4FJ2A 3REQB 3FPEA 4U2FA 1RM5A 1D2HA 2HGZA 2WFAA 4BS9A 5JVDB 1TK9A 2G4LA 1II0A 3EBOA 1QE5A 4IL5A 1AKTA 4A0QA 3KE8A 4KSYA 3KJNA 1V1MB 2FSHA 1H3FA 3DAHA 4LGCA 1JLKA 4H6WA 3VH1A 3ZTYA 3CYFA 1GKYA 3NB0A 2O0MA 3NRJA 4F2HA 3C6MA 2Y3IA 3PQ6A 2DOKA 5I4KA 2VH2A 3LRTA 1S3IA 1O4VA 1GM5A 5E8JA 2H52A 2O2IA 1FYXA 2QGNA 3MLBA 5SZKB 2QAJA 1OASA 1CY8A 3TYXA 3VXKA 3KTAA 3R44A 2WAAA 2CXTA 4JC4A 4EA6A 2UU9B 1OUMA 4OAOA 1DQZA 1AB6A 1IMJA 3M5WA 3RC2A 4D9GA 1FSSA 2DTXA 4E5SA 5LZ4A 3HU1A 3VYSB 1P60A 1ZAYA 2C3YA 2HCJB 2HQBA 2J9FB 2WB4A 5AKYA 3AIOA 3V9AA 4KN8A 1X9HA 1SHTX 4NECA 5LDDC 4EUEA 4QOHA 1EEXB 1HYHA 1XPJA 2P3OA 2GXSA 2WKSA 2YVQA 3L07A 3M1AA 5DGCA 4BCBA 1YJXA 2BFBB 4HQFA 2J4CA 2QK4A 3B1WA 3WQQA 4ZI2A 3A9SA 5KKCA 1GR0A 1LZLA 5K8UA 1KK3A 1A5AB 3VR6D 1XHFA 3EE6A 5T7BA 3CP2A 2C8LA 5EKUA 1ISGA 3DDHA 2XCLA 5A9TA 2V1XA 1BRMA 2ZB7A 5IFLA 1FLAA 2I2AA 2JZNA 2RBKA 2Q6KA 3NIWA 5HXBA 4BLPA 3RRNA 5E7JA 3EQ2A 3GT3A 5ITWA 3VR2D 1VZ3A 3HMQA 2BBTA 4PTLA 4CVNA 4EEXA 4D6PA 5KDDA 4CWAA 4EAQA 5ENZA 3HZHA 3OJWA 1U7OA 1UXHA 2C7BA 3TQIA 2PWPA 4KNWA 1U2EA 4CLDA 3QE0A 3NKLA 3G1TA 3NM4A 4JNKA 1SBZA 1U2PA 4GEKA 1NBHA 3YASA 4AMVA 1RWXA 4BYMA 5AXAA 1FEZA 1MB4A 1YVRA 2G83A 3STXA 4F21A 1RM3A 2BEWB 1W87A 1GRCA 1X3SA 1RQGA 3CH5A 4KXXA 4ZOLA 3RS9A 3WLJA 1C9JA 4XR9A 3DKKA 3EIHA 5B57C 4BZXA 2F4NA 4X5OA 4HGOA 1DAKA 5E9AA 4YP9A 2H8KA 3UAVA 4J6FA 1I01A 2ENUA 4HMQA 4LNUB 5EY5B 5BSRA 1K92A 3ESXA 4OP2A 2NXEA 1DPGA 3BB1A 4F96A 2PWBA 2X23A 1UJ6A 3D6VA 3DF9A 4NNPA 5DWQA 4Y8VA 3V2IA 1M1XB 1K63A 2CD9A 2R1VB 2WYOA 3S2YA 1TKCA 1G19A 4ACAA 4P93A 3P9QA 2UZ1A 1R5BA 1NHWA 2ZRGA 3IB3A 3SX2A 1FS6A 5I7EA 3E82A 4YJFA 2QEQA 3A26A 1AS2A 3DUFB 2NU6A 5TVKA 2JFYA 3C85A 3GL9A 4ZHSA 4ND6A 4S04A 4FU0A 4EYEA 3IVGA 3TLMA 1RHUA 1JJAA 3ETGA 5FHQA 4EJ2A 2CF6A 4MV8A 2PO5A 5J4KA 3DOFA 2P30A 3D7SA 4ZDJA 4INOA 1IAVA 2LP4Y 2OO5C 4REOA 1PV2A 4UUMA 2ZRPA 5ICCA 3G0BA 4OLBA 1TRHA 1JBEA 3TEJA 3CJQA 4TQ9A 2PL9A 4GI1A 4TXMA 2Q6IA 1DO0A 1VBNA 1NW4A 3E9RA 1PZMA 2BFFA 3ELUA 5EHIA 4YT8A 5KSZA 1Y4DE 2GBLA 2HV8A 1CUGA 2E4AA 4JLMA 3V1UA 5HS6A 4HDRA 3V97A 2WMYA 2BV3A 2J9YB 2W6JA 1M2VB 2OHHA 3DEKA 3L6OO 4AS3A 5LR6A 1U8CB 1K28D 1ISMA 2VJOA 3H1PA 5JH7B 3U3RA 2B4YA 3UJ3X 1OWOA 2G67A 5ELMA 2QD5A 1DO2A 1C4KA 5DHFA 1N25A 2AFIA 2CL7X 4BNDB 1R0ZA 5EHNA 2Y8EA 4Z51A 1L4YA 4WNYA 2HLNA 4LJ8A 5A2GA 2MINA 2WMDA 2XXBA 4RA6B 2F7SA 4JCOA 3KL4A 2Q27A 4ZGNB 2NV6A 3Q40A 1DJOA 4M9QA 3FI9A 2XGJA 4W6QA 3W5HA 1U11A 1JQBA 2WJHA 3LQFA 5EJ6A 4RBNA 1RI1A 3IE1A 3LF1A 1DC7A 4HKTA 3D7MA 4LTMA 3IQFA 4A23A 1U0GA 1XU4A 3OQIB 2PNJA 2DPYA 3JQ8B 3A1SA 1VF7A 4FEYA 2ORED 1ZC4A 2X85A 1ABBA 2DPMA 4MPPA 5DE3A 3G0DA 5E95A 4DGSA 1ZCFA 1J7KA 1NTRA 1O95D 3CIOA 3MSXA 3TTTA 2G28A 2W9XA 3R4CA 2VJPA 2KYRA 4GKAA 3B7WA 4QQNA 1CQJB 3J81k 4B8YA 4CG0A 3SIPA 5I7VA 4BO0A 1MC5A 1FYFA 4CMHA 1TVEA 1I2DA 2Z2KA 1JPUA 5HW0A 1T8WA 1IZZA 1WSBA 1M2OA 1U90A 2I4MA 3FOFC 2EGGA 2WUEA 2WV9A 2BTOA 5AHRA 1WP4A 3KLMX 2GM4A 3OM9A 1Z0AA 1NFRA 2POQX 3L1VA 1HEYA 3U7HB 1J1UA 2FPSA 2A59A 2X8KA 3QPWA 4UOEA 5AK4A 1JR3E 2V9ZA 3IDAA 4L5AA 2NSJA 3JYQA 1ZM4A 1ZOSA 3TMAA 3D26A 4A5OA 4YDSA 5JATA 4J9VA 1BDJA 3WE7A 1A8UA 1SHUX 1WVIA 4PG4A 4F71A 4K0RA 4UPDA 1PTKA 3A4YA 3RLIA 1K8ZB 1KS2A 1J09A 1T9BA 4IY1A 4EY4A 1LLUA 2ZJ3A 1H6CA 5K3DA 3KUCA 4CHTA 4LOAA 4ETNA 3NXKA 3ZE0B 3MWFA 1WXWA 2O8VA 3GGPA 4Q7MB 3X1JA 5JPCA 1XPRA 4W5TA 1NUQA 4OBEA 1XT6A 2RJOA 5JJCA 4IILA 1FNMA 1IJKA 3CFYA 4UVIA 3EMKA 3FFTA 2E4UA 4I8XA 1AX9A 3ROKA 2EKLA 4HE6A 3G2OA 1U5BA 3VJRA 5LXTB 1NJ2A 5IJAA 4NE7A 1TCBA 4G97A 2HU5A 3TLJA 4KDFA 4IEFB 4QEDA 1QSGA 2R4TA 1BHJA 2FSSA 4KN9S 5LP6C 2DYKA 4MPDA 4AZWA 1SKMA 3LMKA 1XQWA 1W0CA 2QJTA 1R15A 2P1DA 3NM5A 3O75A 5FV7A 5JYEA 4QO8A 3O95A 4DDUA 1ZNYA 4YWHA 3NHLA 1RMTA 2HREA 2QPOA 1CIJA 3E3AA 1WHTB 3FF4A 3IILA 1S02A 4MRVA 4XLEA 1O87A 5SY9A 3UMJA 3X1KA 1MO4A 2WE7A 3N05A 4BNIA 4IGAA 4ZOCA 3T54A 1BPLA 1LFAA 3HY3A 4JH0A 3RS5A 4DZRA 1GGNA 1R12A 3G2MA 5KAMA 1XTTA 3BRCA 4W5JA 2ILTA 2OO7A 5CH8A 4BNNA 1QAOA 4JJAA 1QG6A 1BN7A 2X4IA 4BE9A 4IF6A 3D8BA 4WJZA 3UVEA 4I6GA 2D74A 5TE9A 2QZZA 1GG2A 1PNRA 2DYIA 3CMEB 1O94A 1JTVA 2NYUA 3F6RA 3K0HA 4Q1AA 4DQUA 2F48A 3D02A 3LRPA 4RV4A 1Y1RA 2FZVA 4MKIA 1ISFA 4P80A 2NSLA 4Q24A 4U0JA 4G8BA 4BV8A 4AIIA 5IBQA 3LGXA 1C3JA 1YJCA 2JIRA 1YIDA 3PEVA 3FHOA 3GVPA 3MFYA 2AHOA 4MR9A 3GIDA 3MJRA 2PJRA 3V00A 3H1EA 3WLSA 4ZTUB 1QHYA 1QB7A 2VNHA 3I4LA 2JLVA 2MYTA 1BNCA 2ZSUA 2VRBA 3EASA 4KRXA 4RVOA 2ECFA 5K2MA 3V8EA 3N75A 4JT4A 3SJPA 1C7RA 1GP2A 3FDZB 4MPRA 2VRCA 4U0KA 3TBHA 4YUAA 2BJVA 2PJUA 3NV7A 3ZGZA 4PV7A 3QOXA 1FUIA 1WUYA 2OTCA 3NETA 2OYCA 5FL7A 2QX7A 3H9QA 3LLCA 2NOAA 5LJLA 3EEFA 2Y1EA 3A4VA 2C4NA 3ABOB 2JIDA 3WLRA 1GEGA 2Z9CA 1Y3IA 2FB9A 3IC5A 2PUFA 2JEZA 2FSVA 4R9RA 1STOA 4KLCA 2J6BA 1XN1A 1N5RA 4C14A 3O9MA 4QDTA 5BY2A 1VQPB 5TQJA 5K6AC 1MAVA 4JXXA 2Q5QA 2R7KA 3RYFA 1Y9ZA 5CYOA 1DXYA 4KRFA 1QFMA 2P9JA 1CFZA 4A92A 3NU1A 1A27A 1G2OA 1GPH1 1T1GA 2QTVA 3M33A 1PLJA 1IZ7A 1ZX1A 2FPUA 1JPVA 2JGMA 3EBLA 1VCMA 3MLEA 1FDVA 2D3LA 1WLSA 1I3OA 3ETDA 4N4AA 3QE2A 1CVLA 3T4PA 3CUEF 1IVYA 2RBEA 3UJPA 4GO1A 4KR6A 1EVQA 4JASB 3OQOA 2NZYA 3U48A 2EJUA 3NAQA 2FZGA 3W6UA 3T52A 1PT6A 4QTYA 1QAQA 8AT1A 1EAYA 2ZJBA 1UZUA 1BKDR 3WBBA 1X7YA 2ZYVX 4C5AA 4TZ0A 1Y9EA 1CLEA 1N1EA 2AX4A 3CCEB 3MN1A 3VR4H 2NUBA 1ZW1A 4FMCF 5G1NA 5JAZA 2NXNA 2PT7A 4HNRA 1WOMA 2NV2B 2JFZA 3B1VA 4U7HA 3OQ6A 1PJ7A 4KQMA 2VHTA 4ZXFA 5CD1A 2C4HA 1MEJA 2GCEA 3THSA 2JS7A 4Z2AA 2EFHB 4JBLA 3OCVA 5CM8B 3PCXA 4MVJI 1O57A 3ACDA 5FI3A 2CD7A 3VSDA 4YV1A 5BSWA 5HKLA 4D57A 4W82A 1KYXA 3AM3A 1X15A 5EKDA 2WIGA 2ZBEA 3CCQB 4C03A 1ABEA 2G9RA 2Q8QA 1XJ0A 3CT4A 3B6IA 3HR4A 4LXUA 5DHSA 4ZI7B 4ARIA 2MIIA 3DO8A 5T4BA 4EZIA 1JS1X 3PX7A 3W5VA 3DFUA 5HF9A 4EECA 3H1FA 4WDRA 3QLTA 3KV3O 1JQ5A 4FDMA 2BEWA 3KKPA 4JLNA 4MA5A 3UV3A 2PMEA 1MF7A 4WDQA 3B1ZA 3DHVA 2EERA 2DC1A 3OT1A 2CMHA 4R2HA 3WK8A 7REQA 3IPRA 4DLYA 4CBVA 2ZDGA 1SPXA 2CFSA 3B51X 3DTVA 3GEDA 1WABA 2AFHE 3UG7A 4WZZA 4RD4A 1E79D 1O94D 3NYIA 1OU4A 1NE7A 2HWKA 1Y7PA 1BDHA 1W4RA 4DR2B 1F5SA 1Z7WA 4M54A 4FBMA 5DZSA 5BSGA 1HDGO 3FFBA 5I8PA 2BAGA 2JBAA 2C29D 4AX4A 2FLVA 4DJDC 2YJ5A 2F3PA 5GONB 5A5VA 2WLTA 1P9OA 2REBA 4LDPA 4I6EA 3GUUA 1Y8ZA 3PFNA 5J1TB 1Z47A 3FZQA 3ILVA 3MUNA 4FD2A 4PXYA 1GQRA 4D0SA 3GJZA 2PUBA 2NWQA 3S2FA 1KDRA 2E7ZA 2CLOB 1ZN7A 2FPGB 5ICGA 3LUAA 3DE2X 2PT9A 4MA4A 4ODIA 1OYVA 3DAFA 4Y2SA 1K88A 3EVBA 2RKOA 1Z45A 2O57A 2IF0A 2OZVA 1KKUA 1A77A 1O8CA 1PQPA 1S2OA 1T1JA 1W8DA 1LF5A 1GSOA 2KI5A 4LHYA 3JYLA 2XUPA 2OBRA 4X1IB 3TLCA 4DY6A 3BBPA 2IBSA 1J1IA 2ZRDA 4YJ3F 2E85A 4UFPA 2CVOA 4DR7B 4YMGA 3T9FA 3ILHA 2HLHA 2GJ9A 2OESA 5GV7A 5KWIA 2HLDA 5SZHB 1I2AA 2QUKA 4KE7A 4P2NA 1D5CA 1QHEA 1Z5VA 2W6MA 1L7BA 2BFEB 2N3ZA 2NSHA 2Q5LA 1JIXA 1FXWA 5HYVA 3OKFA 1BLIA 4CUKA 1PYGA 5ICMA 5HWSA 1C7EA 3GDFA 4K6HA 7ADHA 2WF6A 2VK4A 4IIJA 2P9ZA 2VP4A 2QLBA 1ULZA 2F3RA 2PX8A 2GJKA 2PGLA 3F78A 5BQ5A 3LDGA 4MS4B 1RYNA 3JATA 2V5VA 4E4TA 5SYMA 2LTAA 2X0RA 4TSRA 1CR2A 4Q34A 1GARA 1YB7A 1C30A 5B7PA 2OCBA 2BL4A 4O1HA 1MJGA 3K2QA 1L3CA 2HPHA 5K3OA 2O6HA 1YRBA 2QMEA 4INZA 1N0IA 4MCJA 4QUEA 4LCJA 1MZVA 3LUHA 4RJJA 3A4MA 3TCNA 9LDBA 1E18A 2VDKB 2G6BA 4X1IA 4E1BA 2PRIA 1PJ2A 5D51S 1OYOA 2CCJA 1P81A 2L82A 3W4JA 3X1DA 2GF0A 1FZTA 1CUEA 2ADMA 2ZIEA 1IOLA 1ZMBA 1YOBA 5DWDA 2R3SA 3U40A 2PV0A 2XVAA 2ZE5A 2ZE8A 2OSBA 3WGTA 5G0VA 3R2JA 1JA9A 2DSNA 1PHRA 5FFMA 4B3XA 4BNTA 4PG8A 4W8OA 2QUHA 2ABWA 2E48A 3FOBA 5DM60 5BR7A 3LOQA 3AUSA 5EQJB 4TN5A 4RHTA 5BVHB 4EP1A 1IHMA 4RPGA 4HNVA 2Z1DA 3HHPA 3K9GA 1K75A 4DBLC 1SKQA 4PICA 3R76A 1H5UA 3TD2A 3THWB 4UULA 4OQMA 3NATA 3E7XA 4EY5A 5KMGA 5A7GA 1DUIA 1IY2A 1ORDA 4QYIA 4Z99A 3TB4A 3TTVA 2JJYA 4CUZA 3I4FA 4BNKA 3GRRA 3GNSA 5H4HA 5EIXA 1TDJA 2R8PA 4BO9A 2VSQA 3MSCA 4LYAA 4R0NA 3KFLA 4PANA 3AV0B 4O0LA 3H83A 4ZI5A 3BXEA 3RVLA 2YZ2A 1WE2A 4EELA 4EYOA 2DM6A 4KPYA 1NVGA 3HWRA 4CMIB 2QL6A 4RANA 2ECKA 2LXNA 3ONWA 4TMFA 3RSFA 3O4FA 3F5FA 3QLVC 3C5HA 3KZ1E 1B8NA 4M89A 2Z6VA 1XDZA 5E6TA 1P1FA 1ZYUA 4RA9A 2QB5A 1T5IA 1DX6A 1A76A 4J2TA 1HQDA 5BMVA 4FILA 2AMJA 1U02A 4JP2A 3ROTA 4RA9B 4CIXA 2OVBA 4Q1CA 3KB2A 2OCXA 4XLCA 1Q7BA 4L50A 4PGGA 1WCWA 3PA8A 4JJKA 4X24A 4CIDA 4TL7A 1EK6A 1QQ7A 2CLLB 3KU1A 3EPJA 1Y6ZA 2OUIA 1IQRA 3LT0A 1JDBB 4RZ2A 4BBAA 1Q11A 4UVHA 2W4IA 3THXA 1YH3A 1MJGM 1EESA 5REQB 3G6KA 2H57A 4QQRA 1L8LA 4XYGA 2WSBA 2X42A 4KO1S 4U7WA 2W42A 1OJ7A 2NPIA 2ISQA 4L6AA 1T2CA 3BXHA 3GFRA 3QFHA 3V7WA 5I3ZA 3R9XA 1W59A 2O2HA 2YX1A 3BREA 3KS9A 4LWPA 2YBEA 4BLVA 3DXZA 4XVUA 4G6IA 5E2AA 3C6KA 3RH0A 2AFRA 4ID9A 3IGFA 1Y33E 3KZXA 5JCZA 3KZMA 621PA 2WF7A 2ESRA 1V95A 2C31A 3EQ9A 3BJMA 3UH0A 3V48A 3TMYA 3FGZA 3LNCA 4E51A 1GPWB 3DHNA 2XUOA 4L8FA 2BGUA 4AMUA 1OH7A 5A2QA 5JCXA 1DRJA 2OXIA 3DAOA 5A3QA 3VH2A 1CY0A 3EDQA 2VJDA 1YVDA 2RGNC 3I9NA 3EXEA 1PRYA 1PF7E 1VHOA 1YX2A 1QZ3A 2HRDA 2PH3A 3AESB 3JZIA 3LZ6A 3MOIA 4DLUA 2V9CA 1YQ9A 2ATEA 2QTVB 4UARA 3RBAA 2D1TA 3LHKA 2QN2A 4XQ9A 1L4NA 2A7XA 3H5OA 1JJVA 3AP3A 1M1NB 4LRTB 4Q01A 1NZDA 4BOYA 1FP4A 3O92A 1AIPA 1WNFA 4HB2A 5G1OA 3HNRA 1G9SA 5DGXA 1Z12A 4FFLA 4KRYA 1WA5A 2PVPA 3SPXA 3SFTA 3UA3A 2GREA 2HFJA 3FWZA 3L5KA 1YIJB 1YC2A 3IA7A 4RD3A 4IJUA 1WXHA 5B55A 3EGEA 1BVRA 3FYUC 4FKZA 3ZVMA 3A3YA 4KHPB 4IJ6A 1Q0HA 1MIHA 3HM9A 5EMMA 5G0SA 3ZWCA 3BQMB 1RXUA 3D1LA 1DKMA 5EVCA 3FRJA 1PWXA 1X7WB 3EPRA 4KWHA 4V0SA 2HMWA 3LBAA 4IH1A 3GNTA 2QX6A 3H9NA 2YQ4A 4FLMA 3PVDA 2VCHA 1ZVQA 2AG1A 3MWKA 3IBFA 4L76A 5CU7A 2WHXA 4BY9E 1ZUNA 3BRWD 4R1LA 3TK1A 3K2IA 3FYSA 4G24A 4CEJA 4WK2B 2ZUEA 1DELA 2YZ7A 3URKA 1APBA 1S2GA 2C61A 3A7DA 4M60A 3KOMA 2BIFA 1T2AA 5KYUB 2XCTB 1TZ2A 1IDOA 4H6XA 1WBJB 2JBWA 4MB0A 3M49A 5C8VA 5FUMA 3D5TA 4XGIA 4RCZA 3F1LA 3JVVA 4KKSA 1YL6A 3W6PA 1G0OA 1E6KA 3HRHA 3U3DA 3L4JA 4QNRA 3MRSA 5TY0A 1KDZA 3PTLA 3P9PA 2JCBA 4KPGA 3CCRB 1EMDA 1MV8A 1VYTA 1U1GA 2PAFA 2PL3A 2VDWA 3EOZA 2DKFA 3LC0A 4FNAA 2KS6A 4OHBA 1C80A 4HB3A 5JMWA 2FQXA 2CCKA 3F7OA 3RVDA 1QP8A 5JNSA 2YWXA 2RB4A 5KX5A 4HNHA 2MCFA 4DIBA 5E2IA 1PL8A 1I8TA 1E4OA 1W2HA 4BLOA 4COKA 3CSSA 2Y4OA 1BDIA 1XDBA 2DFVA 2Q9CA 1S96A 4MDYA 5F3DA 1GU1A 3ZGNA 4PR3A 4LGMA 1UMCA 3KFVA 2JLQA 4OLFA 1FRQA 3ESDA 3WQSB 4LMAA 4MR7A 1RZVA 4EJFA 4F9TA 1J49A 3ZD7A 2Q3MA 1UFRA 1PFGA 3EWNA 4ZP1A 2XUFA 3MAGA 2JFOA 1XAJA 4MVJA 2CXXA 2PS0A 3PQEA 3IERA 4KIGA 4IDDA 5IT9A 3EGCA 2ZRQA 1A5TA 3OOSA 4MEJA 1KEZA 2EW8A 2LR0A 1RHKA 1E4EB 2OFWA 4Z4WA 2VL7A 4J7AA 3I8SA 2VBGA 4P4LA 5BSEA 5J5AA 1GXSA 1SXJB 3JQ7B 5DN9A 3ZR4B 2O8EA 2QD3A 3EF3A 1C8KA 3BCDA 1OFVA 3BCUA 1W5SA 1O6CA 3HVJA 4WT7A 1TKRA 5I8ZA 4CT4B 4G89A 2GZSA 4M9CA 4AO8A 4B43A 4QYWA 4QJ3A 2HWUA 3F8WA 1J8DA 3E03A 1P6XA 4CM1A 4IZIA 1N2CA 3O31A 1C9DB 3GIWA 1M2HA 1L5VA 2K2QB 4UDXX 3RD5A 3RLFA 1GL7A 4ALJA 2DSTA 4KC0A 4DC0A 5EMHA 3N28A 1BVUA 1IU9A 1HBJA 4FHGA 4HQRA 4JJFA 4QDXA 3RUPA 2Z5LA 3W2TA 2Q21A 3WWCA 4TTPA 5CGZA 3NBKA 3K5IA 4R9NA 3KSAC 2FTKE 4A9AA 1HNNA 2W6PA 4KRGA 1JYFA 2NT4A 3D0RA 2J8ZA 1PK8A 5GPBA 2PXCA 2QTAA 2WOOA 4XASA 3VUEA 3QW4B 1ZD8A 1M1KD 1O4WA 4RORA 3T5AA 4O1MA 3BZWA 3OLYA 3ZK7A 4RSHA 2PSJA 4XDGA 3GFBA 2DWQA 1U99A 4Z4CA 3C3DA 4OHRA 2A67A 2ATVA 3N86A 1Z3CA 3RUFA 1JFRA 1JBQA 2NP6A 4M2LA 2H9IA 2F17A 5AIAA 1R6UA 2G1JA 1DDOA 2A5GA 5AM2A 2VHUA 3OZFA 5IMSA 5JDIC 4MGZR 2EBHX 2MSCB 4KOAA 5EZQA 3EVDA 3ONDA 4FOTA 4L8GA 4XUGB 2IUTA 4F9FA 3CTMA 3WYAA 5E4YA 3GZNA 3BCHA 1EAMA 2OZPA 3CH4B 5HKBA 3UQYS 2XE8A 4Q4JB 4KVZA 5FEMA 4MW4A 2JLZA 1NRWA 1OBFO 4BPBA 1L1QA 3EIQA 1OLSB 5AJYA 1VOTA 3H1BA 4XQFA 3BSSA 1I2MA 1IHDA 3CGGA 4G8CA 2X8WA 4R9SA 4DLZA 1E59A 4H0CA 5FX2A 3MGBA 2HTEA 3O1IC 4BNDA 2OD9A 1J2RA 4IIVA 2O6LA 2HLDD 1P2DA 1YCDA 4OP7A 4KO4S 2NV4A 1BCSA 4U1RA 1US8B 3U13A 2ZR9A 2ZUDA 5E7MA 5AYVA 4D6YA 3IHLA 1D0SA 1U0JA 2A0XA 2OGTA 1W46A 2QYTA 4WXYB 1QBGA 1CZKA 2JJQA 2IY9A 2R6CA 3KKLA 1XZLA 2H9AA 1CP2A 1JAIA 1E6EA 2BDTA 1NVEA 1ZMXA 3MILA 3UH1A 5A5DA 3A6PC 4ZGGA 1F3OA 1ENZA 3E61A 2FRXA 1O89A 5J2TB 1J8FA 3LDHA 2D4HA 3UJ6A 2QXTA 2OXRA 4B3DA 2V6IA 2PKYX 3E3NA 4X7FA 4MR9B 4PSVA 1EVZA 4F93B 3PNQA 1UBEA 1XAIA 3MC1A 3JTEA 4LJSA 4HXYA 1PR4A 3CEJA 1Z7YA 2D54A 8GPBA 3NTXA 1SC6A 2EJTA 5IVIA 3JWPA 4K88A 3H1AA 3RYIB 2FXVA 1Z68A 3GJSA 1QO0D 3MINB 1ZK3A 1KI7A 2H1WA 2VT3A 4BN0A 3N2GA 1KAMA 4D79A 5FWXB 2QLJA 1ZW6A 1IN8A 4D9NA 1Q22A 1C0IA 5JXGA 2G25A 2VP2A 1R8YA 5AM5A 4MEAA 3LQ2A 3WXBA 1TIKA 4LHXA 2IEZA 5FTMA 3DT8A 1T3ZA 2XECA 3DNPA 2CHGA 3WHIA 2HIGA 3NWOA 3A9UA 5DM0A 2QE7A 4C7BA 2IYZA 3SVLA 8LDHA 1NUUA 2BW0A 1F48A 1H2FA 2E21A 3QP9A 1M83A 2EQ5A 4QBGB 5FOUA 1O2DA 5NULA 3TW8B 4F8EA 2C7RA 4XSGA 4MQEB 5BUSA 5IYZB 4TXNA 3T7DA 3PB3A 1U2TA 4DR3B 3F2IA 3PA1A 1U0RA 2P5TB 3D8UA 1FNDA 3GRUA 1DEOA 1QTNA 4KWEA 1NLMA 4X94A 1KZYC 2QLFA 1OLXB 4RK0A 2G5GX 2YVLA 1WSAA 4YV0A 4NCNA 1Y9JA 3AKEA 2G82A 1QANA 1JNYA 1V5GA 3BORA 3LKVA 2DETA 2HXGA 2YASA 3NC1C 4L74A 3V8QA 3WAJA 2A1TS 3HABA 5D1NA 2CZGA 2ZWMA 2ZBFA 3ZDFA 3K0AA 5LMZA 2I7CA 2NZ8A 1WD7A 2YMPA 4DLSA 4YUVA 3CCJB 3QEBZ 2PYZA 4OL0A 4YREA 4XI9A 4BECA 4CHGA 1L7OA 4D4HA 4Y9TA 4ON9A 1KAOA 1V5FA 3MXOA 4K81B 4HK4A 1QTIA 1GL3A 3QXCA 2CJXA 1ORVA 3GPBA 1N92A 4Q21A 4YR7A 3O73A 3K6SB 3GLGA 2JEYA 3PPYA 1XBTA 2R85A 3VYUB 2O4UX 4N5LA 1COZA 3M4JA 1YACA 3ICCA 2ZIVB 3DP7A 4CCSA 1E7YA 4PZZA 3L0OA 4YP6A 1V3UA 1ZY2A 2EQAA 3OAAD 1R6VA 4HWGA 2JHPA 3D2LA 2JD1A 5T4HA 3DKRA 4PAQA 5LA6B 1CZOA 5BRAA 1POXA 4IGEA 4BEVA 1AQLA 1EE9A 2VXCA 3VJKA 2ZCVA 2HK6A 1I33A 3QWIA 1VQ6B 4FZ3A 5HIMA 3QLUA 4MI3A 3X1ZA 1E2LA 1Z73A 3CZAA 5B4VA 1BEEA 3WRYC 2FUCA 1A96A 1MG5A 4QPNA 5I9IA 1JHYA 4L78A 3I1YA 1E1YA 1LCIA 3BULA 4HQNA 4S1WA 4BN5A 3BFXA 3E5HA 3JRWA 4PHHA 3V8BA 2V4ZA 1YCHA 5DLQC 3ZXIA 3LTEA 3CQ9A 3UENA 3A3BA 4PO1A 3SZMA 3Q3VA 2J7KA 3RDPA 1E3QA 5BT8A 2H00A 4NS1A 4EGJA 1LW6E 5BR8B 3G23A 2NN3C 2XEDA 3DXYA 2RGDA 4ZCRA 3S27A 4DDVA 2YWEA 1NJ8A 3IR6A 2X22A 3CLSC 2QA5A 3I9V6 3LXUX 3FLBA 2PMKA 5G53C 1UBRS 5IF3A 5K0LA 2NMVA 3PA6A 3H8JA 1GA4A 3G5AA 1RVV1 2OLKA 2ODNA 2P2CA 1H6DA 2GN4A 1A2QA 2EWVA 2EZUA 2WP0A 3EYAA 3VDMA 1RAIA 2GEDA 1BC5A 3X2FA 5BOSA 1SUIA 4EIWA 1MC8A 5E6SB 4IH4A 2GCPA 4PWZA 1NWCA 3SJ7A 4C6TB 4H15A 3QKUA 4R05A 3Q6QA 2LDBA 4OYRA 3I2YX 1E5DA 2WIBA 1G8SA 2UAGA 1SOMA 2ZIFA 4FWBA 2DFLA 2FCAA 2C98A 3WL8A 3D31A 2H1SA 5L45A 1UPCA 4FN4A 1J6UA 1EFVA 3D3WA 1QRDA 4GI7A 2VDUE 1NRIA 3TVTA 3OCXA 4CKXA 3L8MA 1G20E 4WXPA 4X7EA 4BUJA 2XUKA 5B1IA 3FMVA 3DGFC 4FFMA 1D6SA 4M9UA 4EKNB 3OG9A 3R3SA 4IIJF 2OECA 2JJ1A 4I50F 5AXBA 1RAHA 2QAGB 5IUKC 4IQ0A 4R5HA 3GJ0A 4KREA 4FLFA 2VJAA 3KXPA 4NJMB 1UANA 4E2WA 1YR2A 5IKXA 4POAA 2AVDA 3B6KA 2VJNA 4YJFB 3IDQA 5LBIA 2C97A 2V1UA 1K6EA 3L5OA 2RGXA 3K0KA 3P9CA 5JAIA 3U5ZB 5A0TA 2WSSA 3CURA 5E1OA 1M6VB 5JAUA 5I6DA 7AT1A 5E3IA 2L0XA 1IVNA 1XQXA 4UBNA 4ZRMA 1YVPA 1AUQA 1NBMD 1EDZA 1ZL0A 2VNAA 2Y77A 3LVQE 3PEEA 5BT9A 2J59A 2YVKA 3SQOA 3UJBA 3DHYA 4BMSA 4CM9A 1C4WA 1HDIA 1YRQA 4PX5A 5EEHA 3MD9A 1IZ0A 4L8VA 4QSHA 2JFFA 3FPSA 2C9CA 4IV8A 4YGXB 2YV1A 3AXTA 4EA7A 1JIUA 2J07A 4CRWB 1G3IA 2P9EA 3NOXA 3RGGA 4E5VA 2C5GA 2GTHA 5E1MA 1EVYA 3ICOA 1RYZA 4TYQA 3X2SA 1NONA 3ZDZB 1MB0A 3A32A 1YBAA 4C2UA 3ONFA 3BMXA 5IN5A 1IK6A 3RU3A 5JNUA 1M8PA 2CLKB 2P41A 3HHEA 2CNOA 1W88B 1KOLA 3WLPA 1CR4A 2PZBA 3JQFC 4FEGA 4MUGA 3V7UA 3VZPA 3KG2A 1NULA 3I6ZA 3PK0A 2Y6UA 4CTMA 3E9CA 1YD7A 3P8ZA 3K6KA 3UGQA 4P38A 1JVBA 2VQDA 4QATA 4Q18A 5KJ6A 3DLPX 4RQUA 4LJLA 1I36A 3B9RA 3QQ5A 2YH2A 2XZPA 2B2XA 4ND4A 4F3NA 3IBGA 4PYLA 3Q8LA 1CLUA 2PKQP 1WCIB 1WY5A 3L3BA 2JK1A 2EQBA 5DLPA 3E9EA 4V0OA 2LUOA 4RYLA 4DJFC 1Y6QA 1IXKA 3U9SA 3IT1A 3VOBA 3OD5A 1JA1A 3OE7A 4O2BA 2XE7A 2W2VA 1RJ9B 2BFBA 3GGCA 3T99A 2P9CA 4RW0A 3IESA 3MYYA 3HA2A 4NBWA 1GG5A 4I55B 2X2EA 1G6Q1 3INGA 1CJSA 2VUIB 4ER0A 3UKDA 5DTIA 2JH9A 1AO3A 4F84A 3I45A 5KPJA 1FQJA 1PQ4A 2HBYA 2GVNA 2B9EA 2VP9A 2GB4A 1N5LA 5KYUA 1Y98A 1NLFA 1OXBB 4FOPA 4MS1A 2JFHA 3ANYB 1R1DA 3OUZA 3DMRA 2VLBA 5ECGC 2Z2IA 3NDBB 1GY8A 4BP3A 3KOZA 4MVJP 1RE0A 2J5KA 4ER5A 4RETA 9LDTA 1Q21A 2HK8A 1XDGA 3Q7PA 4ZREA 1CETA 4AXBA 4CLOA 1QKJA 2ZAGA 5B6IA 1U8UA 1XRLA 2YUIA 4GQIA 2WYIA 3NOOA 4FMDB 1HYBA 2VC2B 3QI2A 3GQBB 4NE2A 4EI2A 3GJ3A 4AECA 5K0GA 4H7KA 4O3MA 3HY6A 4XIFA 4Z4EA 1Z5WA 3MBIA 4Y18A 4FFBA 5TGDA 4BQOA 3GLHE 3O93A 2GVZC 1HE5A 1JN0A 1K9VF 5LZ7A 1L5MA 4GD3Q 2BEUA 2PXXA 2W90A 2WMOB 3TLZA 4CDNA 4XYLA 1ZA2A 4RVSA 2F3UA 4L4YA 2GXAA 1OOEA 4LS3A 2N42A 4X63A 4Y7DA 3CVYA 1UPUA 2BMJA 2WICA 3U7GA 1AXEA 4ZOBA 2LGJA 3NJRA 4JENA 5CCEA 4F06A 5IH7A 1NSYA 1E3JA 4EG0A 1D2MA 5H82A 2AW3A 2JGDB 1CDOA 4EVRA 5JAHA 5JH7F 3RS3A 3V34A 1NP7A 2GDZA 4MH0R 1SCJA 5KYGA 1OH8A 4XA8A 3I2HA 4EHFA 5B7QA 1AUOA 4P32A 4GRDA 1KIAA 5I9MA 2QE7D 5TQ2A 3O1LA 2ONJA 4PONA 3TZCA 3KYJB 3G5UA 2VSNA 3ZZTA 3PG5A 1CTQA 2IU0A 1MORA 3SK0A 5JWRA 4ZODA 4CR8A 3LUCA 2WWTA 3BGSA 4JYZA 1TAQA 4LNHA 3W5SA 4EW6A 2GAAA 1ZK2A 4OOXA 3JQ6A 4YQYA 3GGGA 3HCOA 4LRQA 1UFOA 3WHLA 2O3SA 2PNFA 3HBLA 2GN9A 3VHRA 2YIVX 1MJNA 2VS1A 1A50B 1KEWA 1S2IA 2PG3A 4MKHA 1G4AE 1PTJC 4S35A 5DCLA 2JAOA 3DQQA 2FH5B 1JMYA 3ZBPA 1IRIA 4LC9A 3VKUA 1VPEA 4MCAA 1L4LA 1B0PA 5CYGA 5REQA 2X0FA 1Q95A 1C41A 1I2ZA 4JK3A 4YRNA 1RPJA 3DOEA 4N82A 3GLKA 3NTRA 2UXCB 4C4PA 1XO1A 3DE4X 3HO6A 4J1TC 3UW1A 1P4GA 3FUWA 5HGXA 1SNYA 3AHJA 5CT5A 1ADYA 2BHTA 4HDKA 3JQBA 3UT5A 1H0SA 4PSUA 3SBOA 1TZBA 2R60A 1XEXA 3O4RA 2IZ5A 5JDCA 4H3KB 1U9YA 4AY4A 3BQJA 4C4SA 1QVFB 1KNXA 421PA 1U4NA 3G3EA 1E6WA 4OHWA 4DJEC 3KLOA 3U61B 1SKBA 1UKAA 3H4IA 4NYJR 4FOLA 2O54A 1T36A 2BFOA 3PDIB 1WXQA 3CZRA 1E9VA 1M8JA 4W63A 3T7AA 4LXYA 1NSTA 3BIXA 3K4HA 3UMMA 1PN3A 1S8NA 5G2OA 3D4NA 3IEXA 1NSFA 2X8JB 3N8HA 1M33A 4PC2A 4DILA 3CEAA 5K3SA 2PFKA 4FFOA 2IJGX 3DONA 2GAFA 3H13A 2IXDA 3IULA 3JCZA 4MUHA 2EXXA 2ZQZA 3IR7A 5F1YA 4TN1A 3V1KA 2HT1A 4PAOA 1YNSA 3DEHA 3AZPA 2Y1KA 4MIEA 1I4TD 2KW5A 3EPPA 3FPPA 1N7JA 4GXQA 2I8LA 3ZHXA 4B35A 2VHJA 3ADCA 2WUVA 4FGUA 1OJLA 5EJ4A 3V80A 3O7WA 1VLZA 2IEYA 2RK6A 2IEGA 2F8TA 2ZL6A 2CC2A 2KM1A 3MT7A 2BF4A 1PL7A 3Q6IA 4MUAA 3SAJA 3DTTA 4NS4A 4HV4A 1RZUA 3I04M 3Q6MA 3TVDA 2NPOA 1WY7A 4U2BA 5EP1A 3CWZA 3PKIA 2O0LA 2XUQA 5HF8A 5JAQA 1XHLA 2V5AA 1QGAA 4WCFA 2GYVA 1VG0B 2UUAB 1IN1A 3DE6X 1D2GA 1W4CA 1KO1A 3HLKA 3LNTA 1YDEA 4OSEA 1J90A 4JUDX 2Z8XA 2WD8A 1HETA 2BR4A 2B35A 1GSHA 1NXWA 2WTAA 4NVRA 5G0WA 3T7KA 1BWSA 2GGSA 3VQTA 4YHHB 1VQ5B 3G0CA 3HVHA 1NBOA 1LVUA 4UQLA 1GKIA 2FF5A 3C8DA 1U6IA 5IW8A 4X44A 2I2WA 2GPJA 2BKAA 3X1WA 1JHRA 3GEHA 1JG3A 1BXGB 3M3PA 1L5LA 4GBMA 3GLTA 1I7SB 3KQLA 2PXAA 1C9KA 1FDSA 2CXHA 3IUBA 3FZYA 1FUUA 5E38A 5IAJA 2HSWA 1DV1A 2JHFA 3OCYA 4OQXA 3MERA 4B9EA 5EJ7A 2QA4B 1PGOA 2EW1A 2OCDA 1HQYE 4HDMB 2NUAB 3QNUA 4Q9DA 4DNFA 1R6AA 4KFTA 3QEJA 3E22A 5DM70 4QTUB 2OAEA 1GYRA 4LJ4A 4D8UA 3V2HA 1C3XA 2IYLD 3QUCA 1Q15A 2NAFA 4GG1A 3LV8A 1O9BA 3SJCA 1D8AA 2VR1A 1YA4A 3R77A 4I1IA 4XWKA 4OHYA 2VRNA 3EF1A 5EWJB 1G60A 1GV0A 1P73A 1VHQA 2I7TA 1S1MA 2Z4SA 2ZYIA 4I5GA 4KODA 4NG5A 4XJVA 4BQIA 2NQ2C 4PCVA 2F43A 1IOZA 2Z57A 4LECA 3ETHA 4AKIA 5FBZA 2AW5A 2PA3A 3LPNA 1NJGA 2R9VA 1VSUA 3WWPA 1RRGA 4URUR 4KAAA 4HFNA 1X1TA 5KTRA 4CTOA 5M7EA 2QM0A 3AKDA 3DHEA 2EKBA 3GLGB 4HBGA 3RWBA 1XQYA 2FPPA 5EJ2A 4IRUB 3LLVA 4GWKA 2I7VA 1PIWA 4GDFA 1EFPB 5ALFA 1FL9A 4B4OA 4Z0NA 3CZ4A 2IVZA 4H77A 1RPNA 1DZIA 2E5LB 3HB4X 2WYUA 3WLQA 5FLYA 2Q0SA 2YUTA 1XZDA 1N2EA 2XKAA 1R00A 1JBKA 3B89A 3L4BA 5ALIA 5EJEA 1IVSA 4CMAA 2ES4A 4HWTA 3W8EA 3TI7A 4D3YA 2C3OA 2HEGA 3ID6C 3IO5A 5T57A 2A8YA 4DNTB 1GKKA 1UBSB 2P27A 1OVGA 2VDRB 2WG0A 4ZQEA 1U0LA 2QIOA 4IIEA 4FZVA 1Z0ZA 3RVMA 4OXNA 4LQCA 3DV0B 5AT1A 5IUJC 1SGWA 5C0OE 3VUFA 2D5BA 1GV1A 1IDN1 2RGWA 2FV8A 1W44A 2I29A 4H31A 1GTL1 4CEIA 3LPCA 3E8MA 1XCOA 2XOEA 4BPRA 2R4QA 4QWWA 1Z17A 4C7KA 3THRA 5K01A 2QD1A 3CVXA 1A1VA 2Q50A 3CNEA 5FDFA 2YN4A 4O2AB 1TTTA 2C5AA 2X6TA 4ZYLA 2ZPTX 4D98A 4IGFA 4IDPA 3SJUA 3I56B 4FE7A 4J3NA 1FVHA 2BFFB 2QVBA 4P22A 1TA0A 1X9IA 4GZ3A 4KBYA 3CVOA 1C3EA 2VJBA 3E5NA 4L57A 5BO5A 3RG2A 2ZBRA 4NBKA 3VU8A 4QU9A 3ZWBA 4AWAA 4F2GA 3HXOA 1E58A 3BH0A 4TL8A 3I9FA 1OTHA 2XY4A 3QHPA 5I9SA 3N2GB 3T7SA 1NBIA 2OV1A 4K6FA 3GA5A 4V02A 3KHKA 4Y9RA 5EGSA 2JGKA 3G0GA 4NPHA 3B1JA 4FKBA 4I1SA 1JB9A 3W06A 5B5SA 3T53B 4DA4A 4WY5A 1N2HA 1QHGA 4XVRA 3BTOA 4N0QA 4D46A 1VP9A 2YV4A 3K31A 1KI4A 3DYIA 3Q87B 5T6MA 4DLKA 4FFPA 2H06A 5GVSA 1B93A 3DDCA 2IUUA 3DFMA 4CMGA 1ML4A 2GN2A 4DFDA 2IITA 2X77A 4PWYA 3CCSB 2SBTA 3WMWA 1X13A 1XD2A 4M1WA 4X1OA 4YWJA 5TMEA 5FT9A 4AS2A 4Z54A 3UV6A 4DR5B 3MRXA 3C8UA 1YU6A 4KPUB 4QUDA 4UPVA 3EXAA 5CG1A 3LW8A 5L7TA 2I91A 4HNGA 2OFXA 3HCNA 2BYTA 2QX8A 1TM1E 2Z9BA 2J3KA 1N0VC 1SZJG 2MMGA 1SU8A 1ESMA 1PP4A 1RR6A 1JYSA 1WO8A 4V3BA 4KTTE 2N47A 1PX0A 5CH3A 2QJRA 3G1UA 3NE5B 1ULAA 4XGRA 3SSNA 5CDYA 3FSEA 5ARDA 1JH9A 3MIZA 3BBLA 2IYSA 2VOJA 2PGIA 3A58B 1HSZA 3FTCA 4L9RA 4Y30A 5AI9A 4ZAFA 4CDMA 3RYFB 4EGQA 3LS2A 1F6DA 1ZGJA 2O0HA 4OHKA 3Q1LA 1PYDA 2QTWB 3H97A 3II6X 1LSOA 2VNSA 5H5JA 3ENNA 4I50A 2C8JA 3NUGA 2OYNA 2MYUA 3L40A 3LWBA 3RVJA 1D9ZA 3C43A 4PGAA 1RYBA 5KYYA 2MSDB 4BV2A 5K03A 3R41A 1VTKA 1LRLA 4TTTS 4JUAA 5IASA 4LRXA 1SVMA 2HU2A 3FCSB 3I3SR 4EQ6B 4EYQA 3V7AA 3RVNA 1FY2A 3KSZO 3VU0A 4KFSA 5JZOA 1V0JA 3UHOA 3QEKA 5LOVB 1X7ZA 1Z39A 5CEFA 5L3QB 3GLFB 1I32A 4ID3A 5BRJA 2HF2A 3AUFA 1AQYA 2J7PD 3GCWA 1PZGA 1JG6A 4UATA 1P62B 3NHPA 1KJJA 1NRKA 3DCNA 1H0RA 4IMRA 1SOAA 1NNUA 4UM5A 3VDQA 4AXXA 5B3KA 1K7YA 5CAEB 1U7XA 2FPLA 2QU7A 1PUJA 2QWXA 4KVGA 4UHJA 5B6PA 5HCIA 5ICEA 4I8DA 1XP8A 2PR7A 3VSBA 2HOQA 4BGIA 2P9GA 3NCTA 2UUBB 2CL0X 3F3KA 4UD2A 5DBOA 3ZUGA 4EHJA 2NYAA 5GM2A 1QQ5A 1U1FA 2FPRA 3NUZA 1RWMA 2HXSA 1YKSA 4HQKA 1G20A 1FQOA 1JPNA 5AVSA 2GPTA 1GRRA 4YMLA 4F5WA 3GVHA 4TLLB 4XB2A 4GX1A 5AKKA 3TDNA 3DZKA 3RT1A 4DMGA 1QK3A 2XRFA 1EFTA 3PEFA 5IHXA 3FKSA 3OE5A 4ZCQA 2DFPA 4E6PA 3K73O 3KSMA 1YDHA 2NZVG 1BD4A 1FFGA 1N2SA 2D59A 1P2TA 3DDZX 3GPDG 5DULA 4BVGA 1QH0A 4PZCA 1KDVA 4ENWA 1L7MA 2P8SA 2WTNA 1VYUA 1TL7C 1BSVA 3FY4A 3GQBA 1SCUB 2AA3A 5LP6F 3WBKA 4MP8A 3B9QA 5C7IO 4B4WA 2DJIA 1MXFA 4CV3A 1Z3IX 1OI2A 4RWEA 4XVCA 5JJBA 3HWX1 1I8DA 2G9ZA 1OZHA 4K9KA 4LMPA 3SGLA 2QBYA 4A0RA 3PC8A 1MT0A 3LYLA 3VO1A 5IYZF 4HLCA 4L4XA 4BKQA 5TQVA 3IT2A 1N6LA 3GAZA 3CSUA 3GZ4A 3M1LA 5CVVA 5BOVA 1WCXA 3A25A 3IOCA 4YQEA 4OA8A 1S2NA 2RKBA 1Y9AA 3ME5A 2IP1A 4IKEA 1OI7A 2PIDA 3EHEA 2PS9A 2TMYA 2WAYA 3IP5A 1GNPA 4WCFB 3VPDA 4BEJA 5IAAA 3F3MA 2XB9A 3RT9A 3EXEB 1IXSB 2MHCA 2EZ8A 5HTKA 1CS0A 2ZRJA 1A82A 1CUWA 2CNNA 2IXBA 1Z08A 1RAEA 1SCNE 4BVJA 1EP2B 3ND7A 1WG8A 1YSCA 2QSZA 5GOZA 3H4MA 4C07A 3GP5A 4MHTA 1N3LA 1RMYA 3NBFA 3HSSA 4DMUB 1EXVA 2PLWA 3REFA 4B6RA 3P19A 3SHOA 3WGVA 2C9YA 3PXBA 4PFSA 1EXDA 1RMQA 1X0XA 3ODGA 1IULA 4N5HX 4I4TF 3RTGA 2P9BA 4RH0A 2GTIA 1L5OA 5JZBA 1BWQA 1GO2A 3DVRX 3IL2A 1MZPA 1LK7A 1C8VB 2WWXA 2ETXA 3TAXA 4C01A 3WWEA 2C2ZA 3QBDA 1Y3DE 2P6UA 1MR3F 2CUNA 1MW8X 3SHTA 5HZMA 4GLFA 3ONYA 2MU1A 2FR1A 5EC8A 4N41A 1HE4A 1IWPB 2ZREA 1E8DA 2ANBA 2OTJB 4YN3A 2DERA 4MROA 4R68A 5HK8A 5CP8A 4AZSA 1K68A 3KVOA 1PNQA 3BPSA 5H3LA 3V8VA 3SF8A 1OU0A 3AY0A 5T3YA 4YJGB 3HADA 4LVUA 4Z0PA 3I42A 4FXOA 2CZCA 2HSEA 4X7BA 3IMKA 3LGAA 2QL9A 3T9EA 4C4RA 2JLSA 2P2DA 1QK5A 2VWQA 3RT7A 4WGGA 1WSRA 3DR3A 1TUGA 4J0CA 1IOWA 2CSXA 4RTJA 3I72A 1N34B 4GSKA 4Q16A 1MQSA 2X9VA 4QHSA 3I34X 1YZLA 5ADVA 3F47A 5LQNA 2DWOA 5B7NA 2QAGA 1FX1A 1SVWA 3FLEA 4G0XA 1GD1O 1SU6A 3RUDA 3T3PB 3UV7A 3CBQA 2BKUA 4B2IA 4X7DA 1BW9B 1OGYA 3H9JA 2I71A 2XDYA 3TOCA 4MVJH 4ZO4A 1KQSB 5AH0A 1VMKA 5KMGB 4MDFA 2EEZA 1QX4A 1MB9A 3AO0B 4KOEC 5AW2A 2PPVA 5KU7A 1FFYA 2LKCA 4GQNA 1RD4A 1K7XB 4ESOA 2Q5JA 3EVZA 2UYOA 1I30A 4OI1A 3MWEB 2NU7B 4K9SA 4C20A 3FNRA 4F56A 1Y1TA 5BVHA 5KTYA 4F8JA 5DSXA 3F4LA 5DW0A 5ERGB 3MWEA 3RJTA 2GRUA 3R24A 4ZQIA 4F86A 5I7SA 4D1YA 4G8JA 2CUTA 4R1UA 4IS2A 5FI0B 3DYVA 4KAJA 5K8LA 5KREA 1NVDA 3WB0A 4XCVA 5MN4A 3IO3A 4TKZA 3VYTB 3EGDA 5LA6F 1MOPA 3WC4A 1Q12A 2CMFA 1RAAA 4URVR 5IM4F 4DJ5X 1JEQB 3RVSA 3VPGA 5J2UF 1ZJ6A 3EZ7A 4QJ4A 2Y05A 3UY4A 1GCAA 5AKIA 2BM8A 1H2WA 3LHSA 1W36B 3FROA 1Y3CE 4LJKA 2YN0A 2K87A 1JXQA 5EMJA 3WGZA 1VIDA 2FE4A 3G6EB 1RWBA 1X74A 2DUMA 2ZAYA 4FINA 2UYCA 1ZESA 3KQWA 4OSOA 3LZCA 4PZLA 3BTUA 2IDJA 2GLUA 3QU9A 2D7CA 3B36A 3I6QA 4HGZA 4N3AA 4QXMA 3IEMA 2GTPA 3PDIA 4AJ4A 3FWNA 1AHIA 4ITRC 2V31A 1FP1D 2DFKB 4L0CA 5FYQA 2WQ7A 2Q4RA 4DCGA 4IIJB 2HCFA 1WDWB 2JIMA 1M75A 2FJ0A 4I2NA 4MHOA 3UGTA 2GJAA 2R86A 1QDUA 2QYSA 4KQKA 3WLTA 4ARUA 1GLNA 4JGIA 3SLDA 1XWWA 2JGFA 3KKKA 2IY7A 2GEFA 1CUYA 3CUYA 4F5ZA 3EFOB 3VNQA 4WFQA 3H17A 2O7NA 3DNMA 1BGVA 1CUDA 4ZT3A 4BWFB 4IXNA 3PEWA 3SYNA 3ZU3A 4E30A 4QG3A 2I9PA 1DC6A 4UDOA 2WZPP 2MSKA 4MKRA 2PPLA 4NU0A 5IC5A 4WASA 4JYCA 1NYTA 3C6ZA 4ENQA 2Q9UA 1YE5A 3AEZA 1HUQA 3OC6A 2RDMA 3I39X 2AC2A 2VUTA 1L4BA 4XMYA 2BTQA 2FSPA 2HKIA 3UWSA 5BV1A 2H4YA 5BWLA 4XSVA 1P8AA 7MDHA 4ETMA 2RFLA 3IELA 4KH1A 5C8YA 3U7FB 1PFYA 5TS3A 4UZEA 3MHTA 1COWD 3NGXA 4Q3OA 2Y0CA 2ZR7A 5FIUA 4F3YA 2RHJA 4ZU3A 2FSUA 2E82A 2ZSEA 2FETA 1MO3A 3GLIB 4YC7A 5MFZA 5TLSA 1ZK4A 1P5RA 3A1PA 2ZTMA 2ASEA 3NRCA 4IFTA 3D8SA 1NVFA 4G5GA 1GUFA 1BVHA 4RJLA 1EINA 2WOJA 3R0JA 1ANKA 3K0CA 5LQMA 4S05A 2OGWA 3DE3X 2M6LA 1NI5A 4L5JA 5IANA 3G2HA 4DLAA 4GMHA 2WZNA 4P0TA 1WEHA 4IO0A 4HB0A 2P3SA 2WJ4A 4OQFA 3U4AA 4MV7A 1DJQA 1NLUA 4IV0A 3FPCA 1I6MA 1OAKA 1UPAA 3U2QA 2OOKA 4FHFA 2EP7A 3WQHA 4UC0A 4YQZA 4Q9HA 1GQSA 4MS4A 4MTLA 5AHOA 4A0SA 1DXQA 3G13A 1H66A 1RABA 5A06A 4QFDA 4XD7D 2X14A 1EXNA 4JKYA 1EB8A 4IUBS 4JFAA 1E3LA 1XNGA 2HNKA 3OTGA 3ZE7A 2FMFA 3ILXA 3ASSA 1RJWA 3BDVA 1IY8A 4NBSA 1KSJA 4FSXA 2WHEA 1CUSA 3DS8A 1T6ZA 4CQJA 1UOPA 1M6VA 4P7FA 3I92A 4IHJB 4XDZA 2G7ZA 3WVNA 4TLDA 2GHRA 2HA7A 4CKYA 5HX7A 1G20B 1YQEA 3O83A 4BNWA 3HKBB 4RMNA 4KTVE 5IBCA 5F4MA 3NHFA 3VYVA 4OQQA 5AKZA 1PO7A 4PC3A 4EJSA 5E6RB 3A4LA 4WKNA 3KQVA 3ZBQA 5BQXA 4CM6A 3M2TA 1Q7TA 5D8DA 1MX1A 2W2KA 2PQMA 3GAFA 5IS2A 2QTCA 5CDHA 3C87A 3WJAA 4RCYA 4JT8A 2QDXA 4MYCA 5IFKA 4NBUA 3NFRA 4DRYA 8OHMA 3TRKA 4E07A 4FYJA 2EYUA 2OQ2A 1ZONA 2KHZA 2XD4A 3U9LA 2GKSA 2CNWA 4WXEA 1SUCA 4LBZA 2ZW9A 5IDWA 3KEMA 4Q39A 4XRGA 4EY8A 4GGPA 2I67A 2WJVA 2DFDA 1CRQA 3CS3A 4QQFA 2ZI6A 2GBIA 4M8IA 5HZKA 5AK3A 2ICAA 4DKXA 5IJ9B 1G8JA 4JJ4A 4Q15A 5CDFE 2AF3C 3ZBUA 1W5BA 2GCOB 2FW1A 4H1VA 4N3CA 2C84A 5JAMA 5HQ3B 5LZ8A 5EKXA 1RC1A 4HX5A 4I50B 5DHRA 3E3OA 5BSVA 1KJIA 2ZT5A 1CFJA 1YT5A 2F9LA 3AEUB 3SOZA 4ALLA 4EAAA 3U9TA 4QSMA 4HRVA 2V97A 5C4IA 3RYCB 2O1WA 1SBCA 3CB4A 2BCGY 1OXTA 3H42B 3I5UA 1WLYA 1I4OA 4EH1A 2VBTA 1YHNA 3MJDA 3TH5A 1QYWA 4FHEA 4K6GA 4DCCA 1L4MA 3EDRA 3EZ2A 1RAGA 2H51A 3PL1A 3V32A 3W90A 5ADWA 2WT9A 1P5HA 3DW1X 4G5SA 1D1PA 1DTSA 4GZ6A 4JEIA 1G8AA 4FX2A 1XRRA 3TRJA 4RHFA 4RZIA 4LSZA 4A0FA 4IS3A 2NYRA 4D9JA 2XSZD 3IR5A 4JJEA 3RJZA 1TYEB 1G8FA 1R9JA 2I2DA 4E1VA 3L8CA 5H16A 3VNBA 1JU9A 2BP7B 2BGLA 3BF8A 2CL6X 2EVWX 1XF1A 4WEQA 5FOWA 1B41A 5J2UA 2X8LA 4H7DA 4G0PA 3IYLW 3I37X 1POWA 4O2RA 5HXAA 3H86A 1ZJYA 2OO5A 1OWMA 3WGNA 4WESA 1HE3A 2IYRA 4J0IA 1A2BA 1AF4A 1KBOA 2IZ7A 2X9LA 3BSFA 3N39C 4HNQA 4M9SA 4J0JA 1E4VA 4YJ2A 4CM4B 4XOPA 1R37A 3F6YA 3IV6A 3S5UA 4AM8A 4B4DA 1Q0TA 3ZV6A 1OFHA 1JRLA 1QVAA 5K3FA 1IWBB 1J2UA 3L0IB 2XBLA 1EWVA 1VBFA 2UZAA 3Q98A 1S9HA 3BTVA 4HN2A 3NZEA 3VR5D 2IV7A 4WGFA 1OXMA 4AMGA 5FRDA 3NNSA 3BMOB 1DG3A 1JW9B 2WD7B 3KFXA 3AB3A 3GEGA 3IE2A 3W05A 4PYOA 4E0FA 2G09A 5KO2A 1VP3A 1CUVA 1IZYA 1R2QA 1UWVA 2PZLA 1FQKA 2ZFUA 1V3QE 3H3JA 3KJGA 4KXVA 4EJMA 4R71A 3VISA