2OK7A

Ferredoxin-nadp+ reductase from plasmodium falciparum with 2'p-amp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
312
structure length
262
Chain Sequence
NFINLYTVKNPLKCKIVDKINLVRPNSPNEVYHLEINHNGLFKYLEGHTCGIIPYYNKKQRCARLYSISSSNNMENLSVAIKIHKYEQNYGYCSGFIKNLKINDDIYLTGAHGYFNLPNDAIQKNTNFIFIATGTGISPYISFLKKLFAYDKNNLYNSNYTGYITIYYGVYNEDSILYLNELEYFQKMYPNNINIHYVFSYKQNSDATSFYVQDEIYKRKTEFLNLFNNYKCELYICGHKSIRYKVMDILKKKKKRVHVEVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ferredoxin-NADP(+) Reductase from Plasmodium falciparum Undergoes NADP(+)-dependent Dimerization and Inactivation: Functional and Crystallographic Analysis.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Oxidoreductase
molecule keywords Putative ferredoxin--NADP reductase
total genus 73
structure length 262
sequence length 312
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2007-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2ok7A01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2ok7A02
4PC3A 3JQPA 3CCRB 3QFSA 1GAWA 3LRXA 3MMPA 1EP3B 1KC8D 1G7TA 5AN9A 3U6KA 2DCUA 1TTTA 2OTJB 1S0UA 4RD1A 2YWEA 4ZCIA 5FA6A 3WNCA 4K1XA 1YITB 2BF4A 1QFJA 4RD4A 2AHOA 3CCVB 2QDXA 3E20A 1FNDA 2VNHA 4TN1A 1TVCA 1R5OA 4PC2A 1NDHA 4YAFA 4J0QA 5JBQA 2BN4A 1YJNB 1VQKB 1VQLB 4LBYA 1KQSB 3AVTA 2EIXA 3G71B 2CRVA 4N3NA 3WNBA 3W2EA 4B48A 3P27A 4B47A 4ACBA 5GV8A 3WYAA 1W2BB 3WNDA 4ZCLA 3CCQB 1KD1D 3OZVA 3ZBTA 3QE2A 1VQOB 3VO2A 1QFYA 2HMAA 1NJID 3G6EB 2CNDA 2OK8A 2XNJA 2QEXB 3ES9A 4PC1A 4RD3A 1FRQA 4LC0A 5H59A 3CCEB 4PC6A 1GVHA 2HCJB 3QFRA 2OTLB 1ZUNB 4M0LA 1UMKA 1QFZA 5DSZA 3WXMA 1B23P 2DETA 3B78A 4LBWA 3CD6B 4G1VA 3V76A 3JQRA 4FWTA 4MYTA 1R5NA 1AMOA 2C78A 2B7BA 3QFCA 4YHBA 4HE5A 4QHYA 1VQMB 2BM1A 3OZUA 1XE1A 4DQKA 1FNCA 3CCMB 3A1FA 1EXMA 3W2HA 4TMXA 2BGIA 1M1KD 2FX3A 3FPKA 1OB5A 3QFTA 3AVWA 5TR9A 4TMZA 1FRNA 3B8HA 3ZZUA 1EFUA 3AGQA 5TY0A 3CMEB 1SKQA 2BMWA 2YWHA 4M4SA 4RCYA 1SM4A 4M2LA 4M53A 1OGJA 1DDIA 3CCJB 1QH0A 1N8RD 2DEUA 1YJWB 4B4DA 1G7CA 4FN5A 3CC2B 3MCAA 3W5VA 1GAQA 1CNFA 1ZM9A 1K9MD 4HE6A 3JQQA 4B44A 1H42A 1KK3A 3CCLB 1E63A 1N0VC 1BJKA 1CNEA 3VNVA 4P6VF 2QTLA 4IW3B 2VNJA 1XB2A 1OB2A 2RC5A 2B7CA 3U2QA 4Y7CA 1W34A 3AVYA 2VNKA 1E62A 1EFTA 1JA1A 2BM0A 4LBVA 3I1FA 2QA4B 1GR1A 4AF7A 1VQ5B 2XEXA 3CC4B 1Q82D 4C0SA 1TUIA 1ZM4A 1E64A 3CXCB 1QGZA 2E1RA 1KTVA 3WBKA 1F20A 1VQ6B 3AGPA 4LBZA 1BQEA 4ZGNB 1VQ8B 4EH1A 1EFCA 1ZM2A 3I56B 3ZC3A 2PMDA 4R71A 1DARA 5THXA 2YWGA 1D2EA 3I55B 3CCUB 1QX4A 4MYUA 3MHPA 4NBSA 3OW2B 4RCZA 1K8AD 1QVFB 1QUEA 3WBJA 3CRZA 3VNUA 4M1KA 1KRHA 4PGOA 2BVNA 2GQFA 3OZWA 3SJZA 1GJRA 2BPOA 2C77A 4TMWA 4TMTA 2DY1A 2XNCA 3QSYA 1R5BA 2GPJA 3LO8A 1QVGB 2PLFA 4RD0A 3W5UA 1QG0A 4YAUA 4H9GA 3E1YE 4N3GA 3AVVA 1AIPA 5EMNA 4ZCMA 1F60A 2BV3A 3ZBUA 1Q86D 1QGYA 1B2RA 4NCNA 4PC7A 1S72B 2J7KA 3ZZ0A 1Q81D 3B82A 3CW2A 3W5HA 4RD6A 4AF6A 5GV7A 3CMAB 3CB4A 1QGAA 1G7SA 2OK7A 3CCSB 1I7PA 4F7DA 1JJ2B 4ZV4A 4Q7JB 4BPRA 1VQNB 4G1BA 1A8PA 2B5OA 1YJ9B 1FNBA 1U2RA 1VQPB 1DG1G 3AVUA 1KK2A 2ZITA 4G5GA 4YAOA 1EP1B 1VQ9B 3W2IA 1KJZA 3G4SB 4B43A 1JNYA 2RC6A 1D8TA 2QTZA 4QFMA 2PIAA 1YHQB 4C43A 2R6HA 3ZZTA 1Q7YD 3W2FA 2QMUA 2VYQA 1KK1A 4ZGQB 1JB9A 1DDGA 1QUFA 1WDTA 5TV2A 3FJOA 5HXBA 3WY9A 1M90D 1IJEA 4RJLA 3CC7B 1W35A 4U9UA 3P26A 2QN6A 3VO1A 2HDNB 1OGIA 1BX1A 1J9ZA 1ZM3A 3CPWB 1G7RA 3W2GA 1K73D 1YI2B 2YWFA 1HA3A 1TLLA 3LVBA 4Y9UA 1VQ4B 4FK8A 1IJFA 5KSWB 3AVXA 2VNIA 1H85A 3U6BA 3OJXA 4ACAA 2EFGA 3J81k 2NPFA 1KK0A 1IB0A 3PENA 3OJWA 1VQ7B 2D74A 4YAWA 1N0UA 1D1NA 4DQLA 2X3UA 1JA0A 1FDRA 4RD2A 4UAJA 1BX0A 2BSAA 1YIJB 1EWYA 4YALA 2BGJA 2DERA 1FNMA 3LYUA 4AC9A 4P3YA 1CQXA 4WQMA 4B3XA 1ELOA 1GO2A 5H5JA 1EP2B 3VMFA 2VZLA 4TMVA 4Y9RA 1W87A
chains in the Genus database with same CATH superfamily
2A57A 1DFIA 1ZGHA 5EJFA 3DOIA 2G0AA 5FH9A 5JNLA 5JS7A 3K6SA 1Y3CE 4MV3A 3QVWA 1TD1A 4KXFB 5TMEA 1EP3B 1T9GS 4O1HA 3FYTA 4QUEA 4W82A 3Q3VA 3RQSA 2PKXA 3GW8A 4MWOA 4ZMSA 1J2JA 1LD3A 2MINB 3S40A 3OBIA 3OOEA 3NFYA 3WBFA 1QIGA 2EJTA 3ZOZA 1DG3A 3E7XA 3HRIA 3NGLA 4J7UA 2YWEA 4QNNA 4UBKA 1JI3A 1GPAA 5KNCD 1Z6AA 1ENPA 1NC1A 3S5UA 3A3KA 2PEYA 1ACMA 5TC4A 4BECA 4C3VA 3MPUA 5K8TA 1DKUA 1P2VA 2XZTA 3H5LA 5C8YA 4B2LA 2RKOA 1I7NA 3P45A 4QTUB 3JARB 1II8A 4MKXA 4PLFA 2CUZA 2XUGA 1WCXA 4FYWA 4DW8A 4MUMA 1U2EA 3IA7A 4R8LA 1XAGA 3ZHOA 2WYHA 5LD2C 2RHHA 4YYEA 3VSBA 4O4HB 5KYGA 5DFAA 1UC4B 2G36A 3DB1A 3E6AA 3TS1A 3MLEA 1L5YA 4QX6A 2H1HA 4PC2A 4I9HA 4JCOA 1U2PA 1K3UB 2IYXA 5HKBA 3SZOA 2IS4A 3FNQA 3SDBA 1XJQA 4G25A 4H7DA 3M4XA 1I30A 1YJNB 5FUXA 1N3IA 4CIXA 2ZQYA 1KGDA 4JELA 3D6FA 1KQSB 3GVHA 3C5WP 3NHMA 5T6BA 5BNZA 3E9EA 2BP7A 1FSZA 1KOGA 3E61A 1OFHA 4ZHSA 3CUUA 4ATNA 2REBA 4JBIA 3O92A 3ZVNA 4E31A 2AXEA 5FXMA 1OVGA 1HMYA 3IC5A 2IU3A 4B47A 2X4GA 2E5WA 2HEGA 2QRQA 4XLCA 3LC7O 3Q7SA 4IIXA 4IRXA 1UODA 1C80A 2AD1A 3FPSA 3KXIA 4GI1A 4WJKB 3H86A 1NONA 3WNDA 1KI7A 4NYIQ 2FWMX 1OTHA 1W5SA 3K0HA 3OLYA 1DAPA 2CJFA 1SCDA 4R2WA 1O2DA 2PA0A 1JHDA 1NR7A 4HWRA 4I81A 5K3SA 1CIVA 5BSMA 5LYJB 3A2LA 3D2BA 2VAVA 1UANA 3FIUA 1IEWA 2C7VA 4XDGA 5JJLA 4PPGA 4BQNA 4ZJYA 3AL2A 5H3HA 1OZHA 1AUOA 2XYQA 2HHCA 1YZYA 3B1FA 1ORTA 2O57A 2QLLA 1FSGA 2R87A 2ZIFA 4OAQA 3QE9Y 1A95A 1ULUA 3HC7A 2FUG6 3RSQA 1E92A 4BMYA 1DBPA 5KU7A 2GTIA 1KZLA 1OW3B 1U1CA 1YI1A 3HL0A 3R7WB 1T0IA 1GSIA 5K4GA 1H6CA 3Q6MA 4QIHA 1RLTA 4UXIA 4XD2A 3TR6A 3VZSA 1HT0A 2H2FA 4IEEA 5JCOC 3FIJA 1FTYA 4P83A 5HE8A 1Y0YA 1XQ1A 2YQZA 2YVKA 2ZREA 2IWHA 3ADCA 5BQOA 3W3AD 1XKXA 4HVCA 2PANA 1N6PA 3SQOA 2KJQA 3WLHA 5BQ3A 2OEPA 2E85A 4HZIA 5HNKA 1WVGA 2I33A 4GH5A 1FFBA 3CRNA 1ZUNB 4A6EA 3W5AA 3T9DA 2D8MA 1VC2A 3LWBA 4OEHA 3F6YA 4V0OA 1CQZA 3MINB 2JGMA 4JB8A 3QYFA 1M2FA 1AE1A 3AF4A 4RPBA 3M83A 4LZZA 4MQ4A 3A6HA 3WLRA 1KSJA 4B6SA 5BWCA 5F9HA 4M0DA 4TZ6A 1EVKA 3RUDA 2R2AA 4A26A 4BMCA 3CEJA 1LQ2A 2AZTA 3T5PA 1TVKA 4HNSA 1XVAA 5FTNA 1A7KA 2GQ0A 1DUSA 2JIMA 3D4OA 3R7LA 5GJCA 1VM6A 4RGYA 1ENOA 1VF7A 3GDWA 2VQSA 3GRZA 2C78A 4H7JA 1ZHHA 5EFZA 2CXXA 5HUJA 3WADA 4CM5A 2VJCA 1JDBC 1I9CA 4PZUA 2XLBA 3Q4GA 4R8MA 1N1DA 1PKVA 4AZ0B 1EGMB 3ELBA 4B5LA 3A1CA 3ZY4A 1I3NA 3R6TA 3TZQA 1GG2A 3Q72A 4IX9A 1V16B 2W90A 3VGPA 3JQ6A 3GV0A 4XOUA 2ALJA 5EE9A 4U6QA 1MO5A 4G4SP 1DIRA 2FGKA 5JD3A 3CCFA 3CCMB 2IZ6A 5JAMA 1I94B 5AJUA 1M0TA 4HEJA 2RHCA 4BFVA 1RQNA 3TN7A 4CLHA 1S1CA 2JL1A 3EZXA 1JECA 2L82A 3PKJA 5TPWB 1X7ZB 1QZ3A 2FJPA 4J3JA 2IQIA 4YQEA 3X3HA 4AMGA 3D8NA 5F23A 1ZU5A 3BGWA 1IEVA 1Y98A 4TWAA 2QBYB 2QP9X 3QFTA 3NR2A 4R16A 3B60A 2WM3A 4YI5A 1C8BA 2XVMA 1ZIPA 1O6FA 1HEIA 3CW8X 5D3MA 4G41A 4TYNA 1FLNA 1DAGA 5CYGA 5CM8B 2A1UA 3SC2B 2H2IA 2VNSA 2CV1A 5ALRA 4KO3S 1J1ZA 3G88A 3VDMA 1PJ8A 1ZX1A 2FMUA 3BDVA 4B2IA 5A2GA 4U63A 3IRUA 2YWHA 2EJUA 4MS4B 1PR0A 1FP4A 3O4VA 1J5EB 4NPHA 2DQSA 1DKQA 1SPXA 3RS4A 1EUDB 3WISA 4EG0A 5EZ5A 1XMVA 4JJGA 4RPCA 5ICEA 2O19A 5TS2A 3C3WA 3JARA 2O6LA 3D4IA 4Q1AA 1M66A 1E2PA 2DG2A 2AL7A 2DH6A 2G9QA 2C2WA 2Y05A 1C9NA 1IIBA 3AIIA 3CC2B 4AS3A 3IEMA 2XF2A 4BMNA 3H87A 5ADVA 2IPLA 2VBGA 1DE0A 5THKA 1M5UA 1QRDA 3K9WA 2R8YA 4WLNA 4X06A 4U5QA 2YZKA 3GT0A 4HAVA 3EASA 4EL5A 3E3LA 1UMCB 4ITVA 3VOAA 4EY7A 4P4UA 4TRMA 2OXRA 1LI7A 3CXUA 3D6AA 2CZQA 2PZGA 5JV5A 2HRQA 1ICEA 1RR6A 3K0CA 1U0TA 3DMNA 4P34A 1T8SA 3INYA 3HR4A 3RRYA 3ZDAA 4OB6A 1FDOA 4LW8A 3CUKA 3NC0C 2FVXA 4UEKA 1YD7A 2IHJA 2FR1A 2YXEA 5JALA 2W6OA 1QZUA 5K0LA 1EDOA 1TJ3A 5AXAA 1R18A 2PUFA 3LLUA 1XROA 4UREA 1XNRB 3QI2A 1DT3A 4JAVC 1BH2A 3I1FA 1U4NA 1P0QA 3RVLA 1C8LA 1RPNA 1TVKB 3HHPA 4GU5A 4H35A 1EQAA 1AXGA 2QW8A 2QUBA 2Z2XA 3I5UA 3CC4B 3L0SA 4PSKA 4R6XA 3WYNA 1ZL2A 3GEGA 4G4IA 2GAJA 1A50B 3OURA 4MRSA 4B6FA 1XNJA 3C5CA 4IV0A 4JP8A 2OR3A 3SNHA 3LX4A 2PZMA 5E3IA 1QOPB 2Q3DA 4LYGA 5FQNA 4QGHA 3VDNB 1CUSA 4DTCA 4MK4A 1MV8A 5B37A 4C0BA 1DTSA 1DCFA 3ZE9A 3L8HA 1T0PA 2I4TA 4B32A 3EGDA 3G5AA 4C7OB 2H0RA 1L1RA 3P2IA 3QVJA 4D4JA 2J4CA 2X14A 2UYYA 2IDMA 2CSUA 5AKEA 3OAAA 1A7UA 2P7IA 2NVUB 3FNEA 1SBIA 2OXTA 4EELA 3EF1A 4J0HA 2DMRA 4DC9A 3NM5A 2HI0A 3OCXA 2FFRA 2B4AA 2Y1WA 4FGLA 4XR9A 5CR9A 4ZEVA 2JFPA 1V1MA 3O8QA 4Z9XA 3TEJA 2I3AA 3AXTA 4YRAA 5B1SA 4P08A 2W43A 3ASTA 2DH5A 4XSHA 3V7UA 5BUCA 1PEKE 4JKOA 4PONA 3KQHA 1ZXXA 2FY8A 2VP4A 1VSTA 2NOAA 1SVWA 1U0NA 1I3KA 1E77A 2GBLA 2ONKA 5JQGB 4MGYR 3VR4D 4X1YA 3ADOA 3MJEA 3G1TA 3KKMA 3I5YA 3Q6NA 1PJ7A 5J5VA 2DY0A 3LA8A 4CQLA 2FKNA 4TYWA 1JLLB 2B9VA 2HO5A 5JSFA 1Q91A 1LDYA 3G6WA 3E9ZA 2NT3A 3AM5A 4E1AA 1K8AD 1BD4A 2Y66A 4GYWA 4TUYF 5CPFA 5CW2A 3V00A 5HPYB 1FIUA 1HE8B 3EARA 4KRGA 3UMYA 1JDTA 3L0DA 2PBRA 3KT3A 3O84A 3RRXA 2GKSA 2WK1A 4KIJA 3R7DA 3VDRA 4DNFA 4YBZA 3DAHA 1P77A 4EAAA 3S28A 5I9NA 3U5TA 1HNWB 2QM3A 2RI6A 2IC5A 2XE6A 1YJXA 4JQYA 5FLYA 2D4AA 4OHCA 4RPDA 5MN5A 4HBGA 1QIJA 4AP5A 3VDXA 1AF7A 5AKYA 4F3KA 1TIPA 3PXXA 1Q0SA 4KLNA 3S1AB 4K0RA 3GBVA 1YR9A 2C9YA 1UJNA 4FFSA 2NUPA 1QVGB 4LZNA 4QC2A 5BYJA 2P6MA 2Q3JA 1P18A 2EFYA 1KJYA 5T8KA 1HDCA 3RHZA 3DBOB 1ZRSA 1JXOA 3FZGA 3HGMA 5EINA 1QHEA 2BM9A 2QG9A 2VYND 1WBJB 3C8DA 4UBIA 5TT1A 2A9PA 2IQ5A 2CK3D 2HWKA 2EHDA 2I4MA 2FZVA 2OBBA 4G36A 4RHTA 4WNCA 3T7JA 1E7SA 1H1DA 5ERXA 1N2SA 2PEZA 3P2YA 4BJ5A 5C8DA 2OESA 3BCHA 3T3DA 1C7ZA 4Y98A 3M8KA 1E4YA 1U3UA 3F73A 4IMPA 2NLOA 1TI7A 1KHTA 1RHUA 3LDGA 3I1YA 3CNBA 2GM9A 4CLOA 1FSFA 3WLIA 3OCWA 1UH5A 5LNK6 4JMQA 1VCHA 4U8HA 4ZQGA 3QLEA 4CI0B 3MT0A 1Q0ZA 4NCBA 3AJDA 3ESDA 1C5KA 4X92A 2EBWA 2ZDQA 3OQMA 4GIBA 4NU0A 1D7AA 2P6RA 5GZ6A 2ZTGA 3I58A 2IHYA 4ALJA 1U9IC 1EJ2A 4QBGB 4PCUA 4RD6A 2XUDA 3SEFA 1K7YA 4OQPA 4QPDA 2MIIA 2IYNA 5KBYA 1RXVA 4G8BA 1XZEA 4F71A 3UFXA 2GCGA 5DNDA 3V2HA 4N65A 4MW6A 1KOFA 2R6FA 4LV6A 3ROMA 1L3BA 3HWX1 1T1GA 4LDJA 2Q6TA 1D7OA 4D6YA 1NAHA 3K31A 3ZX5A 4A10A 2DBVO 2NZXA 4TLMB 3JSAA 4TYMA 2FMFA 1BYIA 2ZU0C 5C51B 1RVV1 4BV9A 1W7AA 1LBSA 2ODBA 1FDSA 2Y76A 1Z4KA 2WU1A 1KYIA 2WP0A 1XFAA 2POQX 1D6SA 1D2HA 2N0SA 3GD7A 1MQ9A 1B93A 2FQQA 2RH9B 4IHAA 4DIEA 5CA1B 1PKXA 2ZRIA 3KZ1E 2O2XA 1M33A 1LVGA 4TWJA 2Q29A 3TRJA 5BVHA 2PRSA 3FKSA 1PE0A 4ZCRA 2Y0CA 1HZZC 4BDSA 2QRLA 1VE3A 2H06A 2K6GA 1ZS9A 4C43A 4RDLA 4QODA 3E9NA 3CEPB 2ZTSA 2W71A 4H3HB 4YJ3F 4EG4A 3MLBA 1PDOA 1QS0A 6Q21A 1RZVA 3F8WA 1KE2A 3M1YA 2WWGA 2ZJAA 1AXRA 4B6RA 5L45A 3MWEB 3BE8A 3GVKA 1QK4A 5KAPA 1I4TD 3U3KA 3CZ4A 3FPEA 4XSGA 3NIDB 1DLJA 2PFSA 1F1BA 4I66A 1UEJA 2JFWA 4P81A 3V80A 1PS9A 4EFMA 4BBZA 2HDNB 1TLFA 1OGIA 2CFOA 3CPEA 2AKAB 2AI3A 3DSRA 2ZS7A 3B70A 3R3YA 4K26A 1USGA 3ESZA 2I4LA 4C7BA 5F78A 1T9BA 2HRRA 4K5QA 3NNNA 1GV0A 1WABA 4MIOA 3VNRA 2B2NA 3OX2A 1JG6A 3VPBA 4MS3B 2QW1A 2XMGA 2HYIC 3AG6A 4KMMA 2QL5A 3UCEA 3VTZA 4O2AF 3VISA 2J3MA 5LNK1 2JLVA 2FSIA 2D2EA 4YRSA 3F71A 4KR9A 3U6BA 3IV9A 4ZVVA 5I9LA 3DMFA 5IC5A 3WWCA 4AWAA 3CLSC 2JFUA 2EFGA 4DLWA 3C3BA 2E3JA 1C7RA 3FFWA 4WFJA 4EZEA 1FQOA 4YWHA 5LZ4A 5GTDA 4O25A 4PZ0A 3LBYA 4U00A 5KX5B 5M5BA 1K9VF 2PUAA 4KLRA 2JIBA 1PJLA 4HS9A 4KO2S 1YZLA 2AN5A 4X0CA 2EQAA 3D4BA 3WP1B 4ZEMA 1Y6GA 3KVVA 2C29D 2QQFA 2QLNA 4OP3A 5DLQC 4P0PB 2Q50A 4LGCA 5DULA 4EQ6A 5CXUA 2VO1A 2WTNA 3DEIA 4FKZA 1JHMA 2I76A 3MD9A 3E03A 4B46A 1A88A 2F48A 2CVHA 4F72A 5LQJA 1WLSA 2EAUA 4CEHB 2OHVA 4UM7A 4URVR 3EAFA 4YRNA 1XLVA 1Z37A 2OAQ1 4YUXA 2PL5A 1VKHA 4ZAYA 4C0JA 3V1NA 1HFWA 3CTAA 3IT0A 1VRCA 4CGYA 3QEAZ 2BSAA 2I8AA 3NM6B 4QGGA 1NBMA 3SU8A 5G2OA 5K0BA 1B8PA 2IF0A 1S3GA 1Y6FA 4YALA 1Z5WA 5JMWA 1L4GA 1NQAO 2BKLA 1FNMA 4JT4A 4G84A 4QATA 4ZYWA 1E98A 2RFLA 2F8MA 4N41A 2Q27A 3Q6IA 1QG2A 4FXPA 4UMDA 3IB6A 4KQ1A 4BWYA 2UXCB 1GGNA 1Q1NA 4L16A 5E9AA 4WUVA 1MTOA 4LMPA 4DG9A 1NULA 5K0NA 1CEQA 3EIFA 2GLTA 1TFUA 3FDXA 3H5NA 3QKWA 4QUJA 2R00A 2W8ZA 3FCEA 1Y89A 1JQJC 4JBHA 3OH8A 1LWNA 4JMPA 3EOZA 5CVTA 1E1RD 1UBUS 1YR2A 1C7IA 2OO3A 2NVWA 1DAFA 3AJAA 3M1IA 4IH9A 4MVXA 4PHFA 2FDCA 4HDSA 3T12A 4C6HA 2RONA 3AK4A 3OQ1A 3QLUC 4RDIA 3KG2A 4MQFA 5E2AA 2ZYIA 3RPEA 1GAWA 3MMPA 2GN6A 1ZW6A 1OX4B 2C84A 1UKVY 2X23A 1VPTA 3IUPA 4PZYA 1U6JA 3EF3A 4R51A 4DLBA 4L08A 3AKDA 5A4JA 4Q37A 4MI3A 2WYVA 3UQZA 1QHFA 1VSUA 1E3TA 2WJGA 1MGOA 3IIIA 1J8YF 1RXUA 1U04A 2BGLA 1D04A 2B1IA 3MWKA 3NKVA 3OQBA 4H7KA 5FLKA 4ZCIA 1XDUA 2QPLA 2XYVA 3VPFA 4CCWA 2M6LA 1UFQA 1OROA 4Z4QA 5FKJA 4AD8A 2VBVA 2LIPA 2CJXA 2D7DA 1JG2A 1QFJA 2EARA 2JGKA 2P65A 4MB2A 4QXRA 4JJEA 4B3MB 1VMDA 1QHHA 3ZNQA 4QU0A 4C88A 3THYA 2VP2A 3MQ4A 4MV8A 5IXJA 1R4AA 1SUBA 1YVUA 3OQIA 5CIQA 1YCDA 4Q6BA 3M3HA 1BDBA 2C9ZA 2GTPA 5AK3A 4XARA 1DKMA 2XB4A 1FFEA 1J4AA 4YK7A 4Z9FA 2O8BA 3BFPA 3ZVRA 1N3YA 4XTRA 3U4MA 1VJDA 4G8DA 3IKMB 1DBRA 4BMOB 5JPCA 4W7IA 3QVGB 2NW6A 4RULA 1HURA 3DT6A 3GLFB 1A9YA 3G9XA 1M0SA 5TEVA 2L69A 5JBQA 4GQIA 2EEZA 3BD9A 1QYCA 4K9LA 13PKA 1FXWF 1QVZA 2QN7A 4IOMA 5EN4A 1LPMA 4DCJA 1MW8X 3H4MA 2BEVA 4JJ4A 1PJ4A 4DLYA 2AMFA 1L6RA 3ZYCA 4PZDA 3HYRA 4I8XA 2VHXA 1MMFB 5E0OA 3T15A 3BIJA 2E5FA 3OUZA 4QEZA 4RQBA 3ZGOA 4BNNA 1ANKA 5EP2A 4ZKEA 4F06A 5KKNB 1LLUA 2WA2A 7MHTA 1RHJA 1GAEO 5ALHA 3BFJA 5BSHA 3B53X 4JI6B 3NBFA 4AKIA 2XUPA 1M8JA 3HXOA 2NYAA 3O91A 3JALA 4GW3A 2AUMA 1GTSA 3ASYA 2ECQA 1JJBA 2NZ8A 1E20A 3U56A 2JDID 1VQOB 1GPKA 4FYIA 3VO2A 1GHTA 4F4UA 2C5FA 3LVRE 5H3LA 4JWKA 1F8UA 5TF4A 3WGJA 1NBOA 3PT5A 4RC9A 2PMCA 1SBHA 1NW9B 1U90A 1Z8DA 2FG5A 2HSEA 3S1LA 1HDIA 621PA 2G8LA 2AFVA 4NS1A 2X8LA 3FCUB 4BZQA 3QQ5A 5EEGA 2GI4A 1O95C 2Z56A 4Y9DA 3ZNNA 3N8GA 3CCEB 4M55A 5HQJA 4W5WA 4BNKA 5LLTA 1NZDA 4C2UA 3E7WA 1ZQ9A 3VX3A 4PC6A 3T7CA 4KW7A 3TO5A 2FPSA 3VVCA 1T4GA 3MFQA 4ZVTA 2BMJA 1O6GA 3DA8A 1K7FB 2FYTA 1UWKA 4YRZA 5B55A 1B8OA 3C15C 3ZNPA 2X85A 4LMBA 3PF9A 3D6JA 3T1OA 4JI0B 1AO3A 1GZ4A 5JSKA 3PPWA 3DZJA 3ETCA 3I5AA 3RU9A 4FCCA 4FFLA 1NUTA 3OIGA 3OZGA 3EAGA 5B6PA 3ZWOA 5ALOA 3P0IA 4EB6B 4UHDA 1RTKA 4BZPA 1QU3A 3ZCQA 1UPXA 2H5JA 1VZ3A 4Q3LA 1IVNA 1EFDN 2FDRA 3TIFA 1XZPA 5FEUA 4OLFA 4FW9A 1GYPA 3M81A 5A5EA 2FN4A 3D8SA 2XA2A 1X0XA 2EWMA 4KPUB 5IZCC 4FZJA 5AOCA 5LDGA 4L0QA 1K6XA 1OE0A 2EP7A 1QYRA 4N8DA 1NNLA 1WMSA 4K6GA 2OFPA 3IMKA 4WKOA 5BW8A 1PD0A 3BNWA 3HJUA 3I9FA 1G9TA 2KX7A 1KDPA 4UHCA 2UDPA 4DQVA 1KEZA 4LRWA 4C3OB 4G7XA 3IQEA 4X1IA 4K6OA 3A1FA 2G09A 3DQZA 4LI0A 1MHTA 3FWPA 3KPWA 1SWWA 4V0KA 3ZU5A 3E2MA 2WZDA 3BZWA 4HDRB 1OYOA 3RODA 3VR4A 1U9JA 3CCCA 4XKVA 4UFOA 4MVJA 1NWHA 4DZTA 4KDEA 1E1CA 1OB5A 1F9AA 2JGDB 2PO5A 3EODA 1NR1A 4Q1BA 4YJGA 3A9UA 3ASVA 3N76A 3GAAA 3AP3A 1FXWA 1FDWA 2RGNA 4D42A 2FP4B 1Q12A 1Z73A 2FN3A 2XX3A 3KFVA 1UADA 1Z4PX 4MEJA 1JHPA 1S6YA 4EW6A 4O2BA 2CYBA 3SLDA 3Q7QA 4M4SA 9ABPA 4AY2A 1B1CA 4NOMA 1ZYUA 3ZEIA 4M53A 5SICE 2VPWA 3PHGA 3DMTC 3LXMA 4X45A 4J4HA 4ZIRB 5H80A 2RHTA 2BTOA 1CRQA 3R40A 2XUAA 1GTVA 5KQMA 2HRDA 1JUDA 1KVRA 2G88A 3JD2A 2R4UA 4OXXA 4UOZA 2IH4A 1P2DA 1C0LA 3GLSA 2VK2A 3A8JA 3SY8A 1JPVA 2WJAA 1JQ5A 4RWZA 4KNYA 3D7SA 1W44A 2PUTA 4KQJA 3CGWA 4WAUA 3ZD8A 3EFOB 2ZIVB 3N2GB 2Q6VA 4AQYB 4RPLA 4ZGGA 3IT3A 3QHAA 4H1VA 1QR6A 4DLVA 3EUEA 1KK3A 5EJGA 4CQLB 5ALEA 4QJ4A 2P8JA 2AOXA 2GWHA 2Y0DA 3K6KA 5KCZA 3QTLA 1SEVA 1R0SA 2AWOA 1FJGB 3D4LA 4FYKA 3R7FA 3BKXA 5LM3A 4GE3A 2JGRA 1SHKA 1OSNA 4ND8B 1EPUA 3IQDB 1Y1TA 4Q19A 5F73A 3URKA 4DA6A 4BEWA 3W7VA 3G0GA 3RVMA 4A0QA 4DDTA 4TYYA 1OXSC 5EUBA 4X64B 2FPKA 3A1UA 4TZ0A 3ETJA 1DC5A 3I53A 3KQQA 4JMLA 5ER9A 3QXHA 1Z6ZA 3C8ZA 1E9EA 1HY3A 5IK2A 3FB4A 4M1EA 3TW8B 4AF7A 2R6R1 4JVNA 3DDWA 3O6VA 3DO5A 3PZBA 1XNQB 3PXUA 4GKBA 3RT7A 2LP4Y 4HNQA 2HLHA 4HQ6A 4S1OA 4ZP1A 5B1DA 2Z95A 3HLYA 2E4WA 3TRFA 3M9LA 3MUEA 1P4SA 3OF5A 1WOYA 5C5DA 3DBHB 2VDOB 3D3JA 1PLLA 4GGMX 1YVEI 1KWKA 2ATXA 1M2WA 2CLMB 5IKMA 2PRJA 4J0FA 3F7NA 3IOCA 4FDMA 3PTLA 4E09A 2Q5QA 4J29A 4MS1B 4NYJQ 1PNTA 4ISCA 4QUGA 2ZSAA 5EIOA 3EIXA 2I3ZA 5F77A 1WMEA 3QBTA 5BVHB 1E59A 2QMHA 1A8SA 1P81A 1XYVA 1VQ8B 3BGSA 3V7AA 1W49A 2QAGC 3WGHA 4C2TA 2R1VB 1EFCA 1IY2A 1WV0A 3AJEA 1E2MA 3SIXA 3E9CA 4ZOLA 2R8RA 3WYFA 2IZ0A 1C3LA 2O06A 3KP1A 2DQZA 4UM9D 3ZN2A 2G08A 1IG3A 4YRRA 1MPXA 3WQZA 3IHWA 5HHTA 1FFYA 5THXA 2QAGA 1YUNA 1ZGZA 3QIVA 1CF2O 4LSWA 2CCKA 1NHGA 3Q5EA 4K6HA 1O5OA 4DMFA 1OBHA 3KKQA 4MV0A 4P84A 1P7YA 3PX2A 2Y77A 4AN1A 3AYZB 4E3ZA 1GPJA 1NJ8A 1H2AS 2WQZA 5AQ1A 2IYAA 5AXCA 1L7VC 1CQIA 4PPQA 2H2DA 2NZUG 1QUEA 3KEMA 4X5OA 5BVGB 1K28D 1I1NA 2PA3A 4PG4A 1WPRA 3F8TA 4KIGA 1SHLA 4C4ZA 4LK2A 4MCHA 8OHMA 4IIGA 2Z0MA 2Z08A 3CT6A 4Q82A 4AWXA 4CM9A 3SX4A 3ZGYA 4LHYA 2CLKB 1Y5IA 2V59A 2WDPA 1LFDB 7ADHA 3RYFB 1Z4IA 2QZZA 1HGXA 1T29A 1SCUB 1CEXA 2OHXA 2JW5A 3EIUA 4ZAFA 5JO9A 1FDUA 3IHTA 2BPOA 5D3KA 1S2IA 3NDRA 5FTJA 4B7UA 2V5UA 3I39X 3DBLB 2YJ4A 1NJFA 2WSSA 3BGOS 2F3UA 4IDDA 2P6OA 4KO4S 2O14A 2PLRA 2QUAA 3ZEAA 2NUBA 4WMLA 1R8YA 2W9XA 2RSLA 4XJSA 5A06A 2ZT6A 3DEZA 3HDYA 3ONYA 1ST3A 5D85A 4NZOA 1LV7A 1L7QA 1Q17A 1VPEA 3QBJA 4XWTA 2HJHA 1UM9A 1YJAA 1U8AA 3CX4A 2FOXA 3KJXA 3OOYA 1J09A 4PLPA 1JR3A 3SJAA 1QIMA 5I4KA 2OCLA 4GFDA 3ODPA 4UZSA 5I5GA 3GC6A 3I4FA 1NQOA 3ZWAA 4KG7A 4Z4GA 1J1IA 1W36C 3ZBUA 2OZPA 3HDHA 1MIHA 1NU6A 5EMMA 4C78A 3M89A 4CKBA 1Z5NA 2P5TB 2W2XA 4EYKA 2J5XA 3IBSA 3KSZO 3M5DA 4MQLA 4HS4A 1XTKA 2Q2QA 1IOLA 3Q7IA 4JENA 5JVDF 2BEKA 4XEHA 2VSOA 1AQLA 1JVSA 1EXDA 4G4JA 3AHIA 3FDJA 3SX0A 1QJCA 2FPGA 1STOA 3IP3A 1ZK4A 2AB0A 2ZEJA 4KQIA 1Z6XA 1EFHA 4AF6A 1P6QA 1KI4A 1UM9B 3L6OO 3OU2A 3PHJA 4IDFA 1ZIXA 2A33A 3EIQA 4YS6A 3K2EA 3RFVA 5F52A 1JWLA 4Z4SA 4CM6A 4F85A 1AHIA 1KERA 1JHUA 1ZGJA 5MGBA 4EI8A 1NFRA 1KAGA 3F46A 3COSA 1NVDA 2C9BA 2P27A 3CB4A 3LY9A 2YIVX 3NNSA 1NQWA 4NTZA 5CVVA 2FFJA 4M8KA 4BO3A 1I0IA 2XRZA 4MQEA 4JYBA 5E4TA 3ZIAA 5LQSA 1T6ZA 3UK6A 2H8GA 1KKUA 3A0RB 3Q7PA 1K5GA 2P68A 2KS6A 2ZTHA 3MJVA 1ZSYA 4DDMA 3CCSB 4B0OA 3SQLA 1KJNA 3LHIA 4HLCA 4GX2A 4II2A 2QSYA 3EDRA 5I48A 5LXTA 2ZJ8A 2XNDA 1BVRA 1N2OA 5C7YA 3QMWA 1ZA1A 4BU0A 1DOAA 2PIDA 3SNKA 4R2LA 4C2AA 1VECA 4MQ6A 2Z6BD 1RAFA 3GJRA 1VCOA 3REGA 1UBRS 3AM4A 4XOPA 1YJ8A 2IKQA 4RVOA 3TOVA 2FUCA 4I1SA 1L5HB 1NW3A 1U02A 2ADMA 1H4TA 1WPQA 3ZU6A 2CXOA 5G0UA 1YHQB 3AINA 3T5CA 1MTZA 2WHPB 3AZQA 3OQJA 4RJTA 1TQ8A 4ND5A 3EIWA 3MGKA 4K9RA 1YHNA 5HEKA 3ZV6A 2MHCA 4HK4A 1LK5A 4BY9E 1KI6B 3CUSA 4N0MA 3ZQ4A 4JITA 3OEED 3ICEA 1ESEA 4KGXA 1L1FA 2RHOA 5KYXA 2DIEA 1SQFA 2QN1A 3JYHA 1GFZA 3N53A 1A72A 4JLVA 1WDTA 4DLZA 4DSZA 2DUUA 3L7IA 1ZOPA 3PKIA 4RJLA 1ECCA 4IIVA 4MWDA 1W46A 1ZUHA 3BQNB 4ZYXA 5ILQA 1LBTA 2R5FA 3BCRA 4GKJB 1VPDA 1SQ0A 1LBHA 3T99A 2DFPA 1IHDA 4GI5A 4KXNA 4E5PA 2XZLA 5MF6A 1J9ZA 2SKCA 2XOEA 5AJVB 3W8FA 4NCKA 2O2GA 4YRKA 4ARZB 1WXEA 1TKAA 3AY3A 5K6AC 4WNAA 1S2GA 4X8MA 2BEUB 1K73D 1YI2B 1JX6A 4RZ3A 4B5KA 3G5LA 3GQBB 2AOWA 3K0KA 3IOEA 2Z6QA 3LY5A 3EZLA 3ZUPA 4BFUA 2ZGVA 1DT5A 4FR0A 4MLCA 2M6SA 4MW7A 4AZWA 2C54A 2FUNB 3VR5H 2AC7A 3EMDA 4Z4UA 1ZH0A 2YX1A 3ZK7A 4EHLA 4OXYA 5JNSA 2W83A 4B6GA 3LXUX 3GT3A 4U2GA 3AERB 4HN2A 4LWPA 1VBNA 5IVPA 3WKEA 2W4QA 4I2NA 1E3IA 1P4RA 2JBAA 3GFFA 3O38A 4KU4A 4Y9TA 3VH4A 3HXQA 2YVUA 4DRXA 4J1QA 4UU8A 1ZAYA 2PZBA 1K63A 1USIA 4J9VA 3ABQB 2WUEA 3CZRA 4UNSA 4MLDA 1YR7A 1RXCA 2DR0A 4L3VA 1F3OA 2LRHA 2QNBA 2TRSB 2UVDA 1BS1A 4KN8A 5ITWA 2CLHB 2ETVA 1ZISA 5CB4A 2JH8A 4NH4A 3ETDA 2ZJ3A 4K03A 3RIYA 1HLDA 2IXGA 2JAXA 3L07A 4XGKA 3ZWDA 5KYNA 1NXPA 1U8ZA 2VT2A 3KKPA 1HQDA 4LJKA 3TLGA 5CDYA 4Q9JA 1YL5A 4RF2A 5AKLA 1FMCA 3RYIB 3VTAA 5JISA 2JLWA 4F5YA 2REOA 5F2EA 1J6UA 2CJWA 3ZLVA 5TLSA 1HTWA 1Z8HA 5KIAA 1IHYA 3PWTA 5FV7A 3TSZA 3H2GA 4RFVA 1XVTA 5KOJB 2RDMA 5I9BA 4TTQA 3LQEA 5TGZA 3KR2A 4TSFA 2R6AA 3FWNA 1JPJA 3FW1A 4HAXA 4FDAA 2B2XA 4PYOA 1C3OB 1Y8ZA 3HKCB 5HQ3B 5IVKA 1N5OX 1QH9A 4MYCA 2IYZA 1XEWY 3EGXA 5AESA 3QITA 3ILHA 4BEJA 3PQ2A 5LQAA 2ZZKA 2XGJA 2V3CC 4B79A 2IXBA 2VPIA 1H2XA 3F2VA 3MYRA 3TD2A 1MVNA 4TMVA 4IZHA 5CNIA 4K81B 1ZMXA 1BU5A 2ACEA 2HWXA 4FDTA 4A2QA 3IE0A 5F4JA 4ENPA 4KAJA 2V1XA 2HIGA 4AJ9A 5EHIA 1L7MA 5ERYA 3JQAD 3UAVA 1XMXA 1YZFA 5MFPA 1S4QA 3LUAA 2BFEB 2QMEA 3SICE 2VZ8A 4D8UA 1PT6A 3DZDA 3KHKA 2C97A 3A9VA 1YZVA 2AZ4A 1WZEA 2V9CA 2YV2A 3AR6A 3H9BA 3NATA 3U1TA 3VC7A 3QKIA 4BGUA 4M9UA 5K4HA 4CF3A 3ENNA 1H5QA 2PQMA 1MQSA 1YHZA 3PFFA 1JYFA 2Q41A 3WDMA 4HN9A 4XKJA 1SD5A 2FZ5A 2L17A 2AHOA 2SKEA 3NYQA 2ILVA 4LQLA 4POOA 4GQBA 1SIUA 3CZ9A 4G2TA 4G0VA 4IFEA 4M6WB 1FUYB 2BMDA 4D02A 3DMGA 3LDHA 3AEYA 1XU4A 2C4VA 2YCLA 1A5TA 3PZRA 2ZYHA 4H18A 4M98A 3TOCA 2VNHA 4DB4A 1NVKA 4D9HA 5ESXA 4TN1A 1IRIA 4EARA 1G42A 4YUWA 3L04A 3ROFA 4WBNF 5HF9A 2FP4A 2ZUBA 3F6PA 3SMQA 3C3KA 3IUMA 3Q85A 4RSRA 3H13A 3QF7A 2ATCA 1EEXB 2R60A 2YYYA 5F98A 2P69A 5ILOA 5G4KB 3E2PA 3OX1A 1YUBA 4Y2UA 3H16A 1ESMA 1I2BA 2A9JA 2Q4DA 3VI3B 1D5WA 4JC5A 1DOHA 2ATIA 3G0IA 4X1KA 1IHUA 3G2KA 4HNAA 5FD8A 3ZLTA 1HUQA 1LLCA 2ZB7A 1PWHA 4PGGA 3AHFA 4CFYA 5FIUA 5A9SA 5E9JA 3N86A 3Q0EA 3ZI7A 2GH1A 3T1YB 3TRHA 1NASA 1KQPA 2OVFA 4FCTA 1B15A 1Q74A 3VZCA 5TEWA 3ZWYA 1AS3A 1ECPA 4IY1A 2YOHA 2G1JA 4EDFA 4F2DA 1NBIA 4YJ2F 1SUFA 2ZBDA 1ZUWA 1T0BA 4P26A 4EG7A 3U4AA 1OUMA 5HR5A 3TR0A 3OM9A 1X1QA 4C0XA 4RAQA 1G66A 1A9SA 1BHJA 3JQAA 4BQQA 4Z3KA 1ZSNA 3VVMA 4DY6A 1D4ZA 2QENA 3X1ZA 3BWMA 5CU7A 5EWMA 2XNJA 2DHRA 2JVJA 1U0LA 5JJ5A 1NVMB 4QE3A 5AXDA 4Q9DA 1MAUA 2JBWA 1RYYA 3E9QA 3KV1A 2ZUEA 2QSZA 1RHQA 1M5TA 4GOJA 3ZWQA 4JL5A 3M2PA 2ORYA 4IIYA 1U7XA 5HQTA 2PWZA 2BJVA 1ZH4A 4LMRA 1WXIA 3NHYA 5DT2A 5BQPA 4LXXA 5IUNC 2CXRA 4UCFA 2V45A 1ARZA 2HWWA 3GDHA 4PVDA 1TTQB 2VTKA 4RFSA 1DIGA 4OATA 4AKHA 1RPAA 5FPQA 3UWSA 1BNCA 3NBZC 1L7XA 4IOKA 1YXMA 1E4OA 1MG0A 2PZJA 2VJNA 3PD0A 4M21A 3RTEA 1NVFA 2V1UA 4I9NA 5JH7F 5KMGA 1E9BA 5TPZA 1J9EA 2WU0A 4I5FA 1XU7A 1N0IA 1P1HA 4RGVA 3RTAA 2QI9C 2QSUA 3A1WA 3FGZA 5DH9A 4LBWA 3HN7A 4MKFA 1TM7E 4Z9BA 1RVDA 2CLDX 3BJEA 3U09A 1THMA 4NKRA 1NQUA 1PX2A 3PEWA 2CF5A 1XPOA 3ORHA 3E70C 3GGCA 4ISBA 3ZR4B 2C59A 4MVWA 1BW9B 1U1EA 1EGHA 1B0AA 3A05A 4BATA 5HA5A 4D99A 4URHA 3ECCA 2VRCA 5E6SA 5T67A 3WKAA 3WLPA 2RK3A 4LAFA 1P4GA 1SVLA 1O94D 2VP3A 3H2SA 4MRRA 4NULA 4RPHA 1ZN9A 2ZU6A 3U3ZA 1N2HA 3AEQA 3CVUA 4GBED 4KX5A 1RYEA 4CT4B 1USKA 4K1LA 4CKEB 3B3FA 1G2OA 5D87A 2E4UA 4BYMA 2MSWA 4D80A 3AEZA 1LS6A 5TNXA 2C4WA 1MJNA 3FXAA 2NU7B 2F55A 3ORRA 4XQCA 2GDJA 4CEIB 5K3OA 1WXXA 3B3JA 1P1KA 4TMXA 1G1AA 2FSPA 2GN2A 3JQ7A 1E89A 1A2QA 2HTFA 4DUGA 2QTMA 4CMJA 4YUZA 5H9WA 2O2SA 3DEHA 4B6PA 1FEZA 4EZBA 4R2MA 1KWGA 1EVJA 1MVLA 3DBVO 1T1SA 1P33A 3D7NA 2IZ7A 1A4RA 3EXAA 3ZZUA 3TGPA 3K1TA 4I4IA 4M8LA 1SR8A 5F5NA 2PGNA 2A5FA 4FYVA 5EPOA 4FJ0A 3KBOA 2BMWA 1CHDA 2OCYC 2VIIA 3X43A 5JC1A 1BZYA 2SCUB 3IAAA 2N47A 4M2LA 4CTNA 2HDWA 2HXYA 1N8RD 1U7OA 1NW5A 4KAAA 3DW3X 1N5RA 5DNVA 4PNHA 3V1LA 2ZW9A 3OLVA 5FBRB 1KZGB 1NJSA 1UBOS 3H11B 3O82A 2DWQA 1CUZA 2RGBA 3G02A 3MCAA 4G1FA 2WHQA 4PLWA 5HIKA 3FNHA 4KUHA 5J2UA 1DJOA 3ROPA 1QQAA 3U4GA 1AY0A 1HKUA 3K73O 2CD7A 2QRVB 1Y1KE 3LC2O 3OIVA 1IYZA 1YKSA 4A0GA 4TUYB 5EHQA 1PNQA 4AXXA 1IHMA 1IN4A 1YB7A 2HPHA 3IUJA 5LWHA 1GGHA 1NJ2A 3CCLB 2EW2A 3MUNA 4GRAA 3UFXB 3KSBC 1N8NA 1C4WA 1JR3D 1LK0A 2Q5OA 3M4NA 2N42A 3M6AA 4K9NA 1L4LA 1FXSA 2IU4A 1BG6A 4N8SA 5JARA 4R81A 1TM3E 1TCAA 3KOXA 2CV2A 2VNJA 4E1VA 3IV7A 3V2UA 2GF2A 5AK4A 1IAVA 3HP7A 3P0JA 1VKJA 4MPPA 1GPYA 4ICIA 3JQ8A 1Z75A 2HA2A 1SRRA 4FSXA 1F6DA 2IXEA 1NNEA 4QOHA 3KEGA 3UHOA 1ZUIA 3Q10A 1Q2UA 2A3NA 3O75A 2PAFA 4QWMA 2B0JA 3ABSB 1KH2A 2Q4TA 3ISTA 3PC8A 4BVKA 4YAKA 2A0FA 2Z1NA 2E18A 4UVDA 4YX9A 1SN7A 1UFVA 3PR2B 4UQLA 1X42A 5LP1A 2WY2D 3PQ6A 4ZCSA 4BLVA 1OXBB 1Y3IA 1M72A 3DVLA 3IDSA 4LX0A 1WXQA 4BX9A 1LWOA 1SHUX 2BCGY 2JLCA 3MJ4A 2A9RA 4FHFA 3I6QA 4LDZA 4LXUA 4EEKA 4OQYA 3F4LA 1UKBA 2X6QA 3K09A 3ULKA 3GNLA 2ZZGA 1BOOA 4B71A 3H18A 2PWBA 5SZJA 2C8VA 4YACA 5CTAA 1J1UA 4EG8A 4UQOA 2AMVA 4AUKA 2IHNA 2XOXA 1FSPA 3DC7A 4H31A 2HDOA 2OV3A 1VE6A 3D2CA 3L4EA 2X6XA 4YRMA 1ZR4A 4ME6A 3E53A 3RVQA 1G5QA 3ME5A 1OU4A 4UTOA 2BFOA 2GERA 3EEYA 4D56A 4CT0A 1XIVA 1Y80A 1JVBA 4EGCB 3TTUA 4AY6A 4G5XA 4QQFA 3SSNA 4YLEA 3MSCA 1OBVA 1Y5MA 1HZJA 1L8OA 2N3ZA 1NI4B 4AKGA 4WCFA 3U7GA 4GPIB 5CB6A 3HE3A 2W2TA 4ZZ0A 1LRJA 5IP5A 1FRZA 2HMVA 1DARA 2PSEA 1JDBB 3KJFA 2HC9A 4LY0A 1CUUA 1DRWA 1P29A 3UWMA 3I55B 5I01A 3SLKA 1T9GR 1UXGA 2YNMD 1RWNA 3OPYI 2Q9CA 3QFFA 4JLDA 2XWJI 4JGIA 4MWZA 2FW0A 3ASPA 2RARA 1Q7TA 4U2DA 2CE2X 2OWDA 2DKFA 4X66B 1HE4A 3VKUA 2EC5A 5KTMA 2AHRA 5C7OO 3LW7A 3K72B 2PX6A 4GX1A 3L0CA 4YFVA 1H69A 4GQNA 1NBEA 2P3QA 4XDYA 4IZIA 4QYIB 5A89A 1JJAA 2Q1SA 3HI6A 1LK7A 4X90A 1HR0B 1VKOA 1EXVA 1I13A 5F4BA 1GGVA 4RTSA 4TMTA 3LUFA 1HVXA 1Z7GA 2FH5B 2HJWA 3FCXA 3WV5A 4OHZA 1LRLA 2PLFA 3Q38A 2E2WA 5HBGA 4RDKA 1GN8A 2JCVA 3PQEA 2FFBA 2WWWA 5AYVA 5BURA 2V4MA 2R25B 1U63A 2G28A 3IVGA 4NYMR 3AVVA 5ECYA 2RBEA 3DKKA 3HJHA 2YN4A 4YJHB 2DP4E 2ECOA 2ZUDA 4QOEA 3ZH9B 1JLHA 2OA0A 4DANA 1DBQA 3D43A 2QJOA 4YUVA 2XXAB 5JLJA 1RWVA 2HDHA 4ZOLB 4N0PA 3OCZA 5C1DA 2R79A 3RUIA 3ZY5A 4B33A 1CYEA 3HCFA 1WOPA 1QVRA 3OFND 1IBRA 3PX3A 1L7AA 4GHWA 3ABRB 3CIOA 2NZJA 1UDRA 1KEEB 3DZFA 4DJTA 1WKVA 3CKYA 3HEMA 4IAOA 4ZK2A 4R0NA 3S1SA 1KRXA 4MVJH 1JEQA 3WL6A 3N2NA 1IIRA 3OCJA 4WK0B 4BO5A 4WEOA 1JJVA 3P9YA 3OLXA 3G1WA 1KY4A 3HHEA 4QO7A 3VAAA 2Q2VA 5JOQA 4O2AB 2JRLA 4GOOD 2IFTA 3LUHA 3V7WA 2IP1A 1MHPA 2O2DA 3EW7A 4NZPA 3ONFA 3VC1A 2IS1A 1S02A 1B26A 3CMAB 1PSZA 3GQBA 1I1QB 3U7FB 3H8SA 3ZJUA 2C00A 4TTPA 1C30A 5T64A 1TM4E 4F92B 5L3QA 4PLZA 4RK0A 3K1ZA 3FLEA 4DV0B 4LOHA 4M1ZA 2A67A 1Y8RA 1U65A 3UXEA 2NZVG 4C0HA 1SCIA 4Y6OA 4OHPA 1E3WA 4FHGA 4LVCA 2H57A 2C7RA 4GPAA 5CBPA 5LWQA 3DMPA 4LXHA 5BORA 3MIZA 4RQAA 3BH4A 5JH7B 1J23A 1A8PA 5K8IA 3CJTA 2R6CA 2JBAB 2GHTA 1U2GC 2DUMA 3FTPA 1K0UA 5B2FA 2PCJA 1V9SA 1N5MA 1U1IA 3L4KA 1XZDA 3GJSA 1V47A 4N47A 3D7MA 1XMJA 4PFSA 4X41A 3RFXA 3L92A 3WDSA 4O0LA 5I9IA 1JFSA 2ECPA 1H3FA 2F3TA 2X1MA 1CXZA 1TC1A 2JAQA 2O7VA 2OBFA 3ANLA 3MJCA 5DGIA 2QD1A 1BDIA 3OCCA 1CVIA 2SBTA 3H5RA 2WD8A 4UTPA 2J0SA 1Q7GA 1RHMA 5FNVA 1AM4D 2GZSA 4BFTA 4X1YB 4HAOA 4F6RA 1GA1A 1QGOA 2ADOA 1V95A 3RIXA 2PWAA 3OPVA 3D6VA 1S8FA 1NI4A 2YV1A 2VUIB 1S8AA 5JO0A 2ZXIA 1CVLA 1DDGA 4IRMA 2UUBB 1WL8A 2PLNA 1QNFA 5U4XA 1V1MB 4LQDA 1UBJS 3PXGA 4FR2A 1E7YA 3I2KA 2AQ8A 2LW7A 3D59A 4GZMA 5F1KA 3AF1A 5G41A 3TJZA 4BKRA 4CMGA 3BCSA 5K45A 5J2TA 1EHCA 3ICOA 3V48A 1YFZA 4NH0A 1PV2A 2X1HA 5FULA 4ESHA 1Z4JA 5CIWA 2PVPA 4GR5A 3R0JA 2ZTVA 3HI4A 3CKKA 5SY6A 1FRVA 4BCDA 1GLNA 4MKGA 3RJZA 3A8IA 4EHIA 3LQ6A 4YH1A 1Q1EA 1UBFA 1TYBE 4L3WA 1O94C 1ID8A 4XGNA 2OFXA 3QP9A 2K4MA 1E0KA 1VQ4B 2ID7A 4C3ZA 1X39A 4UBLA 4MUXA 2ZTMA 3F1KA 5H02A 1THGA 3ZWNA 5AVQA 3HDJA 2OAEA 3OOJA 4GMXA 5G0WA 1JHXA 4YUYA 3STYA 3MUOA 3VHRA 4RS3A 3OJXA 4NLLA 3PRKE 1RT9A 2P6NA 3HZRA 3SEZA 1T36B 4MUJA 1VIMA 3KPYA 5DVZA 1XZLA 1B4DA 2JZOA 4HYTA 1E5DA 4B75A 3ORYA 3N3BC 1VG1A 5FYQA 1D6JA 2HLDD 1K7SN 1NY5A 1RS0A 1UPFA 2B82A 2D5CA 2H1SA 3K8QA 3OTIA 4G1CA 3UHJA 3UMCA 1RRFA 1GV1A 6GPBA 5KYTA 4KWTA 2PUBA 1C3EA 2OBNA 2FPXA 1VL6A 2HU5A 4HQLA 2C0PA 2UV8A 4Y2JA 2X0NA 4D9NA 1N0UA 5GWXA 1T1EA 3TQTA 1A9RA 2Z57A 3TVDA 4HRVA 4OUKX 1NB0A 4D98A 2VQDA 1I2DA 2P90A 3ND8A 3OFJA 4LDRA 4CR7A 3CWZA 4ENRA 2CDCA 3M6XA 2E4AA 3LKVA 4GEKA 3NTUA 3ILSA 4GLLA 4Q1DA 4UHJA 4INPA 2QQEA 3KPUA 4J43A 4RPGA 3RSZA 4AJOA 3SF0A 1Y8CA 1NMYA 2J41A 2O0LA 4LZOA 1LLDA 1FUUA 2X9GA 1H2EA 4UTRA 4QLAA 4YR9A 5AVWA 1N7GA 2CLCX 3JD1A 3QLVA 4WNYA 1Q6ZA 3AKYA 5KQLA 4RTPA 2HMTA 3DOCA 4JN6B 2FA9A 5E6UA 4HWTA 3VSEA 2XB2A 2QTCA 4KPFC 1W0JD 1I5OA 2QG4A 4I6GA 3KUDA 1JG7A 3D8UA 3K4PA 2PD3A 4FGUA 4FZ3A 5AXBA 2QPAA 1V7ZA 3ELWA 3GH1A 4FI3F 4JNKA 4JT8A 4JSYA 4UAVA 4CUJA 2K7FA 4PF1A 3IPLA 4Z0TA 4JROA 3EZ7A 4ABTA 3DHWC 4JI1B 4DZZA 1D09A 2HAEA 2GDZA 1XQ9A 1O4WA 4FDVA 5JIBA 2I6QA 2D13A 3JTMA 3ON5A 4ZWNA 5HMLA 5JEDA 3UXHA 4I1PA 4C9BA 2D0DA 4WOCA 1U8EA 1CE8A 2HU2A 3CLTC 3O7WA 4C0AC 5BV8A 1KEEA 5E2BA 1Y8RB 1UJ5A 2ZB3A 5G0TA 3OT1B 4OQQA 4ZD6A 1RD4A 1ZVKA 3B9RA 4LF7B 1L4YA 1MDBA 2HF7A 4OGLA 2BGKA 4CPDA 4EFKA 4O63O 5EPEA 2P6UA 4L27A 4QSMA 4FB5A 1CQIB 4H0CA 1PUJA 4XWWA 1I10A 3HCEA 3QU9A 1IXKA 2WVJA 4NX2A 3KS9A 3FYSA 4R8VA 5A0TA 3QWHA 5THQA 3A4IA 1II0A 2WVHA 4NV1A 3UM9A 1RYMA 2LZJA 4BL5A 1L5MA 1J39A 1D5CA 4E22A 4ZHQB 1S3SA 1BXZA 1QE0A 1T0JB 2RK6A 1PR3A 4A7PA 1DV1A 1AGPA 3CM0A 5AD1A 1YWGO 2Z2YA 3I9LA 4RUKA 5CA0A 6AT1A 4BPBA 4Z4WA 2A58A 5F3WB 3L4BA 4IDQA 4AJJA 4IJKA 4DTIA 3OQNA 2GK6A 1G291 3LO5A 2WLTA 4UCQA 1H23A 1N2CA 2AF3C 4G7WA 3CX3A 4J16A 3U9TA 3PL5A 1DPGA 3IE1A 4AJ1A 4FN4A 3WLJA 6REQA 4B0PA 2HLNA 4CKCA 4P33A 1N2IA 3B13B 3FSEA 1R5OA 3BBLA 5J47A 2YXPX 4BUZA 1B8NA 1C1DA 1MRNA 3C3DA 4KE6A 1G5FA 4R2JA 5CFOA 3QPAA 3KEOA 3H9NA 4LG1A 3S8EA 5LZ2A 2Z04A 3O8RA 1ADJA 2XI4A 1ZCAA 4D74A 4EUKA 1P39A 4QBIA 3AWDA 1EFVB 3QZUA 3AVTA 2ZDGA 3GFSA 4JXZA 5HUQA 1Q1GA 3MC1A 3GLIB 1KARA 3R8CA 4BMPB 4NJOA 3G71B 3GLRA 4UNNA 5AOBA 2YMMA 1FJXA 3SBEA 1U9IA 2XQJA 1X80B 4Q4AA 4RY2A 2P5YA 1JALA 3JYNA 4DZRA 4DV6B 1G38A 1VJGA 4HUQA 2HR1A 4JLPA 5BMVF 1SVIA 2Q0SA 2ZYSA 5GGYA 1U1DA 1U5CA 1YDFA 4WXPA 1LW7A 4ZCLA 2A9FA 4A2CA 4C4PA 1NUPA 5CTJA 4W5NA 1Z13A 2DPYA 1KD1D 3OZVA 2I3BA 3NGXA 3BD6A 2QLJA 4OXRA 4YJ3A 3B7PA 3UKDA 1ML4A 5DYIA 3OIYA 1NJID 5J4LA 3OEWA 3DLCA 4MGEA 2W22A 4ZOLF 3TGWA 3G6EB 4H27A 4PHGA 3GG9A 4DDHA 5BNWA 2VT3A 5IWCA 2VR1A 3OF2A 2P4EA 4GMHA 1YUMA 1J42A 2WMYA 5BO5A 4R9VA 1VLMA 2ZULA 3LLMA 2DHEA 2ZI6A 2GJAA 4MQFB 1T3TA 4MW4A 1FQJA 4RBNA 2WRZA 5DO9A 4C03A 1XZ8A 4OQZA 1KYTA 3NP9A 2R1TA 5IJ0A 3U1VA 3VHQA 3HFJA 4E3WA 2LKCA 3DULA 5AM2A 2W4MA 2YOGA 4WUTA 4Q1FA 5I7WA 2ZWAA 3HGTA 4JODA 3DE2X 1W85A 2CDBA 2DPMA 2OHGA 5BSTA 2DUWA 4D4MA 2HSZA 1S8OA 4DMLA 4ARIA 4WXMA 2HMWA 1G8AA 2OQRA 1GVHA 1CDDA 2XR1A 4X9XA 3ZXXA 5GZ3A 4G6ZA 2EQBA 1KY5A 4GLBA 2J9FB 4RVSA 2HTEA 4JHLA 4QICA 5HF8A 2Q3HA 3J80A 1V48A 2PMBA 1B0PA 4FOOA 1YULA 1DWQA 4XQ0A 4DA9A 3P9ZA 4AULA 4QYWA 3OO1A 1GNLA 1AV7A 2FN9A 3ZKAA 4B85A 2JIQA 4BIMA 5A4DA 5LP6C 3DAGA 3HYLA 2Y67A 4KKSA 1Z0UA 2C99A 4Y2YA 1XMPA 1I5RA 3QG5A 3VH3A 4C2BA 4XB2A 3PUJA 3QOYA 3UIEA 5BR1A 3JQRA 5FHQA 4TUYA 1PQ4A 4UBMA 2Q5HA 3OF3A 3WK8A 3F3YA 3JQFC 1DGQA 3H1FA 3ELDA 3L8EA 2YKGA 4F60A 1AMOA 2IP4A 4NMWA 1DFGA 1SCJA 2GKOA 4ZYTA 4HE5A 1DDOA 1E1DA 3EY4A 5IAKA 3A35A 1XWWA 3EWIA 2G9ZA 2CYCA 1SC1A 4CFSA 2E4XA 4ARVA 2ZM6B 1X77A 2ZM5A 1BEUB 2PD4A 1K4MA 2AJ8A 1N36B 2NTJA 3HVIA 4JB3A 1CR1A 1Q1BA 1J49A 3ANMA 2GCIA 1UBKS 3OJ0A 1KETA 3JRWA 1SVSA 4X7CA 4JC4A 5C8ZA 2IGTA 3EGXB 1IUNA 2PL1A 2XCLA 2A4MA 3JASB 5E7MA 3SSOA 4CMKA 1L5RA 3FYDA 3ZWVA 4WZEA 1KFCB 1RI5A 2FUKA 2GJPA 1RC1A 3AW9A 2I78A 4MVJP 1FBNA 1KKLA 1JE1A 1EFVA 2GD6A 1LXCA 4RSHA 1O54A 4DA0A 1KQFA 1S2LA 2YZ7A 5CGQB 5EZYF 4H16A 5AW8A 3IAM1 1GUBA 1CZRA 4MWEA 4Y18A 1W5BA 4PLGA 5J5AA 3PPIA 3H19A 1B0UA 4D9IA 5KSZA 4QU9A 1IEQA 1NUUA 2RCYA 4F2PA 3ZS9A 1W4RA 3E5MA 2WMDA 3PRHA 1MXFA 1EFUA 4M76B 1O4VA 1LSUA 3O8LA 4UHBA 3MCTA 2BFFB 1FS6A 3IURA 3L1UA 3W1VA 4DEXA 3IAS6 3TIIA 3EPHA 1B1AA 2JGIA 2ABWA 4IIJB 1KDVA 1PNRA 1LNZA 2XDQA 2C4KA 4QOIA 3DNFA 1UJBA 3CCJB 2CFCA 4FC7A 4NY1A 5DRTA 2VLBA 3G2MA 4LOJA 4Q01A 1YMVA 1PP4A 2FX2A 2L19A 1JFTA 3IVAA 2DEUA 3CVVA 1YJWB 2QIPA 5I3ZA 2H0QA 3TTYA 3SXPA 1SXJC 2C3PA 2YXBA 2BH2A 3WDLA 1DWPA 2X9VA 1ZINA 3PPVA 5CK5A 3NOXA 3WGYA 1C7FA 3PX7A 3IRVA 4MP3A 5FTWA 1KQ3A 1M8FA 4HE6A 4KFUA 5LD2B 3GEMA 1NOKA 2EDCA 2WFAA 2OFWA 3TDKA 1T5OA 3GVXA 4IDAA 2XCTB 1P8JA 5EERA 1EKXA 2ZYRA 2DC1A 4REQA 3DUWA 2OT3B 4QFCA 2Q3MA 1E63A 2PBFA 4ZN6A 1YZHA 2R7LA 4A5SA 5T3YA 2VHZA 3BF8A 2P3MA 3TVTA 2J1LA 1CD5A 1UBTS 2OUKA 4AJLA 1OLSB 5EFOA 2GJSA 4GM4A 1Z5VA 3V1KA 1D1QA 4JQOA 2EHJA 4KVAA 4JX8A 2C2OA 2EZ8A 4NU6A 4RY9A 1C4KA 3CF0A 1R4NA 5JZSA 5LR6A 2ZTNA 3N2YA 5ES3A 3N0RA 3N8HA 6ABPA 1UQRA 1ZNWA 1JZTA 2WKSA 4FDLA 4Y0NA 5AW9A 2WB2A 1J7JA 1NV8A 4U7JA 3RVBA 4L6CA 1GR1A 4MQBA 5HFJA 2WQ7A 3HKDA 1VQ5B 2DTXA 2TMYA 1NR5A 3WRXC 4R2XA 4ZKDA 1VHTA 2JJ2A 1E8DA 2J85A 3LCMA 3HVJA 3PFKA 1VKRA 1ULZA 4H3SA 4TGLA 4Y67A 1B73A 1U2DA 1EB8A 3NALA 4J9UE 4WHMA 5AH0A 4DEVA 3Q2IA 5GPBA 1QTQA 1CLUA 4NNJA 4KOAA 4PINA 3H9CA 3RF6A 1R8XA 3TZKA 1E2GA 1P2GA 1YS6A 2ZXHA 3W5IA 4IDOA 1ZXLA 2JFGA 4X20B 5K9ZA 2XYPA 1BHQ1 4D0SA 3BM5A 2R7KA 2FQXA 3FUWA 1F20A 1WP9A 4JR0A 4KQCA 3AR3A 5A1TA 1SXGA 1CQPA 1M1YB 3BB4A 5HWSA 5JFGA 1XA4A 4W6ZA 1ZM2A 1XT6A 1WIWA 1FVFA 4H6VA 3LFTA 2ZKLA 4ZU6X 3X1WA 2PM8A 2CDNA 3UUWA 1L8QA 1VMKA 4MHTA 5E6RB 5IDWA 3DLBA 4V2IA 3RY8A 2BGRA 5HFNA 3P32A 4DA7A 2DGDA 2CUNA 1M6YA 3GP3A 4X94A 3H05A 4IS2A 2J3JA 5JJKA 3PXDA 4I9GA 2GMWA 1GKIA 4K9SA 4MHOA 3UXYA 4B31A 1GAXA 2CFRA 3R5FA 3D81A 4MQEB 5TIIA 2VWPA 2JHFA 4QECA 3IV6A 3FPPA 4HXYA 4YWJA 5I7VA 1M83A 1A5ZA 3GDFA 3G5UA 1GZ6A 3LA6A 4B3JA 4UZFA 5JY6A 2W6PA 1JFFB 3NIFB 3EVZA 1KI9A 1M2KA 3L7BA 1Z07A 2F4VB 4OLJA 1VCIA 2N1MA 3L1JA 1UC9A 3M82A 1KI3A 1QV7A 1RCFA 5F2OA 3NV9A 2EG5A 5HCIA 3KCQA 1CHNA 1Z5UA 3CUTA 3EHDA 5I7AA 2H11A 4Q24A 2FLVA 3JQCA 4E7PA 5B4UA 1FJ2A 2YYZA 2BFCB 3OT1A 3OZDA 1XA0A 3RC2A 3V4SA 5A6SA 1XZQA 2ONYA 1V3UA 3P5BA 5CVEA 5E3JA 3CG4A 4KAXA 3TNDA 4R3WA 1ZGCA 3FGNA 1CTQA 3W5UA 5K6TA 4MUKA 2WR8A 2F90A 1WOSA 3KZKA 4ETIA 1YRLA 2Y1OA 2PX8A 4B7ZA 1O77A 1ISIA 2CNBA 2BZ1A 4ZGWA 3T54A 4WZAA 4QEKA 1T8UA 4C4OA 1BXKA 1OFTA 3H6GA 4JQZA 1YCFA 3DP7A 5MDHA 3M9WA 1ZCBA 3QLUA 5ARDA 4CNBA 4EA8A 1P7WA 2IDKA 2OXFA 2CXQA 5EMLA 2BV3A 2OP1A 5DNCA 4BBPA 5K3DA 2I4RA 4J6EA 3TNLA 2AOTA 3E8XA 1Q86D 5BWMA 5K99A 3QBDA 5JD5A 1QGDA 5BWLA 4QRIA 3OPXA 3SVZA 3FHLA 4C0KA 1WUIS 1N6HA 4H6XA 2C5SA 2QIOA 4IJQA 3LMKA 4QUDA 2CNOA 1QF6A 2V7XA 1ZIYA 4P3PA 2CCJA 3ROXA 3W78A 4YHHB 4BE4A 3H6KA 2AOUB 1QDLB 5IH3A 3MGAA 3A58B 2JBHA 3UNXA 5DX1A 5BY2A 3HTXA 1P44A 1ISPA 4BQEA 1WNTA 2DQYA 1SZPA 3KTFA 3PUYA 2ICAA 5BOVA 5E1OA 3ZPNA 4PBRA 5FBQB 4HDKA 4M1MA 3NIWA 5K0GA 1FFGA 4KKVA 5IC6A 2D1RA 2BOVA 4F8JA 1UPAA 2WJ3A 3F5DA 1FMLA 2O1EA 2G83A 2P2LA 1UR5A 3G23A 1P1IA 1ZOOA 4O29A 1DC7A 2JATA 3WB0A 4DCPA 4DNQA 1BX3A 4DIFA 4EMBA 1QGAA 4TZTA 6NULA 4FUQA 1K5PA 4DLRA 3R9WA 1JEJA 3U4DA 1Y4ZA 2OGUA 3G5TA 2NX2A 2L42A 2QWXA 4NK4A 1RRKA 3IR7A 3UV7A 4V1CA 3GX1A 5EJ5A 1MAWA 1UWCA 4RAOA 5AJWA 4BPRA 1I1HA 3DVAA 2V4ZA 2QVYX 1YS2X 2GUGA 4POAA 2R7NA 3L0YA 4PICA 1YJ9B 3EMVA 5LJIA 1W4AA 1NIJA 1EVZA 1XTRA 3GLIA 3LIPA 2X8KA 3DLTA 2WTUA 2VDRB 1XL1A 2J3DA 4GUDA 3RS5A 2CEAA 2BM8A 3CNNA 3JWJA 5JW6A 1QHYA 5L53A 1U0FA 1PK9A 3OKPA 1WVMA 4IIEA 3F96A 3WI7A 1E96A 4Z51A 5A5FA 2XMPA 4GT1A 3R9XB 3VJLA 5CLIA 4Q3EA 3U7IA 5KKAA 3H0EA 4E03A 4I55F 2B99A 4N18A 1KKMA 3U1BA 3MTEA 3O3CA 2CNNA 5JSYA 1Y1PA 3E3MA 1PFGA 4ZGQB 3K2IA 3F6CA 4LXYA 4DV4B 1IVSA 1RM5A 1QIDA 3C6YA 3N7UA 5K1ZA 2W2LD 4IJVA 4L2IB 2YV3A 2JIDA 4H60A 1N92A 3P26A 3VO1A 2XA1A 2G9VA 2Q6LA 5DISB 5IYQA 4PBSA 3FYUB 1U0SY 5FLEX 4XMYA 3ZKWA 2GNOA 5ITZA 1GTG1 5GM1A 4D0NA 1VDMA 5DEOA 1VKZA 1OPRA 2YRFA 1CRPA 3UHAA 5D6OA 5AVZA 4P3IA 1BCSA 5I47A 5KREA 4QPZA 1NG9A 1IMOA 1EX1A 4F96A 3FMFA 3T41A 3UJ8A 3A04A 1DJMA 3VR2A 6YASA 4NC9A 4EFLA 4C4AA 2A1TS 3BIXA 3O8BA 3DC2A 1T3SA 1OAOC 5HJ7A 2F8TA 5AIAA 4HFRA 4LXIA 4NFYA 1ODTC 1RFLA 4CM4A 1GQQA 3B1JA 1JIVA 2MR5A 1JSRA 5ESRA 5FOVA 2PR7A 4C7VA 1LF0A 4PTYA 4D8TA 1DNPA 4EG3A 1XQVA 4B73A 1QH1B 1OWPA 4JI4B 1G5IA 5FOWA 2H54A 2NAFA 3OM1A 4YPFA 3CWCA 3LPNA 1RACA 5C81A 2M98A 1CR6A 5LMUB 1ZM7A 3F9CA 3JAKB 4GNRA 2BISA 4AZ3B 5EZSA 2ZVPX 3W5CA 2D74A 3C7KA 2A5GA 1AZSC 3UK2A 3M34A 3QIAA 2UVPA 3WGKA 4TMYA 1TA4A 3ZE7A 3KZXA 5JS8A 5CH8A 5JZMA 2P2DA 3MJDA 2VHTA 2AOTB 4J4TA 3UN1A 1UBSB 3KELA 1YF3A 1T2VA 1X1SA 2UUPA 3Q2OA 3UQYS 4WESB 2QLBA 2W6NA 3R3XA 5CXXA 3W6NA 1PIWA 2EG9A 5D8DA 3D5QA 5F3RA 3H2JA 4BV8A 2ZSFA 3ED5A 4BRWA 1VL0A 3KVNA 9LDTA 3WDKA 1MW9X 1U7WA 1ZH6A 3USES 4RIGA 3CRVA 1BGVA 3PLNA 5K20A 4I4TB 1YC2A 1DAOA 1N9ZA 2OBLA 4JYMA 3SIRA 1YA6A 1W47A 4JJZA 4XTCS 3IO3A 2ECKA 2RH5A 1W4LA 2V5VA 1SKYB 3CKLA 4HDSB 4RKFA 1ACJA 1AKWA 2WE8A 2BONA 1ADCA 3OTWA 4YJ2B 3WB2A 2IYFA 1ZOSA 2XRFA 1B6SA 2GJ9A 3GVPA 4P2BA 1IUKA 3HMKA 3Q2KA 4U7GA 5JXHA 2QLTA 4IMIB 3JQPA 2ESRA 1M1UA 3QU7A 4EATA 1O6ZA 2FUEA 2AE2A 1IEXA 3RRZA 2FMKA 4M88A 4AJEA 3RH0A 2E55A 5JLAA 1ONOA 1N77A 2JI8A 3W2TA 2VT7A 4EB6A 2AN4A 1AHHA 2HRCA 2ZRNA 4XX0A 4YDRA 3LF1A 1I2MA 1ODKA 3BXZA 4KGDA 4U39A 5DB4A 2RGWA 5EGNA 2VTVA 1ESNA 3KKZA 3RC7A 3EZ6A 3FYUA 1AGXA 1JQLB 5LOVB 1U1GA 3DYIA 3UB4A 1A9XA 4IDNA 3E81A 4HGRA 4BNDB 5CM2Z 4AYXA 5HX7A 1S3IA 2X19A 1N1EA 4ZQIA 1LTHR 1ONNA 3U3MA 1OFUX 1Q6YA 1XDBA 2JGJA 4PO9A 4PR3A 2MSEB 4FVTA 1EE2A 3U7QA 3FFXA 4XD7D 3GO4A 4C04A 3WK5A 2XIQA 1IY1A 2I80A 3ZGXA 3T9CA 2PQ0A 3JTEA 3KAQA 4CMCA 2VJJA 1VG0B 5I6DA 2EKQA 3NW9A 2VCYA 3C3MA 3R7WA 5JCXA 5EKUA 4RVHA 5E4YA 1NDHA 4TV8B 5CFQA 4S05A 4LRXA 2EW1A 3EGVA 3M5CA 2C1XA 5CX4A 1M3SA 3UZUA 1G8PA 2BEWA 4LDAA 4EYQA 1VQLB 1IK6A 4Z0NA 2WHEA 3AO0B 3EXIB 4D9KA 3ADPA 3FHTA 1BMFD 3HN2A 5IZCA 1DEOA 2VZEA 3NHLA 4GNKA 5TQJA 4ZO7A 3IP9A 5A4KA 1XTQA 2ZI5A 3JYPA 3TLBA 2RGAA 3JALB 4PNEA 2V74B 4TMFA 1YI0A 2FTKE 3LWDA 2I6TA 4LVNA 4N5HX 2XOKA 3T9AA 1DTWB 3ZZNA 1ZWLA 4C07A 4OI0A 2B6HA 3GIWA 3ONNA 1DHRA 3EUFA 3OE7A 4QOSA 4N40A 3FBTA 4R1TA 3A9SA 2VK8A 4ONEA 4Y2XA 4KLAA 4BB9A 1ZN7A 4UEOA 2ZRAA 3KUCA 3H9UA 3O4RA 3EXEA 4MDYA 4D0GA 4IBOA 4B3CA 1JKIA 2W7TA 1PV1A 1X7HA 4JOBA 3UBMA 4INAA 1WSBA 2OK8A 1NPDA 2FVYA 2RBGA 2WB4A 1SU8A 2ZI9A 2DFLA 3H1GA 5EE5B 2D00A 3ZDFA 4ZGBA 3OQOA 3DD5A 3RYIA 2VDWA 4N5DA 2NZWA 3F6SA 2CXSA 2DKNA 4AJIA 1HDZA 4I1OA 5H4HA 5HZBA 2JJ2D 3T3IA 1ST2A 4DCOA 5FPKA 3LQYA 3YASA 1NA5A 3P9PA 2P9YA 2Z30A 3P97A 3PCXA 4OIMA 1LVUA 3THSA 4RF5A 3EEIA 1F2UB 3UATA 3G8DA 5KU1A 4GBGA 3NOOA 5L3ZA 4B6EA 1JQKA 2VJPA 4TTJA 3U4QB 3ZVKA 2WZBA 3ROEA 1OI3A 3UT5A 4LCEA 1T2DA 3I9V6 1Z6YA 4A6XA 3ZD6A 2WWRA 2QPTA 3WXMA 3FSJX 1R0XA 3I72A 3NT5A 4NVRA 3CKMA 3H94A 1ZEJA 3L05A 1Y5LA 3MTDA 3OJCA 4YRPA 3V4PB 2J48A 4HQFA 3Q41A 1YH3A 3B78A 1HDEA 1R1DA 2JKYA 1VB3A 1YJQA 3IP1A 3JYLA 4DRZA 4DUZB 3HNRA 3PGKA 2YRWA 4HJXA 2EBFX 1CS0A 2Y1DA 1T13A 1M76A 5TPWA 1G3RA 3SIWA 2ZL7A 4AT1A 4FWTA 4WCDA 1ZZEA 1GQYA 4HQOA 5AKJA 3KZVA 1QH8A 3PCTA 4JB2A 4REMA 2ZJ0A 3CMMA 1NUQA 1QDUA 3BRCA 5A02A 1LPPA 4EHFA 4P3XA 3KB8A 3V34A 3SLGA 1KL7A 3RSHA 4AZ0A 1C7JA 4Y8VA 2BCJQ 4RADA 1YS4A 5G4LA 3PEFA 2Q4BA 5CAEA 1IJBA 1GUAA 4F3CA 121PA 1V8FA 4ZO8A 1X87A 1BQ3A 1XF9A 5DI3A 3S2ZA 2COUA 5EVJA 4DA8A 3ER8A 1RMTA 1UK6A 1A9PA 1ZG3A 1OVMA 3L5OA 4XN0A 1E1CB 2JGDA 3CLHA 3KOZA 1Q0PA 2XGOA 2V97A 3MPOA 1WW2A 2FEAA 3ZK9A 2ZXEA 4O59O 4CCYA 3CSUA 3PR1A 2BAGA 1EVLA 1QMPA 2BHTA 3K5HA 1C1XB 3GOHA 4EF4A 4XLTA 1JBKA 3C6KA 2AYXA 3MM4A 1U8TA 4KAFA 5DP2A 5EG5A 5IBQA 4UUBA 4TMZA 2AFHE 4I1IA 2GX6A 1GGMA 4XVRA 4MEAA 1QAOA 2GOYA 1Q7BA 5AWFC 3CMEB 3SOPA 3FCAA 4RPIA 3T1NA 4BFXA 2SECE 4DLAA 3HKBB 1OB0A 3ZI0A 2IIVA 4J90A 4MULA 3IAUA 4K6KA 3H65A 2OP0A 1CU1A 2QVBA 4A92A 4LF5B 2AXPA 4IVNA 4OP7A 5ARBA 1ISRA 4I4CA 4W1RA 5IDXA 4QUZA 2WKWA 2X6YA 4L8FA 3E35A 2VPZA 3M6FA 2QRGA 1YACA 3FZQA 4G5OA 1WPCA 2PVCA 3OESA 4PE5B 4Q3DA 4RVNA 3AV0B 3F5SA 4HZGA 2VPYA 1N34B 1FMTA 2QT0A 3RBVA 2BKUA 1W93A 4MNTA 3A4TA 3OU6A 4X95A 5ALDA 4B44A 2NPOA 3N2ZB 4ZA2A 2QK4A 3TAHA 4BZXA 1DTEA 3H9JA 3Q11A 4G0PA 4HVAA 3DJYA 3ZDQA 3P4YA 1A77A 3F90A 4IMJB 4R8KA 2QOEA 2QX6A 2FZEA 5K2MA 5BXYA 1Z26A 2I2FA 2WTXA 1ZLYA 3SF8A 1EFPA 1I01A 5DYWA 1AS2A 1LQTA 3UT5B 3DM5A 3NONA 3I62A 3AY6A 3O8DA 3ZU4A 1XP8A 3KYIB 1HRDA 5KNDH 1Z9BA 4C30A 1JDSA 1O08A 1NUSA 4B2PA 4RPJA 1IDN1 2CXNA 3L6RA 5EP3A 3PPXA 1E9RA 3V3TA 4MYSA 3G2JA 2B8WA 3CUVA 1WKBA 5I9SA 3TBKA 2AJBA 2I4NA 3FJ1A 2X3FA 3K15A 1DQNA 2R47A 3GGPA 3OPYB 2C1ZA 5TT0A 2WUFA 2RH4A 3LYHA 3KTAA 2WJPA 4X00A 1M6EX 1Q20A 2B30A 1QS0B 2Q4OA 3HU5A 3QU2A 3OFVA 4PO3X 5EJ4A 1K8QA 5IU6A 1XRSB 2WLSA 3TJMA 2X13A 4KVFA 4BGVA 4WK6A 2R3SA 3TLXA 1W5AA 2PYZA 5JSQA 2XT9A 1UJMA 3I05A 4CL0A 4JU8A 5HVNA 2R1VA 4D82A 4HGYA 1HDOA 5WRFA 4ID3A 1OA1A 1U9CA 1LSOA 1VQ6B 2WFMA 2I2AA 5IJXA 2RKBA 3FPCA 4LBZA 2IOQA 4DJ5X 2AVDA 4WZBB 5EI5A 3IMCA 2NP6A 4QJ3A 1R3UA 3DDSA 2H1LA 1BE8A 3IAFA 4O4IB 4AFNA 1G98A 1AQUA 4MX8A 1DX6A 4G5QA 4F6LA 2HU7A 2W2QA 3PPYA 3OFSA 4PYQA 1YRWA 1PBNA 2B4TO 3NMUF 3D8TA 4LF4B 1NRWA 3WLQA 2I55A 4G67A 1TCBA 5E4FA 2GCNA 1ZZGA 3B6KA 1A2OA 3L7CA 1IAQA 4PFJA 4MGHA 4RK1A 1R50A 2FN8A 1ISMA 1KE1A 2J0VA 4EKEA 1MR3F 2WUVA 5AMXA 3A27A 3NEJA 2YRXA 1PL6A 1AGRA 1Y4UA 4N6GA 1KRHA 2PE3A 4URZR 5BSVA 1CUCA 1B00A 1HYQA 2CL5A 3AR2A 4PHCA 4H77A 4UDYX 3E2IA 3HO6A 3OZBA 1GRCA 2X0EA 3UGKA 3WLAA 1GJRA 2ZS8A 4UE3S 1KFEB 1WAMA 2EZUA 4EO9A 3LBHA 2DY1A 1DAKA 3VV2A 1YTLA 3C7AA 1EINA 5A7FA 3BHNA 2JASA 4BNUA 3RLFA 3JRXA 2R7AA 5FI1B 3DKRA 3LXXA 5IMBA 3A3YA 1KVQA 5HGXA 1U0BB 3ITKA 4RVCA 4BNZA 2H2AA 1W9HA 1N1MA 1GFSA 3BCDA 2QRNA 2W11A 3E5HA 4TMKA 3WV4A 1AIPA 4ENUA 2IGBA 6LDHA 5KOYA 5FNZA 2H16A 3OEYA 2G40A 4RV4A 2VHQA 3X1MA 3U0VA 3ICPA 3NDIA 4I50A 1F60A 1CUXA 2Q4RA 2VQ3A 2LVBA 5DTQA 5LLSA 1SU7A 3MJTA 3EC1A 5AM1A 1U28C 1J20A 3R5XA 2JKVA 3IBYA 3FM9A 1TUGA 4ZVNA 5GONF 4IH4A 1QHGA 2ODTX 2PKCA 3LDAA 2CW5A 3S4YA 3TXXA 5CJ2A 1XJCA 1KAHA 2AJCA 3BJIC 3QH4A 4AIIA 3CR8A 3OLCX 1G8SA 1TEHA 1EZ1A 3E3OA 3FOAA 3ZV5A 1MXHA 1PFUA 1U7ZA 1MZPA 3A9TA 1FU7A 3LFHA 4PHTA 4EB3A 4B4WA 1Y81A 2PMWB 1T36A 1NKVA 4EP1A 5ALNA 1QTRA 1Q7CA 4G8CA 4J3NA 1KS9A 2AJLI 3PWSA 1P91A 2N46A 3T5AA 2VBIA 3NU1A 4MYRA 4R1NA 1JSZA 1SOMA 2FEMA 5H9VA 1OQAA 3X44A 5JZVA 7AT1A 4RJJA 5CT5A 1IY0A 1HSOA 2J30A 1ZRMA 1YZQA 3AU8A 3LECA 2REXB 4KC0A 4S12A 5KYUA 3CTPA 3PQ3A 5TVGA 4ALMA 9MHTA 4Z7JA 1DEKA 4MPDA 2A9VA 2JLSA 1X19A 2QVZX 4PYMA 4XSVA 1BKSB 3IPXA 4FX2A 4QHSA 4RVGA 2BGGA 1VTKA 4DARA 5CEEA 3JAKA 1NVVR 2GNAA 2IEZA 4G5GA 4D2IA 5LP6A 3U4HA 1B8UA 1O96B 3BCUA 1ORVA 1ENYA 4FFMA 3ZQUA 1SHTX 5EJ9A 3QPWA 4B43A 2QT1A 1JNYA 1I6WA 3KDSE 4XIYA 1TM1E 1XQBA 1JKFA 1WMAA 2WT9A 3HCPA 3GFGA 1AHPA 4LF8B 1NLFA 2ZE5A 3T3OA 2QN3A 1MQ8B 1FTWA 5J2UB 3KUXA 1N2ZA 1Q7YD 5EXPA 2FKAA 3MT9A 5GOZA 3RTBA 2JHCA 3UOGA 4ERNA 5TMBA 2P91A 1Q9SA 3BWCA 3HH8A 4O8ZA 2OYNA 1XXLA 1PJ2A 3GNTA 5EE0A 3EBOA 4FMPA 5CFPA 4ZQHA 3ISJA 2H00A 2GLXA 2CFTA 3PHCA 2IEAA 3A4VA 3DPUA 3PNQA 2KVOA 1YZTA 4WEQA 4XVCA 2FPWA 1Z3CA 4C4XA 1DELA 3GAZA 2ZAGA 4D9CA 3ZV3A 1N06A 3C5HA 4YMWA 5AVVA 1I6MA 2LCQA 4YJ2A 1W8IA 2VQEB 3TXAA 1NLYA 1F5N