2OKMA

Crystal structure of ace19, the collagen binding subdomain of enterococcus faecalis surface protein ace
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
146
structure length
146
Chain Sequence
b'ERDYPFFYKVGDLAGESNQVRWFLNVNLNKSDVTEDISIADRQGSGQQLNKESFTFDIVNDKETKYISLAEFEQQGYGKIDFVTDNDFNLRFYRDKARFTSFIVRYTSTITEAGQHQATFENSYDINYQLNNQDATNEKNTSQVKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Collagen adhesin
publication title Crystal structure of ACE19, the collagen binding subdomain of Enterococus faecalis surface protein ACE
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Cell adhesion
total genus 43
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2007-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05737 Collagen_bind Collagen binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2okmA00
2Y1VA 4HSQA 2F68X 5DZ9A 3QDHA 4Z23A 4P0DA 2XTLA 3KPTA 3PG2A 3RPKA 4IGBA 2Z1PA 4IGBB 2X9ZA 1AMXA 4IGBD 2WQSA 3HTLX 2F6AA 4UZGA 3V10A 2OKMA 4IGBC 3QE5A 4OFQA 2WOYA 2X9WA 3HR6A 4Z1PA 5DZAA 3UXFA 2X9XA 2X9YA 3PF2A 2WZAA 3RKPA 3OPUA
chains in the Genus database with same CATH superfamily
2UY6A 4XN4A 4IRSD 4AEHL 4PRHD 4ZUUA 4KNTA 4XPFH 4PG2C 1IU1A 2MCG1 4ODXB 1CFQB 5IB5B 3IFLL 3ARVA 4NO0A 5CHNA 1OM3H 1X5MA 4JFZH 1IQWH 1THCA 2YD9A 2UX6A 5ECJE 3CIAA 4NM8H 1IM9B 4PRAB 4BEIA 2BVOB 5BS0D 3T6WA 1A6VH 4PWEA 3ARBD 3QUHA 3T77B 4Z7WB 3MLPA 3NFSH 5CZXC 4K2UL 1KV7A 1FLRL 3I9IA 4Y1AD 5C6PB 2X6AA 1IGYB 3N40F 5FYJL 4W9GC 4U49A 1HINH 4YVUA 5IIEB 5FO2A 3VXTA 1XMEB 4U1JA 2R4RH 1F90H 4NKMA 2OMXA 4QGTA 3X1FA 2GJ6D 3B9DA 3W1ZA 2VE6A 4NIKB 4ENED 4DZ8A 4PJCF 3D7PA 1PD0A 3MHZA 4P23A 1L7TH 1FGVH 3OKKB 1RUMH 4CC1A 3FQWA 4AVHA 3DX7A 4AZ8B 4B3VA 3JV6B 4ONFH 4LLDA 5LGYA 1U95A 5D2LE 4M7LT 2KERA 3ZRSA 1JJUA 1L9QA 3OLEA 4JKKA 1UOVA 2OP4L 1NCCH 4ZMZA 3ABGA 2FIKB 1DJIA 1IGIH 4LGPB 1I7RA 2VCOA 3ULVH 4OFPA 4HZAA 5LDUA 1JHLL 5IG7B 3S96A 2NR6D 3U1PA 1EAOA 2PWGA 3GKWL 3MLRL 4WUUB 3OB0H 5J6HA 2JXMB 4Y2OA 3KPPA 1Z5HA 3P77B 4KDTC 4N2FA 1ZLVK 1L5GA 1G7HB 1Z66A 1AKJB 3I9AA 3DI3B 4FFYA 4P46C 3UJIH 1MRFH 2WOYA 2CUIA 2WKOF 3FFCA 3KLQA 1T2QL 3CK0L 1TQUA 3P73A 4PLKD 4XX1G 1CXHA 4H8UA 3RIFF 5JHDD 4YNYA 3M1BA 3CSGA 4L1TA 3DX0A 1U8HB 4R96B 3T0ED 3GLZA 2HUEA 4TPRL 3HRZA 1ICTA 3L2MA 1EZVX 1H8OA 4FXGB 4KRPC 3VFPB 2ITEA 4R0LB 1N6VA 3AFLA 2EXYC 5BRZA 3NJXA 3KYNA 4MMZC 1ZWIA 3S3BB 2VLJD 3MRCB 3O8XB 3PQYE 5AOIA 2GW5A 1TVHA 4RAHA 3IAGC 4LHUB 3Q1EA 1NBCA 4ORZC 4I5BA 3FTYA 4KQ3L 3UXFA 1JGIA 2WLIA 4U6XA 1MLCB 4PJ5E 5KAQF 1DVFC 2E4FA 3B4NA 5JQ6H 4FHKA 3MNZA 4HKXA 3ZOAA 4DN3H 2CKBH 4RZKA 2AV7A 3C8DA 3AT0A 4JKPH 4JEGB 3T2PA 4JFYB 3GMRB 4XP9L 1XGPA 4BQ6A 3NCYS 3GFUA 3ARFA 1W72L 1JNNH 4MJIE 3KNBB 5KOMC 4MXVF 1ADWA 1PDKA 3KYKL 1FUNA 1AH1A 2EDEA 2VDLB 3GRWL 4NZTH 5D9SB 1T20B 5EU7E 4E42A 2RTTA 1MWAA 1A6TA 1FN4A 1X7QA 1BWWA 2AJVH 3GK8L 1GC1C 3SBWC 2P5EA 4LDOB 4GW4A 3KPNA 1TTBA 1XSOA 5BV7C 3ARGA 1DQKA 3FQXB 4K9EL 3S34L 3HAEB 1ZT1A 5HJBA 4L8SA 3HJ0A 4IIQA 1IC5H 1AZCA 2CO4A 3PGFL 5C0FB 5HY9B 3GRBA 5IESH 5DJAA 4RAUA 4YSQA 4MKTA 5F88A 1AY1L 3UERA 3UPAA 3BC9A 2L8AA 4EI5B 2R69L 2W0FB 4V1DE 3ZZ1A 1B4JL 1GOGA 2VTFA 4PJFE 3BEVA 2HVJA 2NNRA 2DF3A 2G75A 2IPTH 3J8F7 3V7AE 5A2AA 5ESVA 5FO8B 4UYQA 3NAAH 5G4OA 1QG3A 2F54B 5EZLA 1J0YA 3KPMA 4G7QB 1B0RB 5DA0B 5TFSL 3VVVA 3KPQB 4X5QA 1DVXA 5CGTA 1XF3A 1R1CA 3KDMA 4YSTA 1EHNA 1QABA 1QQDB 4JO4L 1XGQA 2BNQA 5D7LA 1J8HE 3V4VA 3TWCL 3SO3B 1A9BA 4G80A 1G6VK 1L3WA 2NUPB 3GLAA 2CQVA 4KY1L 1SVCP 4AT6B 2K6YA 4X6DF 1E90A 2FT8A 3MV7B 3WLBA 2XWXA 3PJSA 2FJUB 5CZKA 2Y72A 5BZWA 2D3LA 3S2AA 3RX8A 1DN0B 4BFJA 1ZGLA 1MN4A 1WBXB 1WE5A 3SOBL 3LKQA 4ZUVB 3UMTA 4DHLA 5GRXG 3KDPB 3CFDA 3VWKB 2E9WA 3B9AA 2WTPA 3VVWA 4O02B 4OLWH 5INCB 3HVDA 2XZAH 4G9DB 1XH3B 3BFWA 2IANE 4A7TA 2YD1A 5K1JA 4QRQA 1QP1A 1RZGA 1RIVH 4JGUA 4KY2A 5IB1A 2DKMA 4ZZFA 3US1A 2VDNB 1IIKA 3BPNB 5LB1A 2ZX6A 3TBTA 2EE0A 4MA8L 3HI6H 1N4XL 3ZYIA 4DFIA 2AEPH 3OXRB 5CGBA 4NUGL 5HDBB 2V7HA 1EJ6A 2ZXAA 3HN5A 1AHWA 4LCWE 3GC3A 4E0RB 2VZUA 3TFBA 3MCLL 2EE9A 3NOIA 1A02N 4ODXA 1CFQA 4BZYA 3QRFM 2VR4A 2OCJA 3AU0A 3D05A 2OR7A 4HHWA 4QY8A 2WCPA 4PTTB 2O61A 2I27N 4O4YH 1IM9A 1J9QA 4PRAA 4YWGH 2DQGL 4BKLB 4Z3HA 2BVOA 1YNTA 2X0WA 3UO8B 3B3IB 1RCYA 4P23C 2ZOLB 1FL6B 4Z7WA 1D9KA 1SDYA 3W9DB 2G5RA 3HNTH 4TUOB 3PL6D 1IGYA 2YWZA 1I31A 1UACH 1U42A 2ZCHL 5IIEA 2UZYA 3ZY7A 3D3VD 4YXLL 4WGKA 3CDZB 2FSDA 4ZMXA 4J8QA 5I6OA 1W6WA 4RGNC 3RL1B 1GGCH 2WUCL 3OKKA 1HHKB 1H5BB 5EZOH 3IDGB 3JV6A 2QPUA 4AOFA 1K8IB 5M94B 4KK6D 3S8WA 3ESUF 2CHWA 1RPQA 1QLEL 3CN0A 5ID1B 2YN5A 4W93A 3ZVVA 1CDJA 1CL7H 2GBUA 3PPSA 2CALA 2FIKA 2XZCH 2EKJA 4WO4B 3WFDH 1JZIA 5CGYD 3U82B 1X9RA 5IG7A 4YPGB 3BUQA 1WGVA 3LNFA 1T22B 4PGCB 5KSVB 2D0FA 4ZODA 4LF3B 5AVQB 1OWRM 1LMKA 3R19A 4WUUA 3F7LA 2JXMA 3GBML 4GXFA 4H88L 2R2HB 4E9TA 3P77A 1K4CB 1JS4A 1PZ5B 2LU7A 1AJ7L 5E6ZA 4HULB 1G7HA 1AKJA 1JZJA 3I9GH 1AD9B 4FQCH 3L5IA 2AV1B 2HWZL 4MS8C 2CSPA 1PBYA 1CR9L 5HPOA 1TTAA 4X0KB 1U8HA 1IM3B 2R0LH 4R96A 3N1FC 4FXGA 5IFAH 3W39B 3NABH 2Z65C 3VFPA 1OAXL 4KXZH 2WNWA 4OI7A 4R0LA 2AEIT 1NDGA 1MJ7H 2UUDH 4IHOB 1YY8B 4AKPA 5TQ2H 1EDQA 4ES8A 4Y2NA 1A14L 1ZSHA 2Q7AA 3LKNA 3MRCA 4NUQA 2R29L 2E47A 2V5MA 3ARFC 4LHUA 4LSPH 1NM9A 1UENA 2J1YA 4JKMA 1MIEL 5FS5A 3HC4L 1DZ0A 2J6EH 1MLCA 1UFGA 2VH5L 3IFNH 2EZ0C 2IADB 5F7DB 4L4TB 4HFWB 1F00I 4N0UE 3BX7C 3SDXE 1MFAH 4XCEB 5JUEH 4YPJA 1HYSC 3HZYB 4K4KA 3SD2A 3EJCA 2ATAA 3KNBA 3S7GA 3ARGC 5B1AB 2CBMA 4EUPG 4JFDD 1UM5H 4GQZA 4DW2H 4L8SC 1KB9J 5BNXD 1A7RL 2A0LC 4UZGA 2BSBA 3IWUA 4UUJB 1CTNA 1T20A 4DETA 1QW8A 4M1DH 3DSNB 1WIPA 5CCJA 2C9AA 3HUJE 3UEQA 1HTYA 1D5MB 2EDRA 1FO0B 1CFMA 3QCVH 2HLAB 4FQLH 3FQTB 3Q01A 5I73C 1R5WB 3OR7A 3REWB 5IY5B 3ARED 3HAEA 3HE6D 1HN1A 1THAA 2NY6C 2NY0D 1ZRUA 4JG0L 1NL0L 1S3KL 3SEPA 4RDQG 3HJEA 2GQHA 4A2FA 4AMKH 3IS1X 4U1NB 2NT0A 3THML 4EI5A 3WIAA 4IQHA 3NP3A 2W0FA 3U4BH 1S9WB 2YAHA 4OF0A 3WKNA 3CZSA 2BS9A 4HD5A 2QADC 3ESVF 5DRWB 4BCXA 5FO8A 4ICXA 1M71B 1XZWA 4C56D 3A22A 4YHMH 2F54A 2ZUUA 3OB0K 3VU1A 2HXAA 2WZ5A 4F80A 3KPQA 4W4NA 4IDLA 2K9FB 3GJEB 4J3TA 2WXMA 2ZWZA 4GAGH 4PV1C 1ZV2A 3Q8FA 5D1ZD 1QFWI 1UD4A 4HXAH 2NUPA 5ACZA 1LO4H 1K6QL 4KVCH 1FRGL 3LEXB 1V55B 2YAMA 3MV7A 5JW5B 1RJYB 1V5JA 3VG0H 5GJSH 2YD8A 4Z7UB 4H1LH 2E9JA 4MBRA 2EYTB 4ELME 2CK0H 3L16A 4PJ8B 1XMWA 3AROA 1DN0A 1QRNE 2BW5A 1WBXA 4PGZA 4ZUVA 4ES9A 4PD4K 3VWKA 3WS6A 2EUVA 4YLBA 4ANKA 1BHGA 1LYQA 3IDUA 3HZVB 2M83A 4O02A 3WFBH 4HPHA 5INCA 3VI4E 2NX5B 3DXAD 4G9DA 3QJHB 1KWGA 2QV4A 3I74A 4LNRB 3NP4A 5CLXA 3L95B 3FTGB 3QR0A 1GHFL 1MCKA 3UCQA 4ZOAA 5EA0H 4HWBH 3VXQA 5BQ7B 3AS0A 4YBLB 4HOMA 4FI6A 3QB7C 1SN0A 5GSRB 3ZHKA 3OXRA 1J1OL 2ZD0A 5JXEC 1W15A 3S35H 2IOIA 2H9GB 1ZIAA 1EZLA 1YC7A 1C1EH 4E0RA 4XNMB 5F3HB 3RWIB 1UXSA 2V7NA 3UPRA 3QI9D 3F7RA 3LN9A 5AB0A 4OJEH 5CFHA 1UOWA 2JNZA 4LFHD 4Z7WF 2X1XR 3SDCD 3WMSA 2WMPB 4BK8A 3B3IA 3GEWB 5FYKD 1EVTC 1FL6A 3L8QA 4I0PD 3W9DA 3ZYJA 2YGVA 2AQRA 2BZDA 1GGTA 3BZ5A 4WI6A 3SE6A 4AC2A 5ITFA 3MLZH 4TUOA 4AV5A 4Z7NF 1UWYA 5EUKB 1BMGA 4EQ3A 2VZOA 3ISYA 4PS4H 1Y6KR 2VO5A 2IDQA 4BHUA 3NG5A 3P4OB 2IALA 5KAQG 2MQ0A 2NQCA 4CAGA 3IDGA 3N50A 2EEBA 3QDAA 3NCFB 1RMFH 5T3XE 2XT1B 4L1DA 1S78D 2DM3A 1JVKA 4WU7B 4U1KB 4MS6A 3K0WA 1A7PH 3CLFH 4EOWH 5ABAA 2HH0L 3CFBB 4IDJH 2NQ3A 1S7UB 3L4ZA 4P2RB 4WO4A 4FA8A 1WF5A 4WW1A 2ADFL 3INUL 2E7CA 1OAYH 2NYYD 4YPGA 2XWEA 4Y9EA 1T22A 5GGTL 4PGCA 1LEIB 5KSVA 5A2JH 4LF3A 2EVHA 1JGVL 3A21A 2ZWKA 3DVIA 4P4KD 5E9DA 3VA6A 1AI1H 3FAXA 3GQFA 2R2HA 2XPYA 1K4CA 4HIXH 4ZNEA 4R0LC 5I71B 3BIKB 3ILPB 1XGYL 3K2UL 4JG9A 4X9YA 3M7FB 5CP7B 1AD9A 3SJVB 3O8XC 2OR9H 5CCGE 3E6FA 4PY8J 5FGCB 4X0KA 4URTB 1WD9A 5CAYB 4LLUB 2EYSB 1BYNA 1WA2X 1MQKH 2Z92B 2WHVA 4ZUSB 3JWNE 5C0CE 3O4OB 4XMKH 2QDWA 5ENWA 2EDQA 4FYRA 4KI5C 2VDPH 3LTVA 3U1SH 1RD6A 5L2KE 1KGXA 4E9VA 1CXEA 5GHWH 4XCNA 3TT1H 4ANXA 2V8MA 1SHSA 3PQYB 1PMYA 4PP2B 4LSRL 2PCFB 4KI5F 2DD8H 1XAUA 2YMOA 2IADA 3VG9B 1GH7A 4MA3B 4L4TA 4HFWA 3UBXA 3REVA 4PJ5B 2Z7ZA 3T3PB 5T5NF 1OALA 3A6BL 1VERA 3HZYA 2H0PA 3BD5A 4HUUA 5E99H 3H7LA 4M5SA 1IT9L 1RQ5A 2ZXCA 2GC4C 2PUQT 5BQDA 4BINA 2R15A 4I0CC 4R2GD 4DP4X 1M3JA 5E0FA 1T03L 3MRHB 3N1QC 1KDJA 4HIQA 4UUJA 4KXDA 5K9QI 2HX7A 4GKNB 2E8ZA 3STZB 3DSNA 3TBBA 3UZVB 3O0RL 4EI5C 1DUYA 2AJYL 2AJZB 2DM4A 5T1LB 4QWWD 3ZK0A 2WNKA 4YDIH 1D5MA 1ANUA 1FO0A 4I7ZC 1V3JA 2HLAA 5F7KC 3FQTA 3HB3D 1R5WA 3MBEB 5FUZL 3REWA 4DO4A 2UV3A 2J43A 4S2SA 3HFMH 2GPZA 3QIWB 3BLPX 2Y1VA 2MQCA 4FTVE 1BMWA 3LQMA 1SOXA 4MDIB 2K7PA 5SWSA 4U1NA 5AWNL 2D4DA 1YEIL 4M6NL 3JV4B 3LS4H 5BO1H 4XVJL 5ANME 2DEWX 2MNWA 1BVLB 1R3IH 1LWRA 3GHEL 5DRWA 4NP9A 5F7LB 2HMID 1V7NH 3SDDD 1A7NH 1QBBA 3F62A 3SO3C 4AGLA 1M71A 2EDKA 5E70A 4A55A 5JW4Q 4WJKB 5I0YA 4JN1L 2DN7A 1KN4L 2X1WL 5BMFH 2B1AH 4KUCD 3UOAB 2H7WA 5MEND 1CVSC 3DBXB 3GJEA 3X3FH 3TBWB 2FJFB 4FS0A 3ECQA 3NCYP 1CLYH 1T0MB 3OQ3B 2VXVH 2A9MH 2JELH 2CRZA 3Q9QA 4HC1H 4JFHD 2DIJA 1E4XL 4NSKB 2W65B 3VWKC 3WS6C 5CEZL 2X3CA 1FNSH 3LEXA 4HH8A 2NYZA 4Y1SA 4S1DD 5C07D 4EJ1C 5JW5A 1RJYA 3RUGB 1HZKA 5IM7B 4Z7UA 2XPGB 4J23A 5DHVA 4OSUH 2EYTA 1MCWW 2AKRB 2D31B 3QJRB 4OJFL 4NPJA 4PJEE 3MRJB 4QTHB 2Z64C 5FKAB 3ULUH 4BSWB 4Z3GA 2APWA 3FUHA 2RB8A 4N8UA 4CN4A 5JHLH 2CNZA 1DLHB 4I13B 1J10A 1BQLL 4ZOBA 4S10A 2FJHB 1BIIB 4NM4H 3POHA 2Q86B 3EBAA 3HZVA 2HT3C 2CU9A 5D5MB 3QJHA 4E9QA 2VKWA 1L9RA 4LNRA 3L95A 4LCCA 3BOVA 3WD5L 1CDIA 4DT2A 5BQ7A 4R9HA 5L88L 4KZDL 3D39A 4XNAA 5HDBF 1KZQA 3B2MA 3FOMB 3Q3GB 3FS9A 4OIIL 4UAHA 2H9GA 2PR9A 2OSLB 3D0LA 4XNMA 5F3HA 1P1VA 4YJZL 4LCWB 3TO4B 4XO9A 4WFGD 2AERT 3HNSL 4IGBD 3EUUA 3V4PL 2WMPA 3TYGL 3DROB 5FCUL 5KVFE 2OK0H 1NCIA 3DTDA 2QZQA 3CZJA 4KC3B 5DHYB 5TQ0H 5CJXA 3C09B 1F3RB 3L5XH 1D6VL 1H5BC 1BQHB 2OZ4H 2X9WA 3NACL 1P5VB 5GS2H 3BW9B 5HHME 3KH3A 4G8GE 2Y7MA 5HYJB 2D0GA 4A7GA 2NTFA 3TCXA 5FOJA 4ZW8A 3EDDA 2X42A 4WO4C 1TKWB 1MDAA 1ZJBA 4WJ5B 2RHEA 1YEHH 4QKTA 1BOGB 2ZAIA 1DQML 2WO2B 1BWMA 2V9QA 3O2WH 2WOBA 2A9NH 3P3RA 1IUZA 1XBRA 3QNYA 2KT6A 5J1AB 3GB7B 3RQ3A 4KTDL 1CXIA 4WU7A 4U1KA 5KEZA 4ZFOB 2YIHA 1DVQA 4DGWC 2V2WB 3CFBA 2J1XA 4PEEA 3R7RA 4MVBD 1L7IL 4AIOA 1UM6H 5I0XA 1NPUA 2VDQB 4A1RA 4JFXB 2A4EA 2P3YA 4R90H 3I6LD 3AT8A 2B08A 3D06A 1A9EB 3EYQD 4HH9B 1OAKL 4OD1L 4AL8H 2DIAA 1AZZC 5J3HC 3L1OH 2BPBA 1VGKB 3NIDE 3CZKA 4I0KA 3MKGA 3E8VA 4M3KB 3BIKA 4OJCA 2NNAB 3ILPA 4PY8I 3UP1A 5C3LD 5CZXD 1RZFL 4ZD3L 5CP7A 4DGVL 1RIUH 2YGPA 4A6YH 3SJVA 1GGIL 5EU3B 1NCAH 3DI2B 4N0YH 4ECNA 2DWEB 3WJJA 4JGNA 5A6MA 1E5BA 4LLUA 2EYSA 1VFAB 5AW4B 2Z92A 3S5LG 4ZUSA 3MFFA 1V3MA 1ESOA 5HDQH 2V37A 2H32H 5ALCH 5TDOB 1WJ3A 3PNRB 1FNHA 2E5EA 2YD7A 1U58B 2BVEA 1UA3A 1NEZB 1P4BH 3LEVL 3EYVB 4I9WD 3B7RL 5JQIB 5IB2B 2CIIA 3PQYA 4PP2A 3GSNH 3IAPA 3FHEA 2EVJA 2WZ0A 4F33B 2DQEL 1D6EA 2GHZA 3P3UA 4MA3A 2KUTA 5CO1A 1VFOA 4PJ5A 3VD2A 3Q5OA 2FQFA 5EBMB 4JO2L 5HI5D 4CVXB 5IMOB 3QK0A 3S97C 3SDXB 4TNGA 2CCWA 4GRLB 4R84A 3EGDB 4H5SA 1WV7T 3HC0A 4OQTL 4MJHA 3II3A 4MJIA 4AM0B 2D7MA 1ZGLP 5GS1B 3F8UB 2JB5H 3ML9A 1HZHL 3MRHA 4TSBL 1E4KA 5GGSY 3STZA 2QT6A 3UZVA 4OKVB 3T2NH 1E9QA 1JP5A 1OVZA 3DJRA 2Y6TE 3NT0A 3MBEA 1O7VA 4LLVA 3AG2B 3ELAT 1MCNA 2B2XH 2ICCA 3S9DB 1JXDA 1I9JH 2VAAB 1QO3B 4MDIA 2OMTB 2ITCB 3CHRA 2DBLL 5EH1A 4Q4IA 1EEYB 1I3VA 2V2XA 4HLZG 2QBWA 4P3CH 3JV4A 5CJQH 1JTTA 4XO4A 4XZ4A 3FB5B 3V0AC 4V1DA 3Q13A 1BVLA 1W8EA 1SJXA 5LNGA 5AW6B 2V3DA 2DM2A 2IH3B 3RG1C 1OCRB 1PVHA 5KVDH 2V5TA 2JH2A 1T1YB 4IHBA 3VMNA 4M8VA 5AB9A 1ACXA 2Y06L 4XNYH 1FE8H 1T66D 3BI9X 3J7HA 2OSWA 2C7FA 2OPCA 4PJ8C 1ZLUH 3DBXA 3KPTA 3TBWA 3G6JE 4PJBE 2VERA 2Q0ZX 3RGHA 4XHJD 3ILQC 3GD1C 4XHQA 4CGTA 2H41A 2W65A 4NSKA 4O5LH 3HG1E 2TAAA 4JZNB 5I0WA 2VN7A 4LLWB 1I1RA 2VW7A 1JMZA 3RUGA 3RWCB 4BZ2L 5IM7A 2XPGA 4EZKA 3QO1B 1BOYA 1KJ2L 3QJOA 3WIFB 2IAMB 3ASOB 3MRJA 1Z9LA 2W80C 1X5HA 3UTTE 3EOAB 1A4KB 4KFMA 4BSWA 4JO3H 1CWVA 2OYKA 4ELMB 3C87A 3K6IA 4QJ4B 4YBLC 1DBKH 3QQ3B 4M7ZB 4NBYB 5IJCC 2FJHA 3ABMB 4HALA 5GIRB 1BIIA 3UABA 3TIDB 1KCUL 3KXFE 3SYPA 3FH8A 2Q86A 3FRUB 3ETBF 1YMME 4K73A 4KRLB 1N8ZB 5D5MA 4HT1L 1F4WL 1HDMA 1KBKA 3ATEA 3EGXA 3OMNB 1F45A 2K9UA 2R0WL 1VADB 3QPXL 4XC1L 5AVZB 2IANA 1E27B 1X9LA 4EUPH 1DJHA 2K45A 1NGPL 2FLBT 1IFHL 1AO7D 1HL9A 5CJXC 3Q3GA 5IV2B 1KFAH 5IOPB 4DVBA 4F3FA 1NPJA 4MXQD 3F7YB 5E1AB 1PZ3A 1R17A 1YN7B 1U8PB 2OSLA 1QTYT 3LNGA 4LCWA 2BSED 1YEKH 4UIKL 3UJJH 4S0HA 2YPLB 2Z31D 2Z8WC 4GQRA 4UMGA 4F8LA 1KPRB 3DROA 5D7SH 1FC2D 5DHYA 4MCYB 4XPFL 1IEAB 5T33L 2YXVA 4WI8A 1OM3L 1BQHA 1ZA3A 2IPKB 4JFZL 1IQWL 4A7GF 1N9PA 3BW9A 4ACTA 3FU6A 4LHUG 1NMAL 1N7ML 4U2ZA 2ALWA 2F2HA 1A6VL 5FGRA 1A4CA 4LP4A 4R26H 3JUZA 2WZAA 1J0JA 2C9SA 3NFSL 5LXGH 1TKWA 3KS0J 2BSDA 2MPAL 1KULA 3LQAC 1BOGA 2CAKA 1HXMB 3BAIA 1NJ9B 3E9UA 1EJFA 1HINL 3C2SA 2WPGA 5GJTL 2R4RL 1F90L 4YHLH 5T5NG 2P8LB 2C4FT 5J1AA 1U91B 3GB7A 4A68A 1NFKA 3V0EA 4OBRA 4ZFOA 2XZQL 1RUML 2KZBA 2V2WA 4B7IA 2XN0A 3L17A 4YIQB 3VDCA 4NRYB 5D4HA 1MF2L 4G3YH 5I71C 1NUFA 2Y9RT 1VJSA 1NBVH 4KTEH 2MEJB 3QT2A 3SB3A 4JFXA 3WJJC 1CE1L 1NCCL 3PAZA 1AOZA 1A9EA 2DWYA 1IGIL 4NQCD 4ZG1A 2ICWA 2XY1A 5T3ZE 3O4OC 1VGKA 3V4UH 2FT7A 5ADOH 1COBA 2R4SL 4XP1H 2NNAA 4WNQB 3GF8A 3QBTB 4I48B 3WGUB 2MMXA 1L6ZA 2BIHA 2NDGA 2YRZA 5EU3A 2O72A 1T4KB 2DWEA 2WWMC 4HIJB 2E7LA 1WZKA 3ZKSD 3FQ1A 1UGNA 2X44D 2C9XA 3K1DA 2OX5B 3LSOA 5DHMC 2NY1B 3FFOA 1YG9A 3L3JB 3VG9C 2ED6A 2OL3L 5BJTB 2L04A 5TDOA 3EYUL 4C4BA 1U58A 1KF9B 4EKXA 3VFWB 2VMFA 1E67A 3EJYC 3OJMB 2DQJH 3EYVA 1TZAA 3WCYA 5IB2A 4RGMB 5L2KB 4N2BA 4WEMB 3EZJB 2X4OB 1OTUC 3GDBA 3KYOB 2UZXB 3M1CA 3NCXA 4X7EC 3QEQB 4IIZA 4F33A 5BXFB 4MA7L 2X12A 4L4VD 3T3PF 1E8YA 3H4FA 3OAZK 4PN6A 3KR3H 2Y25A 5IMOA 4N0UA 4CKQA 2D3JA 3SDXA 3BRDA 4WKZB 4GRLA 1PU0A 1Q38A 5DYFA 3L3OB 5I8OH 2ZYIA 3LHPH 3MBEC 3S0PA 4DN3L 5I0VA 3GM0A 3OXSB 1UUSA 3IS0X 3QIWC 3X1NA 1JDAA 4GP5B 4AM0A 4F8PA 4FOMA 5BRZD 5T5FA 3EZ8A 3T3MB 2WCSA 4C4UA 3O81A 3Q8CA 1FH2A 2IGFH 5IF0B 4P59H 1N12A 4JFOB 4QR7A 3X13A 5C2UB 2XN2A 3ISRA 5DZJA 2E6PA 4J1UA 4KX8A 4HGMA 2AXGA 4G7SB 3HUJA 2YARA 4XR8C 3MO1B 4YZFE 5E6IB 4AI7A 2XV0A 5DK0B 4UWQB 1A4BA 2FECI 1HKLL 4ZMNA 2JVUA 1TU2B 3K6NA 2VAAA 4EXKA 1QO3A 3V9FA 3CZNA 2OMTA 1C5CH 2ITCA 4B9JA 3S3SA 1BVKB 4KDWA 4JO5A 3T0AA 1G5AA 5B3JE 5B1KA 3I85A 4ODBD 3FB5A 5IESL 5K9JH 1AOHA 4JY4A 2AXJA 4FNUA 2IH3A 4UTAA 3VSTA 1J0HA 5EFIB 2CHNA 1G0DA 2ENSA 3EBHA 1XD1A 4P2QB 3RJQB 1WFJA 4Z3EA 1T1YA 1CPUA 3L7FB 4Y9GA 3WXWH 2IPTL 4N8VB 1GC1H 3ZDZB 3DETD 3H42H 1CDHA 3NAAL 5BV7H 2ARWA 1X9QA 2A0LD 3B2DC 1HT6A 4LB8A 3P4LA 3HCVA 3RUGF 4X9IA 4J3BA 4LLWA 4OZIB 3RWCA 5DWUH 3T4YB 2HVKA 2J8UB 2OQJA 2BP0A 2BSTB 3WIFA 2IAMA 3MPCA 3EOAA 1HHJB 4MQ7B 4E9YA 3DRQB 4ELMA 2YD5A 1UOLA 2VITB 4GQQA 1A6UH 5D5MF 1QRNA 1SY6A 3TIDA 2APTA 3FRUA 5KVEE 3ARRA 1L0YA 3LIUA 4M7JH 3RGBA 4JZJA 2XFGB 1N5AB 3DUUB 1Q8MA 3NJVA 2ZCKH 3HRPA 4WWID 2PN5A 1VADA 3NFPB 3TO4C 5C0EB 3KPRE 3BHBB 2BNQD 1X44A 2P43B 1E27A 4JFEE 2EDNA 5DC0A 5FM5O 4KZEH 1FJ1A 3BAWA 1IRAY 2XTJB 4OLWL 2WKLA 2XZAL 4TL4A 5ABDE 2MTPA 2XNAB 1IC7H 3CSYB 4QXGH 3C09C 4HS3A 1F3JA 2BY1A 4POUB 5IV2A 2I7OA 4EN2A 1LGVA 3CIQA 1YN7A 4HG4K 1U8PA 1U8NB 1MJ8H 3JVGA 2XKSA 4JO1L 2ZUYA 1XCXA 3NFNB 4LL1A 3N06B 2YPLA 1QR1B 2CGYA 2Y2TA 1KPRA 2DZEA 1IKFH 4Z76B 4AVJA 4MCYA 1NC2D 1IEAA 4URKA 3U0WH 3E7JA 1MFNA 2IPKA 1YMHB 2DY2A 4YWGL 4F7KA 3Q8AA 2QKIB 2PO6D 3L48A 4MXWH 3WJMB 3MOBH 5DMGD 3GJFK 5HHMB 3QWNA 3QYCA 5DMJB 3AS1A 4GLRI 3HNTL 3BD4A 2J57A 5BO0D 1DO6A 1HXMA 1AGBA 1NJ9A 1UACL 4OB5H 2FUQA 43CAB 3QVAA 2VOTA 5K69A 2FLMA 4HOXA 2P8LA 4NZDA 1U91A 1CN4A 4XRCB 1S7TB 3ZKXB 5D72L 3TJHD 4KUZH 5LDSA 2D0HA 1UWEH 2VMEA 4NRYA 5EZOL 1D9KD 3MA7B 3VXRE 4AYID 3FAWA 4HDIB 5CIPB 5DZAA 5FUOH 2PCYA 3FSVA 4DPBX 2KPNA 1PAZA 2Q7YB 4A2HA 5F1NB 3UADA 2E7LC 4JM0A 4NJ9L 3WEXB 2YBGA 1EGJA 3W5MA 1UB5B 2O5XH 3Q6FB 2XZCL 2FZ3B 3V0VB 3WFDL 2AJXH 3FQ2A 3I2CH 4LIQH 5DTFB 5FFOA 3HBPA 4KKBC 2O1AA 3V52H 2ZXQA 1F11B 5SX5K 4DQOL 4WNQA 2AQTA 4I48A 3NIDB 2EQDA 1C5BH 3UIYA 3E8UL 3KEDA 3MV8E 2CLVB 2ID5A 4NN7B 3H56A 3FO2B 4HIJA 3HG2A 4U1LB 2DJSA 1KCWA 3LH9A 4N1EA 4LARH 5I0ZA 1HH6B 1DBJL 2WUBH 1KTDB 2OX5A 4Y89A 3I9GL 4IOSA 2VXUH 4FQCL 1OSPL 3L3JA 5D7IE 1OE1A 1HCFX 4NGHH 2L7JA 3U48A 3MX0B 2PP8A 4FFYH 5C0CA 1M2VB 5B21A 5BJTA 2DJUA 3TFKD 3FSAA 3VFWA 5IFAL 1UJ3B 4AUYA 4EE2A 3LB6C 3HE7B 4UM9B 4JNXA 3P0VH 1N5YH 4GRLC 1JNLH 5L2KA 3N41B 1OSEA 4GT7A 3MV11 1MJ7L 4PJHB 4B9CA 4YHNA 2CLRB 3KYOA 2UZXA 4ZFFB 1AKJD 3QEQA 2AJUH 5KG9B 1DL7L 2I24N 5GS1C 4MNHA 3ARDD 1A6ZB 3DKHA 1U4FA 5GZNC 2ARJQ 3ZMRA 4LSPL 4NAMA 1UOKA 4OGAC 5F0LB 4LO9A 4LOUC 1GY1A 1DTUA 2J6EL 3CSTA 4XPBL 3IFNL 4PM1A 4WKZA 3L3OA 4MQXC 1J5DA 3BDXA 5M95B 3QRGH 3RFRA 4Z7OE 1IEBB 5JUEL 5EPMA 3FTWA 4MB5A 5IK3B 5J5EA 1JGDB 4TOYH 4RFNB 4J6IA 1UZ6F 5IF0A 1QFWM 4JFOA 1GTNA 1MVUB 4PWHA 4DW2L 4Z1PA 2JKSA 1VHPA 1FI8C 4J3WA 3I84A 3WIIH 3CJJA 4W9JC 2NUTB 3MO1A 1RU9H 4MNQB 5E6IA 3ZDXF 1CGSL 2AVGA 4DPCX 5DK0A 5DS8B 1G7QB 4TULH 2QVKA 1TU2A 2CR0A 4NNXB 4MCNA 3WFHB 3G6AB 4FTVA 1MWAH 2XQYA 3D4CA 3ZO9A 1S6NA 5FC9A 4IBWA 1AQHA 1S9VA 5JOFB 3SKUD 1INDH 2PWHA 5L6YH 1F1AA 2DLGA 2Y07L 1T6VN 4AMKL 2A3TA 1NLDH 5ANMA 4TQHA 5FEBA 1RVFL 4N2LA 1TOXA 5EFIA 1AAJA 4L05A 1Z5LB 4P2QA 2ZYSA 4LAQL 2EDTA 5F1SA 3ESNA 1LQBC 1NFDB 1QWHA 4N8VA 4Y5XB 2YUWA 2IAMC 4I8DA 1ID5I 2OTWA 3T0BA 3QUZB 4IRJB 4O2CB 3NZHH 4HJEA 5AKSA 2R23A 3T0VA 1D7CA 4E9LA 4F9PA 4M7ZC 2W38A 1P9MA 3QIUA 4N28A 5ICXA 3O6LH 3QNFA 4OT1L 4EI5D 4Z8FL 2VUOA 1KGJA 4OZIA 2XJKA 4K9EC 3AM8A 4EDXB 1KTRL 1NIDA 4GAGL 3T4YA 3HG1B 3BRGC 2J8UA 4HP5A 5GPRA 5JO5A 4HXAL 4WIQA 4Z18A 2EXWD 1HHJA 2KI6A 1LO4L 4YUEL 3RP1A 3DRQA 4JW3A 4KVCL 4PJEA 3UTTB 1BBJB 2F54D 1QFWH 3VG0L 5GJSL 3WKYA 1ID2A 1Q9WB 4HS8H 3WEOA 4E9SA 4HUXB 2CK0L 3MODH 3KXFB 2QELA 4HK0A 5ESAA 3LPPA 4CU6A 1WZAA 5D7EA 2BWDA 3JVGC 2C9RA 3CU1A 1XGZA 3NFPA 2R8SH 5A43C 5C0EA 2AP2A 1E5CA 3BHBA 3CHSA 3WFBL 4YGVB 4JUTA 2WXKA 2XNAA 4UOQA 2VN5A 3CSYA 4XH2B 2WBWB 2BNRD 5CMAB 3F7QA 1VGEH 1T1WB 3GZQA 1QFHA 2GJRA 2YXWA 3D52A 5EA0L 4HWBL 1U8NA 1G87A 4M00A 5E6YA 4UT7H 4OM1H 1HHIB 2DPKA 3BD3A 1EXUB 3GRGA 3NFNA 3PHOB 3D85A 4LU5H 3RLSA 5DS2A 3TYFB 5HHOB 3G5XB 3U2SB 3EJPA 1C1EL 1PYWB 2Z93B 4QIRA 4GG6B 1AQKL 1C12B 5CLWA 1YMHA 3UBFA 4HS6B 3H8NA 5C0BE 1FIGH 4HCRH 3ECWA 5JMRA 3IETB 3QZOA 4YDLB 3MXWH 2XJLA 4HLZH 4PLOB 3QG6A 4JR9L 4PCSA 3WJMA 3SGJA 2M1KA 1IAMA 2KMWA 1WWAX 3MLZL 1DUZB 5ISZE 5IFJB 4W70A 4PS4L 43CAA 4WZ9A 3LY6A 1QKZH 2WJ5A 1IGCH 1A6WL 3AXIA 3FQRB 4Q9RH 2JIXB 3MLSL 2AQ3A 2VDMB 4WI0B 2R7EB 1NCHA 1U8IB 3PNWB 4DGYL 4G9FE 1JSYA 1XR8B 4TVPD 3MA7A 2WXQA 4HDIA 5CIPA 2JLLA 4FQ1L 2ZOOA 1PQZB 3ZQWA 1KCSL 4P48A 4QOKB 1FZOB 2Q7YA 5EOTA 1A7PL 3CLFL 2YMXH 5I5JA 3WEXA 4EOWL 1OOAA 1UB5A 4M9OA 3Q6FA 3ENEA 2FZ3A 4IRZH 3V0VA 5A16B 4YDMA 1PF3A 1E8XA 2NY1C 1JHTA 3N55A 2F53E 1F11A 4KKAD 3VGFA 1NMBH 1XZ0B 4E2OA 5FUCE 3TESA 1KLUA 4CADB 2PR4H 3FHAA 4KK5D 1AI1L 1YEFH 4TUUA 4Y5YB 3IPFA 4KKLC 5GZOA 1CICD 3FO2A 5GS0D 2R27A 3LKPB 4HIXL 4RGMC 5DO8A 1A4JB 2V3FA 1KTDA 5DD3H 4EDWL 4ODHL 2KQMA 1V27A 2CUAA 2GJ6E 5E2UL 3V7AG 3MJ8A 2VXQL 3MX0A 1M2VA 5E8DL 2WP3T 2QEJA 5DGRA 4A2LA 4QUOA 4OCLC 4HCFA 1TVBB 5TDNB 5E9DD 3VXPB 4RIRB 1MQKL 3PIQA 4JRXD 3HE7A 4UM9A 4M43H 3K6FA 1H8NA 3C60B 3RY6A 1MCSA 4G2AA 2H8PB 3L3OC 4X0NA 3DHJA 4PBVC 4YO0B 2APBA 2AZAA 2CLRA 2PYFB 3SIKA 1CLOH 5DJCB 3T6XA 1RP8A 4OFDA 1A6ZA 4L48A 2XKNB 5E8PB 1VESA 3GXPA 2HCZX 3AC0A 3TT1L 2P52A 1TMQA 4N0FB 1NSNH 2WBXA 3EBIA 2DD8L 4BWTA 3C5SB 1TZHB 2L0DA 3T3MF 5E6IC 1MOEA 5GGTA 3NIGF 3RAJH 1IEBA 3FH7A 2K78A 4M8QB 5E99L 5G2NA 4EAEA 4WTZG 3VM5A 1QD0A 3PRZA 2WB1A 4IMLB 4TSAL 4GI6A 1MVUA 1JWUB 1LEKA 4NQVB 1KYOK 4PV9B 1BXAA 1LTXA 4YHKH 1JYXA 4NOFA 1WRFA 4MNQA 2NUTA 2AEOA 2VDLH 4YDIL 3ZE2F 3MV9B 4GI9A 3SKJL 4H0HB 1P7KB 2I32A 3WFHA 3G6AA 4X9BA 5FYJE 1FH5H 4HISA 5KSUB 1XXDC 1A65A 2A7BA 3ILEA 3IDMB 2OMNA 3WMQA 5K33A 1FPTH 4HIIA 4OZHE 5JOFA 1NAMB 2X4NB 3MN8A 3CG8A 1PX8A 3IDXH 3HAEH 1ECZA 3X12B 1P9MC 1PG7H 3HR6A 1S7SB 3BPOB 1BQHG 5BO1L 1NICA 1PGRB 3LS4L 3ZDZF 4PVNA 3AM8C 3OSKA 1R3IL 3BSGA 3DHPA 4Y5XA 3CFQA 1V7NL 1A7NL 2CDFB 3CHOA 3CHPA 4OCSH 2WQVA 4K7FA 3G5VB 4I85A 4IRJA 4O2CA 5HDRA 3TGXA 4JGJA 1BCIA 1P7QD 2H1LM 4KKRA 5CP3A 3DGGB 2OULB 4YX2H 2UXGA 4XAKD 3LZNA 4RBPK 4OZIF 4JDZB 5BMFL 1HI6B 2B1AL 2EIDA 5SWSD 4GSXA 1A0QH 3CHQA 5G5DB 2FAUA 2J8UF 4Y1TA 3X3FL 3H9SD 4EDXA 1TYJA 2JELL 2VXVL 3HG1A 1IQDB 4HC1L 5AAWA 3ULSB 4FQXB 3QXWA 1VZGA 4KV5F 2FLRT 2JJTA 2EDHA 1FNSL 3A6OA 1NGZB 1H3WM 3O3BB 3UTTA 1A8JH 2XXMB 1BBJA 2XTJC 3T1WA 2XN1A 4YDVB 3TV3L 1Q9WA 4OSUL 3E1ZA 4HUXA 4UCFA 5EBGA 1RZ8B 1GPOH 2A6KB 3ULUL 3CXDH 5JPMB 3KXFA 5JHLL 4N2EA 1YEDA 3AWGA 3PU7A 3QFDB 1MFCH 5A6IA 2B9BA 3IKCB 5IQ7H 4YGVA 4JMXA 3B7YA 3KPOB 3DNKA 2QJDA 3QE5A 4AYFB 4KO7A 5EO9B 3S4SA 4XH2A 4O02H 1UA6L 2ED8A 1T1WA 4YAQB 3LRHA 4U4IA 3DX8B 3R06B 5F7HA 5FV2A 2QKIC 1HHIA 3CDGA 3N1PC 3PWPE 1KCKA 1EXUA 2X2UA 3PHOA 4LZKA 1BFVH 5HHOA 3SGJC 3TYFA 1E6OL 3U2SA 3G5XA 3APCA 2VDNH 3MOQA 1JXJA 3A4AA 5FYKL 3W9EB 1JYWA 3BWAA 1PYWA 3AGWA 2Z93A 1YY9D 3NZUA 4GG6A 1PZBA 2K3HA 3KLDA 1C12A 1NEZG 1WTGT 2KL6A 4BV1A 4FXLA 4XX5A 4HS6A 1NH6A 1XR9B 1RZIB 2RALA 3G9AB 4JHWH 4K5OA 3GXNA 3IETA 4PYHA 1KGCD 3WKML 5TQ0L 3IRCA 3ZKXC 4BFGA 3ET9F 4MZIA 3D39D 2XACC 3M88A 4Y9CA 3L5XL 1G6RA 4ANVA 1F58H 1DUZA 4JVUA 1JNHB 2Z4QB 3LH8A 5IFJA 1OGTB 3I02B 4WHYG 3GNMH 4PRPE 3HNVL 2HFFB 3OWRA 4G5AA 2EECA 2GITB 3GBNH 2G3ZA 2CGRH 5FR3A 2JIXA 2LT9A 2YKLH 4WI0A 1K9TA 5I5MA 1U8IA 3VXME 3F64A 3PNWA 4HAFA 4QTIH 3BVUA 1XR8A 2DQTL 3O2WL 2COVD 2ZP9A 2VJ8A 4GKOA 3QPQC 4LMQI 4GPVA 1G9HA 4B50A 3EBGA 5JLZB 2PPAA 1PQZA 5DQJA 2NDFA 4QOKA 5K5YA 4P5TD 1JF6A 1FZOA 4NN7C 4Q9CA 2XVBA 4YLCA 5C6TH 1LQSR 4YSCA 2X53A 5C0AB 5BW7A 2WQXA 1OGAB 3LKOB 2HPTA 3NRPA 1UM6L 2J1WA 2XWZA 2YSSA 3SYOA 1X3DA 2P80A 1XZ0A 3VQ1C 4HUKB 2X88A 4G59C 4CADA 2QMKA 1HQRA 3BYTA 4Y5YA 1UJ3C 2AMGA 2F58H 3E0GA 3M1OA 4PQXA 2DQDH 3RY6C 2EIKB 3OAUH 1A4JA 3K91A 3ZKQD 4OCYH 5AZUA 4JHZA 5K1VA 5LO7A 4A6YL 3EO0B 4OZGE 4WFHE 1G84A 4FZEH 1Q9OB 3Q1SH 1FC1A 3BDBA 5D7IB 3N41F 3VXPA 4RIRA 4F7TB 4PJHF 2IV8A 3MLYL 3C60A 1SDAB 3TC9A 3U6XA 2AQ2A 2H8PA 1GZHA 1MPAH 3R4DA 4PJXB 5ALCL 1F4AA 3WSQH 3W3BA 4CDGC 5DJCA 3VGHA 1TUPA 3PHQB 4KTYA 3EIFA 4PWFA 5DEJA 2JI3A 1P4BL 2XKNA 5EMYA 4TQIA 5BPPA 4RFNC 3MRGB 4N0FA 3K71B 4KHTH 4OI9A 3CZFB 3FULA 5BVJB 5B39B 3C5SA 2X1OA 4UT9L 5J1TC 1UA7A 5A7BA 4YE4H 1VEPA 4X98B 1J9CT 3UGXA 4Y2DA 1FCGA 2Y1YA 5FW6A 5D71H 4LEOB 4PRIE 4M7LL 3HIZA 2QVTA 1BQ5A 4FG2A 3O3UN 2VUKA 4FJYA 1AMXA 4M8QA 4N4YB 1OIOA 2XV6B 1WA0X 3GPSA 1OW0A 2KDYA 4L2YA 3PQYD 8CGTA 1JWUA 4NQVA 2W5PA 2JB5L 5JW4N 5EU4B 3GXMA 3P30L 4NYLA 4UT6L 35C8H 4PJ5D 3L4UA 4M5YL 3OF6D 1Q72H 5DZPA 1P7KA 4JE0A 1KIQA 4OCRH 5K39B 5SWZE 5CINH 1H15B 5KSUA 3QH3A 4Y5XC 3KL3A 3IDMA 1FO0H 2B2XL 1I4FB 3QUZC 4IRJC 1NAMA 3HBZA 3UDWA 1I9JL 1NANI 4MJID 1Z3GH 4CKVX 1J88A 1GGYA 3BAJA 3X12A 3VGGA 2N01B 3AG3B 1S5IH 3UG5A 1HEHC 1GKEA 1NFDF 1S7SA 1KENH 2UYLB 4R7LA 2CJUH 4P3CL 2EH8H 3FN9A 5IHUH 3RZWA 3S6CA 4UNVA 1FL3B 2JCCB 2G2PA 3C8KB 1MEXH 1KIUA 3MBED 4GUCA 2CDFA 3G5VA 2CDEB 2EABA 3ISWA 2JJTC 1IAIM 2PXYB 2WN2A 5KVDL 1C8QA 4RMSA 4JFDE 4XAWH 4JDZA 1LNUB 4XNYL 1FE8L 1KDIA 2VLME 5G5DA 3V6BR 2ALAA 4EEEA 3TURA 3GMNB 3HG0A 2DL9A 3TWYA 2R2BA 1CGWA 3Q2CA 3ZSSA 1IFGA 3WBDA 2FHBA 4NQXB 4FQXA 4V1DD 1S2EA 4O5LL 2P45B 4L5FH 2EH7H 3GO1L 4MJJA 3U6XS 3WIHA 4WUKH 5GRYA 4CSZA 4D9LH 1CF1A 3NCJH 5DYOA 3I50L 4YDVA 1LHZA 4JHAH 4R6UA 3BAKA 2DL2A 5EOCH 1RZ7H 1GMIA 2A6KA 5GGUB 5JPMA 4JO3L 4C54A 2GHWB 1ZLWK 5GRJH 1I7ZA 4WI2A 4OGQC 1U6AH 3QFDA 3II1A 1TF4A 3IKCA 3BP7A 3RZCD 4JRFA 3UTSE 3KPOA 5K59F 1W9XA 1P6AB 3KPRA 1JFQL 1ZSDB 2C3HA 1J8HD 2ZUVA 5D1QE 4A2DA 4AYFA 1EJ8A 3V7MA 1CU4L 2P24B 1EMTH 3LX9A 3B1UA 4S1RH 2FNWA 4JHBA 4YAQA 5EV7A 2HG5B 3DX8A 2CHXA 3KBEA 3R06A 4M6MH 4LCVA 2OYPA 3R8QA 4YDLC 4DAGH 4L3FA 2KH2B 3PWNB 5FYKU 2P5PA 4WSGA 4GG6F 4AEEA 1G7PB 3W9EA 2HUHA 5GSVB 2C26A 1MY7A 3EH3B 2H3XC 2PPCA 1E30A 1IAIH 4XMTA 1NEUA 1E4XI 1XR9A 1BQUA 1WZ1H 4OLUH 3WEBA 2IAND 2BHZA 3WU1A 3LXAA 4X9HA 2WZ6A 1OTSC 1JTOA 5C0BB 3GGWB 1SMDA 2X2YA 4JHVA 4WU5B 3U30B 1J0KA 4AKQA 5DCCA 1GW0A 1JNHA 2Z4QA 4QRRB 2IDFA 2IWEA 5J9PB 5TTRA 2Y2YA 4NZUL 2GITA 1WZLA 4TNFA 2OCCB 5DFVD 4FI7A 2BCMA 2VXSL 1FYTB 4UV7L 2TRYA 5DZLA 5GGRB 5I1KH 3GIZL 1IEHA 5DJ0A 5FAAA 3TCTA 1PEZA 5CBAA 4PI2A 4YHLL 4TLTA 4R4NC 3WNNA 4Y5YC 1QLFB 2AJ3B 3ZN6A 4IEFB 2IPUK 1O7SA 3V0FA 1BEXA 2NY5C 4ZO9A 1AE6H 4G3YL 2O6CA 5C0AA 4P2AA 4IRSB 1OGAA 1VF5C 4X6BB 4MBOA 3VFNB 4KTEL 4CN1A 1TJGH 3DTXA 4XMLL 1SEQL 5A3IC 3LQAH 1H3GA 3FSOA 3BMWA 4W9CC 5BS0B 4XB3A 5DZNA 1DJZA 1O75A 3ARBB 4QO1B 5C92A 3C60C 1SBSH 4XP1L 1GZHC 5H4ZA 3MGTB 1OZUA 4TLSA 1TG8A 1VCBC 4X7TB 4Y1AB 3VXUE 4GW5B 1GJIA 3EO0A 1N0XL 3PWJB 3UBGA 3UYRL 4KZCA 3TBSA 3EOTL 2Q3XA 3CD4A 1HWGB 4XWGH 2GJ6B 1FBIH 3HVNA 4FL4B 2KZWA 1WFTA 5D7IA 4OD3H 4N8VG 4DPRA 2NMSA 2QSCH 1SFHA 4F7TA 5JW4M 5EZPA 3QZWB 1BXUA 3CCHB 2QKSA 4PHXA 4PJXA 4N3UA 2Z0BA 4GS7B 1U8KA 2BZCA 2HJLB 4YOKA 3PHQA 2CHDA 4G8EB 1F56A 2LLGA 2VZVA 2DQJL 1ET5A 3BPCB 1SYVB 3BCDA 2DOCA 1T0NB 3VWJD 5LXVA 1UUNA 1BX2B 2FX7H 5A2CA 3CZFA 4TQ8A 1OW0C 4OCXH 5BVJA 4P4RB 5B39A 4KPHH 2K6WA 4XOAA 5H37A 2V17L 3B7UX 3CFKB 4K3DL 2VB5A 4DPAX 3FQNB 1F1GA 3NSDA 4KRMB 5TE6H 3N42B 3BSHA 5G55A 2DB8A 3L54A 4L9DA 2J1ZA 5DVLA 1E4WL 4HIPA 2ZIDA 3BAYA 5JIQA 3LHPL 4BSJA 1INQB 4PS8A 3CQPA 4A2EA 4H0GA 4F2FA 5AW8B 3UDWC 2F7RA 5JHDB 1WWWX 5EU4A 1FVEB 4G5ZH 2DIEA 5AB2A 1QW9A 1ADQA 1OLLA 2IGFL 3T0EB 1MUJB 1XIWA 2IWGA 1NBYA 1LVEA 1B3JA 1BJMA 3BPOC 4Z3JA 1O6VA 4N5UA 4HSQA 4UILH 3A23A 3DTUB 1TR7A 4PJ7B 2GFBB 3SQOH 4KNSA 1JYNA 3G5YB 4AV4A 1NGQH 4OF6A 1I4FA 2D7QA 2QPSA 1TO4A 3QQNA 2B0SH 4WWPA 5CKGA 2VLJB 1UASA 3VQMA 2QHLA 1C5CL 4Z3IA 2VLLB 3PREA 4XN8A 4F15B 4OM0L 4L2LA 5F9DC 5K9JL 2ZSWB 2JCCA 3LN4A 2GSGB 3C8KA 1OSYA 5IEKB 4HFUL 4FQXC 2CDEA 5AZEL 2DW5A 2PXYA 5FF6B 1IVTA 5IHBA 3DBSA 1LNUA 2R56H 2KHAA 3VGDA 5I6MA 3NIFE 4FFVD 1GC1L 1E5ZA 3GMNA 3H42L 1M56B 4M29A 3CE1A 5BV7L 5JPMC 4J28A 3UAEA 4NQXA 2JJVA 3DUHA 1RJLB 3CFNA 4B9ZA 1B4LA 3WELA 1WBZB 4FQHA 3F5WA 2YPVA 5DA4A 5DWUL 4IS6B 1U8CB 2OBGA 3GSRB 3BVXA 4ZTOL 5D6DC 1D2PA 2BHUA 3QAZC 4ZMAT 2DQHH 5GGUA 4PJIB 4JB9L 5DWPA 1IO4C 2Z91B 2WJ7A 1A6UL 1OANA 4H0LC 4ICWA 5GGQL 1OGSA 3K7UA 1OF2B 3HOGA 3GWJA 3HTLX 4EN3D 4M7JL 4MDJB 1ZSDA 3GXUB 2NXYD 3CLEH 3P4NA 5F7NC 2P24A 1KTLB 3S2CA 3FTXA 4OGXH 1JZ3A 1CC3A 3QFGA 1WHOA 3SD5A 4DEPB 3FRPB 4CSTA 4JDEB 2HG5A 4U4BA 4KZEL 2DLHA 3JZYA 4HJTA 4NCDA 1PSKL 3KEHA 1VPOH 3K72B 3PWNA 3CSFA 1GA2A 1IC7L 4QXGL 1QRND 5GISH 3U36B 1G7PA 1MFDL 4TKWA 5JHMA 4MFHA 3QNXB 1MJ8L 4JQIA 3QWQB 1VZHA 3EYSH 3L9YA 4IU2B 2HT2D 4KO5A 1IKFL 3OHXB 4AZUA 4U6HB 1E7UA 5C0BA 4DO6A 2M8XA 2A77H 2C9QA 3GGWA 3C75A 3E3QE 1MW1A 5EC1B 4QRRA 2WBJD 5KZCB 5FYLE 5J9PA 3H53A 1BGXL 2A4CA 2HSIA 1HL5A 2X70A 4PRPB 3FT3B 4JM2A 3S36H 1FYTA 2A73A 5GGRA 3QUYD 2XBZA 4FQQB 4OB5L 3V2AR 4I18C 3FUEA 5FXCH 1H3TA 4GLRH 3IGKA 5TPWH 4G9FA 5BZXA 3V0DA 5KANI 2EAEA 4HHAB 5E4EB 2HJFB 2AJ3A 2WIIB 4IEFA 4LHQB 4KUZL 4OIFA 1OGPA 4AUJA 1UWEL 1VACB 3TJEH 3IPBA 3ZSTA 4AG4H 3DK0A 2ZUTA 5FUOL 4X6BA 3VFNA 3RVUC 1MKFA 1CLZL 3KWXA 2FO4B 3FUIA 4ZK8A 3MRKB 1HEJC 4FNTA 2PWEA 4LIQL 2VDQH 1N64H 4GH7B 5JPNB 3QEGH 4ZMOA 4UIMB 2BFGA 3MXVH 5LGKA 3DV4B 1KTKE 2XXFA 2DAVA 4HCIA 4XBPB 5GRVK 3AABA 5T3XD 2DTSA 3MGTA 3F6JA 3PL6B 4GW5A 3LRLA 3QUGA 1C5BL 3PWJA 1IB5A 4AEHH 4N2CA 3D3VB 4XT1C 3T08A 2GJ6A 4OZGB 2VDKB 2WUBL 3VU2A 1SZNA 2CBTA 1N0LB 2F1EA 4DKTA 2FR4A 1WD8A 4PJXF 1RZQA 4NO2A 3QZWA 2VXUL 3KVPA 3BZDA 4G6AC 5JIDA 3MU3A 4KMLB 4NGHL 4FFYL 2X3BA 4G42B 1WWCA 4M03A 4OZFB 4N2AA 3HZKB 1XGRB 1BM3H 5DVMA 2EACA 3BPCA 3P0VL 4NQQA 1JNLL 1VCAA 1T0NA 1BX2A 4GKSB 4IK6A 5B7MA 2AJUL 1JRHH 5EO1B 2WYHA 2NR6A 3SDAD 3DK2A 3CFKA 1EV2E 2D8KA 2FNBA 2ZCZA 3FQNA 4ZXBD 5IBTH 4ONHB 4MASA 3BDYH 2KC0A 4OFYD 5C0CD 1NGWB 4AQ1A 3VE0B 1JZ4A 3NZ8B 2WW8A 3HG3A 2D2OA 4P5RA 1S7QB 4MNGE 5B8CB 2Q8AH 5L2KD 4WHYH 3PJNA 1INQA 4DEWA 3LXCA 6PCYA 7FABH 1BAGA 1JHLH 1FVEA 1ACZA 3GKWH 3T0EA 3P4MB 1MUJA 4IJ3B 5EEUA 4L23A 3NPSB 3GBLA 3N04A 4DK3A 2FBJL 4TN9A 3NMEA 1DSFH 4F5CE 2GFBA 1G9EA 3RVTD 3G5YA 2PWDA 2OXGA 4K3EL 3L4CA 5IOKA 3CVDA 3KHQA 4OF8A 3OX8A 2PXYC 2P5WE 4FGMA 1T2QH 3CK0H 4OZHA 3WY1A 3PCYA 1MWAL 4UF7C 2VLLA 4X8JA 1HSBB 2JCCF 2HPOA 4FQJH 3TX4A 2P46B 4S1QH 1NBZA 1INDL 2R1WB 1UWFA 3GXDA 5L6YL 2ZSWA 4UZSA 3WKQA 4S1SL 2C3GA 2GSGA 5IEKA 3OAYH 4HX1B 2WB7A 4PP1D 5E6ID 1GYUA 1XEUA 4B60A 5FF6A 5AW3B 4HETA 4QRPD 4DTGH 1OSZB 1YEGH 2W59A 4UTAH 4FTVD 3IFOB 2JJSA 2VMCA 3DX9B 1Q1JL 4JFDB 4L3ED 4FABH 1YQ2A 4ADIA 2A2QT 4XNBA 1QBAA 3V5HB 1RJLA 1RUQL 2JKLA 3LKRA 5JMOC 4JM4L 3P69A 3O6LL 3F04A 1XT5A 4O2FB 1WBZA 3KHOA 4IS6A 1U8CA 1HAUA 2FYVA 3GSRA 4ZNCD 5KJ7E 3AUVA 5TE4H 3AREB 1IGMH 3HE6B 3AACA 2NY0B 4G6ML 4QT5B 1AGFB 4BJLA 3IJSB 4K5PA 3V4VL 4LK4A 1OF2A 2CO3A 4HS8L 3D6GA 1ZEAL 3QIUD 2G2NA 1URLA 3C08H 3OC5A 5DO2C 1TQVA 1CGTA 4MDJA 1I8LA 2GJJA 1IC1A 3Q2NA 3GK8H 4NX0A 3MJGX 1R9FA 1OT2A 1UKTA 2R8SL 4K9EH 1Z3RA 4QYOA 4MQSB 4C56B 3FRPA 4JDEA 2CO6B 2VR3A 4HZLB 1N19A 2YD6A 3K72A 5C08E 3UIZA 2Z3FA 2HRHA 1OZTG 1LO2L 3MJ6A 3U36A 1VGEL 2YUVA 2R69H 3MUUA 3PWPA 4FI8A 2OMYB 1RURH 3QNXA 5CJ8A 3T65A 1B4JH 2IBZX 2X4PA 4UT7L 1HL8A 2KZ1B 5D1ZB 1LK2B 4A2MA 4BK4A 1KMGA 2VDRB 4JG5A 5IJKC 2GUOB 1YQVH 2AJSH 3ALPA 4BFOA 5EOQL 4PJGE 4IU2A 1B0GB 3HR5B 1VEOA 4NC0B 4U6HA 1MJJA 2ENJA 3BVWA 5LBVA 1Q0YH 1WITA 5CCHE 3EH2A 5FCSH 4NP4L 2VDOB 5EC1A 1CE6B 3TM6A 1HILB 3MXWL 5J8OA 4JO4H 3MACH 3B8YA 3ZXAC 3GMOA 3GSXB 4PG9B 5B4MD 3RFZA 3PG2A 3ZQ9A 3D85D 4KY1H 2WGXA 4PRPA 4UQ2B 4HUVB 3DXAB 4IRSC 4NKOB 3ECBA 5DC2A 5L8JB 4RMUA 5CU5A 3HS0B 1I3GH 2L7QA 1PTZA 3VXMA 2N7SA 1QKZL 4H8HA 1AO7E 1B90A 2D3VA 4HHAA 2EJ1A 2Q3ZA 2WIIA 4WEBH 3AVEA 2BC4B 3ARBC 4G43B 5F9AC 3BUDA 4AQAB 5IP4A 2LU5A 4G8GD 3SZ6A 2Q7NA 2XXCB 1AD0B 3QI9B 4BM7A 1BIHA 3ZKMD 2YMXL 3UC2A 4FA6A 4ENEC 2XICA 3MRKA 2V4LA 4FL4C 3SDCB 4PYGA 1DCLA 1MCRA 2X0UA 5BUPA 4I0PB 1KLGB 4JVPA 4MA8H 1N4XH 4UIMA 1NMBL 5I1LB 3DV4A 4XBPA 3KMDA 3G08A 2XHNA 4NUGH 1Q0EA 3QJZA 3PL6A 1BD2E 1YEFL 3NSJA 4GS7C 3TEZA 1R34A 1UWGL 3WKPA 4ETYA 3GYRA 3D3VA 4QHKI 2YZ1A 3IE9A 1HE8A 3N43B 1I85A 5KYXB 3EJTA 4OZGA 3P2DA 3LZOA 2K3TA 5DD3L 4EIGB 1N0LA 5DD0L 2K4AA 3IYLW 4WGWB 2DQGH 1A7QH 1GYWA 5H4YA 2NR6C 4KXAA 1D5ZB 4R4BB 3ZZSA 1KSRA 2MRYA 2X4RB 4AQEB 5ERWB 1NC4D 1MVFA 4IW4C 1OD9A 4G42A 3S37H 1IBBA 4OZFA 1S7RB 3HZKA 1XGRA 2JMRA 2WXFA 1S8DB 4M43L 2ZCHH 5GZOD 3T8VA 1B4RA 3OR6B 4GKSA 4JPKL 3U0TB 3FUMA 1CLOL 2KYIA 3Q6GH 5EO1A 1C16B 2WUCH 3FFDB 4PLKC 1KBGH 5GS3A 4ONHA 5DJZB 2EDBA 2GABA 4JREB 2JJUA 3T0EC 4P4KB 2QQLH 4F37K 1NGWA 4X7DC 3IMSA 3KJ4B 5FLUA 2HKFL 3CN1A 3VE0A 5CD5D 3MJ9A 1XSJA 4N1CA 4PRIA 3BP4B 3U9PH 2BVQB 3VTTA 3HE7D 1MDTA 4KAQH 3UCRA 5B8CA 4XNDA 5J0BA 2EUWA 4Z7IA 3FSZA 4FNRA 3U6RB 3IJ7A 3S36X 5IJDC 4FNQA 5IVNA 3GS0A 4HJUA 3PV6B 3P4MA 3ZZQA 1EEQA 3GLDA 2E59A 3M7OA 3VRLE 4F15C 4PJ7F 4G8AC 4ATWA 1HJBC 1TSHA 4Y4KD 3GBMH 3MRQB 2XYBA 3QXTA 5K9OB 3LPFA 3MLUL 3CVCA 2YOAA 4QI3A 4CW1B 2YGNA 1GGBH 4IOIB 4LVOB 3A24A 2P48B 4FYQA 5SWZA 2VDLL 3LZLA 2ARJB 4PHZA 4PJAE 5IQLA 4LOEA 3TO2B 2HWZH 5CU9A 3FQYA 4EQ2A 4XBMA 1FFTB 4KXZI 1PPIA 4L4VE 2JJSC 5L8LB 5DC9B 3P1VA 1SGKA 3CXHJ 2R1WA 1M7DA 1AQDB 2V8LA 4ZFGH 3IDXL 3H54A 4NXKA 4HX1A 5BZDB 2XWJB 5ADPL 3GMLA 3CVHB 3MUHL 2V9RA 4AXWA 1URIA 1A14H 1OSZA 4GO9A 4R8WH 3RWHB 2G0KA 4Y5VA 3B2UD 1OB0A 5SWQB 3DX6A 1SQMA 3DX9A 4JFDA 4OCSL 3F3HA 1MIEH 1QACA 3BJLA 1N6UA 4HMDA 4MD5A 3CDFA 3HC4H 4R2GB 5AVWB 3V5HA 4HOWA 3ULVE 1GJUA 2XN9E 1QYGL 2WLYA 1JPGB 4O51A 4O2FA 5BUGA 2XC8A 1I8LC 5DQDH 3WE6B 3HB3B 4PJIF 2RBLA 5KANG 3AREA 5HGGS 1WP6A 4DEPC 4QT5A 2Z0UA 1AGFA 2N0KA 1X5ZA 1QWNA 1A7RH 2DMKA 3LRKA 3KW8A 5KYNA 4GP4B 1EA9C 3ARPA 1MCCA 1AGDB 1GPOL 1R47A 1KJVB 1W2KT 1DANU 2NY2D 3KL0A 3CC5B 3D30A 4XP6H 2QL1A 1ASOA 3TVMD 3SDDB 5I26A 4XOCA 1KXHA 2CO6A 5LKNA 3GJFB 1SN2A 4JG0H 3U9WA 4HZLA 1NL0H 1S3KH 3OHXC 6PAZA 5KS9E 1MIML 2EC8A 5DUPL 4FA7B 1UHVA 3UBHA 4O02L 4ZAKD 3THMH 5MENB 2H3KA 1QPXA 2IJ0C 2OMYA 1CVRA 4PGJA 2Q76A 4TV3A 1T21B 1LK2A 1YMMD 2VO8A 1H19A 2GUOA 1T7VA 4FNPA 4FEIA 3PWUB 2VDNL 3ABLB 5C07B 1KXTB 3MRMB 3WAKA 4LGSB 3HBGA 5J6SA 4FTDA 1ET7A 3MROB 4AH2A 1A3LH 3HI5L 4MHHG 4JHWL 4RA3A 1HILA 5EIIG 5E4EC 5AKTA 5B39G 3GSXA 4IBTA 4PG9A 5IR1B 3ROOB 5KUKA 4ABQA 2VRAA 4NIYE 3LV3A 4U6YA 4HYTB 1F58L 4UQ2A 4HUVA 1LP9F 4NKOA 5IKCB 4X5WB 5SX4H 1HWHB 5B38B 3HS0A 1XSIA 2GK0B 1PL3A 1VKXB 3B9KD 3ILDA 1DDHB 2YKLL 4XPTH 5JPNC 2YOCA 4QTIL 2BC4A 3CLWA 4PGEA 2Y0SA 5CD3A 1D5RA 4G43A 1MNUH 4AQAA 4D0DB 3RWEA 1JPST 2MJWA 3AZUA 3LN5B 1A66A 2OV0A 3PL6C 1EERB 1AD0A 3QI9A 3GDCA 4ZW3A 3HHMA 5CIPH 1I85C 3LKSA 4NT6B 4IGBB 3M8OH 1CFSB 3SDCA 5GS0L 1R5IB 2X1PA 3KPSE 2NSXA 1OP3H 1KLGA 5I1LA 3LQZB 1E2WA 3WTXA 3C12A 1J1OH 3FKUS 3MREA 1PZUB 4NDMB 3AT9A 4PSPA 4WENB 3UACA 4KK6C 4PY7A 3P0GB 3IN0A 4K94L 3FB8B 4Y9FA 5F9JA 5K93A 1AHMA 3D4ZA 1I1FB 2ZXBA 1FVDB 3VXUA 1TPXB 2DQDL 3MLXH 3DSFH 1I1YB 1W16A 1DYZA 2PPEA 1OOWA 4OCYL 4U1MA 5I66B 3PP3H 5CGYC 2TSAA 2W60B 1MCJA 3BE1L 2AC0A 4FZEL 3PS6A 3T4AA 1D5ZA 4R4BA 1QPKA 2X4RA 4OAWB 4AQEA 5ERWA 1D7BA 5F6HI 1S7RA 5T3ZD 4YHPB 2VLRD 1WAAE 4K8RD 5JIPA 1NOLA 1TTCA 4B9YA 3LHAA 1R3HB 3FN0L 5B8CC 1ET8A 2Y24A 1YNLH 2LLNA 2XZZA 3RTLA 1C16A 2YZ8A 2K70A 1ZHKB 5DJZA 4AV0A 4G83A 3TNNB 2MKWA 3GKZA 3L6FB 4IJ3C 5IMLB 1XX9C 1F6FB 3NPSC 4RH4A 2EDFA 2ZG2A 1JI1A 2E7MA 2BVQA 2JKTM 3OKNB 2ZX5A 4CBPA 3L5JA 4YE4L 2HH0H 3U4AA 5D71L 4NENB 4ZTPL 3BKML 5EORL 2L3BA 1VFBB 3WMPA 2ADFH 3GPEA 3U6RA 2ATPB 3INUH 2J4WH 3TA4D 1XH2A 5ID0B 5GGTH 3WDJA 1IGTB 3PV6A 1XGUB 2OYMA 1JGVH 1KOAA 2O6EA 4DKDC 2BOCB 3MRQA 4F92B 3OKLB 4LPCA 3W2DH 4ANUA 1Z6JT 1S3RA 4CW1A 5K9OA 5KSBE 4NHUB 1SXZA 2NSQA 2FWSA 3QZBA 1SMAA 4NZFA 4Y2DD 4NC1E 1XGYH 1RP9A 2ARJA 4OCRL 3TO2A 4YMPA 3MI6A 4W1TA 2MTAA 2FB4H 4HUNB 4A37A 1J1XH 4I1PA 3DPBB 4L3AA 1FO0L 4MJ6A 2ZAHA 2NNCA 3HMXA 1Z3GL 2V9TA 3KVQA 4Q9BA 1CD0A 5BZDA 2XWJA 3RBSA 4K23L 3CVHA 3UJTH 4J27A 4TL5A 3VD5A 3VX0A 2C7UB 5EUOE 3IXAB 3TCLB 1NANH 2XG5B 5I1EH 2EH8L 2WWNA 2Y5EA 4I88A 5I0DA 4P5KB 1TJXA 5JA9A 2C9UA 1MEXL 4QF1B 1TT6A 3AREC 4W9ZA 3HE6C 3T8MA 2Q2EB 3NSXA 2B8OT 2NY0C 4QTFA 2LU3A 2ZCLH 2EIZB 2ODHA 4QHNB 5DJ2A 1ZLEA 4XAWL 5E6UB 3JTTA 2EXSA 1EWHA 1ED3B 5ALBH 4X6CE 3ZHDA 4GQPH 1JPGA 4XBGB 5LWYL 1JZ5A 4GSDH 1YO4A 4BFEA 3WE6A 1F6LL 3NQKA 3S37X 2NCMA 2BHFA 1SXBA 5D8JH 4G6KH 3WY3A 4MCZA 3VFOB 5IREA 5FDWA 1UADC 2BVYA 2ZJSH 2F8OA 2EH7L 1WIUA 5D6CB 1BYPA 4F9LA 4R5XA 1WICA 3UYOD 4AQ8C 4D9LL 5C9KA 1T03H 2AK4E 4OIBA 3QARA 5EOCL 4HJ0D 5GRVL 1HE7A 1AGDA 3FYEB 4ZO8A 2AJYH 4ZBJA 5T8IA 1LXMA 5GRJL 1IKOP 1BZ9B 5MEQB 1AG0A 5D1ZC 4G6FD 1QFUL 5FUZH 3SDDA 5DSCB 4WK4B 2R9HD 4QXTB 5HDWA 3OG6B 3GJFA 1TLMA 3LH2L 4X80L 4B7LA 5AWNH 1YEIH 1U8LB 5E4AA 1EO8H 4Q52A 2VXTL 4JX0A 1UC6A 2G4EA 4PLJD 2AXFB 1Q9KB 4M6ML 1JXKA 4Q0XL 5D1ZI 1T21A 2LHAA 5HI4D 2C3WA 4XXCA 4DAGL 3I3EA 1J8KA 4O9HL 3QZWG 3S98A 1SXAA 1RK7A 1Z9SB 4YBHA 1M7XA 1ZA6B 2JQAA 1KXTA 3MRMA 5C07A 4JN1H 3QC5X 4I77L 2ZONA 1S9YB 3KPRD 1BQKA 1Q9LB 3J27A 2VZ1A 1D5XB 4JFED 3MROA 2LFEA 1IAIL 2PNDA 3HS0C 6CGTA 3D8MA 1U93B 4OLUL 5FB8A 5IVXE 4HEME 3TJPA 4FAAB 3ZT7A 4LOFA 4BA8A 5IR1A 1E4XH 4HWNA 3ROOA 3CMOH 3QULA 5CEZH 1INEH 3UGEA 1CMOA 2DQIH 1JFHA 5IKCA 4F58H 1L0PA 3P2TA 5B38A 3QI9C 4AVIA 3TA3D 3DX1A 1CJYA 3NCCB 4OJFH 3KE0A 2GK0A 1QAWA 1SF5A 1T5XA 1QATA 1DDHA 3SDCC 2YFNA 1P4IL 2AZUA 4GG8A 5I1KL 4GXUN 1AO7B 1XEDA 4XN1A 1BQLH 1GIGL 4I0PC 1ZLVH 2EO1A 3IF1B 2JK5B 2V6HA 1CFNB 1QSFD 3TH3T 3AWEA 2QPEB 4D0DA 3LN5A 4JY6B 1B88A 3T0DA 1LDPH 5FO7B 5I76A 3QR1A 1DSWA 2Z31B 3W81A 1AE6L 4NT6A 4IGBA 1CFSA 1G9NL 1ETB1 1R5IA 4GSRA 2A9CA 3L4WA 3CN3A 2QPFA 5L88H 1KB5B 3MCKB 4XNXH 3LQZA 4PRDB 1J0IA 1IAKA 4P9HL 5I18L 1J5CA 3LQAL 3ZYZA 3FB8A 3MDJA 1I1FA 1S78C 3VXRD 1L9MA 1FVDA 1YDPB 3CVBA 4GEIA 1I1YA 2DYPD 4KK8D 3HNSH 2UY6B 5I66A 3EF4A 2W60A 2NY5H 1S4IA 4NRXA 2NYYC 4Y88A 2BXYA 1KYDA 5FHBL 5FLVA 1D6VH 4XWGL 4JREC 5CHNB 4U6TA 4P4KC 4OD3L 4WCYL 3V95A 4YHPA 2EKSA 3KJ4C 3OKEA 4P8QA 3U7WL 4JMNA 3R4RA 5KBDA 3QDJE 1R3HA 5F1KC 1P4LB 2HTKD 2IDTA 4EXPX 1ZMYA 1NCWL 3MV8D 1FGNL 4TXVB 3BGFB 4HF5L 3RVUD 5E8EA 2BSRB 4HEPA 4B9PA 3TNNA 3K8LA 4ZTEA 3VXTB 3L6FA 2FX7L 5IMLA 1AXSA 3R1GH 4NQCB 4NOBA 1KN2H 4KPHL 4KTDH 4BUQA 3OKNA 2VISB 2MNJB 1XF5A 4C59B 2G2RB 4YFDB 2ED9A 3DX7B 5TE6L 4NENA 4LVOC 3TZVA 1DQJB 4QHLA 2ATPA 3DOIA 5ID0A 3MGAA 5GGRY 1OAQL 3V6FA 1IGTA 2WQAA 1XGUA 1ZVNA 2BOCA 4OLEA 4APQD 1OAKH 3OKLA 5T1MB 4RWYL 4G5ZL 4NHUA 4JRXE 4LL9A 1X5JA 1ACYL 1PZCA 4F5CA 1RZFH 4DGVH 1SHWA 3BVTA 2D03L 2Z34A 3KPPB 2Y4SA 2MIZA 2VL4A 5GGVL 1K4DB 2ENYA 2W1NA 4UILL 2OCFD 2FH8A 3BN3B 3DPBA 3GBEA 1LK3H 4PJAB 2MSPA 1JK9B 4MLIA 2YQBA 3FT0A 4R2GC 4L4VB 3OM3B 2JKWA 4MX7B 4B9KC 2YGQA 3LZFL 3EHBB 3HFFA 2ZUSA 3P73B 4Q4EA 4QHUB 3ZE0F 4Q2ZB 4P04A 3CX5J 3IXAA 3TCLA 4QWWC 1XIWD 3HRZB 2EDDA 4AGQA 2C3XA 3HB3C 3BVNB 5DJ8A 4QF1A 1TEYA 1MFUA 3KVDD 3RVWD 3MRNB 4UQCA 1P2CB 4YSAA 2EIZA 3BZFB 1J05A 1RSFA 4OVUA 4QHNA 3KYNB 3T6QC 2LABA 1ED3A 1TVHB 2R56L 2YWYA 1ORQB 3CFIC 3J07A 4XBGA 2XN9B 5ANHA 2IWKA 3AWFA 2IEPA 3QYNA 4I5BB 3ZRFC 4U6XB 2FWLB 1B0WA 3VFOA 2HMIC 3SDDC 5D7JB 1AG6A 2GI0A 5I6PA 1MJUH 5D6CA 3UTOA 5I19L 4TYUA 2YC1B 1CFBA 1HZHH 5C0RL 4GAAA 3FU7B 2R1YB 3NSFA 4UV4H 2FVNA 3NESA 4MB1A 3SCMD 2O5NA 4G1MB 1JERA 4XXCC 5DSCA 1TQTA 2Y2WA 4PCYA 4QXTA 4RMQA 1A6TB 4I1RA 1W80A 1PZDA 1X7QB 2XV3A 2YLHA 4S1DC 2AAAA 3VRJB 3BQUA 3MNDA 2YQ3A 3DGDA 2DBLH 3KLAB 4OGXL 1U8LA 5C08A 4HUMB 4FDWA 3BKCL 3SE8H 4KQ4H 2AXFA 4IIQB 2OA9A 3AJ7A 1Q9KA 4GXUM 1VPOL 5D4QA 5CEXB 4I89A 2AABH 5GISL 1Z9SA 4Q6IB 1ZA6A 3VFVB 1S9YA 4PJGA 3NJKA 1QEXA 1D5XA 2CZNA 3LCYA 1WFNA 3V6ZB 5BCAA 1U93A 3EYSL 1QOKA 4BFNA 5ESVB 3WLWD 4EO5A 2HYMA 4QHMA 1IE5A 4HIHB 3B8SA 2LW3A 2ZKYA 1VA9A 4AIEA 4JANB 3HA0A 4DWHA 4FFTA 3HKFA 1KT2B 1A8ZA 4WWOA 3L1GA 3EJQA 4FX5A 2FEEL 2HG0A 2J6WA 1IAOA 2FK9A 4Z7VF 5HYFA 4O2EB 3BWUC 4BE6A 4Z6AT 2BNQB 4B0MM 1NUDA 3O0LA 2QFPA 3OMZA 3WXVH 2OAAA 4IGBC 3S36L 3H3KA 3U2JA 3QDMD 1BAWA 4NZ8A 5IVOA 1AO7A 4GMTH 3SPVB 3MV01 2GB2A 2JK5A 1X5GA 3ZDYB 1KCUH 4DP8X 2EEAA 3RL2B 2R2CA 3GSQA 4JY6A 5BZWB 1F4WH 1ZGLB 5LGHL 4KXCA 1JGUL 2BSEA 3LKQB 4GRWE 1TPXC 1RXLA 2Z31A 3QPXH 2I7SA 4DN4H 4AG4L 5ISZD 4CMHB 4ZFOL 5I24A 2VSKB 4JM2D 1KB5A 1UH3A 3MCKA 1NGPH 1NC2B 1EEZB 1O7DC 4PRDA 2AQPA 1PLGL 1KGCE 3SE9L 2UX7A 3KPSB 4XX1E 4QRQB 1X5FA 2B1OA 4ENZA 4G9FD 2VDQL 2PO6B 1YDPA 1HFUA 3MXVL 2XKUA 3DMMD 5E00B 3IJ9A 4MVBC 1HOCA 2V7HB 4Z7QB 1AHWB 2FD6L 2H2PD 3JXAA 5T33H 4XMPL 4XTRD 4ODUB 1KBVA 3GM8A 5D2NE 3EYQC 2F53D 1KTJA 2VKXA 4QY8B 4BZ1A 3ULUE 1I1AD 2O61B 1NMAH 2E76C 1N7MH 1Y6MR 1YNTB 1P4LA 1DJXA 1D9KB 1RIHH 4H8WC 1OCZB 2B3RA 3P9MB 4JRYE 4IOFD 4A7QA 4YHIB 1BM3L 2MPAH 2V5RA 5ECGA 2BSRA 4PJ9A 1UCBH 2GTZB 2UZYB 2AK1L 1O5DT 4IBLT 5GJTH 3RDTD 4NQCA 4DKFH 4J3XA 1JRHL 4U7SA 5D96B 2BERA 2VISA 2XZQH 2G2RA 5I8EB 4PGDA 5IBTL 2K0RA 2KLRA 3BDYL 1MF2H 4HIEA 1TO5A 1Y1DA 4Q6KA 5KJRH 4GUOA 1DQJA 3FT4B 4N2MA 5PCYA 5HYQB 1JD7A 1X4YA 5KSAA 3NA4A 2Q8AL 1CE1H 5F96H 4NJAL 1DQTA 1U8MB 5T1MA 7FABL 4JO8A 2DV6A 3FC8A 3H3PL 5EWIL 2R4SH 5BVPL 5HI5C 5T5FL 3Q5TA 4J4PD 1HQ4B 4XB7A 1ADQH 1RFDH 1Z5YD 1YUHB 1DSFL 1K4DA 3ECVA 2BP8B 2ZXWB 3LJ3A 1E3FA 2VWEE 4PJAA 1JK9A 1ZY9A 5T1DL 4F2ME 4H26B 4L4VA 4LSTH 4MWFB 4MX7A 3ARDB 2VZTA 4QHUA 4GOSA 2J72A 3QRBA 4WV1B 2F74B 5F0PB 4Q2ZA 3U0PB 5AAPA 2OL3H 3VD4A 3EYUH 4L8BB 4D9RE 1KG0B 5DC4B 4FQJL 3ZJAA 4S1QL 3A3YB 3L9BA 4LBEB 4ABUA 4Y19D 1VRSA 3FO0H 5EUOB 3TV8A 3BVNA 2X4UB 3B3BA 3A5VA 2WLLA 1NDGB 3MRNA 3X1BA 1P2CA 3PJLA 5JYMA 4RQQB 3DIDA 3BZFA 5FYJD 3EKCA 4MA7H 1QMUA 2Z7WA 4DTGL 3LKNB 1IARB 1YEGL 3RYMA 4DCQB 4UTAL 1ORQA 3APDA 5DHEA 5F9OH 2EDMA 2XN9A 4FABL 4ZPVA 3ZTJG 4N9GB 1QI3A 3S8FB 2OFQA 4BRJA 3NJLA 4NQSB 2MCMA 4M1CD 1XHHA 5D7JA 3ZE1E 2YC1A 4P5MB 3APNA 5TE4L 1T66C 4RMRA 3K8KA 1IGML 3FU7A 2R1YA 4R5TA 3TN0D 2YPVH 2AK4B 2YA0A 4X7SH 4LFHG 3IVKB 3QQ4B 1MAKA 4UTCA 3OJDB 4G1MA 4XHJC 2ZOTA 4Z0BL 4GQ9L 1HIMH 2OSXA 3FUFA 3C08L 3NDYE 3O2VH 3WI9A 1HKLH 1SY6L 4OGZA 4XPHH 1WAEA 2QGDA 4MQTB 3ZL1A 3VRJA 3U25A 5C0ND 4M4RB 3QDGD 3VI3F 3KLAA 4G11A 3OR7B 4RWHA 3I3DA 3TU6A 2DYRB 3V79C 4CUCA 3QWRA 4H2AA 1UKQA 4OCWL 4TNVK 1A2YB 1N10A 2FX8H 2N0MA 5CEXA 3Q8EA 2FYYB 4Q6IA 4CSSA 4QNPE 3VFVA 1RURL 12E8H 3GHPA 2CKBA 3SYQA 1IJ9A 4TM9A 3SN6N 3V6ZA 3WFZA 3P2BA 1YQVL 2AJSL 4FG6D 5HVHB 1GS6X 2BNUA 4HIHA 2H2SD 1ZTXE 4JANA 3V0GA 3CVIH 1BFSA 3WGVB 1SLVA 2ERJB 4PLNC 1YC8A 2OI9B 4FLQA 1KT2A 5C0IB 2XA8L 1Q0YL 3QJTB 1TQCB 2JF1A 4MXQC 5DZVA 4Q8BA 3UZQB 4LLMB 4RFEB 3PWPD 2EO9A 4PJDE 5FFGA 2R83A 3MACL 4O2EA 1F3DH 3EDKA 2AS5M 2Z31C 3ME0A 5ACZB 4HPYH 3GS7A 4BGLA 5LCVA 1RY7B 3A47A 1IZKA 3SPVA 3W0WD 1I3GL 4DH2A 2BNRB 1ZV9A 3RL2A 3CU7A 2NW3B 1EPFA 4N6RB 2NY7H 2BSSB 5EU6E 2Y7LA 3C9NA 1EJOH 3FTZA 4WEBL 1SMOA 5CCKH 5KZCD 5DZ9A 1KPVB 2YRLA 4FADA 4PVMA 2G0LA 4QRTB 5AVUB 2UWEF 4PRPD 4QXUL 4TF4A 1CFTA 5T3XL 5KVDE 1NC2A 1EEZA 1D7FA 1IL1B 2IGLA 5EBLB 5FHAL 3L4TA 2F7OA 3KPSA 3TOPA 2FX9H 2QQQA 3VXMD 2AW2A 2E86A 3VXQB 2J71A 2PO6A 3QA3B 4JO1H 2AANA 4PRBA 1EGJL 4KKNA 1K2DB 4YHNB 3GSUB 3V8OA 5E00A 5IB4B 1FSKB 1NOFA 2XVGA 4UQ3B 3BGFC 1UXSB 5MP6H 2MQGA 2V7NB 4HJGB 3UPRB 1VB9A 2CMRL 3EG9B 3QEUB 5CJ5A 4ODUA 4XBEL 3V5DB 3N85L 5IW6B 1F1DA 3WHE1 3UGUA 1A3RH 1YPZE 1DVUA 4H1LB 3I6KB 2J5WA 2WQSA 1A7QL 4JL2A 3U79A 1WAAA 4Y4HD 3CPLA 3P9MA 4JFFE 1BQRA 5ITFB 3VFRB 3QDJB 1SRDA 3FT9A 3S37L 1UH4A 4DOHB 4YHIA 5EZIL 4RZCB 4LEEA 3VUAA 1ZVYA 2GTZA 3W57A 1OF0A 5AZ2L 4WFHD 4UANA 3QHFH 4J6RL 4UDTB 3SKOB 3Q6GL 2IALB 1EAPA 5I2IA 3MA9L 1JPSH 5D72H 1KBGL 5I8EA 2Q6WB