2OKMA

Crystal structure of ace19, the collagen binding subdomain of enterococcus faecalis surface protein ace
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
146
structure length
146
Chain Sequence
ERDYPFFYKVGDLAGESNQVRWFLNVNLNKSDVTEDISIADRQGSGQQLNKESFTFDIVNDKETKYISLAEFEQQGYGKIDFVTDNDFNLRFYRDKARFTSFIVRYTSTITEAGQHQATFENSYDINYQLNNQDATNEKNTSQVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ACE19, the collagen binding subdomain of Enterococus faecalis surface protein ACE
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Cell adhesion
molecule keywords Collagen adhesin
total genus 43
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2007-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05737 Collagen_bind Collagen binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2okmA00
4Z1PA 3KPTA 2OKMA 2X9ZA 2Y1VA 2X9XA 4UZGA 3V10A 3HR6A 4IGBD 2F6AA 4Z23A 3RPKA 3PF2A 2X9YA 2WQSA 2X9WA 2Z1PA 5DZ9A 4IGBC 5DZAA 1AMXA 3QE5A 3UXFA 2WOYA 4HSQA 3OPUA 3PG2A 2XTLA 4P0DA 4OFQA 4IGBB 3HTLX 3RKPA 3QDHA 2F68X 4IGBA 2WZAA
chains in the Genus database with same CATH superfamily
3MBXH 4IRZH 2MIZA 3V6OA 4WUKL 2XVKA 3WEXB 3O0RL 5I1AA 1XR9A 5D7LE 2B77A 1GGBL 4GKLA 4NNXA 2LU5A 5CP7B 4HIEA 5D1ZC 1ASQA 1IAOB 4KNQA 2AVGA 4OU3A 5KJ4A 1KN2H 3KGRA 1S7VA 3P9LA 4B41A 4DVBA 2Z0BA 2QLYA 3HZMA 1DN0B 5CHNB 2XN1A 4MJ6A 4YWGL 4DKTA 3FJTA 1CUOA 5BQDA 3ILQC 5AAMC 3RY6C 5I6XC 2HH0L 1UJ3C 4PRAA 2F68X 1GYAA 4X7EC 4HUKB 2G60H 1P5UA 4K5OA 3FCBA 5JA8B 3QUZD 3U4BL 1SEBB 1G7LA 4PRDA 5DJDA 4YC2B 3TBCA 4JHVA 1MCCA 5KN5A 1RJYA 4X8JA 1MCSA 2AQSA 2UXFA 2APVA 2XI9A 3JT0A 4S0HA 5EU3B 3TVMB 5J6SA 3PDOB 1A0QH 1I1FB 3BKJL 5LGJA 1NIDA 2JWYA 5I1EL 1UWXK 1KULA 3ROLA 3FB7B 3WLWC 4TNEA 2IPUK 3RVWC 2OMZB 2QGDA 2ZYIA 4JHAH 2AJVL 1FCCA 2NNAB 1IBBA 1U8IB 4PV9B 2EDJA 3EYQD 4ZS6C 4JO8A 4ANUA 1CFMA 1LO3H 1ZCRA 5IB4B 4QEGA 3FU3A 5TE4L 1GZPB 1NFDE 1P6FA 1ZTXH 5E8NB 5K9QI 2UZPA 5D2LA 5JZ7C 1JYVA 2NY3C 5CD5D 5DEFA 4QTHA 4PJ6A 1IBGH 3B43A 4YDNA 2OMXB 2G3MA 4AYBA 5L2JB 3RRQA 3WJLC 3WEXA 3QJQB 2ADYA 2WXHA 2BNUA 1TQVA 5ALCL 1UH4A 5HYFA 1P9MC 4YHNA 2BVPA 2DQTH 3R7QA 3FC8A 4HPYH 3CZLA 4K3DH 4A7QA 3BT2L 2C9RA 3DX6B 2F53E 1U3HC 5F7DB 5TH2B 1MCWM 3APFA 2DYPB 2QZ5A 4Y5XC 4ILDA 1JPSH 4MX7A 4G5ZL 4P23A 5C0IB 2OZ4L 1JPFA 2ZWZA 4U1MB 3TBYA 2K9FB 5CEYA 2VZVA 4LSTH 2ICEB 3LZNA 4BK5C 3O9WB 1AD9B 4BKSC 4N2NA 5FA4A 3MXWH 1G7LB 2PCXA 4PRDB 3MRCA 4FQCH 1RFDH 5I1DA 3Q9QA 2QHLA 3KW8A 4D94A 4ZD3L 5I6MA 2CGRH 5JHDB 5AOLA 3SPIA 4I9WE 1AOHA 1D7CA 3L13A 3QBTB 4KZDH 2H5UA 1ZA3A 3CZFB 2V2WB 4FFZH 5FM5O 3B9EA 4A7TA 3CWGA 5BZWB 4CU8A 4NEHB 4A04A 2CO7A 1NKGA 4LEOA 4RZKA 1IGTB 1H5BA 3S3SA 3RJOA 1BF8A 2H1LM 5LXVA 4MA3B 4B53A 1CGTA 1IGYB 2WYZA 4FG2A 5F7LB 3V4UH 4D0BA 5HHOB 2FJHB 1O75A 1U41A 2NR6C 4U7SA 5FYJU 1A4JB 2APTA 3EJJX 1DVTA 4F8PA 3TJHC 3F7PC 5I8CA 1SYSA 4G6AC 3MMEA 4Y2DD 5J9PA 1EK3A 2NMSA 4UT9H 4ZMZA 3JV5A 3N1GC 4GP5B 3QO1B 1JNLH 1RZ8A 1J88A 3AQXA 3LH8A 1EH9A 3RJDA 3TA3D 4LFHD 4ZMTA 2O61A 1KBBA 4BUQA 4XNYL 3S5LA 2VDNH 3TYFB 4HKJA 5C0DA 2CCLA 2OL3H 2OTWB 1OD9A 5D1ZB 1TJGH 4GSQA 3RLSA 4QXTB 4XNXH 4MRBA 1UXLA 4Y1AD 3N5AA 1D5MB 4YXLL 1ZLWK 4AV4A 1MCQA 3PGDA 3CK0L 3UBXA 3FCTA 2N3JA 1G6RH 2YQ2A 3PY9A 4BKLB 4MJIE 3TFBA 2J6EA 2H32H 4YBQD 2DQIH 1S7QA 3QQDA 1LO4H 2GT9A 4ONHB 2AK4D 2XWZA 1SXCA 4DKFH 4PJBA 3HJ0A 3BP6A 2M2DA 4GO6B 4M7KH 5DFTA 1QATA 4XC3L 1TZ8A 1SHWA 1A4KB 1E40A 2ZE0A 2DQHH 4HIHB 3BUQA 4M48L 4JG5A 4YPJA 4JO5A 4OW6A 1KIRA 1N0LA 4S0TD 3LQZB 3GFUA 1BD2A 4XXWC 5LG1A 4BFNA 1SJHB 4A1RA 5GGRB 4N2AA 5BVPH 4BKTC 1XEUA 4JBSA 3HC3H 3RDTA 1ITCA 2VMCA 3SPJA 4NC2B 3ULVH 3CIAA 3GSXB 3FBQA 5FUCE 4Z7AA 4KRMB 2Q86B 4FQIL 2LLGA 3GDBA 2LFGA 3RWDB 1JNLL 4NQED 1ZS2A 1YEJL 4IIQC 3ZDXE 2R27A 4L9LC 4YUEL 3MJ7A 4APQC 1PS3A 1UADC 3WNPA 3WNJA 1VGEH 3G5XA 1D6VH 3EOYG 1ZHNA 5BCAA 4HMCA 3D5OF 2WWNA 2Y7NA 2HJLA 4X7CC 4PJAE 3O11A 5CIPH 3PP4H 4J23A 2UX7A 3DDGA 4H8PA 4PLNC 2ILLA 5KVEE 4K9EL 3IN2A 4AGPA 3ZYZA 1AMYA 1HHJB 4LHUA 3UBXB 3LRSA 4Z7OB 5M94B 2AZAA 4K8RH 1P6AB 5I2IB 5ERWA 3R4RA 3LMJL 1ZS8A 4AVKA 3TEXA 1MRCL 4AVIA 5AVXB 4GRLA 3IVKA 1CGXA 3G5VB 2RTTA 4U49A 2G2PA 5IHWA 2FJSA 2AEWA 4ODHL 3EGXB 4OI8A 3LKOB 3IS1X 1QHQA 4GRWE 4HA1A 4LSUL 4V1DB 1TCRB 4F2MB 2BOCA 5SWSD 5KS9E 5E1HB 1DQKA 5F7EL 4F58L 5DUMH 5F7FA 5F7NC 4K7PX 2Y2YA 2AJYL 2W91A 4PJCF 4UQ2A 5MEOB 4OV6F 3AY4C 1V3JA 3KVDD 4L3EB 5IVXB 2ERJC 1LEKA 3OVUB 1XGQB 3ARRA 1BFVH 4Z7NE 4WWKB 1F1DA 5A2AA 2G4EA 2J5LB 2Z8RA 3NOIA 4UQEA 5JQ6L 4CN6A 4FLHA 3UACA 2WNGA 3OAZH 1B6DA 2WUCL 2BSEA 4IGBC 4X0KB 1CD1A 1RI8A 5IBTH 4MB1A 2VDQB 1A7RL 1X5LA 1U30A 1PAMA 3SJVA 4N2OA 1TZGH 1EVTC 1EBAA 3QULA 1CZ8H 4FGMA 4R96B 1MY7A 2YSSA 1DBKL 4G2AA 5E6YA 1C5DB 5E1AA 3BP4A 5DK2A 4G1MB 2BJML 4BIKA 1DCLA 4MNHA 4GAYB 4Y19A 1UWEL 3HUJE 3MA9H 2XLLA 3E1ZA 4ZOCA 5IKCA 1FYHB 3OKOB 3FUEA 2WO4A 5AW7B 1VEPA 1VLXA 3F05A 5AAWA 3B5HA 1E4XL 2DWXA 3MRMA 4P9HL 2V7NA 4QRRD 4JREB 4O51A 4YHOL 3LZRA 4A39A 4FQCL 5HSFA 1RFDL 3WGVB 1RIVH 3NJHA 4FMKA 4I18B 1MW0A 1C1EL 2FQGA 2ICEC 3GMNB 3MFFA 3TCLA 4C4KO 3UTTA 1TEYA 3KLHD 2OR8A 2HLFD 5CIPA 5AZEL 2RAMA 2BVPB 1P84J 5BZDB 3WTUA 5LN8A 4WGWB 5IROA 1W72A 5I17B 2XG4B 4Q9CA 3O0LA 1AIFA 1QP1A 1ZV5A 5I1HL 3LQAL 2J71A 5JPMC 4TVPE 4P57A 2VUKA 5J57B 4ZMNA 2WNKA 3SE4C 4WU5A 1PZSA 4FXLA 1DP0A 4O02A 4QHLA 4CU6A 3FTSA 1QBLH 1C16B 1QLRA 2FSEA 4FFYA 4U7MA 1MWAA 1E9QA 2EDHA 3DGCR 4JY4A 3AABA 5AWNL 1R3HB 3TNNA 5IGXL 6PAZA 3UDWC 1DTUA 5D2NC 2NZ9C 4MXWH 1BJMA 4K7PH 1G6RA 3JVGA 3QORA 4CW1B 5JNYB 1EMTH 3VMOA 5TGBA 1A47A 2Z1KA 1MHPH 4ZFGL 1H3VA 2BVOB 2DQFB 4PJEE 4LL9A 3CMOL 3JZYA 2BS8A 5LB1A 3T1FB 1NDMA 3PFUA 4W6YB 1EDHA 4ETYA 1CTNA 4RCAA 2FLRT 1A2YB 1U8CA 2E59A 2KZWA 3MACL 4XVTH 4JFEB 4MQ7A 1J12A 3MRPA 4RSVA 3ZE0F 1RUKH 1DJWA 5IIEA 4PJ5B 4RFEB 4HH9B 1OIOA 3Q43A 4PS7A 1CXFA 1LEGB 3KPNA 1OTUD 1UACH 2X12A 3OG6B 1HSAA 1NOFA 4FKKA 1LEIB 1YNLL 1XIWC 2PWDA 3ARYA 4PGJA 3BAIA 1AGCB 1NCTA 5GRZA 5HGDA 1UXMA 3CN1A 1I8UA 4K8RC 4YDIL 3CK0H 3ZKXB 4YSEA 5HXMA 1D2PA 2AXFA 5JIHA 4FA7B 3V0GA 3RX9A 5F6HJ 2RALA 4JCMA 3HE6A 4P2QE 3ZSTA 4QLRA 1DBAH 3P3RA 5F8QC 3MBEA 3VGDA 3NIGE 2G5BA 1VFBA 4NFDA 3LKRA 5T33H 1CXLA 3QUYB 3TO2B 2CBQA 2QGCA 1TQTA 2GTZA 4KPHL 2J44A 1TJXA 1GVIA 4DEUA 4UV4L 4XXCA 5LGHL 3K5SA 4HX1A 1GIGH 1Z9MA 2OYMA 3ZQWA 4FN0A 4XHJD 5L6YH 3KBEA 4PJ7E 2C26A 3LN4B 4AYFA 4NXSA 1G7PA 1URZA 3NQIA 4Y9FA 4AZ8A 3GBEA 3WJJC 1F45A 4B3VA 2D03H 3V6BR 2X70B 1KV7A 3CH1A 5EBWB 4CA4A 3HAEH 1Y1UA 1GKEA 2KERA 3T6VA 1OTSD 3ZTDC 1AS8A 4MD5B 3GRWA 1RIHL 3ULSA 4NM4L 1I4FA 4XMUA 3CMOH 1RUQL 1J8HD 5BXFB 2WVVA 4BELD 3HMXA 4UIMB 5DYFA 3ZX1A 2J6EL 1YHPA 3II1A 1HNYA 3SBWA 4HIHA 5DQDH 3O81A 1M6UA 1S9WB 1PG7X 2Y24A 4NCC1 5C0GA 3UTPE 5JOFA 3CXHJ 4NXKA 4G5ZH 4WDIB 1FNEA 4X4YB 1AQ8A 1KYAA 2LQRA 1LEGA 3KPNB 1BVLA 5GGRA 4CVWA 1HSAB 3G6JE 1LE9B 1RUMH 1Q9WA 2H6PA 4HQQH 5JQHC 2YAPA 3F8UB 4X7TB 4M7JH 4FNLL 2CDGA 1T1XB 2OQJB 5GGSB 2OXGB 4AH2A 1F5WA 5IW1A 1F3RB 3P4MA 4OTXL 2FEEL 2KH2B 1S7TB 2F53A 1OQOA 2BXYA 4EOWL 2W0FB 4IKIA 4PU2A 1CXIA 2CHZA 3QB7C 3BDBA 5JOEA 4QMEA 1D5IL 2NX5E 2WBJC 2YUWA 2WMPB 5H37G 1OAUL 3GXTA 3Q01A 4AYEC 3VQLA 4S10A 5A3ID 2BIMA 2YN3A 4OB5L 5I6PA 1Q0EA 2BVQA 3TNMB 3UBHA 1A0QL 2BOLA 4LSRH 3MV01 4LEXH 3NFNB 4RZCB 2D03L 2VN4A 2DF3A 1ADQL 1AJ7H 3GSRA 4BFRA 3BVDB 3VWJA 4N2MA 5D6CB 2PYED 2WYHA 2Z7YA 3GZKA 3HBQA 4W9CC 1Z9PA 4CMHB 4TSCH 4LCCA 4H4NA 3KLDA 2VXQL 3PNRB 4AE1A 3HBGA 4WW1B 4YBQC 5E2VH 4ZFZB 3C75A 4WI4A 3WE6A 3VDAA 3S96A 3I6LE 3THMH 5JPNA 3FFDB 3GXMA 4JKPL 1MJ7H 2P4AB 2VW6A 3EJYD 4K5MA 2ENJA 2ZP0T 2ZX5A 4KQ3L 1XGRA 4HS6B 4AGOA 5DMJB 3KH3A 5GS0C 4FCAA 1KIQA 1FZKA 4LE8A 3DHUA 2ZP9A 2WLJA 3FFCA 4IGBA 4AQ8A 3ROOA 3RWFA 1AFVL 1RZGA 1XCXA 2VJ0A 4NJ9L 1G6RL 4L8BA 3UZQB 4OI7A 2OYPA 4B9JA 4OT1L 1NMBH 3BPCB 1PG7H 5JW4R 1XIWA 2H3NB 3NFSL 1AD9A 1XGUA 2LAAA 3GB7B 2BNQA 1UJ3B 4MB5A 5DWUH 5GQBA 3WKYA 2IEPA 5LDUA 2ZOKB 4N0RA 5BO1L 2FYYA 3D07A 5DQJB 3MZGB 3CFKA 1F3DJ 3CFEB 1HN1A 3MV9D 4KKBC 4UM8A 5EOTB 2E76C 2HTLD 4I1NB 3BQUA 2MSPA 5IB2A 4F9PC 5I1HH 1JZ2A 4LCWB 5B1KA 4Y2LA 4XO5A 1YN6B 4Z7IA 4XNMB 1GC1C 1C5BH 1T0NB 1BZQK 1T20A 3ZDXF 5IV2B 2AI0L 3LCYA 1PKQB 2GK2A 4I2XE 3VMNA 1R3LB 5E9AA 3WS3A 4G43B 4I2XA 4ESKA 3D39D 1UT9A 4FNSA 2ZUWA 3UZVB 5D7EA 5FKAB 4Q0XH 1G6RB 3QORB 3JWDH 3SE4A 4KKQA 1BF2A 3OF6D 1Q38A 3VFPA 4XC1L 1VERA 4OFVA 1CR9L 1HL8A 3D6GA 2FEEI 3NIGB 1LLAA 4NDMB 5BZZA 4FQXD 3HPLA 1JNNL 4KMTL 4CKVX 5FECA 1B0IA 3QXDA 5J6GA 4AQAA 5F7UA 4PHXA 2EXTA 3RWCA 5D7LA 1YN7A 1WH0A 3L95A 1NPUA 2DYSB 4P5KB 3EGSB 1PLGL 1XF5A 1NCBH 3L1OH 5MP6H 2HTLC 2DMGA 2WKOA 2X89A 2EYSA 3MRQA 4H44C 4TSAH 4XMLH 5T3ZH 4PY8J 5B8CA 1QAWA 3GQFA 4N0UB 2B5IB 4AK2A 2COQA 1AR2A 3RVXC 3SOBH 2WKOF 3MRIA 1WK0A 4KUZH 4XO8A 2XZQL 2VERN 3SE8L 4WK0B 5DSCA 3QIUC 3VXRB 1BFOB 3TO4C 4EI5C 1NH6A 4ZT1A 2VMEA 1RUPL 3G5ZA 3WFDL 1XF2B 1IBFA 1GKOA 2NY3D 2YA1A 4NN6B 1PZBA 3HC0A 2DWSA 4PJ9B 5CD5C 1UM6L 4QOKD 1LDPL 5EUOA 4XE5B 4E2OA 1WSST 4FOMA 1AHWB 3I50L 4BXSV 4ZDHB 2A9ML 3MBEC 3SPVA 2KZBA 4PJCA 1N0LB 3RG1C 2IDFA 2UZXA 3EHBB 3OKLA 4ODUA 4R84A 4Q2ZB 1SUJA 1O5DT 1Q90A 1XV8A 5E6IC 3T6XA 3JWDL 4N68A 1UC6A 4OIBA 3ULUE 1B3IA 2WUCH 5IHUH 3FQNA 3UC0H 3UZVA 4NUPA 1AAJA 4LDLB 1L5GB 1OP5K 2WINB 5CSZA 5ESQA 1TKWA 5T8IA 2PYFB 4QRUA 1OQXA 2BNUB 1GPOH 1K3ZA 5AW1B 3LXBA 3P02A 1KIUB 5DQDL 1JZIA 2X6VA 1KT2A 2L8AA 2PXYD 4TUUA 4WEMB 4WI8A 5FM8A 4WV1B 3GSQB 4FNTA 1ZHKB 3CV5A 4HX1B 1BG9A 3IXAB 2CDFA 3VFTB 2BIPA 4JRYB 4MAYC 4YNYB 1VGEL 2CMRH 4MLIA 3WBDA 5BV7C 3J07A 4Q7DA 1XH2A 1YMME 5DR5H 1GHFH 3EFOA 32C2A 1AO7E 3HI1B 1ECZA 4P2YA 3PP4L 4S1SH 3RWHA 4PRID 5GJSH 4TOYH 5KYXB 3RZCD 1BFSA 2CKBH 3CHSA 3N43B 1UASA 4LOFA 4NQSA 5I2IA 3QDHA 1E5ZA 4F2EA 5I1KL 1CGVA 1QD0A 4FQ2L 2F2HA 5L4MA 4LLWB 1AGEB 1ASOA 1UM6H 3D50A 4N85A 5I8CB 4K9JA 3K4AA 1AS7A 2WB1A 1K3IA 2X2JA 3QXUA 4QI3A 4I3SL 1HOCA 3NJXA 4A6YH 4NUJB 1FNHA 2WAHA 3GSUB 4ZZFA 1XBDA 3GIZH 1J0KA 4OCWH 4UF7C 3K8MA 4G9FD 4WO4D 3VFMB 1EQWA 1J5CA 5FV1L 5LNGA 3K1DA 5KVDE 1I7ZA 1A65A 4Q6IA 5CEZD 1MFEH 5TF0A 3D3VB 5H94B 5FWRA 43C9A 3FO2A 2OMUB 3L3GA 4WF7A 3ALWA 5KSUA 3VYPA 4WW2F 1Z5LB 1DO5A 2OX5B 3EW3B 3FU7B 2FUQA 5B39B 4JUTA 1A1OB 1BXVA 1KFGA 3BGFB 1SDYA 2LTQC 3OXRA 5C08B 2R2CA 1WS7A 3O2VH 4JFQB 1AZCA 5CN2A 1XR9B 4KRLB 4LCCC 3WY4A 1GGBH 3FZUC 4AIEA 1RUKL 5D2LF 1JGUL 5KUMA 2FWUA 3MO1B 1OSYA 4KNTA 4U05A 3X3GL 1BX2A 2OTWA 1A4KA 4AJWA 1MVUA 3VXTA 2GJPA 1T0OA 4RZCA 4YWGH 4PJEF 1P4UA 1XGZA 2NNXA 4HEME 4KRNA 4AT6B 3EO9H 1NICA 1FVCB 4Z7WA 3D09A 4JFDB 3QJFA 1OPOA 4J4PD 5BOPA 2L4OA 2WTRA 5FOBB 5KVFE 3K0WA 2CRYA 3CPLB 4XAKD 2H4EA 3OB0H 5D1QC 1ZE3H 4JFOA 1D5XA 1GSMA 4CBPA 4PRNA 1G7JA 4YSSA 4FTVA 4LSSH 5PAZA 5I76A 2MOGA 4D9QE 1GGTA 3QDJD 1T7YA 2AQ3A 2ZX6A 3ROOB 2VR3A 5B1JA 4LCWA 3ECWA 3V10A 1U8OB 1JXKA 5GHWH 1OF0A 5D1QE 3NA9L 2ZQKA 4RGOL 2ARJQ 2AI0H 3LEYH 4G6KH 1NBYA 4OZGE 2F58H 3HUJA 3VH8B 3UZQA 5KYWB 4AG4H 4OZFH 3VAEA 3EYOB 5PCYA 4Z8FL 1HT6A 2KQNA 2OSYA 2XXGA 4I0PC 4G7VL 4YSPA 1OOWA 3QWRA 1U58A 3SGKA 3JWOH 3DV6A 3QNYB 2MQCA 3RYMA 5DQ9A 2B59B 2HFGL 4O00A 2BLFA 3MFGB 4C83A 3VD4A 3HMWL 5SWZB 3G5VA 2ORBH 3LQAC 4JDTL 5FYKL 3T1FA 2F6AA 3O6FD 3L81A 5CN3A 5J6GB 2ZXBA 3PYCA 3GSNH 4KUCD 4JMNA 2IIJA 3O2WH 2X4PB 2XN2A 2PPFA 2HCZX 4BE6A 4X5XA 3K2KA 2D8KA 5CILH 1B0GA 3KPRE 4P23B 4NB7A 4JQIA 3T4YA 3OL2A 4LPWA 2HAZA 4D0DB 4PS3A 1HCZA 5GS0H 1UACL 4ZK8A 4MNQD 4NKDB 1A7NH 1RZFH 3ZTJG 3CSFA 2IQ9L 2FX9L 2WANA 3Q5YA 2FYVA 3LNGA 4IRZA 5DJYB 1KEGH 1NQBA 3E2HC 1YMMD 3LKRB 3BWZA 1CN4A 3T2OA 1XF2A 3VFUA 3A21A 4GUPA 3P0VL 4X80L 3H2QA 2WWOA 4ES9A 1VHPA 2DDQH 3MROB 5GHWL 5HYJD 1BYPA 2A0LD 1SXSA 3STBA 5IQMA 2CIIA 4WCYL 2IALA 1A7BA 2XFGB 3TO4A 3X1NA 1C5DA 2N01B 5E1AB 2ZUQB 5DS8B 1SEQH 4EDXA 5C0FA 2Q7AA 1MRFH 2WB7A 3NRFA 4Q2ZA 4PJBF 5D72L 5F9WC 4ODSL 2BY0A 4L0YA 1JK9B 1KJMB 4ZYKB 3QZNA 5E5MB 1DBML 3HG1A 5AW9B 4DUWA 1P4LA 3B37A 5F0LB 1JWUB 1MFCH 4ANKA 1BQLH 1TVDA 3MBXL 4LLAA 2CPUA 2HVBA 3C8DA 5IG7A 1EEUA 3ARED 2XZZA 3EJUA 4JUSA 4FNUA 1MJ7L 5IMKB 2MNWA 2QTEA 3SPHA 3V4PH 3MRCB 2G5UA 3V0HA 3QUKA 2OV0A 3MKKA 3EDKA 3RKPA 5J3HC 3BKMH 3G3LA 2G2RB 2UY6A 1MLBB 2J6EH 4LDOB 4PJ9C 2DQJH 5CEXB 4AEIL 1SHMA 1WITA 4DSYA 3ZVVA 4E5XG 3T1WA 5D6DA 4QTIH 3TCTA 3WHXA 2ZOTA 3WN5C 1O7SA 3OJ2C 4CDHA 3IDYC 4NQDD 3KLSA 3ZO9A 2GJ6D 1D9KB 2VLKE 1A6AA 1I7TB 3N42B 3KLQA 2A0LC 2JCWA 1XH0A 5H2BB 4X7TA 2PWGA 4D0DA 2Y7MA 4JFHE 4OLVH 5CEZL 1HVXA 5FGRA 5EBMB 3R1GL 2QQNL 2ZWKA 2WQUA 3LZLA 4PJAA 1XGPA 5F96L 3PHQB 3WXVH 3DXAB 4L2LA 3MREA 4PG9B 5F1NB 4C58B 3VFWA 2YXFA 2ZCHL 1SOXA 1TZOA 1UB6A 3MFFB 4PEEA 2VC2H 1GTFA 4IHOA 3D18A 3LKNB 4D0CB 3ESPA 1JD7A 4X9BA 3HKZA 4M7KL 2R9HC 3MYJB 3NCEB 5E4AA 4XB8A 3B3BA 5ID0B 5I19L 1F56A 2EC9U 1A5FH 3MX0A 4PUBL 1AKPA 3GIZL 3GSVA 4TNWK 2H9GB 2HKAA 1YEFL 1ZHKA 1VZHA 3B4NA 3LY6A 4L8DB 4OB5H 3RGBA 4X9GA 1A9EA 4PGZA 5DC2A 1M7DB 2HX8A 1E4KC 3DJZA 4WHDA 2CR3A 2OTPA 2DIBA 4HT1L 2YLHA 5HYQB 1WEJL 1ZWIA 1MI5E 4Q97A 2DH3A 3HCVA 4P5SA 2IC2A 3BKML 1T7WA 4FQJH 5EZJB 1JI2A 1CIUA 1CK0L 4OCXH 2PCPB 1J7VR 1MHEB 1NCUA 1OL0A 1QLEB 3VO0A 4CVZB 1A6VL 2Y06H 4Z7VA 3GNMH 2RMNA 4POZC 1FNSL 1WBZA 2DBLL 5DVOA 1JGUH 2E7BA 1F6LL 2Y4SA 4AIOA 3WFBL 5EEZA 3OKKB 3VU1A 4BFGA 2HRPH 1JXDA 4PRIE 4OGZA 5ANMB 4AITA 5ICYA 1EAPB 2F1AA 2VXTL 5DA0B 4A2DA 4BK8A 1MW2A 4BD4A 3MR9B 2BHYA 1QLFA 5AZ2H 4KUZL 2EIBA 2G75A 3LKPA 4EIGB 1S78D 3MRDB 3T9WA 4UM9B 1H9DA 4Z7UE 1LE5B 5KSBF 4H0HB 3VA6A 3RURA 4PVNA 4KO5A 2X42A 1RVFL 3L48A 5TDNA 3QUZA 4N2EA 1IQWL 3S37L 2DZEA 3EFFA 4Y4KC 2PF6A 4GRLB 4PWJA 2ZOUA 2OR9L 4P2QD 3BX7C 4DEPC 1TPXC 4UBDD 1WTGT 4OFQA 3N41F 1R19A 2VW4A 2QPDB 2A9MH 3RA7H 3D69B 4DKDC 1YEFH 3LXUX 3ARBD 1X44A 1MVUB 2W9DH 2FH8A 3MX0B 1FORH 4OD1H 5DJ6A 3FW6A 4MA8H 4NO3A 5DRXB 5FYJL 2HMID 3KWWB 1AQDB 4HT1H 2OMNA 3C6LD 3LEYL 4FMFA 3ZKXC 4A66A 3V5HB 2HFFB 3EYVB 2C9QA 2DQGL 1Q9WB 2ZOLA 4PD4J 1A6PA 1P2CA 1BVKA 3HPJB 5C0BA 1K72A 1DJHA 4E41B 3W0WD 5IUSA 5CO1A 2D73A 5EULV 2Y06L 3P4OA 2ZXAA 2Y7QA 4HIIB 4ZXBD 2WK2A 1TTGA 5EZJA 2B59A 2J1WA 2DQEH 3BEWA 3HMWH 1DQJB 1YAZA 1FH5L 5CLTA 1E27A 1IM3A 2YFOA 4MCYB 5ID1A 3PWPD 2W1NA 4R2GC 3MODH 1KN2L 2ENQA 1WWAX 2HLEB 1FZJA 2A9DA 4LHQB 4MJ4A 3BAJA 5AOZA 4WEEA 5KOMC 2BSTB 3CN3A 5JORB 4X5QA 4R4BB 4TLUA 5J8OA 3QZBA 2CKBL 2EDYA 3A3YB 4KTYA 2WLYA 1M71A 1N2RB 2J57A 2X1OA 5H4YA 3H4FA 2NOYA 3P11L 2OXHA 3VXUD 1A9VA 4L3AA 3DTXA 2EJ1A 3IJYA 3QC5X 2F8XC 5KYWA 2DY2A 2NY7H 4X7SL 4FQQA 5KBDA 1N5AB 1QSVA 2BS9A 2R2BB 3VX0A 1FC2D 4AI7A 1DANU 4GW4A 4OI9A 4QHNA 4FDWA 4XCFH 3FQTB 4PJIA 3FQXB 4HK3J 1KGIA 2GSIA 3VYOA 4YN3A 3S3CB 4R0LB 5FYJH 4ABQA 5I1EH 1OCWH 1M6OB 3B2PA 5C0AB 3HC2A 2DMBA 4WJ5B 3D39E 4XH2B 5C0CB 1G94A 2C1OA 3QHTC 2EVGA 6CGTA 2XUWA 4OF5A 3KEHA 1ZJBA 3O8XD 1DYZA 1XL6A 1P5VB 3HHRB 5E56A 3VD7A 4BZYA 1OB1B 2R2HB 3CU1A 2CHWA 3HFFA 4MD0B 3A4AA 1CLOH 1AGDA 1ROCA 2CKBB 2WQSA 2X9YA 3II3A 4KHXL 4MDJB 4AC4A 5GPRA 1L5GA 4PJAF 4PLJC 5TE6L 4MCMA 4LOUD 2FBJH 2DLHA 3FU8A 1P4BL 2FYYB 4BSVB 2ZOWA 4UILL 2LU3A 2X3CA 1BHGA 5CEXA 3VRJB 1QW9A 4UT6L 2K4WA 3I85A 3PQYD 1QKZL 3N04A 2OMZA 3EF4A 5EO1B 4TUOA 5E7BA 4Y1AA 5IT2L 2D7TH 4WWKC 3QZOA 1DVFD 2Y5TB 3RPBA 5CBAA 4LLQB 1MJ8H 4WEUD 4YHIA 1P7QD 2DWYA 1CICD 4LSDA 4IOSA 5I1LA 1OCCB 2OW6A 3GHPA 2K8QA 1JPTL 3PLYA 4OM0H 2NTFA 1AGEA 2Q2EB 1WZMA 4LKCA 2CA3A 3B5TA 2MCG1 1F90L 3BE1L 2VZUA 5I1KH 3RWEA 4D9RE 1H3WM 2Q5BA 3U0WH 5IB3A 3UOAB 1KGWA 3HPLB 3OX8B 5IESH 2PWHA 3FQ1A 2X53A 3F00A 3GMRB 3NA9H 4RGOH 4Z9KB 4HLZH 1F3JA 2YKLL 1BFVL 2D9QB 4YS4A 3DECA 4G6KL 3QHZH 4HK0B 4IU3A 4AG4L 2DM7A 4C56B 5F7DA 4MB3A 1M7IB 1NCCL 3KPMA 3H0TA 4TQEH 3PAVA 5BJTB 1MIEH 2CALA 1N6QH 1MNUL 2X70A 4IDJH 2KI6A 3JWOL 1HC1A 3DXAA 3QDGB 3D4GA 4ZTOL 3BDYL 5T1DL 3VFWB 1G4MA 4Y5YA 4B0MB 3UX9B 5B39A 1P4BH 3L3IB 1RUQH 3QJZA 4LPYA 2WVVB 3RTQC 1OGAA 3PGCA 4J5VA 3OHXC 3O4LE 2Z35A 2AF2A 4ZUVB 3RTQB 1ZEAH 1OVZA 3RDJA 3TO2A 1JZGA 3C2SA 4M7LT 1G9NH 1HEZB 2F19L 5DD0L 5DZPA 5TFSL 4EUPG 3BPLB 3VI3A 3X12A 3FUKA 3FMGH 2CO7B 5T1KD 3B2VL 4GQQA 2XWTA 4N9GA 4TNFA 1RUAL 1ACCA 1NFDF 4RVBA 2I9LA 3BUPA 3W9EA 4OCRH 5ETUA 1LK3L 2CK2A 1W0VA 1YEIL 2G3ZA 4LLQA 4HPHA 2NY1D 1RIVL 2NZ9D 2ZKYA 2V8MA 1A8JH 1BPLB 1DUYA 3D85D 3BUDA 3IMWA 3FT4B 1GH7A 4UV7L 3GEWB 5AYTA 3U4AA 3BVNA 4BGLA 3HZVA 4GKZB 5IESL 1YEKH 3JV4B 1LMKA 2Y36H 3EGXA 3DX7A 3L4VA 1GY2A 4XPTL 1M3IA 4BV1A 4RMUA 2WM0A 4PBXA 2LU4A 3MUY1 3L4XA 4FG4A 1IGCH 5EMYA 5I23A 4OD1L 3JTBA 2QMKA 1OCZB 1H5BC 4LVHB 4AGMA 1CFSA 3ARXA 4TNVF 5D71H 1I1AD 4FQLH 4NKIL 3MV8B 3V4LA 3FHAA 2ED8A 1NC2D 4HC1A 4EDWH 3IPFA 3A47A 2QGEA 1W8NA 5DEJA 3SGKC 4OCNC 3W39A 4P5TB 3GMOB 1GOGA 5IQ9B 5KJRH 4E41A 3MOBH 4P3DB 4ZUSA 2X0UA 4OV5B 1KTRL 1FG9C 2O72A 2F1BA 3BLBA 3WIHL 1EXUA 2VW7A 3PGCB 4LO9A 2I7SA 1XB3A 4JM0A 3C9NB 3K4ZA 3DOHA 4LVOC 5KBLA 3NJLA 4IDLA 4EXKA 3SJVB 3CFMA 1I8IB 4TV3A 4WK4B 1IAIH 1VSCA 1OANA 3ZMRA 5FB8A 1D6VL 2MH4A 2Y9RT 1IC4H 3UDWA 1IQDB 1IX2A 1DQLL 2VLKD 2QVKA 3RZWA 4JQXA 4ADIA 2Z93B 3L5WA 4PJFA 3V9FA 4EJ1C 2C3WA 3OAWA 4OCYL 1DBAL 1I31A 3ZKQD 3NFSH 2WWMD 5GRVK 4BZ1L 4Y4FA 5B7FA 1I3VA 4PN6A 1JV2B 5IF0A 4DTGL 1QW8A 5ENWA 1WF5A 4LLWA 3VU2A 4FJZA 3SDXE 4ZMYA 3DX1A 2ETWA 5FHBH 4AX3A 3C2AH 4X4ZA 4MCYA 2WXIA 5L6YL 4ALAH 2CM6A 3OQ3B 3UCRA 4U0RB 4N2HA 5D71L 3ZRSA 3VXQA 1V7NL 2WY3B 2R83A 1MFUA 3FU6A 1HWGB 1OP3H 5J6HA 1QPXA 3QO0B 3VFMA 3SYCA 1FZJB 2R69L 2ZD0A 1MQ8A 3S6CA 1YYLL 3NQKA 4KK9D 3VSUA 1EEYA 1HOEA 2OMUA 4UI2A 2A9NH 4TQIA 1KN4L 4LCIL 5D72H 1FNAA 2J55A 3QJFB 4OLYL 4N0UE 3DHMA 5C09B 3WU1A 2IDCA 4IIQA 1EXUB 3SDXA 1ZS8B 1IAKA 3UG3A 4WI5A 2ED9A 3LXCA 4AQEB 3WV0A 2N0KA 2NLJB 2W0PA 4UQDA 3BD3A 3MV7D 3O6LH 1B2WH 3MO1A 4R0LA 4H20H 1BX2B 4RQQB 5KAQF 4L8SA 1ZA6A 1PX4A 4LGSB 1VA9A 3SDCA 4M7JL 1JWMA 4FNLH 1XZ0A 1TTRA 5E8EB 1YEHL 4I88A 2K78A 1A6AB 1I7TA 4O2FB 5FOJA 1RVFH 3IMTA 4AQ1A 1FZOA 4EOWH 4GFTB 1W2KT 4U6XB 2OMBA 2WKGA 1E4XH 3MLTA 5BRQA 4DP2X 2VISB 1VPOL 3BN3B 3KE0A 2RGSA 4JDVA 4I3GA 4NKOB 1MCPH 4WSKA 3M6DA 3WTVA 3LKSA 4HIXL 3HE6B 3O6MH 2XWDA 3FYIB 4UOJA 4AV5A 1R34A 4XPHL 3RA7L 2ITCB 3HOGA 2H32A 4P07A 1WUZA 3KDPB 3EKCA 4MA7H 2APBA 1JL8A 3BAEL 2AJZA 1CL7H 1Z5HA 4RA0C 3P4NA 1V55B 3MNDA 4CC4C 2R69H 2BP0B 2Z8SA 1OGSA 3UBGA 3KPQA 2DQGH 4YXKL 1F11B 1NCWL 3VI3F 4F3FA 4FCHA 2Y5TA 1BXUA 2DWTA 1GJIA 5E5UB 3WMPA 4BSJA 4OGXL 4R8WL 3CVHL 3FQNB 4AW4A 4MBOA 3NZUA 3IK2A 1I3GH 2YGNA 3KYAA 4JCLA 4HAFA 1J8HA 2V5RA 1OGAB 4UIMA 1WEJH 2XJLA 3KS0H 3ZKNC 3T3MF 4YHYC 2WOBA 4LCVA 5JHDA 3DKHA 5IW3A 4KQ4H 2IQAB 3AG2B 3T2LA 3NJIA 1S9WA 5HVWA 4PJ9A 5I15L 4WV1A 1P7KB 2BIQA 1BQHG 3KVPA 4N5UA 3OAZK 3DO4A 2XWTB 1DJSA 3MQIA 2WZ0A 4J3TA 2I27N 3BESR 4HV8A 1VPOH 2EYTB 3WIFA 4GG6B 1JTTA 3CSYA 3MNVB 1MCIA 1UT2A 2I9TB 2O6FA 1HCVA 2IV8A 1JYWA 2CZNA 4OIAA 4Q89A 1AR1D 4GKNA 4DP5X 3QFJB 3K1KC 3VDBA 1CL7L 3L3IA 2WQVA 2R0KH 2FRGP 2GBUA 2YEZB 1KENH 1T21B 4MD4A 4R83A 4JZJC 2BWQA 1OTUC 4OGQC 3CVHB 3IGLA 1VCAA 3LB6C 1RZ8B 1J0IA 4YNYA 3U7YH 3ZL2A 2EXYC 2WVUA 2BP0A 2FQDA 3OZKA 2DD8H 4X8GA 2IH9A 4G8GB 1NANH 1X7TA 2EDFA 3QISA 3OKNB 1WZLA 2VQ1B 4J3XA 1F8TL 4HH9A 4N2IA 3KM1A 2VIRA 1ROWA 2NY6D 4EDWL 3US0A 4WGKA 3T0BA 2QADD 3I3DA 5I73B 2NYYD 3D34A 1AZNA 1BAFH 1G4RA 43C9B 4P4RB 4JN1L 5T3XD 1IGMH 1TTCA 3M1BB 1DL7H 3VJ6B 4WI0A 4ZQTA 1CR9H 3LIZA 4QY8B 5GGTA 1KGUA 3BQUC 4I5BA 3R8BB 4YH6A 3OXRB 3TESA 1GCFA 3DX7B 1HXYB 4P2RB 4K71C 2JELL 3DMMB 5D4QA 1JGVL 4GKZA 4Q74A 2W88A 3CDCA 3TBTA 2C3HA 1KFAH 1WO2A 5IBLC 1OAQH 2D7NA 3FQ2A 4BDVA 3SE6A 5AVQB 1J11A 4OZHA 4X50A 1XGRB 4HS6A 5AEAA 3T0ED 5IFHL 2VDML 3ILPA 3QJVB 1ZSDA 1CE1H 3MLUH 5AKVA 4AYMC 3D2UA 5C07D 1S3RA 1KPVA 4GFXA 5F1SA 2XZCH 2HVJA 3LQZA 1PX3A 2B15A 3SE8H 4BA0A 4FLQA 1RSFA 2D0HA 3FULA 4OCYH 4AZ8B 4B9KC 4L4VD 4GS7B 5TTRA 4AKPA 1RQ5A 1AHMA 2EYRB 1NEZB 5DC9B 4C4BA 4DWHA 3PJNA 2EDNA 4DEPB 3P11H 5CXPA 4Z7QE 1T6VN 5HHVH 3T77A 4UTAH 3HZ3A 4Q9QL 3U7YL 1A7OL 4RRPG 4GIAA 5F1IB 2VLJD 3E2HB 3WDJA 3S88H 4KY1L 3FF7A 5K5YA 3CFIC 2XQBL 4ODVH 3QHZL 4M5SA 5F1KC 4PJXB 1HSBB 1PQZA 1M6OA 1ZANL 4YLBA 3VX1A 3UMNA 5AVSB 3CE1A 4F24A 2CHDA 4IMLA 4LB8A 2C1OB 3ARSA 5IM7A 2W60A 4BXVA 1BAFL 3Q9PA 3QCTL 1TJHL 4RMRA 3K72B 4CDGC 4OF8A 3BCDA 2R0WL 3ARGB 3MR9A 4MNQE 4GMTL 4B3EA 4HHGA 1AE6L 4QRPA 3EJCA 5F6HI 5D7IB 4FXGC 4Q6KA 4JNXA 3M1BA 3B9DA 4K3JL 3KPRB 2OXGA 2ZICA 2P3YA 3UYRH 1IT9L 1C5CL 2TRHA 2C3GA 3U0PB 5TDNB 1FYTA 1WA2X 1WVZA 2OMXA 2PR4H 5D7KD 5FW6A 4X0KA 2BVUA 1EANA 3DMMA 4NO5B 4ZNEA 2VAAB 1TFPA 4AK1A 4AQAB 5TE6H 4OZHB 5E95B 1WDAA 3G7TA 2ISDA 4AEHH 4AEFA 2A73B 4NERA 3RVVC 4YHML 2NX5B 1KB5H 4FG0A 1FGVL 4ATWA 1H15B 5BW7C 1OSZA 4JGNA 1H6EA 3FONA 4OFDA 2EDKA 2DLGA 2IAMB 4HJGB 4QRTB 5G55A 3WJMB 1IMHC 4BZ1A 1KPUB 1A4CA 1QNZH 4UOW1 1UA7A 4Q9QH 1UXWA 2Z1PA 2XVLA 1EXGA 3LNIA 4X6CB 2XQYK 5K9JL 5D7JB 2P46B 3VFSB 1G7IB 4ZW7A 3W9DA 1L3NA 1HU8A 4PGDA 1IGCL 3E6HB 3GLDA 4U6HB 5D70L 5T3ZD 5BZDA 1F0LA 4JRYE 2MPAH 3QDME 1TZAA 3SDDB 5BQ7B 5BRZD 3L2MA 3N0PB 2Y22A 3NCYP 4OGAD 4HVBA 2CDEA 1D9KC 5CCHE 3U6XS 3T2PA 1B3JA 4HK0A 4JO1L 5K39B 4DN3L 1BXXA 2WJ5A 3VGAC 1N3NB 3ZT7A 3WHE0 4X5XB 4U6XA 2DH2A 2DKSA 2FJHA 3BGAA 3LOWA 2ZG2A 2B4CC 4A2HA 1S9XA 2ADJB 3GSOA 3FH5A 1Z1WA 2V7NB 1U8MA 4NAQA 3QIWB 1SYSB 4CSZA 2QVIA 1GC1H 2ZYHA 5E6UB 4P4KA 4ZO8A 1WS8A 4QRQA 1UM5H 3SO3C 1JNNH 2AV1A 1U42A 4YHMH 4BUGA 2VAAA 2Y6SD 3ARBA 4UTAA 3LIZH 3CFEA 3BKYH 5TD4A 4W81A 2ZSWB 5CD3B 3FH7A 2CJSA 3EJZC 1QO3B 5KUKA 3FB7A 3TWCH 3CCHA 1AS6A 4U1LA 4ZI8A 2YR3A 1UUSA 2APXA 2FJUB 5GS0D 5F44A 3QPQD 3BFWA 2APSA 4GBXB 3RX8A 3SDAC 3EOTL 3RGVD 5K9JH 1WCBA 5EHFA 4X6DE 1D6EB 1DSWA 2YBRB 3EFOB 3ELAT 4LSTL 3Q8EA 3W56A 5HY9B 3EG9A 3NYKA 4QRSA 1DSFH 4HWZB 4PBVC 5F96H 2JV6A 2WZPD 2CBPA 3MJGX 1BV8A 1LK3H 3FT3B 3GK8H 4L4TB 2AMGA 4X5WA 4NQXB 1T80A 1I8MA 4JM4H 1S7RA 3AGVA 2XFXA 3TH2T 3GEFA 3RAJL 5BRZE 2XV6B 4LU5L 4JKWA 4UQ9A 3UJIL 2Z31B 1WZAA 2L0DA 4X6EA 1VF5C 5TF1H 2X7LA 4RDBA 4IOIB 2AXGB 1E6OL 4OH2A 4OGYL 4EN3B 5IOKA 5BS0B 1Z6JT 2DD8L 4MHHG 2C5DC 1ZPLA 3L9YA 1PIGA 5ITBL 3DX6A 3KLAB 5F7YC 5CR1A 3PAUA 4DGUA 1BXAA 2JQZA 3COOA 4ELMA 1XIWD 1YECL 2R1XB 2BPBA 4JGUA 1ZVNA 3UGEA 5BV7L 4XVUC 3FRUA 2BIIA 4DEWA 1MVYA 4PLKC 4MZ3A 1A6TB 3H2WA 1IEBA 2F54B 5D7SL 5I1CH 4UT9L 2IPKA 1I1YA 1B0RA 1SY6H 3HR5A 1UA6L 1I8KB 3RWJB 1FNSH 3QZMA 3NH7H 4YHKL 2R7EB 4ETQB 4CC0A 1QSED 1TCMA 4PWKA 5LN4A 5LNEA 3ZQXA 4XWGL 2VLJE 4L3CB 3HR6A 3CCHB 2ED6A 1IC5L 1WGOA 1K6QL 4MMXA 4F93B 4JL1A 3BZFA 4BM7A 2NXZC 5IB5A 2ZPKL 4CVXB 1AKJD 4Y4FC 2APFA 3D39A 3FUHA 4ATTA 4C56A 4L8DA 2YBRA 3OKMA 1T1XA 3AZUA 5GGSA 4F7MA 5HHPB 2P5PA 3CVIH 1PZCA 3FNKA 5D7HA 2ZAHA 1HXYA 2G0KA 4W1TA 4HUCA 5INDB 2DI7A 4I87A 5GRVL 2A77H 3CLFH 4WNQB 3EFDL 3OWEA 4UIKL 1KXVC 5DVNA 1AZZC 2VDQL 4ZPTB 3TT1L 3GXFA 3TVMD 2XQBH 1FGNH 2W65B 4MJHA 1E0OB 1TCRA 1HJCA 4A7VA 5CSBA 4OIFA 5GS1A 1BD2E 1ZRUA 1KIPA 3NSJA 2YAQA 4XMKH 3OKKA 4ZFOA 3SN6N 3FDWA 1G0DA 3LZOA 4JRFA 4PY8I 5BV7H 4TPRH 1TJHH 2ZXWB 2UWEF 1DVFA 2YD5A 1IFRA 4QHKJ 4B96A 3WSQL 5JIMA 4OLWH 5EEWA 1AG0A 3BSHA 4JFFB 1AIZA 3D52A 1H0DB 3ETSA 4JRYA 4HJUA 4Y16A 4A68A 5BVPL 5GZOD 5GRUH 3BPOB 2BZCA 1NL0L 4NC1E 4PREB 3OJVC 2I24N 3L9BA 4PCSA 2A9CA 1ERNA 5A16A 1CDUA 2XWCA 3LQMA 3QWRD 4MJIA 3KBHE 8FABA 3H9SE 3Q3GB 1AC6A 5L2KB 2F18A 1TPXB 4NIYE 4NI6A 4XMPL 4Y4HD 1R33A 2IANE 4NOFA 3BVTA 5CWSB 2VDPL 3S2AA 2UXVA 4K5PA 3X3GH 2QVFB 3L7FB 1V3KA 4NRZB 3OKEA 4ELMF 2GB2A 4YAQA 2WXPA 3FS9A 4XBPB 1B2WL 2QQQA 4PVMA 3RDTC 4MDIA 1SLWA 3EZ8A 6FABL 2AV7B 3BO8A 3CSPA 2OMWB 4PR5B 1EVUA 3PWUA 4LHUG 2OZNA 3MLXH 4OD3H 3RL1A 2V4LA 3K0YA 1J1XH 2VM9A 4XPAL 3JWNC 4Y88A 1PZDA 5DD5L 2VDOH 2ZOKA 3UAJD 1F2XK 3ABKB 2CUHA 3TEUA 3S35X 3IF1B 2QBWA 5IBLD 1T83C 3F7YA 4NWTH 3BEVB 5I19H 3NSYA 3MRJA 4FZEL 1IGJB 2AJZB 2BCKA 3EJYC 4GMSH 1BQ5A 5GRJH 3MN8A 4TPRL 3UEZA 4R7NA 3VXSB 4F7PA 1KB3A 5ID1B 4R2GD 2IALB 5F88B 3HG3A 2Q76A 4QKTA 5D9SA 3QI9B 4PJHE 1BFTA 3WKNA 1N3NA 3VI4E 3DPBB 1L7TL 5JORA 4L3FA 3V4VB 4W6XB 1E9QB 4L8BB 2Z93A 3L6FB 1XSOA 5E2TL 5DK0B 3GSNA 4JO4L 4XBMA 3U36B 3EUUA 5AYQA 4MDJA 2FL5B 5KVEL 4AXWA 3R19A 2IBZY 4X4KA 3HUJF 2WTRB 1AXSA 5EZPA 1NCGA 2X6CA 1SQMA 3D9AL 4AYDC 3H2PA 1DFBH 4UNVA 2ORBL 1WPCA 2D2CC 3TA3B 3R7RA 3VQMA 1CLVA 2AABH 4GW5A 5FYLD 4MAZA 1TR7A 2NY5C 3FQXA 3P9MA 4G9FA 4EIUA 1K85A 2VJXA 4JJ5B 4HEMA 1O6SB 5C0AA 1EEQA 1T20B 1SVCP 4AJ0A 5D1XC 3IMUA 3NEEA 1RL1A 1KG0A 1DVXA 3NSDA 5FF6B 1D5ZB 4YPGB 4AUUA 1S3KH 1QRKA 4MAYA 4YSDA 5EBMA 5HVHB 2CBOA 1UQSA 2Y3AA 3ECBA 3DARA 3AUWB 5TK2A 5HHME 3H7BA 4PVLA 1KCUH 3MXVH 1F4WL 2BZDA 2RFXA 4P5MB 5DHXB 5C6PB 5GJTH 1UFGA 2WXQA 1F4YL 1VFBB 4FRWA 1MJUL 4NQQA 1CFNB 3CN4A 5AZEH 1PDKB 2AK4B 3TJEH 3QEQE 3OMAB 1NGWA 2DDQL 4KKAD 3FCGA 5ID0A 3LQAH 5HYJE 4U1LB 4MMZA 5EPMA 2ZF8A 4ERSL 5M95B 2HRGA 4R6UA 1QWUA 2V9UA 3E6FA 1N18A 3MJ8A 1H6FA 3CFCH 2UWEB 4GRMA 1I9JH 5L88H 1JBJA 2ZUQC 5FUCC 3CN2A 4NFBA 1O9ZA 1WCBB 1KGXA 4U1KA 1QEXA 2DQEL 4YHIB 2ICEA 3OLDA 4MXWL 4DQAA 1NM9A 4M43L 4I5BB 3SKJL 1LL1A 2F54A 4GAAA 5I1DB 5DGRA 4DO4A 4PB9L 3EOBA 5ES4B 2PKDA 2GKIA 3EJPA 4ZQKB 4HFUH 3QXVA 4OJDH 5FW8A 5EBGA 4FQHA 4LARL 2BIOA 1WRFA 2WSKA 4PP2A 4B9IA 1RMFH 4N1HB 1ZE3C 4IOIA 2H2SC 4M61B 4WUUA 3TL5A 2CDFB 2NY4C 3EDDA 2DRUA 3B2DC 2O26U 4F7CB 2J1ZA 1MW3A 5LBVA 2XWBA 3LRLA 4AGNA 1M7IA 2GY7B 2RB8A 3CSTA 3EO1A 3Q1SH 4M5YH 1YA5A 4PW9A 3VYNA 4OLUL 9CGTA 4MAYB 4BGDA 4YE4H 1NUFA 1GGYA 1J8HE 3L3DB 2F5BH 3DETD 2B3RA 4U6YB 1HQ4B 1RULH 2FO4B 3FQUB 3G6DL 1PYWB 3QZWG 1DUZA 1SM3H 4FEIA 3B9KC 4OSUL 5GISH 3QDJE 3LV3B 1QHOA 5AENA 2Z35B 2PPCA 3BP6B 3I2CH 4ZAKD 5KYNA 2D7OA 2JIXA 4ZW3A 4IJTA 4KV5E 4W9EC 4IGBD 5EG6C 3TN0C 4DN3H 2F5AH 2KZ1B 3UTSE 3W11C 1FNGA 1EWHA 4BHUI 5INCA 2Y0SA 2YEVB 3K6NA 5D6CA 4KHTH 3ML9A 4O9HL 5GRYA 1RZIA 5EU4B 4GRMB 2BP8B 3H3PH 3LZFL 3WIIH 4CN1A 1BA9A 3HI5L 4OUUA 3WNOA 3OKYA 4DOHB 3L3OB 3IDGB 4QWWD 1YNTB 2JQAA 2VLME 3HE6C 2NXYC 3C08L 2XU9A 2Q8AH 2XIBA 1Z5LA 2OX5A 5CEZE 3Q7JA 5E99L 3RZCC 3U0PA 2Z34A 2A83A 1DJIA 1FYTB 3D06A 2O5YL 4JQVA 5I1IL 4Z78A 1MXDA 2CR0A 3BUBA 1OZTG 5E94B 5JPNB 1NGPL 1A6VH 3IGAB 2OMVA 1SJEB 2X4NB 3DXAE 2VLRB 1MH5B 2W81C 2NRDA 1AR1C 2EEDA 3AADB 4I0CC 2QLVB 2VITA 4OFIA 4U4IA 3VRIA 3KHOA 3GI8L 2XOTA 3AT9A 4DVBB 5I82A 3RGHA 2K9UA 2AEIT 2FZ3B 5CSGA 5AW8B 2IFFL 4AEHL 2JJUA 1XAKA 2AJXH 1G7PB 5HVGB 1KUMA 4PREA 3IDXH 3TZVB 1JPTH 1M7DA 1NJ9A 1KBGH 2YHGA 1J9TA 4LRNH 2IGTA 5D1XA 4LU5H 5FYJE 3K91A 4ZRGA 1INEH 5B3JF 4EO5A 3QCUL 1ML0A 3LS4H 4TL4A 1HILB 4LSPL 3HS9A 3S48A 2OR9H 1V27A 4I3RH 1U4EA 3C5ZB 1F13A 4WIQA 1G7QA 3MBED 5J56B 2ICWJ 2P1YA 1MFBH 4ELKA 4HPOL 4GG6F 2H1XA 3QJSB 1XF4A 3RU8H 3LSOA 3SE9L 4TSBH 1NZRA 5FB8B 4U0RC 1AGBB 4M56A 1NCNA 1RK1A 4ADJA 2H45A 3LPOA 1JIBA 3NIDF 4NRYA 1MAKA 3RWGA 3V4VA 3H9HA 1HZHL 3RVWD 4N2GA 2ZF9A 3UJJH 2MTPA 4KJYB 2JXMA 3GBML 4J3WA 4ONOA 4NWUL 3GSOB 4QY8A 3KXFA 3MRKA 3WELA 5IZ7A 4P2AA 2WBJA 4KKPA 1EX0A 3HVDA 3MRJB 1RKRA 4JR9H 2YQ3A 3AXLA 1NMCB 3IF1A 4GW5B 1OXYA 1GC1L 3A6BL 3LKOA 5IMOA 4LL4A 2BY2A 1H8SA 3WTTA 2MPVA 3QPKA 4QGTA 3L95B 1QUNB 2A3TA 4PJ5D 2A6IB 2F1EA 3LIZL 4H1LB 3MYZA 3NIGF 4UQ2B 5IHZB 5GSRB 1YEHH 4IMLB 1XTMA 3SGJC 1LD9B 1DVZA 5GZOC 1ZKAA 4Q8BA 2BY3A 2ESVB 4UWQB 5FF6A 1OALA 1ILUA 2NSQA 3EYVA 4P0DA 5AYUL 5MEND 4HEPA 1RPUA 5T1MB 4IOSD 4IBTA 3SPCA 4NO0A 3ESUF 1ZHBB 1BLIA 1VGKB 3N1QC 1C12B 4R5VA 4XMWA 4JZOA 1FFOA 4P5MA 4MXQC 2YGPA 4MA1B 3UTTB 4W70A 2A74B 3H9ZA 4KVCH 1Q0XL 1NDGA 3BAYA 2QSTA 1PSKL 2XN9A 4QF1B 2X9WA 2BXZA 4RGMB 5T5NF 4D3CH 5DMYA 1HSBA 1PQZB 1S2EA 4B0MM 2YPLB 1FSKC 4LNRA 2RACA 1EJFA 4WHYH 3KPSB 3G5WA 1ACXA 2P24B 1JOIA 3T8VA 1XGYH 4OCSL 5EU6B 1NCWH 1XAUA 5KYYA 3CFCL 1XWVA 4Y19B 3KPMB 2UWEA 5EB9A 5KVFL 2DM4A 3RKDC 5E08H 3BH8A 2MCMA 2RCSH 3GBMH 3SIKA 4HJIA 5HGAA 1SF5A 3VDCA 3BJ91 3T65B 3BSZA 4YGAB 3US1A 1K8IA 1BJ1H 1CU4H 3D4YA 1QSZA 1DQIA 1MQKH 3A0OA 3B2UC 4XNQB 4XOEA 2OSLB 1TO5A 2GIYA 4Y5YB 1BZ8A 3CC1A 1NGZA 3ESVF 4DHLA 1J8HB 3QR0A 2CU9A 5EORH 2HKFL 3ARVA 2EVHA 3CZGA 5MERB 1PDKA 2AK4A 2X28A 1CXEA 2JI2A 3GXIA 4ZD3H 1P69B 1ZVYA 4PYHA 4WWNA 4LP8A 4O5LL 4PCKA 2QKIB 3GMMB 3VNYA 1I1FA 1RMFL 1SY6L 1JDCA 1TQSA 3MUGA 1NGWB 1UEMA 2DTSA 2EUXA 2IPTL 3T6QC 3OJDB 5IB2B 2VDRL 1QTPA 3EIFA 4YXHH 2JTDA 3UBXI 2P8PA 3FOMA 3LXAA 2Y3NA 4HCRH 4JB9H 4CVXA 1NIFA 2J8UE 4G8GE 4EDXB 1A7QH 4XWGH 4QHLB 3I9GH 1W0VB 3PGDB 2M83A 4LT7A 3DIFA 1IC5H 2AFNA 1K6QH 3BC9A 4DOHE 3ECQA 5AUMB 1MG3C 2IG2L 2DAVA 3LPGA 3VGEA 2PWFA 1N9PA 2FLMA 1W0WB 3OLGA 5I0VA 3DVNB 4OJAA 1VFUA 1FIGH 3STZB 4APQD 4U1IA 1MFAH 3MCG1 1Q72L 3NABL 1FHGA 4HW6A 3T8MA 3HMXH 3ZE1B 1L9OA 2VL5A 4XN7A 3OLEA 4PY7B 1GW6A 5DLLA 1B4JH 4FQ1L 4L37A 5EWIH 2MOVA 2RCSL 1WA0X 3ZK0A 4KKLC 4DQOL 5DA4A 3QNXA 3FQRB 2BCMA 1AD0B 2AEOA 3ZTNL 3GS7A 5L7XL 1OAYL 4N2BA 3L2LA 3LRGA 1WLHA 4PGCB 4RMWA 3FKUS 3HW7A 3D3VA 4LEEA 2JJSC 1LHZA 4NQTA 3Q8CA 3L4YA 4UMGA 1F4HA 3ARFB 2R8SH 2K7QA 2XKNB 2DL2A 3HBZA 3MRIB 4LSQH 2YGVA 4EEEA 1KB5A 3VXMB 2C9AA 1YUHB 5I16B 3KJ6H 2YGOA 3SBRA 4H8WH 3P3YA 3ARDC 3FB8B 4P2OB 1IC7L 4D0CA 1WBZB 5AKTA 2VABA 2UYLA 4X98B 3U9PL 1ECYA 5HJ3B 4MDRA 4FQXA 4P2OC 3BWSA 1FNEB 4X4YA 1HI6A 1CTOA 1XH3A 3AW5A 3JWDC 3ABZA 2ERJB 4ANVA 1H5BB 2CMRL 3LH2L 4LVHC 2B4CL 2CRMA 3I6LD 2H6PB 5J7CC 1WFUA 4M1DH 2YKKA 1HNGA 5HYEA 4OCRL 1VFOA 1MWOA 2ZTBA 1JCKA 4H0GA 3S34L 1N0XH 1EZLA 1O7DE 3NJKA 5FUZL 4MWFB 4X99A 2HT3D 4WI0B 3RVXD 4BFIB 4YSOA 3TIEA 3T77B 1HHGA 3HMXL 4TUJB 3QDGE 3K8LA 4I48B 5LKNA 3MV9B 5KW9H 3J8F7 2BNQE 4U1NB 3RVUD 3TONA 1F4XH 4ERSH 3A67L 4ACPA 1OK0A 4PJXA 5DC4B 1LM8V 3L1GA 1GW0A 1J1PL 4LCWD 1XF4B 2AAAA 4M62L 5C0GB 5CR8A 3CXDH 1N59B 3ULVD 3BP7B 3BUIA 4MGXA 4ABUA 1UA3A 1HDMB 3BPLC 2ZX8A 4KDWA 2F8VA 1DQMH 2PTTB 2YZ8A 3QQXA 4GMTH 5JXAL 4Y16C 5MI0B 4DGVH 5CZVL 3G6AB 5T5FA 4GT7A 4P9ML 5E51A 5E6ID 2X2IA 3UJJL 2XKNA 2ZAGA 1HE7A 5JW4Q 3O2DH 1RURH 4TN9A 1IC7H 4FYQA 3FT4A 3G5YA 4IIQB 2WBJB 2W0FA 4JO4H 4JW3A 1HQRA 4XP6L 1S4IA 3QQ4B 3TBWA 1IRAY 1NBZB 3OSVA 3RIAF 4KXZH 5JHLA 2DLFH 4OQTL 1ZLUH 2BERA 1RHHA 2I07B 1Q94A 1LWRA 3QDAA 5DJCB 3MOQA 1UWYA 3LX9A 5LQBH 4WFFD 5JR1L 3NUKA 2AS5M 1OCRB 4OZFA 1IC4L 1S5HB 3N40P 4N8VB 2RH0A 2BSTA 5I28A 1TSHA 2I7OA 5I9QC 5IMLB 1LNUB 1EJOL 4PGEB 3SKOA 1T3FB 2JFCA 4YE4L 5EU5A 3IAPA 2PNDA 3C6LA 4O2CB 4OVUA 3HLAA 3O3BB 5IBUG 2MQ3A 3VI4A 4KXCA 2IWFA 4J3VA 3LKSB 4RH4A 1S3KL 3BSZH 1OGPA 2R2BA 3KLKA 2DICA 4PSPA 1OP5H 1CDJA 1CD0A 4Y9CA 3KXFB 4TXVB 3WMSA 4WNQA 2VDMB 4BCXA 3QHFH 4AWJC 4WAFA 4DW2H 3JTTB 3I6GA 5EDXA 4O58H 1DQJA 3CXDL 4IQHA 4P46D 5K9OA 1SDDB 1KACB 4DK5A 4GG6E 2NCMA 1RZKC 2AERT 1Z9SA 5ICZB 2YBGA 2YPVL 5KZCD 1C08A 4F9PA 5DS8A 5K39A 3P9LB 2J5LC 4G80B 2HJLB 3MOAL 4JN1H 4YFDB 3SQOL 4LCUB 4M6OH 1J9QA 1KCRH 3PP3H 4I2XB 3ZPDA 2BOBA 3QAZB 1GXEA 5LLIC 1C12A 1I9JL 3GRBA 4ADGA 5L88L 5FO7A 3KJ4B 5D5MA 2DLFL 1JS4A 2FK9A 3V6ZA 3GKWH 1G7IA 2P5EE 1BIIA 1U21A 2NQCA 2FX7H 3QUKB 2YXMA 3L3KA 4Q9RH 4WZ9A 4N0YH 4UM8B 1T1WA 3IJ7A 4S1DD 5LGJB 4H20L 4H8QA 4FJ6A 2RA1A 1MFVA 3NIFE 2KLTA 4LPUA 3DUUA 2QTVA 5LWYL 1YMHB 2H7WA 3L8QA 3H1ZA 4PMEA 4N8PA 1MG2C 1D5BA 1FF5A 4Y9EA 1UG9A 2VL4A 4ICWA 1NBVL 2JH2A 4TLSA 1X4YA 4HK3N 2F7QA 5F9DC 4AC2A 4UNUA 1INQA 3ATAA 4W4OA 1ETZB 2J8OA 3J27A 3L6FA 4X5RA 2EZ0D 4KY1H 5L4JA 4OLUH 5I18H 4R26L 2FO4A 3MCLH 3VXRE 1MCLA 3N44B 1PY4A 1Q9OA 4P4KB 3GMMA 4Z77A 2WWKT 4TRPH 3O3UN 1HWWA 1K8DA 3E8UL 4W9JC 5SX4H 4L23A 3NPSB 5EC1A 1SDAB 3SZKC 4QT5B 3WGUB 1IGTA 2IANA 2YSSB 3QEHA 4G9FB 2H9GA 2VUYA 3VB9A 5DJZB 2V5YA 2ATPA 4NRXB 3DBXA 3UJTL 2VIRB 2DJMA 2O6EA 3ARTA 4ODSH 2G5RA 5A43C 4MX7B 2MCPL 5ESVB 3K2UL 2NZIA 4NKMB 1YNTA 4O9HH 1CLZL 3RX5A 1PAZA 5KSBB 4EE2A 4BHUA 1Q9LA 5AUMA 3MVSA 1RU9L 2PWEA 4KJQD 1FPTH 4AQOA 4KOBA 4A2MA 3OGCB 1EHLH 2BHZA 1E6JH 5JXED 3DYPA 4IU2A 4AM0Q 1BIIB 1NFDA 2XNAB 1CGSL 1HH9A 2FJFA 5DLMH 1J1OH 3STZA 4KDTC 3WKPA 5KSAB 2B14A 5A3IC 1T7VA 2HN7A 4PS4H 1KB5L 3PV6B 3WN5B 4K94L 5FO8A 4PJ8B 3GD1C 4JQIL 5IOPB 5HJBA 1CQYA 2OW7A 5BMFH 2PYEA 1X5YA 2WQWA 1JFQH 1KPVB 2R4RL 3WN6A 1KJ3L 4PGCA 5AW4B 2XBZA 2EIJB 2HRLA 1QRNA 2X0VA 4PJDB 2Y07L 3EOAB 4LHJB 3UROR 3CN0A 1N64H 2DYPD 1HH6B 5F70A 3ZKND 1JHKL 3N41B 5F9OL 3CVIL 1QPKA 4BFKA 2ICES 1R3HA 1GY1A 4Y4KB 2X2HA 5D70H 5E2UH 4AGQA 1JPGA 2JB5H 4Q6YA 4ES8A 1OT4A 3E8UH 5HHXL 2G30A 3ZKMC 2WLLB 1UXSB 4Z0BL 2VLJA 3QQDB 4GI9A 4J39A 4MSWB 2VABB 4M6AA 2HWZL 1HINH 4N8CH 1XGYL 4CADA 2OLDA 3DK2A 3PG2A 5L2KE 1YMMA 2ZCZA 4GSRA 4NZTL 3RNQA 4YX2L 1JXFA 1MFDL 2O6DA 2IANB 1JP5A 1P1ZB 1W72H 3OC5A 4LSVL 3TBVA 4LASH 1H3PH 5AVTB 3K2UH 4AIZB 1F8TH 3ZBMA 4L3CA 4YMPA 2RQEA 3C5JB 3K72A 3UGUA 5IP4A 4MMXB 5F0JB 4IK6A 3RFZA 3SE9H 4HMEA 2ZXDA 1CG9B 4Z7UF 1P7BA 3AG1B 2Z91B 1SPDA 1J0JA 2LFEA 2NUPB 2Y1YA 2HPOA 4QJ4B 2FHCA 2Q86A 2YOCA 1CT8A 2VDPB 4YDLB 3F7LA 15C8L 4XNZC 2PW1A 4POUB 1NC4D 2R1YA 5BUPA 5I1AB 4XN1A 2XYBA 4FI6A 4H88L 1J9RA 4I4WA 3NCFB 4PRHD 3SBPA 5ALBL 3UTOA 1Y7VA 3CHXA 3IFNL 3QDMD 3RBGA 1U92B 3HG4A 2VDMH 4P3CH 5FFGA 1T7XA 1QVOA 3A6BH 5I8OL 1IV8A 1E5YA 3OKNA 1AQKH 2EH8H 5ECJE 5I71B 5D1ZD 1WUNT 2YAOA 3ZGHA 5E03A 1E50A 5EH1A 1FL5B 4IHBA 5ITFA 4NYLA 1LXMA 3LRSB 3HZKB 5JZ7D 4NBYB 4ODXA 3WMQA 1AI1H 4IRJB 2IGFH 4HUNB 5FCUH 3L4ZA 4L8CA 5H37H 4K4KA 3Q6FA 5AYUH 3T5WA 1M05A 1EHAA 1A7OH 5C0RL 2EILB 1VESA 2NXYD 1PPIA 5T1LB 1AYOA 4XCNB 2IH3A 4CRPA 3SDAA 3PQYA 2CRIA 3FSVA 3IGAA 3L16A 3ZE2F 3UFIA 4F5CE 1Q0XH 2OL3B 4MA8L 1U8JB 4F15B 5ANMA 1OWWA 3L4CA 1EAPA 3TOPA 4CC4A 2LABA 3O3BA 2VLKA 4M6OL 1UT1A 3PWVA 1R3LA 1BQUA 3WS3B 4PGEA 5HJDA 2IH1A 2ZSVA 3KPPA 3D87B 3VXOA 5JW4M 2X1QA 2FEJA 5AW3B 4Z95H 4APXB 1TQBB 1S7SA 1EO8H 1P4IH 2XVBA 1ES0A 4IEFA 4RFOH 4UDTA 2YPKA 1IT9H 1QFOA 3ZLQC 5AKSA 1UZGA 1E9PA 1MY5A 1DEEB 1TFHA 3BP5B 3T2NH 1ZXQA 1HXMA 3WIAA 3GKWL 1X5IA 3TVMC 5F7AA 2NY0B 4M03A 4XGZB 3PL6B 4KY2A 4U1GB 4Y5VC 4J1UB 1B90A 4NBZB 3RVTD 1U3ZA 2GBAA 1ACYH 3U7AA 1IGJA 2BCKB 1GA2A 2J20A 3EO0A 4JFSA 9PCYA 1FL3B 1PG7W 3IFLH 4A7GA 2N0MA 4L18A 5ICZA 4HHWA 4L3EA 3K6OA 1A1MA 3ZZLA 2BSRA 4KI5C 4NT6A 3F65A 3ULUD 2B1HH 1E4WH 4ZSOA 4JDEA 3MJ9L 1OT2A 1BVKB 2UWEE 2CO2A 4WY7H 2ZZUT 4X5WB 3V6ZB 4BFJA 3TT3L 4J28A 3ARPA 5A2JH 3WTSA 5IJVB 3V6OE 3I9PA 4NQUA 3H9YA 5C09A 5FO9B 2Z31A 5TE7H 4UOZA 2PCFB 2JE8A 2QV4A 1B2YA 1J05A 4JM2D 4QTFA 3V7AG 5EO9A 3LB6D 2EO1A 2R4SH 4G7YH 4YDKL 3T0VA 1IM9B 2WXMA 5J5EA 3PXJA 3VE0A 4K23H 3IJ8A 3P9MB 1BZ7B 3HS0A 2D9CA 4OY9A 4A55A 4N4YB 5JOPE 1LQSR 1NM4A 2VDKH 2VR4A 2XXMB 3MCKB 2BMKA 3TU6A 5CZVH 3SDCB 4N87A 2GVYA 3DROA 3UP6A 4YFEA 1EXHA 1CO1A 3O2DL 4HUXB 3RY5A 5LGYA 2NY5L 1BQHB 1OAXL 4FXTA 4XPFL 3UPCA 1EJ6A 3H9SB 4L1DA 1S7SB 4UDTB 3MRNB 4KVPA 2WD0A 1NUDA 3BZEB 2WN2A 4IKKA 4ZO9A 4M43H 3RHWK 1JRHH 4LF3A 5DDHA 3NSXA 2GHZA 3AM8C 2QDVA 1TVHA 3EDFA 3GIVA 4KI5F 3NVQA 3NDYE 4X9IA 2DQFA 1YEDA 1AP2A 2JKSA 3PJLA 3EUDA 3S36H 4NUQA 3U2IA 4ONFL 1IKOP 4U3HA 4BFBD 1CL7I 4ENZA 2DIEA 4HKBB 3ZZQA 4JQIH 4RMQA 4BZ2L 1NCDL 5EC1B 2IDTA 6FABH 3VFTA 1CYXA 3V79C 1B6UA 1MCFA 1PCXA 2YOAA 5HYIA 4F3FB 4HF5L 1WFMA 3CVDA 5IV2A 3GMPA 1BWMA 1DBJL 5HHPA 2R2HA 5T1MA 2Q8BL 1S7XA 3FCTB 3NACH 4UYQA 5EUKB 4BDVB 2PO6B 3I84A 3O3DA 1TJMA 5FKAA 2XA8L 2HFEA 4JPVL 2JSFA 2H2PC 2VZSA 3PWPE 4KROB 4LRIC 4B7IA 5ACMA 1F86A 2A74A 1DUZB 1S7QB 3IDIB 2PPEA 3REVA 1JZ3A 1QYGH 4UYPA 3X17A 3RUGE 1M1SA 1WIUA 3QE5A 3SEPA 4F27A 4G6FB 1BZEA 4F8QA 1TYRA 4A7SA 3NSCA 4YX2H 4G83A 1KIPB 3EADA 5D7LB 2YD8A 3D4CA 3S8GB 3BP7A 3QUXC 2BVEA 4XCCL 1MIEL 2XVGA 3FOMB 3W39B 1TTAA 4QYOA 4NN5C 2N4IA 2Q7NA 5FCSH 2GJRA 5JTWA 3FU7A 3O9WA 2HFTA 1H3GA 5CFHA 4PW4A 3K74B 2LTQB 3GTVA 4TVPL 2YPVA 4Z3GA 4P2RA 4W6WB 2EDOA 4JX0A 4LIQL 1NBZA 8CGTA 5AD0B 3V4PA 1SJEA 1CQKA 4L4TE 2QFPA 4LOUC 3LV3A 4XP6H 4KK6D 3Q05A 2CUMA 1I8AA 2DMCA 1P1ZA 4IMKA 4N25A 5HHQA 3UAFA 1I8LA 4WWPA 3W5MA 1QWHA 1MWAH 3NAAH 3OQRA 3VFGH 3X11A 3GHEH 2KLSA 3L5XL 2DJUA 4O02H 2NDFA 4MA3A 1XCTB 1BVNT 2VDNB 5ITFB 2ZXGA 3RL1B 1HTYA 3QEQD 5CM1A 2YK1H 3U30C 2XXCB 1H8LA 3TJEL 5FV2A 1YCSA 3K6SA 1VKXB 1WT5C 2P48B 4AQZA 1WZ1H 1IEAA 3QUZC 2VXQA 2ZT9C 4DP1X 3D0VA 2V3EA 1JHTA 3SGDH 4LGRB 4PRNB 3AU1B 4ZMQA 4NCDA 4V1DA 5JW5A 3VXSA 3MLVL 2FIKA 1Y0LB 2HT4D 4F2FA 2HX7A 3TNMA 4MCNA 4ETQA 1ADQA 2D3VA 3NTCH 3PPSA 1ZSDB 2R2EA 3MLWH 4Y2NA 3VSVA 4NS0A 4QUOA 3IGFA 5HI3C 4F8TA 1ZMYA 2E4TA 2FVNA 4PH8A 3BT2H 1FPTL 1MDTA 2H0JA 4WTWA 5I1GL 4MHHI 3W0WA 3Q8BA 1LE5A 4PRPE 3V52H 4NPJA 4HIJB 3QG7H 1NEZA 2ZKXA 3RY4A 3WDIA 1SOQA 4ZBJA 4NQSB 3NJFA 1ID2A 2V3DA 2ZXCA 2ZCKH 1RJLA 3EH2A 4WSJA 1GZQA 1LO0H 2ADFH 2L7QA 3QAQA 4JY5L 4MYWB 1GZHC 4UTBL 4ZPTA 1RCYA 4EI5D 1IAIL 2IBGA 4NENB 3BIBX 2DEYX 1H8NA 3PQYB 4HS3B 1E3ZA 3EHBC 1QUNA 1J0YA 5F6IC 1JUFB 5CJ5A 4NUGH 2JB6A 4NN5B 5LAXB 3GSUA 3RIFF 3PWVB 1U8JA 4WO4A 1OLLA 1I9RL 3MRGA 1BD2B 4PJXF 3RGVC 1NANI 2VDKB 4K3EH 4HZLB 4Y9BA 1HHHA 4Q6IB 2MJWA 1KPUA 3L4TA 4G8IA 4OD2A 3SGEH 5K59E 2IH1B 2NDGA 3II2A 1PLAA 4FQPA 2BRQA 4WSGA 3ZT5A 3QIUB 1N19A 2RFXB 2ZXEB 4IKJA 1UKTA 3LZPA 3N91A 4NZTH 3FB6B 2A6JA 3D0VB 3RB7A 3UH8A 4WUKH 4KC3B 3C9NA 5E8DL 3MLWL 5HVFB 4J3OH 2QPFA 3MLSL 3HHMA 4PGBA 4UDUB 4K3GA 2WYIA 3BW9B 5ICUA 3C5XA 5EU6A 2OYLA 3WI9A 3FFCB 2FEDD 2X40A 4C56D 1AZUA 2L7EA 4MRCA 2R0LH 5HHNB 2Q8AL 2G9HA 2J2ZB 1N70A 3QG7L 2BNRB 1M71B 4IRSB 4U1KB 3TIDB 3INUH 3ZL1A 1D2OA 1RZFL 4GRLC 4RNRA 2BRRL 2ADFL 2MKWA 5ACLA 2DIAA 1R47A 1Y18B 2AJ3B 4Y2DB 1NPJA 3QI9C 4QO1B 5IEHA 1FV1B 2UY7B 2ZKHH 1X5MA 5EU3A 4U1HB 2FTAA 5DS1A 1MREL 4DAGH 4DP9X 1OPGH 4FEMA 4KK9C 2VN5A 3BYTA 1P7KA 3ZDXB 4R3SB 4P5KA 4R7NB 4F7PB 4KI5D 1KB9J 1V7ML 4TNWF 4WFGD 5LAXA 2OBGA 2Y7OA 1S9VB 3MA7B 5C0CA 4JO3L 2FIRT 2YEQA 1JGEA 1A7QL 1WHOA 4KAQL 5F7KC 3FUNA 4FXGB 3UL4A 5E6IA 2R4RH 3VWKD 2H26B 4MMXC 3EG9B 4P59H 4WWKA 2E9JA 1S5IL 2KMWA 3OZ9L 5G5DB 2IG2H 1G5AA 1EEYB 3PHSA 3ORJA 2Y07H 3B2UD 1HYSC 5DSCB 1V3LA 1BFOA 1FO0B 4KK8C 4NAMA 2IAAC 3O4LD 1DQDL 3GDCA 3HC3L 1AXIB 3U6XA 1VRSA 3KNBB 2F53D 35C8L 3REVB 4AV0A 5IJKC 1OTTC 4V33A 1CTMA 1Q1PA 2P5WB 5FDWA 4FP8H 4G8EB 1BZ9B 4J8QA 4OM1L 4U0QB 3O6FA 5BS0A 4OZIA 1CBVH 2DQTL 4HSQA 4MS6A 1FNGB 5EEYA 3WEBA 3IWVA 3MUGB 2PP9A 4KFMA 1MI5B 4YUEH 4DQOH 1NGQL 2J56A 2CIKA 4A2GA 1NC2B 3GBNH 1Q9KB 1W72L 2B1AH 4LSVH 2XA3A 2BRRH 2ICCA 3FUMA 4LQFH 3PHOB 3P2BA 4YDIH 3PCYA 4HJJL 4LSQL 1TT6A 4JDVB 4I85A 4R90H 3ZYIA 5BXFA 5I16A 3GJFB 3GRWL 2ID5A 2WINA 5SWSE 2YD1A 1YZZA 3CC5A 3U7WH 4I8DA 1S7WA 3NP3A 4I4WB 1MEXL 2VLLA 3FQYA 3LS5H 4HDIB 1KNOA 5ADPL 3IDMB 1KT2B 5KBPA 2EUVA 5I74C 5JPMA 1R75A 1IVTA 1KYFA 1KXHA 3G6JB 1I9EA 4CN4A 5HYJA 3HNVL 4HZ1A 1AIFB 3TFKD 3VFGL 2WC7A 3BRDA 3QEHB 4ZDHA 1M2OA 3KPQB 1BLNA 3T3ME 4HLEA 5J1AB 4EZMA 2E47A 2PO6C 3UTSD 3KLAA 5A2FA 5IR1A 2ATAA 4HJ0C 3OKMB 4KJPD 1WGVA 3P0GB 1DDHB 5DHVB 3FTZA 4QNPE 1RD6A 1DQQA 2CLRB 2LOEA 3I9IA 4OLZH 4RGND 4XVUD 1MJJB 2A6KA 4N26A 2UUDK 1FO0A 1VKXA 3HZVB 4OM1H 4W9ZA 4Y0GA 2IAMC 2YPLE 3ABMB 3ES6B 3HB3B 3U2SB 1I8KA 3ESMA 3F7RA 4GSXA 2VMFA 4YO0A 1YEWA 3ZXAC 2UYLB 4M3KB 1ZPUA 4XT1C 4Y89A 1WWCA 1LMIA 3BSGA 2JLPA 1X4XA 4MS8C 5EA0H 2L3BA 2EACA 1OGAE 3V5HA 5CHNA 2GJ6A 4E5XB 1AHKA 5FR3A 4QRPB 4J12A 5HD8C 5I1GH 4E36A 2ZWLT 4PRAB 4WEBH 3P2DA 4MZIA 1R24A 3QCVL 4IOFC 4OV5A 4TLTA 3S36L 1OW0C 3KG5A 4HC1H 4G6JH 2HJKA 3E8VA 1EO8L 1P4IL 4FKEA 4JE0A 3BEWB 4N90D 3VGBA 2OAAA 3BD5A 1IEAB 2IOIA 2GCYB 3ZE0B 1E2VA 4LLYB 2VDRH 4JFPB 5GSVA 2GFBB 2R59A 3HZYB 4PM1A 2W65A 5HGBB 2HUEA 5CGYC 1X9RA 1UENA 4H2CA 5DD6B 5K1VA 1XT5A 3DJSA 2A7BA 3X14A 2QFRA 2WJ7A 4R7LA 1EJOH 2IFFH 3T04D 2Q3ZA 3QPXL 4HWBA 3QAZC 5AG8A 4UCFA 1V8HA 4PJDA 1CDIA 1JN6B 2VE6B 3P3UA 5IHHA 4JRYD 3DX2A 2DLTA 1HE8A 1FAIH 1FFNB 1HESA 4ZUWB 1TDQA 3GB7A 2BVYA 5EZLA 1YYML 4ZOAA 1V5JA 2EO9A 3F6JA 4XZUB 4WI9A 2TAAA 4JZOB 4A67A 1I4FB 4I13B 2QKSA 2E7LA 5HJGA 4PGDB 2G3NA 2N59A 1B4JL 4FQ1H 5FA3B 3RP1A 4H0LC 4FTVD 4MJJA 3TBTB 1MCHA 3GMLB 3QRGH 4ZTPL 2W9LA 4UU9A 4KQ3H 5GGSY 4TVUA 5HI3D 1IGIL 2VITB 3VRIB 2QR0A 5EOQH 3D7PA 2YUVA 3MCKA 3BH9B 3U46B 3FT9A 1S5HA 2B2XL 5D4IA 3TF4A 3U1PA 1L0PA 2YD3A 2GBVA 1KJ2L 1X7SA 1ZGLB 1Z5YD 2WXFA 3CU7A 2NYKA 4XI5D 4XB3A 1S9XB 2ADJA 2B7DT 4XB7A 5FO7B 2J6WA 5I8EA 4EUPB 1ZDQA 4S2SA 1EUTA 2NY7L 3AFLA 4X7SH 3NJVA 5DDHB 3VGAB 4RA3A 5EU7C 1GGUA 1RK0B 4MNGE 2WCPA 4XO9A 2AV1B 3KR3L 3QXDB 1HHIB 3WS6C 5HI4C 1IL1B 2GFBA 4WHYG 2P26A 4CGTA 3AC0A 2JKIS 5DZOA 3F12B 1I3UA 1E8WA 1OCWL 1KMGA 2HPTA 4Y1TA 5IHLB 3T3PE 4LNVA 4NO3B 3TZVC 1PY0A 3BAKA 3NFNA 3QI9A 1KTDB 2X3BA 4PI2A 4UV4H 2AXHA 5IKCB 5IFAL 4ZUTB 4A38A 2DTMH 5DJ0A 1SXBA 4KKCD 3QIBA 4MJ5B 1FFNA 2W0LA 3L3JA 4P05A 3KCWA 3ASOB 5E7FA 1A6WH 1UCBH 1I82A 4O51B 5DJXB 1W0WA 2GYSA 1YC7A 4BCYA 3FT2A 1WIPA 1XZWA 4HBQA 2B20A 1TITA 3NIDE 4UAOB 3MUUA 1E9PB 1VCBC 3DV6B 3KPLA 3QNYA 3RE0A 4OF7A 3PUUA 1ETA1 4FNRA 3W1ZA 4C56E 5J9PB 5DO8A 2EP6A 4W9GC 5IBTL 2IH3B 1ZT1B 2ICWI 5LCVL 5EOQL 4D3CL 5DHYB 4OAWB 4UILH 4UU9B 2DKUA 3O3AB 1F3JB 5IVOA 4AQ8C 2C7FA 4OFYD 5HDQH 4HFWB 1AKJA 3JSSA 2BY1A 3ZQ9A 1KTLB 2NY6B 4G11A 2H26A 1TETL 4QXWA 5D1XD 4HJGA 1LJMA 4QRTA 1ID5I 3KM2A 3BZ5A 5FEBA 1JWUA 5B3JE 3ARFA 1T03L 5C0BE 4DP6X 4ZPVA 2OXHB 1FZMA 4U6VL 1K5WA 2BNQB 1LO0L 2JTYA 2ESVE 1ZTXE 5GGVY 1AXTH 2EZ0C 2OJEB 3DURB 3KWUA 4BKLA 2OMYA 4JHZA 1C1EH 1XF3B 4FMVA 4NZFA 4HLZG 1A3ZA 4N0FA 4UUJB 5AKRA 1INDH 4J6RH 4ZS7L 4M29A 3BWUC 4M8QB 1IM3D 3UTZA 1NC2A 2XY2A 3KPSA 3N44F 4N9GB 4XNMA 1MI5A 2OI9B 5GZOA 2PTUA 4ZW6A 2Z0UA 3KPSE 3GM8A 4DK3A 3WFCH 3MHZA 4QRPE 1C16A 2NY4B 1W16A 2A9BA 3IS0X 1H3TA 1A02N 1ND0B 3QHFL 1UWGH 3OMIB 4K7PL 1ZT4B 4CMMA 5CZXC 4LLVA 5EN3A 4YHPA 5FO9A 3M17A 1EZSA 3UAAA 2X4TA 3VCLA 4D8PB 4ZFGH 5CBEB 1TQWA 2QHRL 1QSFA 1L4IA 4U1NA 5KANI 3D0AA 1UZ8B 5FGCB 5DC0A 4WFED 2VSMB 1ANUA 1I75A 3WHE1 2IADA 3MOAH 3RI5K 3AXIA 4NFCA 2KPNA 1TETH 1VB9A 1B4RA 5DD1H 5E5LA 1XB8A 3C09B 1IU1A 4RFEA 3MLVH 1GOFA 3LEXB 3MAWA 3B1TA 5KEZA 2EXWD 3NTCL 2PTTA 1J8SA 4WU7A 3BPNC 1F00I 2A6KB 2YD9A 3K6FA 1SN2A 4B6ZA 4WEBL 2W80C 3EJSA 3O9WC <