2OKMA

Crystal structure of ace19, the collagen binding subdomain of enterococcus faecalis surface protein ace
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
146
structure length
146
Chain Sequence
ERDYPFFYKVGDLAGESNQVRWFLNVNLNKSDVTEDISIADRQGSGQQLNKESFTFDIVNDKETKYISLAEFEQQGYGKIDFVTDNDFNLRFYRDKARFTSFIVRYTSTITEAGQHQATFENSYDINYQLNNQDATNEKNTSQVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Collagen adhesin
publication title Crystal structure of ACE19, the collagen binding subdomain of Enterococus faecalis surface protein ACE
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Cell adhesion
total genus 43
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2007-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05737 Collagen_bind Collagen binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2okmA00
2OKMA 2WZAA 3PG2A 5DZ9A 2F68X 1AMXA 3V10A 3UXFA 2F6AA 3RKPA 4HSQA 3RPKA 3PF2A 5DZAA 2X9YA 3QDHA 3QE5A 4IGBD 4P0DA 3OPUA 4Z23A 2X9ZA 2WOYA 2X9XA 2WQSA 2Z1PA 4Z1PA 4IGBA 3KPTA 2XTLA 4UZGA 4IGBC 2X9WA 2Y1VA 4OFQA 3HR6A 3HTLX 4IGBB
chains in the Genus database with same CATH superfamily
2QSVA 3ULUD 2RD0A 4H4NA 2K9UA 2C1OA 1T1ZA 2Q7YB 1A6TA 5B7EA 5EDXA 4BDVB 5KS9B 5FFGA 2NY4C 1T83A 4MJ2A 4MSWA 2A83A 2QGBA 3ARRA 4L1BA 3V0WH 1WRFA 2P8PA 2KT6A 3PDOA 3WEAA 1MCWW 3VA6A 1MJUL 2MOVA 2WINB 2OSLA 2HCZX 2R1WA 2VN5A 5D7LB 1YNLH 2W0KA 4J27A 5E8EB 5F7BA 4NP9A 3WNPA 1EH9A 2NY3D 5DSCA 4TNGA 1EXGA 2VXTH 5JTWA 2EEFA 4X6DF 4GG6B 1B6DA 2C3HA 1X5XA 4KJQC 1BYOA 5IMOB 1JZDC 4PS8A 3QG6B 3VWKA 2AXGA 3GMPB 3OSVA 2R69L 3FU3A 2DEYX 4MGXA 5CJ8A 3RY6A 3ZL4H 1PSKL 1SBBA 3T1FB 5JOPE 1OB1A 4IYKA 2E8YA 3ROOB 5G4NA 4JN2A 4A1RA 4CSTA 4P59L 4Z8FH 2QELA 3JWDC 3TBCA 1IZJA 5ALBL 3WGVB 4D8OA 4JO3H 1KWKA 1MKFA 2I9LB 3HNSL 4E9VA 3PGCA 3QYCA 3VFNA 1OGPA 1VKXB 1WD9A 1IBDA 1J9SA 1FF5A 1TQTA 3MCYA 4OKVA 1T7XA 3MXVH 2P80D 3P02A 4WW2A 3BT2H 3D06A 1OL0A 4HUVB 1S9YA 2C3XA 3O2WH 3PXLA 5TK2A 1F56A 2IAAC 3CUPB 1SXSA 4JG1L 4PLKD 2FZ3B 2LW3A 3RDTB 4APQA 4QO1B 3FTYA 3GTVA 3QAZC 4KHTL 3DX4A 4R7DB 5J4MA 1CGVA 1Z2KA 1MHEB 3BH9A 4NBXB 2A6KB 2OYMA 4YHMH 3MCG1 1UT2A 1M2VB 2ZUQC 4KH9A 1AE6H 4ZUTA 3RDTD 1AHWC 1QNZL 2YN5A 1A4BA 2XN0A 5CD5D 5HPMB 1JZ8A 1EWHA 4M6ML 1YG9A 4XI5D 4F24A 3QIBA 3KLKA 1A4KB 2HMID 4LIQE 5BS0A 1U8CA 3KLLA 5D93B 2JI3A 2PTVA 3S98A 2H0JA 5CMAB 4AYMC 3W37A 1YC8A 2OTWA 1RIUH 1TIUA 3TNMA 3ZDXE 3QRBA 2D7MA 4I2XB 4JY5H 1Y6NR 4X5RA 4FNLL 4BM7A 2WK2A 5FYKH 4JKLA 3CN2A 3P30L 5D1QE 4U1SB 3V4PL 2PW2A 2Z1PA 3QWNA 1AGCB 2EDDA 3IDNB 3NCWA 4Z5RA 3B9DA 4KK6D 4WFED 1F4YL 3J7HA 3OMIB 2QMKA 4G43A 4ZODA 3PP4H 3E1ZA 1RL1A 1OAZL 5IQLA 3FUDA 1I3VA 3KPSB 3DTDA 2WXNA 1HXKA 4MA3A 4YL4A 3FOMA 3K8MA 3LX9A 3A22A 4B60A 1YYLH 4DK6A 1D7FA 1NEZA 5I6LA 4OFDA 5DYOB 2F5AL 3LNFA 4NQXB 3KPSD 1JCVA 1I9EA 2HKFH 5F9AC 4G3YH 4HWBL 1TFHA 1JIBA 3VB9A 1FLTX 3SKOB 1WAPA 3KYNA 4GSXA 4MS8D 3U79A 5AAPA 2BOCB 4OSUL 5FDYA 2NMSA 4D9QE 4LEEA 3ARFB 5IR1A 2XZQH 4RAUB 4KTEL 2D7OA 5E8OB 3SODB 4CILA 2QQKH 3BFQG 3U2IA 5MP6H 4PGJA 1BX2A 1W9XA 3DLQR 1UB5B 2NDFA 3AROA 5LAPA 1T1YB 2WP3O 1Q72H 3KLDA 2NQCA 3WG7B 2ZCKH 5E2WH 2GUOA 5FDWA 1X5GA 2V0AA 3ARFD 2EDNA 4BH7A 2UY6A 2ZCHH 3K6SA 1WC7A 3RGBA 3SDXF 3G5XB 1NBZB 1F4HA 4Y4HA 1OP5K 1M6OA 4XAKD 3V0EA 3E80A 1QHPA 2H8PA 2Z7YA 3JQOB 2E59A 5K1NA 5FLVA 1XTLA 1YEEL 3C8DA 4IRSB 1TITA 2DMGA 4MJ6B 2CSPA 1DBKH 2J71A 2QL1A 2YD2A 4GO9A 1IX2A 2AGJH 3SYOA 5HYJD 5L9DL 1L9MA 4YNYA 1M9WA 1NCNA 1PYWB 3HI6L 4AQ1A 2H5UA 1KIPA 4GPVA 2NTFA 4KUZL 4E9XA 1F6FB 4IRSD 3PP3K 2W38A 5EO9A 1OLLA 4ZUVB 3W57A 3AVEA 4NO5A 1GGBL 4Y7OC 4UM9B 5HYEA 1L9QA 1KIRB 3IJ9A 2NY4B 1CYGA 5J5EA 2FAUA 2X0VA 3V9CA 3N40F 3GJFK 2JCCA 3TBSA 5CN1A 4UM9D 5CEZE 1IT9L 3JTBA 2YQ3A 5AOIA 1PX3A 2N56A 4XCYB 3SYPA 4C56E 2NY4D 4X7CC 3S8WA 1F4WH 3DV6A 1TJGL 3UTZA 2ZSVB 2Z9TA 1FNSH 2J88H 2IFFL 1HS6A 4OB5H 2GT9B 2PR4L 1EJFA 1SLXA 1CD9B 4N3TA 3I6GA 1UWGL 3QJHA 3WS6C 2PTUA 3FUEA 2B20A 3MLWL 2ADJA 3QWOA 1INEL 4CN4A 4JY6A 4KJQD 4RMVA 3ZPDA 5LBSA 3BEWB 2G5BB 5JDSB 2EIMB 2VC2L 1G9HA 2B2XL 4OV6F 3VFVB 1RZ7L 4N90E 1W6WA 1A9VA 3LKRA 2Y2YA 1F42A 2ICEC 2Q7YA 4K3JL 4ZS7H 4D0BB 5I24A 5IW1B 4LU5L 3Q44A 1DBBL 2VERA 3QDJE 4BDVA 2X6CA 2QHRL 4HUXA 2OMVA 4P5TC 4XOEA 3KVQA 1NICA 3AU1A 5D7IF 3VQMA 4MD5B 4QXVA 1H8NA 2F8IA 3MLRL 2WINA 3NQIA 2WNGA 3L9YA 5D7LA 5E8EA 1AJ7L 1TTCA 3QAZB 4Q9RL 4ZDHB 2HG0A 1YMME 2MRYA 1DQTA 1QPPA 4DJMA 5DI8A 1I3GL 2ZUQB 5D1XD 2ZX8A 3QS3A 2FEEL 3DGCR 1AHWB 3L7FB 1DCLA 3FOLB 4HLJA 4MD0A 4ZTEA 4YGVA 2G5UA 4HIJA 1BD2B 2FL5B 2XUWA 4JPWL 1GVIA 1TU2B 3MKKA 4M6OH 2KPNA 1WA2X 3IJYB 3T1FA 3U46B 4MJIB 2EXTA 1OHZA 3MFFB 5JHAA 3D5OF 2DIJA 3QZOA 3W38A 4OQ1A 3CLFL 3CHPA 1Q38A 2ADGB 2IDTA 1BD2D 4P99A 5HHOA 2D73A 4WVRA 4G9FE 5E94B 4AY0A 4HOXA 2FEDC 2ZKHL 1VKXA 3DV4B 3TYFB 4DUWA 3QHZL 1OIOA 4HPOL 4X6FB 3SIKA 4WWKA 2YD0A 1K8DA 3ARGC 1SF3A 3ZHNA 5F7LB 4DO6A 4LQ1A 3UTTD 5JYLA 3TH3T 2EDTA 4XXCC 2VLRD 3IMRA 3R8QA 2VSKB 1E43A 1H0DA 4AOFA 2XHNA 4M7LT 2E9JA 1DJGA 1E27B 2EDJA 3N43F 4XC1H 5FV2A 4LPCA 5A6MA 3NT0A 4AI7A 3NQKA 4PJAB 4GIOA 3V79C 2ZT9C 1KY6A 1ONQA 1KTCA 5HPMA 3B9EA 1MNUH 3AXLB 5GS2H 3QNFA 2YK1L 2AV1B 1DFXA 2NTSP 1LXMA 5GJSL 4U3HA 4JDTH 4WW1B 2VWEE 2VR9A 3VTTA 5C0CE 2L7QA 2YKLL 1EK3A 3JUYA 4MASA 4IBQA 4JPSA 3ME0B 1BF2A 2BIPA 2Q8AH 1JZHA 2JTYA 3H9HA 5JXAH 5FKAB 1EJOL 2O6CA 2X28A 4E0RA 1D2PA 1CLVA 2VO5A 1YNTF 4X6CA 4Q74A 5BNXD 3P9LB 4XNXH 1CZ8H 1EDQA 1HCFX 4N9OB 3MA7A 2ZXGA 2ZWNA 5DEGB 4UTAH 1ZT4B 3ECUA 3PGFH 1P84K 3CMOH 1EVTC 5E1GA 4Z1PA 4LLMA 3L3JB 1C16A 2XZAH 3HR6A 3LTVA 3TM6A 3IGAA 5J12C 2UXFA 5CD3B 1E3FA 1XF2A 1UXLA 2G3ZA 4OF5A 4PJBE 1KCSH 4DCQB 3HFMH 4I0PC 4UDUB 1GA2A 1QACA 3DVIA 5DZLA 2MCAA 4B50A 4E9QA 2V33A 2X40A 2PN5A 4HZLB 5FYKD 1F2QA 4HIEA 2W0LA 4IBYA 5E5MA 1U33A 3BDYH 3AG3B 1NKRA 2Z91B 3QVAA 4ODTH 3HZ3A 3BT0A 2EDLA 5H94B 4A04A 2ZG3A 5CEXB 3MPCA 3PLYA 2FWOB 5ERWA 2AJSH 3PWPE 2DWEB 3WUZA 1L4IA 3IT8D 5HI3C 4U6VL 2WIMA 1WHPA 3U6RA 3ZMRA 3NCFB 5L4FA 5AAMA 4FFYH 4J1UA 5HGAB 1EXUA 2BVTA 4ZPTB 1UA6L 2MKWA 4XO9A 2P28B 4GB9A 4X5XB 4P07A 2GIXA 3JWOH 4YHNB 1S4IA 4TSBL 5JMRA 1ETA1 4NERA 2MFNA 2F7PA 3OLGA 1UACL 3BMVA 5IZ7A 5HTSA 3P4NA 2EIZB 1XR8B 2ICEB 1ES0B 4GMSH 5A40E 4PEEA 4YZWA 1LE5B 1JZ7A 4JPQA 4N86A 3KYMB 5GGRB 4MA8L 4P5TB 1UATA 4WI7A 2EYTA 4PI2A 1NCDH 1V5JA 2E0PA 1BGXH 1Y0LA 2X2YA 1IB5A 4BWTA 1OAXL 4XCYA 1XIWA 3ILDA 4L5FL 3UYRL 5LBGA 4K3EL 4P5TD 4BHUA 4TVSa 1FZOB 1G7QB 3IDIA 1SLWA 1BVOA 2IF7A 3FT2B 3G6JF 4X4ZA 4ZQTA 5JA8B 5F7EL 3LIZH 2ZOTA 4NDMA 4C54A 1CE1H 1NWPA 2BP0B 1FFTB 1RK7A 2FH6A 4NKMB 2X42A 4N9GB 3EFDL 3RVXC 4HISA 1SMOA 3B83A 4JFPA 1SUJA 3OKMA 4MNGB 1IMHC 2VL5B 1OEZW 1BEYH 1DVYA 1U8JB 3EFFA 3FNKA 2Q86B 3VFVA 4LO9A 4RFEA 4D0BA 3ECBB 4HJTA 3JWOC 3V2AR 1YEDB 1WEJH 1CD8A 4EKXA 4LPVA 3BZFA 4OBRA 5C86A 3P3UA 4M6NL 2VKXA 5E8DL 1HL5A 2HWZL 1U8HB 1DJIA 3ARGB 3I02B 4WTZG 3M8OH 1HJBC 3DBXA 3UPRB 5DVPA 4DPBX 4NZUL 4AENB 2DIAA 1I1YB 1MPAH 1A7NL 1YPZE 4WI3A 1HHKA 3CHXA 5ABDE 5CKGA 5JHDB 3HI5L 3IU4H 2WJ7A 4O2FB 1DBMH 5IHUL 4FQHA 4QAWA 2OFQA 3CXHK 3NABH 3FOLA 4JANA 4PV9A 4TRPL 1LEGA 1U3HD 2ZAGA 4PJFF 4ZOEA 2VDLL 3GMRA 4JVUA 4AK1A 5JHDD 1QLRB 4MJIA 2ARJB 1BBDH 3UZEA 2Y5EA 4TTDD 1IGYB 4HHWA 5E2UH 4JZOA 3N1PC 4Z7UB 4M7ZC 4XVTH 2A6IB 2FCBA 2YPVH 1NA8A 4OT1L 2K45A 3DV4A 5GGRY 3V6FA 3L4UA 1K85A 3W2DL 3IVKA 1VGKB 2AEWA 3QUMB 3MA9L 4H1LG 4NZ8A 2EZ0C 3VGDA 4PB0H 4ELME 2CDGA 3N0AA 1AQKL 4GW1B 3UZQB 1NIFA 1HKFA 4NCDA 4LNVA 2Q7NA 3GRWL 5CFAA 3B43A 1MI5D 2GIMA 5EBMB 5KYUA 4X50A 3PQYA 1DUYA 3U4EB 3VXQB 5T1DL 1AKJD 1YEKH 1F41A 5C7XL 5HVFB 1W8OA 5J12B 2EEBA 2ED8A 1N5AB 4MA7H 3DJZA 1ZSDB 5BUAA 1FNEB 2GJ6A 2VMEA 3FTGB 1PL3A 2XPZA 3IU3A 3FZUC 1E8XA 3QUYC 4PY8J 5CN2A 5CEYB 2HRPH 2CR6A 3AW5A 3TA4D 3LH8A 4WV1C 4I0PB 2JB5L 5DMGC 4RVBA 1EPFA 4H1LH 2ADFH 4QYAA 1T1WB 4HETA 4LSTL 3X17A 3MU3A 1M05A 2QEJA 4IIQA 3DDFA 3N44F 5DD5H 4I0PD 4WO4D 3KCWA 1PJ9A 3VGHA 3W5NA 4HMCA 3G6DL 1KGCE 3JYBA 4H2AA 1HEHC 4JN1L 5FKAA 4A55A 4S0HA 2IPUG 2QPFA 3RTLA 2K9FB 2P43B 2Z8VC 4MJ5B 1EDHA 3ZO9A 3P9LA 3WYRA 1B2WL 4XZ4A 43CAA 1KFAH 2WLIB 2P42B 1ZT4A 2IDQA 2UYLB 5GS2D 1W72B 3IAPA 3EAKA 4Q8BA 5K1JA 3DYOA 2IH3B 3TTYA 4OD2A 4ZRGA 2MTPA 4XP6H 1TSRA 1OAYL 1HYRC 5CD3A 5DC9B 4JB9L 4NZRL 3RWHA 3H9SB 1XSIA 1EJ6A 1E28B 2BC4B 1WICA 4H8PA 3D25B 3GHBL 4YQXH 1TTUA 4UOW0 3ULAB 1HTYA 4OCNC 4HZLA 2YEVB 3H2PA 4JJ5B 3QH3A 4KKQA 1X44A 2PR9A 3QDMB 3JZ7A 2P9RA 1CC3A 1DJSA 3NSXA 4HUMB 4KX8A 4IU3A 2B1HL 3BUYA 4G6KH 3RTQC 2XY2A 2GYSA 4N8VA 4C59B 5LDSA 3CFBA 4HUKB 1KYFA 1LO5A 2UX6A 1OSPL 4JFFE 2X09A 3SYQA 2DQFB 1N6VA 1FIGH 2MQCA 4JFHD 4NCC1 4AQEB 1DVQA 2FWOA 3RL2A 2DWEA 3QDMD 3REWB 4OLXH 1EAPB 5K9QG 4RFOL 1M7IB 5I18H 2YD7A 4G5AA 3G04B 3IDMB 1X5KA 1PX4A 4H5SB 3SE4A 3RVWD 5K59E 4FQJL 3AB0C 4X5XA 4WI0A 4LBEA 2D9CA 3ZSSA 5C6WH 1B6UA 1DJHA 3GLEA 5ICZA 2WC7A 4WJ5B 1FL6B 4B9JA 4K7PH 1NFDF 1YQ2A 4TLKA 5EZLB 1XR8A 5DR5H 4GQ9L 1HE7A 3LZPA 3FHEA 3WJJA 4E41D 5CLWA 1P5UC 2YO3A 2X4UA 3K5RA 4QJ3B 4BZ1H 1LE5A 5GGQL 4M5TA 1MY5A 4Z7OB 4OF6A 3WIHL 1SXZA 2X1WL 2BSEA 4AV5A 5ANME 1JZEA 3MJ9H 4G6AC 1YUHA 4DZBA 1TT6A 5M95B 4XP1H 1Y07A 2ORBH 3P1VA 4MNQB 1RP9A 1RMFH 3F3HA 1QTPA 1G7QA 1T4WA 3ATEA 1N64H 1BQSA 3EG9A 1XX9C 3TZVA 4ADGA 4UQIM 1HIMH 2XPGB 3QR1A 4L05A 1DVUA 5F7WC 4FZEL 1X9QA 4MNQD 3VACA 3QK0A 1EMTL 4FP8L 4N9GA 2R29L 3MRNA 4IW4C 1JNHA 3HE7A 2IWKA 1CGSH 1E9PB 4L4VB 4LP4A 2COQA 3DPBA 1R17A 3QQDB 4WUKH 1RH8A 5HHMB 4KDTA 3QGVA 2YD1A 3M1OA 3V4VH 3X13A 5IFAH 2ZXDA 1TVHB 4M7ZB 4Q2ZA 4KHXL 5CILL 3VWJC 3A5VA 4L4VD 1J5OH 2MPVA 5HHMD 3AXHA 2OL3H 1N8OE 4B0MM 4JPVL 3WFDH 5CUSL 1OGAA 4NOFA 2HG5A 1M6UA 1KXQA 1D7BA 1B0GA 2PTTA 1A1OB 2DQUL 2XV6B 3ARGA 1FPTH 3BW9A 3KD4A 3DXAB 4P23A 1PQZA 4GUPB 4S2SA 3TIDA 3HMXL 3WXWL 4ZOCA 3MLUL 5JIIA 4D9LL 4Q97A 1WIUA 1KCRL 2EZ0D 3BD3A 3HC0A 1UH4A 1HQ4B 2GVYA 3GSUB 4OIIH 2L8AA 3DXAD 1OTTC 4X6DB 1LK3H 3VXPB 3S97C 3QUYB 4DGYL 2X9YA 4JX0A 5TE7L 1YEHH 4XVSH 3W9DA 5EC1B 4WV1B 5I16B 4HZAA 3WMSA 1YEGH 4BFRA 1UENA 2GK2A 3P9WB 1PZ3A 2Y3AA 5EO0A 4PJEF 3QUYD 1F02I 5AW5B 2XWRA 4L3CA 4PJ7F 3OKLB 2VW7A 2X4QB 2B59A 5DMGD 1Q9LA 4A67A 4QRPE 2V2WA 1HSAB 5DLMH 5KSVB 4F58L 3QUMA 4JAMA 1ZDQA 5LNDA 1JK9B 5FA3B 1B4LA 2WCGA 3HZVA 4GW1A 5LLIC 1MCKA 4GT0A 5ESVB 3MZTA 3OKNA 4NC1C 1SOXA 3O3AB 4GSDL 2KUTA 5ANHA 3U4EA 3NZUA 2BVQB 3VXQA 1FH5L 1V3MA 2R0LL 3FB8A 3IS1X 5I1JL 5GZNA 4AEHL 1A0QL 1ZE3C 4YSUA 1N5AA 3WIHA 4BEIA 5GZOC 5I0YA 2EEXA 3QFDA 2YSSB 2E4FA 4PRIA 1GYCA 5B39B 2H7WA 1LP9E 3BVTA 1FZJB 2AEPL 3G5ZA 4AIOA 4X8CA 3OJVC 4HT1H 4ONHA 3RTQB 4E5XB 4IS6B 4DO4A 5L4IA 2X3AA 4TVPE 2OTUA 35C8H 3P2DA 1LK2B 4W6XB 4PTUB 3RJQB 1TLKA 5ACLA 2H32H 2AQTA 3PABA 4JHUA 4CVWA 4FHKA 2G75A 2YPLE 1MJJB 5AW6B 1I8IA 1HL4A 4FMFA 2OXHA 1O7SA 2YPKA 3Q8CA 4I48B 2D3NA 4POZC 5LGJB 4MZIA 4EN3A 4K2UL 3AB0B 3GSWB 5CP3A 2ZKXA 4YDMA 3CH1A 3EGSB 4TPRL 3QDHA 2FO1A 4JHZA 4BK5C 1FFNA 1ITBB 1UXMA 1VEPA 4HIHB 4TV3A 4GKSA 1E28A 1T21A 4OVUA 1B88A 5IV2B 2VDNH 5E51A 3CFEA 4JJ5A 1P5UB 2ISDA 1BZ7B 3TF7C 2BIQA 5HDOA 1DDTA 4D8PB 2DIEA 4NO3B 3K6OA 2F6AA 3P9MB 3QDGB 4JQIL 4TLSA 3VQ2C 5I8EA 3SE6A 4AQEA 4GINA 1G7MB 3VFWB 4XC3L 3CX5K 4UM8A 1BAFH 4W9FC 3S96B 3CG8A 4GG8B 4JL2A 2AJUH 2FR4B 1EX0A 3L13A 1M7IA 1Z1WA 3P2BA 1WWAX 2F74A 1AMYA 1NBVH 3QDGD 1JPFA 5EF1A 3SDXB 4H5SA 4L4TA 5HGHA 3QRGH 2J4WH 3EOBB 1MIEH 1NIEA 3GBNH 1BM3L 5CLXA 2C26A 4AVIA 4BBWA 3AT8A 1MLBA 4QRSB 2E7LA 3VFOA 3M88A 5CNHA 5ACZB 1UWEH 3CMGA 4CJ0A 4MB3A 5EZLA 3RX8A 4NRXA 3PAZA 2F1EA 1QWUA 2PETA 1L6XA 2NQDA 3O4LB 1GS7A 3VWJB 5CCJA 3C5JB 3WEMA 5D5MA 4KZDH 3GTTA 4EI6B 4EZKA 4TUKH 1NEPA 2ZWSA 1OZUA 4KDVA 3NZHH 3EGDA 5L2KE 5JORB 4JZNA 4ETQA 3FT9A 5EN2B 3O4LD 1ORQB 3GJFA 3VWJD 2Y9RT 1IEHA 1FUNA 3Q6GH 2R27A 2RFXA 5AZEH 2OMYB 1R3JB 1NOAA 1JD7A 4HCRL 4HS8H 4XO3A 3HRZC 5BRQA 3GXMA 5JOFA 5IKCB 3NJIA 4RSYA 2YA1A 4FQCH 3VI4B 4PGCA 5JHLL 2ENJA 3RG1C 2ZSWA 1NBYB 2QSQA 4F5CA 1ADWA 2X4RB 3FO1A 1OCCB 2ODHA 4PJGF 4F8OA 3GSOB 3LS5L 3C6SB 1TOXA 3SY0B 3VG9C 1M57B 4K23H 3TTSA 1RURL 4FA6A 1KGIA 1UM4L 3HAEB 4Z7NE 1TVHA 3SZKC 5FOBB 5IQMA 1UJTA 3PXHA 2B1OA 2WB7A 1GYWA 1EZUA 1U93A 4N2FA 5DVMA 5CCKH 4NRZB 1Q0XH 4MRBA 1JTPA 1M9SA 2VDPL 4NUGL 3QPXL 1YNKL 4O02L 1S7RA 5MEND 1WFTA 4FXGC 3V4VB 5HGDB 5D7IB 3CZKA 1UJ3A 4JFWA 2X3BA 1PG7L 3PRZA 1Q90A 2E9IA 5LN4A 3TCLB 5I1EH 3NSYA 5CP7B 3KPRE 4UIKL 1KPVB 3NA9L 1N5YL 2OL3B 4P3DB 1HQ4A 3PGDA 2FK9A 3PFQA 2AXJA 2E7DA 1CTMA 4RMRA 1PZBA 3ZTEA 1TKWB 1KB5L 2DQIL 4ALAL 2VR3A 1HE8A 3SBQA 1F11A 1NLBH 1NUFA 3OKEB 3U9PL 2PO6D 4K71C 4GP8B 1FHGA 5B1CA 3OF6D 1PKOA 1L6PA 4OGQC 3GIVA 3R1GL 5JXEA 1YEFH 1CLYL 1QLFB 5C0AA 3EXJA 4WY7L 4YFDB 3TONA 5EBLA 1KN4L 1L7IL 3WAJA 1UGKA 4FULA 1J1XH 4APXB 3NMEA 4IHOA 1MFBH 4KAQL 4K7PY 4AE1A 3ECQA 1V8HA 3E1F1 2RR3A 3KGSA 5I1KL 1F3RB 2VSDA 4PJCE 2ITFA 1MVUB 4K3DH 1QEWA 2VNCA 2VXQL 4N0YL 3RKDC 1JI1A 4POZD 3L3IA 3MRMB 4RX4A 3SPIA 4NO0B 3N43B 5TPWH 1FNAA 4CBZA 2Q3ZA 4G8GA 4UQ2A 2X9WA 5B39A 2VMFA 3V0JA 3ABKB 3T0ED 4AXWA 5JIDA 4PJ8C 4NWUH 2YHGA 1ETZA 2B39A 4OM1L 4Q0XL 5E6YA 4ODBD 3UXFA 2RBLA 1A1MA 2H4EA 2GTZB 5IFJB 3RPKA 3VD2A 2XKNB 3O3BB 3GXDA 1XT5A 4JFXA 2NPLX 3RZWA 4L29B 2EDMA 3H54A 4AK2A 3GRBA 1ZTXL 1AZVA 1GGTA 5D2LA 4AQ8A 1PZUB 2FGWH 5FUCC 2H9GB 1AQ8A 4UNTA 1FE8L 3RWIA 3K6NA 1A6ZB 1QKZH 1YNTB 5GRWA 3BPNC 3WDHA 5I82A 3RX9A 2NXYD 3EYOA 2DWDB 4LARL 1CDBA 4P48A 3HG1E 1EHAA 3GSWA 2RB8A 3OJDA 2H32B 4W9IC 5KSAC 2AQSA 4Y2OB 5DQJA 2C9VA 3C08L 3D52A 3VGBA 1OCWL 4HIHA 2W88A 1UQSB 5LXVA 4ACPA 1FN4A 2G0KA 1WWWX 1ECZA 2B4CL 1QMUA 5E5LA 5EUOA 4HFUL 3ZW3A 5SX4H 3HW7A 2E7MA 3EJYC 5TK4A 4K8RL 2ICWJ 2OMWB 3DMMC 4QRTB 1F4XL 2NNCA 2Z93B 3ASOB 3MYZA 1F5WA 3T4YB 4D8PA 4U49A 4G1MA 3H56A 3B6SB 3R18A 3ULVH 2VDNB 3MLXL 2WYZA 1SMDA 1ZHKB 1F8TH 3FCUB 3KGUA 4G7QB 4TVPH 3SSGA 3UAEA 3FO0H 1K4DA 2J6EH 2PP8A 3FTVA 2CUMA 2F8OA 3DX3A 3RY4A 3SO3C 3HRZB 4LLYB 5J6SA 5K69A 3NAAH 1ZEAL 3O8XC 1K4CA 4P05A 2JJWA 2E56A 5FF6B 2J5WA 2WZ5A 3D85A 5IB2A 1I1AA 2LOEA 1PIFA 2QBWA 4F7EB 2BVOA 4P9MH 4A37A 1JHKL 5F7NC 3A4DA 2ZCZA 2WW8A 1WDAA 4WU5A 3UDWC 1D5ZB 2PWFA 4MCMA 4W9ZA 3V0FA 5KW9L 4R97C 1L9OA 3OGCA 3TYGH 4N0UE 3VG9B 4YDKL 4LESA 4JHVA 4LASL 4IK7A 4N3UA 4FS0A 3KBHE 5PCYA 4XWOD 1URLA 2ZG1A 5CJXA 2DQMA 5JO5A 2L7JA 4XP9L 4EEEA 1U8PB 5JORA 1GCFA 4OJFH 3LKNA 1KEMH 3GXIA 4OGYL 4FXGB 3VFMB 4U1NB 1R24A 4FABH 4TMPA 4CN6A 3IWUA 1RZJH 2E74C 4NNXA 4P3CL 3H9YA 3QG7H 5D7SL 2YJQA 3GXUB 4N6RB 2F5BL 5E9DB 1I85C 2CJUL 4L2YA 3GHEH 4WFGD 3WNMA 1F86A 4AG4L 5BVPH 1U58B 4HXAL 1VACB 4Y2NA 5IKCA 5EFIB 1MRFH 4MCZB 2UVEA 3Q2CA 2GI7A 4XO4A 4IJ3C 4Q6IC 2QPDB 5CFHA 2F54E 3A21A 2VW4A 2X4RA 1A1NB 4HXBL 4EDXB 2ETWA 4L48A 1E6OL 2VLLB 2XXGA 3GO1H 1XXFC 1GSMA 3EFOB 4D94A 3WNJA 5AAWC 4W9CC 1IEBB 2OP4L 5IJVA 1C5CL 4K71B 3AXIA 4DGWC 2WANA 5L6YH 5I17A 4F1SA 5CSGA 2VABA 3WIIL 1H3TA 3GDCA 3AQYA 5FOBA 3S3CB 1U3ZA 4KOCA 3FFCB 2WXLA 2OX5B 3ESMA 32C2B 2L3BA 2XYBA 4D0DB 1Z9MA 4ZX5A 4Q9CA 1ZLVH 1EDYA 3MJ8B 2WVVA 1CT8B 1ZA3A 1COBA 1WV7T 4GAJL 5D7IA 3BRFA 1MFUA 4ONGH 3GI9H 5IOPA 3FFCD 1F4AA 3TCLA 5HD8D 3FH8A 3KYKH 3LH2H 1FC2D 4QHLA 4N5UA 2BWIA 3FMGL 1QRNE 4K5PA 4YSPA 4IKKA 3Q6FB 2XWZA 3NJMA 3ARSA 2L4OA 4R90L 1E6JH 4KXDA 3T8MA 1BOGB 1U8NA 4HAKA 4NEHB 4WTWA 5GZOA 1FDLL 4NQCE 1TKWA 4I4WA 3ZDXF 3EOYG 1OAUH 1A3RL 3DX7A 4PJFB 3RKDD 3K2MC 3OKEA 4PJ8B 2J8UE 3MO1B 3MACH 4HUWA 4JDZB 1N8ZA 4JKPH 1X9RA 4KZ0A 5DZAA 4O2EA 3PHQA 3DROB 5IVXF 2FIRT 3IFPA 3HN8A 1DTUA 4PJ8D 1S7SB 1JZIA 4H88H 3NRQA 3V95A 4ODHL 1BAWA 2G9HB 2CUAA 1DN0A 5D6DA 1BXUA 3JTTA 3DGDA 4OCXL 3SGJA 3PWUB 5E56A 1XD1A 3HLKA 2IAMA 3BPNB 4P2OC 2EQDA 1KXVC 5DUJA 1MAKA 2DQGH 3G9AB 4PTTA 1N70A 3II1A 1QLEB 5MEQB 5CF3A 5KSAB 2ENPA 4DW2L 4OCLC 5FWQA 2WPGA 3ULSB 3IDGA 4BZ2H 4KJPC 4GAYA 1WTGT 1RK0A 5AVZB 4FD0A 1DQLH 1BFSA 3P11H 4MD4B 3K1DA 1C12B 1U30A 3CC5A 3HZKA 2A9DA 2KZKA 3LMJH 1OF2A 4FQ1H 1XGRB 1X6NA 3TASA 5HGBB 1MCHA 3DMMB 1EEZA 2W07B 2W94A 5IFJA 1TZAA 1AXSA 2BVYA 1QSEE 2KPWA 4L9LA 1F13A 1HC1A 1WZMA 4WFFD 2ZJSL 2W1NA 2G0LA 3L3OC 4R2GD 2NY6D 1TZIB 1HQRB 1JVOA 2VH5L 1KELH 3DMMD 4HSAC 2I5YL 5CJQH 5C09A 2DLIA 1FGNH 1P4BH 1J9TA 1YNTA 3MUJA 3SO3B 5ITBH 2AJYL 1NUDA 3O8XB 2YAMA 1ZS8A 2V8LA 3H7BB 3W9EB 1TYJA 3ETBF 1QI3A 3Q2NA 5IMKA 1JTTA 4PJ5A 4PW3A 2HKHH 4GMTL 1BMZA 1GGUA 4OUUB 4QOKA 1SEBB 3O8XD 1RIVL 5DEFB 2G60L 1IKFL 4QF1A 1F6LL 2Q6WB 1UQSA 4GKZB 3QR2A 4R97B 2NYKA 3S5LG 5C1MB 1DQDH 1PG7X 5CAYB 4Z3FA 2P47B 4FZ8L 2WTPA 3FQXA 1KBKA 3BDXA 3KPPB 4HKZB 2BSDA 4PBDA 5K9OA 1EANA 1XEDA 1AFVH 1RJZB 1SDDB 3VD0A 3B1TA 5DMKA 5J9PB 1P0SE 4DKFL 4KI5E 5FM5M 3T4YA 5CBAA 4TL4A 2W95A 2Z7ZA 3P0YH 3BVDB 3E8UL 5EF2A 1KBGL 4LKCB 4WUUB 1T0NA 1NLDH 2WVTA 1ZHKA 4BFGA 1G94A 2RIKA 5DD0H 3BAYA 4CMMA 1MFVA 1EEYA 5FECB 1CLCA 1QR1B 3RHWK 1MW2A 4JW3A 3JXAA 3SHSA 2Z8SA 2HJKB 4WUUD 1ZJAA 1BXVA 4OLZH 4DPAX 4IJ3B 2VLJD 4Q6IB 1CI5A 1RFDH 1F6AB 4MB1A 1FG2B 2ESVA 4UT6L 5D4QA 4MHHI 4AGMA 3BKCH 4NBZB 4XODA 5DMIH 5F1OB 1MW1A 3US0A 1CS6A 4E36A 2V7HB 3RZCC 2E9GA 3V0VA 2XTJE 3WFBL 1GW6A 3VI3E 2IPTL 1C9SA 3ULVD 4IDJL 3L16A 4TVPD 1N18A 1NFDB 5HP5A 3HNVL 2OLDA 3QS2A 4GLRH 3HG0A 5LNGA 2AC0A 3MUZ1 3ET9F 2ZNWA 5DA0B 2Y4SA 1F3DH 3BP6B 4UT9H 1TQBC 1NAML 1D5XA 1B9KA 2IV9A 3LZLA 4GH7B 2EXSA 5DUBB 2C3GA 5C0RL 3QWRD 3ULUL 1M53A 3CSGA 5EIIG 1XMWA 4OZHE 2P46B 1NCBH 5E9DA 4YAQB 4UWQB 1YZZA 2HSIA 3MRHA 3UZVB 1VACA 1DSYA 3ZYZA 3L7EB 4P2RA 4DETA 1RJCA 4Z0BL 2LTQC 5FR3A 3IF1A 1D3CA 4PGBB 3BRDA 3CPLB 2NUPB 2KERA 5CGMA 4FFZL 4EDXA 4QNPE 3D30A 1DUZB 3G6JA 3K5SA 4IRZA 4NXSA 1IE4A 1O6SB 4TLTA 1JZ4A 5LHDA 1Q0YH 3KR3L 2EDRA 5DJZA 4MFHA 1BWMA 1JPGB 2DQHL 3MDJA 2WZPA 3A6CH 4YSSA 2R2CA 3LN5B 3EDFA 5AW0B 2CPCA 3PCYA 5C07D 4MLSA 4YHIB 1OGTA 3UTSA 1VAHA 4GQRA 1ZLUK 3TT1L 5I1CL 4ZW8A 4TF4A 4UQBA 1AANA 3ALPA 3DURB 1EZLA 3MJ8A 3I75B 4PN6A 1CT8A 2F7IA 3IDJB 4P2OB 3RWEB 2FJGB 3S36L 4YPGA 3DSNB 4R0LA 5BV7H 2UUDK 2XWJB 1H6FA 3O2VH 4ZXBA 5DURB 5DD6B 3BSZH 4BE6A 2WVSA 1KTKE 4BFNA 5BCAA 2B1AH 2NNAB 4P06A 5AW2B 2N7AA 2VISA 2DM2A 5DJ2A 5CIPH 5T3XL 4P2OD 2ATAA 4HEPA 4GI6A 4Z7IA 4LSSL 1QSFB 5GSRA 3UL4A 1HEJC 5DURD 1KCKA 2QVMA 2C9AA 3F83A 3CIAA 4XMKH 4PJFA 5SWSE 2C7UA 4RIRB 2E8ZA 1UURA 2P5PA 4XB8A 3JVFC 3MO1A 1QSFD 3D09A 4KJPD 3H3BC 1V05A 3FRUA 1I9IH 3RU8L 2D3LA 4PJEB 1NGYB 2HZHA 2X3CA 4HWZB 5E00B 5T1MB 3DROA 5EG6C 3X14A 3NZ8B 4MNHA 3K80A 4PJ7B 2DWTA 2EDQA 3L3OB 4RZCB 4UT6A 3MCLL 1VDGA 4F9PC 1N4XH 4XVJL 4E42B 1KYOK 3F12B 4OI9A 5HJBA 4Z3IA 4F27A 4YSEA 2MMXA 2IADA 4B9IA 3TP4A 2MHAB 2R56H 1ZXQA 2XPYA 2Y1VA 4U6YB 1I7RB 4HC1A 3L8QA 3EXLA 1CL7L 1E8WA 3BP4B 2HVBA 1IBZA 1NAMA 2MOGA 4HPHA 3FN9A 3WTWA 4E9WA 5CS7A 2CHZA 4MD4A 2UVFA 4CDHA 3CVHA 1C12A 3FT4A 5I1AA 2DYSB 1PCSA 4G71B 4MQTB 1UD8A 2DI8A 4OCWH 4OZGF 1A7OH 5GJTL 5HGBA 4QXTA 4MMYB 3G08A 2GFBB 2HFGL 3LQZB 3GSXA 1E8YA 1XR9B 4XBMA 5H4ZA 3V6ZB 4RRPA 2YQBA 4G7VH 2VN7A 2YMXH 4JR9H 2LABA 2NNRA 4M4RA 3K4DA 5DU7A 4YSQA 1AH1A 3O0RL 2JLLA 4PV8B 2H0PA 4PRPB 2BOBA 5TE6L 3ESUF 3LXBA 1OM3H 2XZCL 2R1YA 1JI2A 4HKXA 4H0IA 3ETSA 1WBYB 4XOCA 2WP3T 3CN1A 1OY3B 3H7BA 3REVA 3VXSE 4DOHB 3H9ZA 4M7JL 3WEBA 2EACA 2YRZA 3L1EA 4PRPD 1Z5LB 4L1LA 4Y19A 5DQ9A 1DL7L 2Y1YA 3CDFA 3LQAH 4N2AA 3CBKB 3MLZL 3UDWA 3C5SB 3SOTA 2RACA 3RZCB 1WCBA 1X7QA 1A14L 4GKZA 4IOFC 4XXWC 4GFTB 2Q6WA 4F7CB 5C9JB 4LCIL 2IBBA 5EUKB 2GSGB 3K0WA 3VXNB 3CN0A 3SKJL 4B9ZA 2VLKE 2QGCA 4H8WH 4Y4KC 5FO7A 5AD0A 1TETL 4FYRA 2D31B 2NNFA 3Q05A 1P84J 4JPKH 3WDJA 4LSRL 3OHMB 4RSVA 2BHZA 2V17L 4X9GA 3RZCD 3BC9A 4LSDA 2H1PH 3UABA 4N2LA 3QFJB 4PJDE 1RU9H 2XG4B 1TQBB 4RAVB 3MRGB 4KQ0A 4L1DA 4LKCA 1BOYA 2GHWB 4NLAA 5CZXC 3GB7A 5DRXA 3F6IA 3R4DA 5ISZE 3QFJD 3LCYA 3F65A 1U95B 3DSFL 1N59B 1O7VA 1QTSA 3BKJL 4YUEH 3PUCA 5DDHA 2WAQA 3HUJA 2ED7A 3BIKB 2LTQB 3RPIB 1V27A 4NNYA 5FO8B 5EU4A 4G8FB 5KBDA 2XSKA 5FO2A 2VJ8A 2ZXEB 5C0BE 2KDYA 3KGTA 3NJVA 2ZF9A 5E6ID 2J12B 3QZWG 1UM6L 3DOSB 4ODSL 2FECL 3BVVA 1NFDA 4XAWH 4KVCL 2GABA 4QGTA 4TS6A 4ZSOE 5IBLC 2E3VA 4G6MH 3LQAC 1P2CA 1J86A 3SE9H 3CQFA 5I1LB 4LDEB 2PUQT 2ATPA 2CJ3A 2X2JA 1QHOA 4RBPH 1Q9WB 1SBSL 3L4YA 3L1OH 3OXRB 4N85A 4OGXH 5DUBA 2NW3A 3QEGL 2IBGA 5IBTL 3GIZH 4J2XA 4YAQA 2WWMC 2ZUSA 4XPBL 1WFNA 5F44A 2J56A 3JWDL 4PGBA 1WBXB 2YD8A 4L8SA 1SYSB 3MGTA 3JUZA 5GGVH 3ALWA 4A7TA 3KHOA 5INDB 3BJLA 3PWJB 2FX9H 1LVEA 4PJGB 4ILDA 2XQ0A 4WEBH 3MBXL 3GMMA 2B15A 4ELKB 3RUGE 4ZMTA 1RULH 1RK1A 5HVHC 3I6LE 5HDRA 1CFMA 4P9HH 1P4LA 1ASPA 1CGTA 3MAWA 2NX5B 1CXFA 1JE6A 2UXGA 4FFWC 5FYJH 1MJ8H 3N04A 3AAZB 3F8UB 4XN7A 3V0WL 5IB5B 3IB4A 1PZSA 2RJMA 1H3VA 5HHPB 3VTAA 2IPUK 3IDJA 4AZ8B 1AGFB 5LDUA 4GSRA 3RFZC 3B9KC 1SYVA 3U1SH 3L9RB 2NX5D 5IB4B 4H0LC 4ZUWA 5HYSA 1FFRA 2WNXA 3ILEA 2KZBA 3PU7A 1I8UA 3IJHB 2YGVA 3P77A 4CVXA 5CLZA 4ABQA 4YVUA 4OV5A 5KBLA 3WL9B 1ROWA 2VXTL 4JLRA 5LBVA 3AMLA 3KPNB 2DMKA 2AABH 3VFSA 3S48A 4E9RA 3P4OB 3FU8A 3ZL4L 3GXTA 1USZA 4F93B 4RIRA 1AC6A 4JREC 1E30A 1G1YA 4Y4FC 3UMNA 5CIPB 2FGZA 3W0WB 4Z8FL 1V7NH 1GHFL 1NGYA 2FIKA 2NYYC 3FO2A 1Z32X 4OZ4A 4A2FA 4JO3L 3CXHJ 3FQTA 4BQ6A 4HJ0D 5FUOH 3P4LA 5T5FA 1GSKA 4NUJA 3SJVB 1YVLA 3SPHA 4E42A 1NCUA 5FW6A 3MXVL 3EYSH 3BT2L 3OC5A 3QE5A 3VXTA 4GRLA 1UD2A 2EVFA 3FULA 1ZPLA 4P9HC 3L6FB 5T1KB 1GC1C 2MHAA 3SKUD 1NIAA 3F6JA 3NIGE 1AO7E 3FO9B 4OVVA 4XPFH 3HKFA 4PMEA 3WTXA 2BY1A 2OM5A 3WFEH 1UEMA 1BFOB 4YHML 2AK4B 4XR8C 1F97A 1R75A 5T1KD 1AE6L 4LCWB 1J18A 2VR6A 3X2QB 3FU7B 4HK0B 2A6JA 4Y4KB 4F57H 2FHCA 4XE0A 3SBWC 2AK4D 2A74C 2XWEA 4J5VA 1RVFL 1EAOA 4IOFD 5HHQA 5CINH 4OLWH 2AJ3B 4EUPB 4M9OA 5D1QC 4Y4KD 3DX8B 3JZYA 3G5YB 1CR9H 3IETB 4X5LA 2DJ4A 1RIUL 1U8LB 2N0MA 3L81A 4JY5L 1AGBB 1CXIA 2Z65C 3UROR 4XMUA 3UGUA 4YLQT 5IQOA 4OW6A 1J0KA 5FYKL 2BSTB 4GEJA 2HRHA 2IVFC 3D2UA 3RI5F 4NGHH 1KPRB 3H0TA 5TFSL 3FSAA 5F71A 4CRPA 1Z9OA 2BIIA 1N7MH 5D1XA 4X4YB 1LE9B 2GEEA 4NQCD 3FSZA 1Z5LA 3HPJA 5EF3A 2X70B 4I1RA 3QUXA 4P4RB 2DPKA 3QDAA 2K1MA 3S36X 4AGLA 4YHKH 4HJGA 4A68A 5IM7A 3CFQA 4YDLC 1YYLL 2B0SH 4X4XB 2GSGA 5BZWB 4GI8A 4NQEA 1DZBA 2HKFL 2XVGA 4G3YL 3KPOA 3WUWG 2D4FA 2HRGA 3LEYH 2D31A 3OKOB 3H3PH 4ZZFA 4MX7A 4AGNA 1GRWA 3S4SB 2HFTA 3OKDB 3KPLA 4U1JB 3L3DB 2EH7H 4N0RA 2XZQL 3MRGA 2R2HB 5F3HB 4JNXA 2JJUA 2QQKL 1VLXA 1UFUA 4EOWH 3CDYA 1GXEA 5IBLD 1L5GB 2UY7A 4F3FB 1Q72L 2BP3A 1RY7B 1ZT7B 2ZCKL 4X2UA 5E2WL 2VLRA 5K39B 4Z3HA 3V55A 4DK3A 2ZCHL 4H20H 5H37G 3ZX1A 2Z31A 4LK4A 2MTAA 3BIKA 4W9EC 3F7PC 4O9HH 5I8KH 2X89D 3ZKSD 1XF3A 3QXWA 1DLHB 4E9TA 3C5ZC 4Z7VA 4B97A 4MCYB 2WWMD 1DBKL 1GYVA 1WZLA 2BSSA 4LAQH 4U1KB 4UBDC 5IMLB 1UXWA 2G3MA 1QSZA 4LHUB 2AGJL 3KJ6H 1CIUA 1LM8V 4E9LA 1INQA 3FRPG 5E1HB 4C55A 5HVHB 15C8H 2QSTA 1IC4H 7PCYA 1QEXA 5ID1B 5H37H 1CDIA 1F1GA 2QR0A 3D48R 4LHUD 1A8JH 2V6HA 5I1LA 2W80C 3WS3B 3LEVL 3QNYA 4RQQB 3MUY1 3CHOA 1BECA 4YXKH 3FK3A 1Q9WA 5ITFB 4K73A 1MSPA 1SY6L 1ZLWH 2NY7H 3DO3A 3MV7A 3RFZB 3B9KB 4NKDB 2WLLB 3I3DA 1THCA 4PJIF 4N5EC 5KJ7E 1IGJB 5CO1A 5KVEH 3F05A 1F4WL 3L95A 3NN8A 4GRWE 1C5DB 2FEJA 4UV4H 4X9YA 3ARQA 3B9AA 2FH8A 3MTRA 1FNSL 5E4IA 3VCLB 4JRYD 3B9KD 3UCQA 1MXDA 3QI9D 5IHZB 3MV9A 2Y23A 4OB5L 4NSKA 4UDTA 1I3UA 1OTSC 3P4MB 1E4KA 3CN3A 3CXDL 3HE6A 5INDA 5E8PB 3G6AB 1KBPA 1S46A 3ZE2F 1JF5A 5B38B 4Z78B 4JREB 1JXFA 3DJ9A 4KXBA 4RDQF 4Y4FB 5J57B 1A6AB 2HP4A 2XC8A 1DJYA 2PXYC 1AQMA 1NDMB 2GIYA 1I1FB 2FTAA 3C8KB 1RHHB 4ZS7L 4Z0XA 4NHUB 4WZ9A 1ZT1A 3QAQA 4Y4FD 3U6XA 3ZZSA 1T03H 1OTUC 4P57A 2QQNH 5E23A 3VXRA 3WOVA 5KYWA 2GB2A 2NYYD 2UZIH 3PL6C 3E3QE 3B8SA 3P40A 1IUZA 4TQEL 1V3LA 1AGFA 2R0WH 3IMWA 2CDFB 5GRJH 5L7XH 4CAGA 1FAKT 4PS3A 1FYTE 3T2OA 4U3XA 3UYPB 4ZO9A 1NJ9B 1B3IA 3FUIA 5JIMA 1RERA 2Q87A 4TUOA 1LP9F 4EVNB 4NT6B 2LGNA 1JGVH 4CVZB 1R47A 5KUMA 4UQ3A 3FHAA 2GSIB 2YBRA 2FO8A 4LGPB 4YDJB 3AM8C 1UG9A 3EJCA 2MOQA 4NO2B 5EU5B 4M6OL 5FYJD 1BIIB 3BP7A 3O41A 3ZDXB 3ZMEA 2LV4A 2A74B 4N68A 1PCXA 2P24A 4Y5VA 5EZOH 1AS7A 2YLHA 3TCXA 3TVMD 3V0IA 2GK0B 5HDQH 4KO7A 5D1QB 1B0IA 1BZ8A 2QT6A 1KLUA 2N7SA 4JO1H 3SJVA 5IVXB 2FQGA 3MNWB 3N85H 4NKOA 6PCYA 3LZNA 4Y1AB 3OC8A 2D7TH 3KL3A 1PLBA 2N3JA 3QUZA 4YPJA 1QTYT 3VJ6B 2R4SL 1NPNA 2MPAH 3IBOA 3KLAA 4R7XA 4LEOB 5DWUL 1Q8MA 1X7SA 2NY5L 1KV3A 1CLZH 1NDTA 1YJDL 2YAFA 4WK4B 4AKQA 3POCA 2P7TA 1KXHA 4Y1AD 3T77A 1WD8A 2HJLB 4TVUA 5KYXB 4M1CC 2EC9T 5GHWH 3FTSA 4XMTA 1RSFA 4RWHA 4XC1L 1UT9A 2K7PA 1QI4A 3OMNB 4DN3H 4XXWA 4YDLB 2VMDA 2F15A 3IE9A 4FFTA 1HESA 4X83A 2AJXH 4F7PB 4D0CA 1NWOA 1SY6A 4EF3A 1MNUL 1ACXA 3DPDA 3EOTH 3GMNB 3K2KA 1BDYA 4F33A 3IJEB 4LOVA 2Z7WA 1UUNA 1S7TA 4AUJA 1T20B 1J48A 1DFBH 4EUPA 4L8BA 1G9MH 1SJXA 4A6YH 4B9KC 1ZOXA 5GISL 1A9BB 1AI1H 1L7TH 5GGVY 1JUFB 2Q8AL 4G72B 5JXAL 4AW4A 1KIQA 2EIEA 3ATFA 3N5AA 1KJMA 5BVJB 1BXAA 4XNXL 4G1EB 3LB6D 5EWIH 3UERA 4UTAL 4XMXA 4QUOA 3PGFL 4UINH 4Z7QF 3CMOL 4ZMZA 2QQQA 3C5ZB 4P4RA 3RWFB 3VRLE 1FO0H 4QHUA 2XZAL 4AV0A 4L37B 2YAHA 3PJNA 5A16B 3RVTD 4BXVA 3EH1A 5G5DA 1AGEB 3D4YA 5JW4R 3BP5A 4Q9QH 1J11A 5EU6B 1YN7B 1KCSL 3C5ZD 1RCYA 1ZDSA 3I9IA 3OKOA 3INOA 5GXBB 5CBEA 4Z3GA 1HDMB 4UBDD 5IJKA 4QRFA 1ZIBA 3BAWA 4H2CA 5EU6D 4XBGA 3BDYL 4L3EB 1KPUB 1BW8A 4YFLI 4HUUA 4ODTL 1QBMH 1ZHNA 4ESKA 2F68X 2DD8H 4PH8A 1A25A 5ACMA 4ODVH 5DCCA 2W65B 3V5DA 3V4UH 1J9RA 3MLTB 1IBYA 2AJSL 1X5IA 4GJTB 4V1DB 1MI5A 4X80H 2CIIB 1G9MC 5FFOA 2WXHA 4FFYL 4QI3A 4NXKA 4HAFA 4ZI8A 4Z7NF 4V1DD 4N5ED 5BZXA 3MJ7A 5K9JH 3TO4A 5KTEH 1PKQE 3AMKA 5A7BA 5DS8A 3PHOB 3CX5J 2JK5B 3NSCA 2XVKA 2A4EA 2PXYB 4MBOA 4PJHB 1ZV2A 4AL8H 1G7JA 1NC4D 3FU5A 4RCAA 5ID1A 4WO4A 1XGYH 4GMSL 4MMZA 2GC4C 1U8OA 1U8IB 2Z92A 3H2QA 4FG6D 4F91B 5B3JF 4RQQA 4CC4C 4NPKA 1NCIA 4H13C 3TIEB 3PL6B 3N6YA 1NCDL 2E4TA 4URTB 4YHLH 3FL7A 3W56A 2WLLA 3E38A 1BGXL 1J8HB 3UEZA 4X9FA 1F2XK 4ZD3L 1OTUD 2OV0A 4ZUUB 4R7LA 1F3JA 4R4BB 2P1YA 4P4KC 5DA4A 5CGYC 4KNTA 5IROC 5KVFE 4HWEL 3AY2A 3AS1A 3LEXA 2H6OA 3JV4B 3OAUH 1RZQA 2WLHA 1J8HD 5TQ0H 5FUZL 1X5YA 1K8IA 1OE3A 1JWUB 3LIZL 1CE1L 1PF3A 3L2NA 2AJVH 4PYHA 3EUUA 3QT2A 3OWRA 3O4OC 1A3QA 2GSMB 2AZAA 2HFEB 4Z78A 3FRPB 4JFZL 4UB0H 4M61B 2Y25A 2HLFC 1NDMA 1QNIA 3D39B 1BEYL 2DBLH 2JV6A 1OVZA 1TZHA 3KDMB 5ILTH 1J5IA 1E4XI 4DGVH 1RHHA 2BM3A 3MV8B 3ZUCA 3UAJC 1M56B 3ESPA 4QMEA 4L1HA 1A3ZA 4GW4A 3KYOB 5CSZA 2FD6H 3D39D 3VXOB 3R8BB 2F08A 1XGQA 1B0RA 4G80A 1AIFA 3TFBA 2Q5BA 1W0WA 3M8OL 2CDFA 3APDA 3UYPA 1MPAL 3T0VA 4FXTA 1OV8A 4UAOC 2HN7A 3RX5A 3UC2A 1Q9KB 4BD4A 3IU4L 4CVZA 1DBML 4PCYA 2AMGA 5KVDH 1IL1A 2CHNA 1SHSA 4WWNA 3NABL 4PJ6A 2UXTA 2CR0A 1UCTA 4YDJA 1N0XH 4HLEA 4I87A 3L2LA 2A4ZA 1BIIA 1HN1A 2ZWLT 3EYUH 1PLGH 5IF0A 1BBDL 1P69B 1ZANH 1C8QA 4TL5A 5E2UL 2GK0A 5D1QA 2VZSA 1KN2H 1MFDH 2FBJL 4AQAB 2YPVL 5SWZB 3OZ9H 2C34A 4NFCA 2A9NL 4ICXA 1B0WA 3LXCA 3VJ6A 5H35B 1RUKH 3IXAB 4PB0L 3QXTA 4LLUB 3CQPA 3BEVA 4WQOA 5SWZD 4UTCA 5I1IH 1RUMH 2CE6A 5KN5B 1D5MA 4U1IA 4P2QE 3PPEA 2ZX9A 4UIMB 4G7RB 2YN3A 5FKPA 1IAIH 1XB8A 3MNDA 3WELA 1HK6A 4H25B 5JR1H 4MA7L 4XCEB 2X4OA 4PBWD 2XWTB 1SRDA 3UAFA 3HOGA 1ACYH 3IJEA 2ADFL 2XXCB 2JJSC 4OFYA 5C08B 4J4PC 1H3PH 3WLBB 2KI6A 4OZGB 4JRXB 2CO1A 2F53E 3F00A 3U0WH 4PGDA 5F89B 5DD5L 4DZ8B 2J72A 1A9BA 2BCKB 5BXFA 4TM9A 4L3FA 1JHLH 3B2PA 4N2OA 5C08D 1HXMA 2WAHA 4JRXD 4HMEA 3WNLA 5BVJA 1AHKA 3DVNA 4LDCA 1V54B 3W5MA 4NM8H 2WWOA 5L8LB 3POHA 3GF8A 4PW4A 2OZ4H 1QFWI 4A6YB 1FI8C 1MFMA 1MCJA 1RZIB 4X4ME 4HKBA 3HCVB 4YIQA 3JT2A 3HNTH 4N0FB 5E2TH 4L37A 2BLFA 4XP6L 4FXKA 1JV5B 1G9NH 5ESQB 2XBDA 1ZLVK 4RGNE 4WIQA 5E8NA 2Y1AA 2WXMA 3NEOA 5ICYB 1TFPA 2OAAA 3O2DH 4CSZA 4YQXL 1G87A 4QHPA 2QLYA 5JW3H 5I6KA 1HDMA 1KTLB 3AS2A 3PNRB 2LHAA 1H6UA 3VFPB 2ROYA 2ITDB 5DGQA 3SCMC 4C56A 2FHBA 4O00A 4HX1B 3S3JA 4G9DB 2E86A 2P5EB 2WIIA 4G6KL 5F21B 4JEGB 5AVUB 1W80A 3QA3B 1U8KB 1FFPB 3NIDF 2YARA 4CKVX 4L8CA 3CN4A 2PYFA 1FIGL 4F37F 5D1ZC 5BJTB 2ZKYA 1N3NA 3IDXH 4KROC 2IGLA 2BIOA 5AW3B 1OP3H 12E8H 1YEIH 3T2LA 3HG5A 4P4KB 2CIIA 4UU9B 2P5ED 3T8XA 3ZKQD 5I18L 4HK3J 1LQSR 2PYEB 4WTZA 5KOMC 1E8ZA 3HBQA 3K72A 4PB9H 3UIZA 3BFOA 4JHAH 1KJVA 4NC2B 1CD1B 4F15C 3GFUA 4JFDE 2NR6A 4AJ0A 1OQXA 3HLAA 1XWVA 3B3IB 3JYCA 3GRGA 4P4KD 1KIUB 1K2DA 2YPVA 4LQFH 2I27N 3AG4B 4Z95H 4L9DA 5IROD 3O4OB 2PYED 4JKMA 3DO7B 4MLIA 5FLUA 4EIBA 3QDJA 2WB1A 4AYBA 2C7FA 4KKZA 2H0FA 1IILE 4K7PL 1C5BH 5DR5L 2VZ1A 3QEQE 3WKYA 4PAZA 3MRPA 3DX9B 3FSOA 4BZ1L 1XBRA 1NGWA 3AGVA 2DLHA 5INCB 4BSJA 1G9NC 1D6EB 1KBVA 3M1CA 3EHBD 2HLFD 4DTGH 4P04A 3S37H 1YMMA 5I74C 1T0MA 5I30H 2CBPA 4ZX4A 3MJ9L 1DEDA 3UAJD 3WTYA 5MEPA 4TNVK 4XP1L 4FNUA 1JPTH 2ORBL 3GSNH 3LKPA 5IEKB 2QFRA 1I8KB 3PAVA 3UAAA 1L0XA 3M1BA 4UAOB 1RMFL 4X7EC 1MCPL 1N64L 2W91A 2YBGA 4N1CA 1IAII 5F1NB 1HIML 4WLCA 4HOWA 1LDSA 4ZO8A 5F7UA 2FJHA 1LMKA 3KXFE 2R23B 4G9FA 3QBTB 5DTFA 1CGSL 5D1ZI 4WUKL 5KSBE 5C3TA 2R7EA 3QULA 2IQAA 4ZFOB 1WT5C 2UWEE 5BRZE 3MV8A 1T22A 3ZY7A 1P5VB 1QBLH 5F9JB 1J5OL 3EJZC 1Z9SB 2OL3L 3WFDL 2FT6A 4R4FH 3WE1A 1YYMH 4WW2F 3VXOA 4JFEB 1OW0C 1XGZA 1NGQH 3JV6B 4I3RL 4XH2A 4EI5A 2J1ZA 3WIFB 1FPTL 4F80A 1EEQA 5AL0A 2GI0A 2ZOLB 3TC9A 3T2PA 1T7ZA 3FCSA 4PR5B 3FCTB 2QTEA 2CCLA 4TYUA 1UA7A 1C1EH 3V0DA 4N6QA 4JFED 2XWXA 1FV1A 4OIIL 1LK3L 1IAKA 5C0CA 1YEHL 4X0NA 1U4EA 2CD0A 4XVSL 5H8DA 3VXMB 1YEGL 2D0HA 2QJDA 1QRKA 1URIA 1NDGB 3RIFK 1TJIH 2APFA 2F61A 2OMBA 3FUNA 3L3KA 2ZIDA 5J3HC 5B1JA 1LDPH 4Z9KB 5FEBA 1SZNA 3VXMD 4RWYL 3K46A 4NRYA 5JIQA 3FQRB 1HZLA 3PE9A 2JKRM 4Y5YC 2WXPA 5DLML 5E7FA 1QQDA 3MRJB 1LGVA 1TO4A 1MAML 3SPVA 1QFWM 3NACH 3OAWA 1S7WA 4J28A 1S3KH 5KN5A 4PRAA 2CO2A 3Q43A 1XSOA 4HIXH 4PJBA 5I1HH 1YY8B 1DVFD 2QADC 3FU9A 5CZKA 1C8PA 1EHLH 3N42F 4KI5F 5HXMA 4HG4J 1NH6A 3IXTA 1CPUA 3B3BA 1XZWA 3DK0A 4I89A 5LKNA 1ED3B 2CGYA 3JVGC 1GMEA 2CU9A 2JI2A 3VYPA 1BFVL 3WLBA 3TBVB 3ZIYA 1SXCA 4HUNB 4JM4H 4K94H 2NOYA 3SCMB 3PWPA 3IKKA 5I23A 3COOA 3FFDB 5HDBE 2H6PA 1KJ2B 2KMWA 2Z6FA 3OJ2C 4PRNB 4WKZA 1MWAH 1YECH 35C8L 3O45B 4UNUA 3H55A 3SPCA 3T65A 1OCOB 2DLTA 5C0EA 5D1ZB 3LZFH 5B1AB 2GW5A 3SCMD 4KROB 4IK6A 4PRHE 1D2OA 3BVUA 1E4WH 2Z4TA 2NNXA 1NC2B 4K5NA 1T04B 3OKKB 1YDPB 4K9EL 3N91A 4K55A 1ZGLA 2WBKA 4F15B 1ZHBB 3FB7B 5IB1A 1ID5I 4KROD 2Q7AA 3D3VE 5AVYB 3UPAA 4KNQA 3BN3B 4U4IA 2OR9H 1JV5A 1R3LA 4J8RB 1YRKA 1BQHG 2VDOH 3GUTA 3GS0A 4BSWB 1OPGL 2PO6A 3DRTA 3GYRA 2CKBB 3WTUA 3VH8G 2KZWA 2VDNL 5DFTA 1AZCA 5F9OH 5HHNB 5DMJB 3TJEH 2WKOA 3MRBA 3PWVB 2JMRA 4G8IB 4I3GA 1RAMA 4AWJC 2KH2B 1Z66A 2FJUB 3A4AA 2JCCF 3KWXA 4JRLA 4HD5A 5I74B 3VGAC 1U8KA 1FFPA 4KRNA 4HKJB 4NQVB 3S9DB 3S34H 4F37K 5JOEA 3GZQA 3ML9A 4NQSB 2ZX6A 1BAFL 5I76A 2VIRB 2F7RA 4O51A 3MRCB 1CGUA 4QRRE 1QHQA 1G9EA 2EVHA 4K7FB 3F58H 4JDEA 3NIFF 4X7SH 8PAZA 2EICA 3G5WA 3ELQA 3HI1B 3QRGL 3B3IA 5AYQA 2J4WL 1MIEL 1Z9PA 2HX9A 2Z8WC 3MC0A 2QLVB 1T7VA 5D7KD 9PCYA 1UZ8A 3GBNL 2FLMA 4PMFA 5B3NA 1L0PA 1P6WA 3EO0B 3EO1B 1RD6A 1UWEL 4R7VA 2ZOUA 2EXWC 3SDDC 3ZOAA 5IG7A 2J25A 3D69B 3TOPA 5BOPA 2CHDA 1XH2A 2PCPB 3DX9A 4OZFH 2Y7SA 2VUOA 4YSOA 4KZDL 2D2CC 4TUKL 1D6EA 1YPZA 3NZHL 4O4YH 1KENL 4YN3A 2YWZA 4RNRA 3OZKA 1IM3D 4AT6A 2IDSA 1QI5A 5CJOH 3IFOA 5AW4B 5AZEL 3K6FA 4A2HA 3UBHA 1I8KA 4FTVB 4PJIB 5ID0B 4JO4H 4HS8L 1J8KA 5BS0E 4AM0A 3VFGH 4YE0A 5HYFA 5I0ZA 5F1NA 3AACA 5FIEA 4IM8A 5TGBB 4BK8A 1KJ3H 3BPCA 3PV6A 2Q10A 4FQCL 1OQOA 2ZP9A 4JFSA 3HN5A 4FTVD 2AZUA 5EN3A 1T7YA 1CFSB 3GSNB 2XKUA 2ZPKH 4UUJB 5FYLD 3HS0A 2WQ8A 2O93L 3ZE2B 1MQKH 3AGWA 4K23L 1E40A 4ZFOA 5EC2A 2WLNA 4YZFE 1CO1A 2X2IA 4ELMA 5F9JA 3VNYA 1FJ1B 4JM2F 3KPMB 3LQMA 5CCKL 4Y5YB 1HHGB 1Q0XL 4MDJA 3KPQA 2E9BA 3JV6A 4W4OA 3UTOA 2YUZA 4IGBA 5AKVA 3D0LA 4QHKJ 4ZW3A 3SDAC 4OM0H 2XZZA 2CO6B 1FL3A 1IQDB 2QKIA 2P4AB 2XWDA 5I1EL 1VFAA 3BGAA 3OPZH 4FRWA 5IW6B 3S3BB 1VFBA 1ADQH 1GOGA 2IOIA 4UZSA 4BELD 4CBPA 2QADB 3CHRA 3X12B 1PY0A 2C9UA 3E6FA 4BQBA 4U1LB 4PYGA 4B41A 5I73C 2DKSA 1CE6B 3I6KA 3GS7A 5F88A 4LL1A 1I7ZB 3AITA 1JDCA 2SEBB 3ABZA 3CZFA 1H8OA 4FEMA 4UQ9A 2JJSA 1NLBL 2FO4A 4J4PA 1NCOA 1S5HA 1BVNP 4H8UA 2CXGA 1TEYA 3DYPA 4TUJA 4F2ME 4RMBA 3HA0A 5C0GB 2YPLB 4YBLC 1KTDB 1YEFL 5C0DA 4YFEA 1A7QH 4NQDE 3BUTA 5IREA 1XCQB 1SPDA 2BS71 4X6CF 2ZWZA 1J1XL 4K7PX 4ECNA 4I1NB 2EADA 5IQ7H 5CZRA 3ZDWA 2YEZA 1S9XA 1I9RL 1U9KA 5C9KA 2H3NA 2VDQH 5KG9B 2WMPB 3VRJB 4ZYKA 1A4AA 1O5DT 4Z23A 3F7QA 4K3DL 1NM4A 2P5WE 1TSHA 3U2SA 2FQFA 2O30A 4GXUN 3U1QA 4X7TB 4XTRC 2OW6A 4PD4K 5TPWL 1MCOH 2ADIB 5B8CC 2OMXB 5DZVA 3NESA 2UZYB 4JCMA 1O7DC 3QZBA 3SKNB 5FGCE 3NFPB 4GXVH 2HB0A 4ODUB 1OAJA 4OIFA 4WHYG 1R5WB 2BNRE 4AVKA 5GS0C 4JFFA 5HVGB 1M7XA 4NWUL 5EOTA 1F45A 3CVIL 1CCZA 3MRDA 5LQBH 4PGZA 3ZUNC 2BNUB 3VGAB 3ULUE 2IXQB 3RL1A 4KKBC 4HH9A 2HVJA 3CHSA 1SDYA 1WAEA 1HILA 2ZXCA 3HJEA 2EVIA 2B5IC 2FGWL 2JKTM 2J8OA 1NC2A 5IJCC 1P53A 1QKZL 1S78C 2LAAA 1VFUA 1JF1B 2A6DB 4WHYH 1S9VA 2AQRA 4LVNC 2K8QA 1MWAB 1WGVA 2M83A 2WOBA 4IMKA 5KS9E 2VQTA 2DI7A 4Z7QB 4XOAA 4EZMA 2WKGA 5PAZA 2EE3A 1HHJB 3VDAA 4ZUSB 1I31A 3M46A 3OR7A 1LNUA 4PI0A 5JUEH 4GW5A 3MSPA 3QUKB 3SDDB 1TQWA 3MMEB 5ANMA 3U0PB 1SJHB 2EDOA 1RUPH 2H2SC 4R7NB 3PAUA 5HHNA 1TYEB 2IANB 5IY5B 3WFZA 2KS0A 2X6VA 4GG6E 4G8IA 1IGFH 3IMTA 1W0VB 1V7MH 3HHMA 2VDOB 3SDDD 1UASA 4JG0H 4XX1E 2J5LC 4JZJC 3ULVL 3UBXI 4HKJA 1GZPA 1HOCB 2IAND 1UWYA 2JCWA 1F8TL 2ATKA 4N22A 4TVPL 5I0VA 2Y5QA 2J6EL 3FO0L 8FABA 2CMRH 1UC6A 2VIRA 4CC0A 3MRCA 3STZB 3NAAL 4FL4C 1M4KA 1OGSA 1QD0A 3D18A 1CQYA 5E4OA 1QASA 3GSVA 5J7CC 3LZQA 4P9ML 2XN9B 1D5IH 1NANI 4Z7NB 4K5OA 3T2NH 4K4KA 3BQUA 3L2MA 4HIIA 1PDKB 2GITB 3EO0A 1E5ZA 4A39A 3ZYJA 2XN9D 3FQYA 4BKLB 3HPLB 4CNIB 1HINH 4L0PB 4WI9A 5ESAB 2X4NA 2ZOWA 4LCVA 2N1TE 3EGXB 3V5HB 1U8MB 3ENEA 5E5UB 4OJFL 4HHAB 4IRJC 4HFWB 1BZ9B 1DQKA 4QD2E 3DX0A 5BUPA 3MTXA 4DKEH 1BVLB 3SDAB 4BA0A 4FABL 3SE3A 1N0LB 1UVQB 1RZJL 3QG7L 2BY0A 4OZFB 4KZEH 5A2IH 2R0ZH 3PXJA 1DO5A 3T5WA 3GHEL 3ZGHA 2OJZH 5BVPL 2I07B 3SDAD 1INDH 1VSCA 1MRFL 3H42H 4S1SL 4A2GA 1SVCP 1WHOA 3FUFA 4LOUC 3NCYS 1GCYA 1Y18B 4PUBL 3SZ6A 2ZOKB 4I2XE 4ZMVA 5E5RB 3X1FA 5I73B 5J11C 4MXVF 3GO1L 1WPCA 4JO2H 3BRGC 3MBED 4QRPA 3KEDA 5ENWB 3BHBB 3SPJA 1CBVH 1X9LA 5L6YL 4R8WH 2WN3A 3RWGA 2PCFB 3FQWB 1VGEH 4YBLB 5MHSD 3GDBA 1R3IH 1VEMA 3KPSE 1MNNA 4U1HB 1J1OH 3NIGF 3WU1A 3T3MF 2ZXWB 3PJSA 4Y5YA 1KYAA 3SDYH 5GRVK 5KAQG 3X1BA 4QHNB 3EJTA 3QO0B 2VERN 2FWUA 4ZFGH 4NZJA 4ONGL 2YC1B 4AYFB 3M17B 4AEFA 2VUKA 4ORGB 3KYKL 3B1UA 3LH2L 1J1PH 2BY2A 4YO0B 3OXSA 3CCHA 1UYWH 3PNWB 3QXAB 3BUPA 5TH2A 3X12A 4C4UA 1LP9A 1VA9A 3K0YA 3UBXB 1E6JL 3MV01 3PREA 4U1LA 2CBTA 3PFUA 5B8CB 3WFCH 5KZCB 3VWKC 3X3FH 1H6TA 4XAKE 5H2BB 2PCYA 3QJVB 1S7VB 3U36A 4XNZC 1I7ZA 3VFTA 5CJ5A 1NGXA 4XHJD 3WJLC 1OAUL 3OX8A 4XTRD 1S7UA 2J6EA 1H19A 1SN2A 3FTXA 3BWZA 3MACL 3G9VA 2KYIA 4OLUH 1M7DB 3EBAA 4CADB 5HYJE 3MRQB 4JKPL 4WKXA 2X9ZA 1ERNA 2YPLA 5C0GA 5KZCD 3EW3B 2DYPB 2JJTA 1ANUA 4BK4A 2X4SA 4PFEA 1H5BA 1B90A 4G5ZH 5DJ0A 5LXGH 3RWCA 1QA9A 2MQGA 1OOAA 1NM9A 4YR6A 4JFOB 2B5IB 4U1MB 2I9TA 5SWQB 2X2UA 1AY1H 2DYPD 3WE6B 1Q9OB 3FQUB 5KG9A 4WW2C 4YEFA 5FOJA 4LLDA 2DQGL 2AV7B 2OCFD 4LVNB 1DEEB 1PU0A 4TOYH 4BFOA 4IOSA 1DO6A 2QMJA 2EYSA 4LDOB 2JB6B 4X8GA 4LHJB 4ZPVB 3SDCA 1S78D 2G2NA 3ILPB 4BZ2L 2HUEA 2X6AA 2OMXA 4P49A 5DWPA 2VDQB 4NIYE 1ZLWK 1DQLL 2D4DA 1M7UA 1IBGH 3GMQB 3VD1A 2XDHA 5BPPA 1H3GA 3NFPA 3VXUB 2YRBA 3LMJL 4TULH 1G7LA 5BUGA 3WD5H 1UZ6F 4FQ1L 5T3ZD 3QJFA 3QIBC 3CSBA 4GIAA 1D9KD 5CZVH 4AM0Q 3F62A 3G5VB 4M8VA 5D7JA 1E9OB 4JFYA 4P59H 5F6HI 3VXUD 2J5LB 3VMNA 2FLBT 4JZJB 4HZ1A 4IMLB 4U3SB 2O6EA 2ILLA 2UXVA 4X5WB 1KELL 5CJQL 5KVGH 1FGNL 2V2TA 1P4BL 5HY9B 2VZVA 4BV1A 3U0TB 5ITBL 2I32A 2JFCA 4FL4B 4TNWK 2MSPA 5T5NF 3RYMA 1UFGA 5DHVA 1I7TB 1DLFH 1NFIA 2HKHL 3ARBA 5DT1H 1HHJA 2BY3A 2YAPA 1U91A 1HWHB 4IBWA 3NFNA 3PS6A 3Q2VA 5MERB 1UKQA 1DQDL 2Y7LA 1BIHA 2V5YA 2ZCLH 3L5XH 5L2KA 4KI5C 4RMUA 3IGKA 1IIIA 2FVNA 1OP9A 4RH4A 3LKQB 1UD6A 4PY8I 4R7NA 1TCMA 4UOW1 4M6MH 1AFVL 3B7RL 4OF0A 4GRWF 2H1XA 2RHEA 4XZUB 5DJ8A 4IRJB 2WNWA 2PP7A 1V3KA 3P0YL 4ZMLA 4G70B 1BD2E 3K71B 3FONB 5C97A 2UV3A 1NLDL 4TQIA 3C09C 1JSYA 3NIDB 1D5BA 4GKNB 2F54B 3GC3A 5IHHA 4U2YA 4BCXA 2HVKB 4GUCA 4EDWH 1JZ6A 5LBSH 3AT0A 3C6LA 4OLZL 4PLNC 2DMBA 2XTJC 1PFCA 4PG9A 4Y4HC 3O6FD 1RJLB 1T0OA 1RFDL 4DEPC 5FS5A 1N68A 2YUWA 1FLRH 5J11B 2QHLA 4WFHD 4XX1G 1EFXA 2RCSH 5DMIL 1E5CA 4XT1C 3TPUB 3WENA 3INUH 4KGJA 3IFNL 1CN4A 3II3A 4Y89A 2CO3A 5EEZA 4BKLA 3AWEA 3OD3A 1OHQA 1P7BA 4J3OF 1DQJA 5TTRA 2C1OB 1T1ZB 1IVTA 1FVDA 4XPTH 1MELA 3EGXA 2FX8H 3KPRA 4PJAE 5E0QA 4MSWB 4UT9L 5A2KH 1EO8H 2ZP0T 4BZ2A 3MJ6A 4JGUA 5GGTA 1BVLA 1PNCA 3PDOB 5AB9A 3N9GH 3WMQA 4IBUA 2OSLB 2R1WB 3U1PA 3AC0A 1AGDB 1NCBL 5TQ2L 2RA1A 4OCYH 5DSCB 2EDFA 2CCWA 4GQZA 4F7MA 4GBXA 1K5NA 4QKTA 3CFDA 4FMKA 1TVBA 2JKIS 1FG9C 2AXGB 2DTMH 2ZOKA 5E9AA 3VWKB 5I0XA 1JWMA 2DICA 4XNZB 1Q0YL 3BHBA 1IKNA 1IKOP 3GM8A 3K8KA 1AP2A 4JN2B 1RZGB 4WDIA 4UQCA 3ZHKA 3VWKD 2F19H 3CBRA 3ZL1A 1PLCA 1X4YA 3F7VA 2M26A 4PJCA 1A7BA 5L88H 3PGCB 1FRGH 4BGLA 5FYKE 2IPKA 4CSSA 2HH0H 5JPMA 4S0SD 5CGTA 4W93A 4B9YA 4OKVB 4WK2B 3K7UA 4WW2B 2FWLB 3TA3A 1T2QH 1S9YB 1HWGB 5EZIH 5BV7L 6PAZA 3O2VL 2GTWA 1PD6A 1QG3A 3BSZL 2D03L 3CXFA 1I1CA 2B1AL 4YO0A 5GSVB 3D05A 3PNWA 3QXAA 2CM6A 2VAJA 3BH9B 4Y2LA 5IBUB 2DQ6A 4DT2A 3TESA 2W59A 4M8QA 2FE0A 4PY7B 4APQD 4B96A 1BQUA 3QEHA 4XMKL 1QSEB 3V52H 2YGNA 2Y07H 3MLWH 4BJLA 3QPQD 1CDJA 3QIBB 3S5LA 4CGUB 1JGDA 3UTPD 5A7EA 1INEH 1M7DA 3IK2A 5IVOA 2O72A 2C4FU 1U8CB 1I9IL 4AVJA 2VC2H 5FM4A 2I24N 5FM5O 1KDJA 3Q8BA 1JXDA 3B2XA 2OTWB 3QIBD 3M45A 3HG1A 2Z64C 3CFCH 4GEIA 5BS0D 3ZDYE 4PPTA 1N4XL 1Q9OA 3FQUA 1RXLA 3I2CL 2PW2B 4WWKC 4Z5RB 3LJ3A 3NCCB 4G43B 2R56L 5I8OH 3LNGA 4HF5L 4U0QB 2ZOOA 4QTHA 3LHPH 2ENYA 4NAJA 5A2AA 4QCIB 4V11A 4MA3B 1T89A 4JJOA 3FOMB 2JWYA 4MDRA 1BG1A 3O9WA 4PGEA 5HPOA 3GPEA 2C5DC 5DRNA 3TNNA 3GI8H 3T3PF 3N42B 1NEZB 2A99A 3MGOB 4JPIB 3U9WA 5DF0A 3WV0A 4XMLH 3UP6A 2A5UA 4FI7A 4JUSA 4OCWL 5DK0A 1A7OL 1ZHLA 1NMBL 1G84A 2AXWA 4FCHA 4M7KH 1DDHB 1JK8B 4OTXH 2VL4A 4ZTOL 1KG0B 3DTXB 1E42A 1XGPA 3K2IA 5JNYA 4G7VL 2YMXL 4JR9L 4KNUA 4X7FC 3C09B 1U4FA 5F9WC 1G0XA 3PF2A 4IKIA 4EE2A 5DFWH 2GUOB 5FDWB 1OM3L 4MNGE 5HY9A 4IU2A 4BH7B 3L1FA 1WC7B 1MW0A 4XMPH 4N87A 4FCAA 5EIIA 1CDYA 4OI8A 1VPOH 4N0UA 2XTJB 1GYAA 4Y4HB 3V0GA 2XFXB 1J10A 4DEPB 3T4AA 1D5RA 2H8PB 3N2JA 1Q94A 2P8LA 2AEQH 1BCIA 1X5AA 5TDOA 4L18A 2APWA 1CFNA 4YNYB 4Y4HD 5EBGA 2VXSH 1SXAA 3MNVA 3LKOA 4NP4H 1KIPB 3BUBA 1ZRUA 1WK0A 2NTFB 3DUSB 4H8WL 3VM7A 3DA0A 1CICA 1N6UA 4QR7A 4JPKL 2YK1H 3AZUA 3BSZA 2BFVH 4NQTA 4NO5B 1MCNA 5D5MF 5JHDE 2VXVH 4WHCA 1I8MA 2H1PL 2QDVA 2E47A 1A6UH 2X1XR 3QIUA 3QXDA 5E1AA 4ANVA 1RU9L 4GQQA 4IRJA 4D3CH 2C9PA 3WN5C 1LYQA 1VZIA 3TBYB 4P2YA 2JCCB 2KLSA 2WNKA 4IOIA 4UZGA 2G2PA 4NN7C 4WEMB 4WI2A 1UH3A 4TQHA 3MREA 5CU9A 3KS0H 3LZRA 1T5WA 2F54A 1QUNA 3PY9A 1F1AA 3D6GA 3DV6B 1BYNA 5HI4D 3UTZB 1IGIH 4Z7UE 5AAMC 3FC8A 3V5KA 2WM0A 3NIFB 3I6GB 4LSPH 1SN0A 3FH5A 4CA4A 2ADJB 3QWOB 3QZLA 4FYSA 4NB7A 4LCUA 4LLAA 5H4YA 2OMUA 1TO5A 4O5LH 3W1ZA 4XAWL 1JXJA 3EF4A 4DGIH 3LKRB 1EAQA 4G6ML 3TJPA 1NSNH 4XP5L 1NINA 3SE9L 3QORC 4XBPA 2NUTA 3T6QC 4HUXB 2OMVB 1QRNA 3BZ4A 4OGXL 3AU1B 2J43A 4BE5A 2XWBB 3ATAA 4XN4A 4LEBA 4JQVA 1XIWC 1WUNT 1AGDA 1IAOB 3GIZL 3LV3A 3DNKA 4QHMB 2AQQA 3BZ5A 4I9WE 2J8UA 3S8GB 5DI8B 3STLA 2CK0H 5D7LD 2BIHA 4MD0B 1MHCB 4YGVB 5GGVL 1AMXA 4HIJB 5E2VH 2FUQA 3MYJA 3QIWA 2FEEI 2FX9L 3WJLA 4BFEA 4OFVA 3OTTA 4WEBL 2X1PA 5DC0A 3SGEI 1RZGA 2DYRB 3ES6A 4J3SA 5DJAB 1CFVH 1RULL 3NDYE 3GKWH 3PV7A 3GSQB 4P9HL 3BAXA 2LR4A 2W81C 1DP0A 4TSCH 5D71H 1GMIA 5HHOB 1PY4A 4J3VA 2WQSA 2WV3A 5DJ6A 3NRPA 4ABVA 4U6HB 5FYJL 1Z9NA 1MJ8L 4KY1H 1PIGA 5HJGA 3H9SE 4GRMA 3WHE1 2NSXA 3CFUA 1KXTB 2FJSA 5HHOD 4WWKB 4GAFB 5C0NC 1K8DB 1KLFA 3U1SL 1G7HA 3EYQC 1NGZB 1FFOA 4YSTA 4JFHE 1OAXH 3HBPA 3QDME 5GSVA 4K3EH 1H0DB 4M7LH 4WWKD 1IV8A 1V55B 4FI6A 1JWSB 2AABL 2JI1A 4PY7A 1ONQB 4ZQKA 4XCCH 2JKWA 1DANU 5F7EH 1QSEA 4HCGA 4UOZA 2IG2L 3QQ4B 1MRCH 2AI0H 4BH8A 3UZEC 5I5RA 1JGEA 4XB3A 1V7NL 2H26B 2YD4A 4BHUI 4BUQA 3D4CA 8CGTA 5D7EA 5FUOL 4XNDA 2IIJA 5D2LF 4E41E 1GKOA 1ZCRA 5F9WB 3H9HB 2P8MA 2W60B 1FYHB 1FAIH 2VDML 4AGPA 4E0RB 4N2EA 1ZWIA 2ZXBA 3KG5A 4X6CB 2Y7OA 1Z9LA 3EYSL 1MCBA 3TX4A 1F00I 3MA7B 2HWZH 2VC2B 4JE0A 3ARDA 1BJ1J 5JHBA 5LWYH 1YMHA 4MAYA 4B5EA 4YXHL 2EXYC 3ZBMA 1XL4A 4XPFL 4LLMB 4QCIA 1URZA 4R5XA 1O9VA 1MCLA 1C16B 5G2NA 3O6KH 3WFEL 1TTGA 3IGAB 1EHKB 4UQDA 1XF2B 3MGOA 4JPIA 5FV1L 1SVBA 4X8JA 4M8UA 2EIDA 2C8NA 5EUOF 4UOJA 4EN2A 1W0YT 4MNQE 3CIQA 3OQ3B 1G1CA 2VDLH 2R15A 1A66A 4TNEA 1FP5A 3QZWA 4HIEB 5CINL 2DWXA 4OLWL 1DDHA 1JK8A 4GY4A 5LG6A 5E5MB 4WEEA 5JPNA 3KVPA 1KG0A 2L7UA 1T66C 3DTXA 4IIQC 3WN5B 3ZHLA 1CR9L 4P5RA 1PS3A 4AMXA 4NN7B 3V6OE 1SF5A 4L4VE 2R69A 1MEXH 4YBQC 5DJCB 2W9DH 5CR1A 1MH5A 5ERWB 5HHME 3IBEA 3GSRA 4KK8D 4XOBA 4JFUA 1I8LC 1SJEA 4NGHL 3L9BA 3U6RB 3U4KA 4J1UB 5FGBA 1N7ML 1EXUB 4F9LA 3VI3A 5JIHA 2XFXA 5FHBH 4PW9A 1R3KA 4M5ZH 3FUMA 4LEXL 3KPTA 4YHKL 3KLSA 5GRVL 5JLZA 1KTJA 1NFAA 2B0SL 1QFPA 3TN0A 3BLPX 3DXAE 3CAFA 3UTQA 4Z3TA 5CKAA 5ECGA 4Z7WE 3DUSA 2FQDA 3AWFA 1OARH 3LEYL 3MBWA 3P4NB 4AC2A 3H3PL 2R1XA 3O11A 2GKIA 2IBZX 4OLEA 3B34A 5BW7A 1M42A 3OLEA 2LU3A 3QORB 1HNYA 2CH8A 4OZHA 3WI9A 4X6DE 2EH7L 4LSTH 5ICXB 1TNMA 3UJJH 4MAZA 1YAZA 2EYTB 3TBYA 4EOWL 3FXIC 4V2CB 3QJRB 1Y0LB 1XIWB 2VRAA 2WCSA 5AB2A 4H20L 3PIQB 5C8JA 3BZDA 5JW5B 1JZFA 4MB5A 3IDIB 5I8KL 3L4WA 3I6SA 5DFAA 4DGUA 2D0GA 1TMCB 1ETJA 3SE4C 1XIWD 2F7QA 1XF5A 2H6UA 4NDMB 4J3OH 5EBWA 4LAQL 2LT9A 2VXUL 2VT0A 2XN1A 2J2ZB 5IVNA 4JFPB 3DECA 3RRQA 1WUZA 4KMTL 2W9EH 3OKMB 3UBFA 3UG4A 3V4PA 1B4TA 15C8L 4OIAA 1IC4L 3EFFB 3ERXA 3GHBH 3QCTH 4RFEB 3EO9H 2Y5TB 3WJJC 2JJVA 1OE1A 1RKRA 4KV5F 4W4NA 1WISA 3UO8B 4ZAKA 4G59C 3BZFB 4QLWA 4YXKL 5KSUA 3VSQA 2ICWI 4HALA 1ZLSL 2YJLA 1AACA 2XWBA 5K1VA 2PWGA 3DBXB 5J06A