2OL6O

The crystal structure of ospa mutant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
245
structure length
245
Chain Sequence
NSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSNGSSTEEKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer surface protein A
publication title beta-Strand Flipping and Slipping Triggered by Turn Replacement Reveal the Opportunistic Nature of beta-Strand Pairing
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Membrane protein
total genus 44
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2007-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 2ol6O01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2ol6O02
5B11O 3CKFA 2OY8A 2AF5A 2OY7A 2OL7A 2OL6O 2OY1O 2I5VO 5B2AO 3AUMO 3CKGA 3EC5A 5B3MO 2OY5O 1OSPO 2FKGA 2G8CO 1P4PA 1FJ1E 2HKDA 5B10O 2OL8O 2I5ZO 2FKJA 2OYBO 2PI3O
chains in the Genus database with same CATH superfamily
1WUBA 1SXUA 4WF9E 5D48A 2RD7C 2RTDB 2A5BA 3N91A 4GE1A 3FA8A 1JMZA 3BX8A 2RCTA 1LFOA 1SWGA 4QRLA 1HN2A 1FDQA 2RTBB 1EPBA 4PJ2A 3T6LA 4ALOA 2ZAIA 4CDFA 2ACOA 1W4TA 4XMFA 4IAXA 4JGLA 3TZSA 4Y59A 5IRWA 1VWGB 3CCJE 1KQWA 1VQLE 1IFBA 1G5WA 1SREA 2WSJA 2C1SA 1KT4A 3SOTA 1E00A 3EW2A 4O3XB 1SWRA 1GX8A 4NNSA 3PDFA 1Q81G 4Z28A 2QO4A 4IBAA 2AT6X 3FEPA 5FQ8E 2HYSA 2QOMA 2HLVA 3WXQA 4Z2VA 3NQKA 4QAEA 2OY5O 3B2HA 1W6FA 3ZW0B 3O19A 4CPFA 3FDCA 2R73A 1FEMA 3NX1A 2OYBO 4BX7B 1NP1A 2GTLM 1SWUA 2VDFA 3VU1A 1PMPA 4L3RA 3CCEE 3WZQA 5CSEA 3UEXA 2I5ZO 2M4LA 4AZOA 1KZWA 3HOLA 1AVGI 3WJDA 3AEHA 1LDOA 5AQ6A 3APWA 3G71E 2RQ0A 3UEVA 1SY2A 2W2AA 1LIEA 2BS5A 4YGZA 4MEEA 1AQBA 4LZVA 4CK4A 1G74A 1NJIG 3WOVA 3LV4A 4DQ4A 1KT3A 2WEWA 1A2DA 3NADA 3NP1A 4AW8A 3ZW0A 2RTPB 3CBCA 4TQ2A 3SZJA 1ML7A 2OFAA 2K23A 5BVTA 4WCEE 4BX7A 2AVIA 3WJEA 3U03A 4AZQA 4Z2PA 2C1QA 1Q86G 2KTDA 2MWHA 1OPAA 4QZUA 1EUOA 3OW2E 2Y3FA 1RL6A 1LPJA 2IZKA 1S7DA 4I95A 1VQKE 2RTEB 4ORSA 4BVMA 1SWTA 4A1HA 4ODDA 1RSTB 1VWDB 1SWKA 2L67A 5L8IA 4ES7A 4UU2A 2FR2A 5HZ5A 3AUMO 1T0VA 2AH7X 4IRWA 1LDQA 1EW3A 4IOCE 4GD9A 3TGAA 4ML7B 2ZJPE 4XMEA 4MISA 1AVDA 4UU3A 4PSQA 1E2TA 3B2IA 2AT0X 2W2BA 3FENA 1B8EA 5HA1A 3P24A 1HXZA 3HOEA 1ZNGA 2GC9A 3L4RA 3RKGA 1VQOE 5AEOA 4LQZA 4AZNA 4GGRA 1YWBA 1KT7A 1SXYA 2G8CO 3CCME 3HPEA 1YI2E 1PBOA 4AZMA 3IG9A 2MHDA 3CC7E 1LCVA 5LJEA 2IZIA 1RXJA 1BEBA 1SWSA 3OE3A 4OMXA 5HCCC 3F9DA 1EIIA 2Q9SA 1AELA 2F73A 4O3WA 1VYGA 4DNEA 4NV7A 2X8SA 3WJBA 3FEKA 5HZQA 2A2GA 1OEJA 3APXA 5DPQA 3CMEE 2OF8A 1VYFA 1YJ9E 4ORWA 2OVAA 1E5PA 4O4OA 1BSYA 5D47A 1HMSA 3CCVE 4WFVA 1VWQB 3OBLA 4KT5A 1G7NA 4YCHA 1VWAB 4XMCA 5LKEA 1N9MA 1X8PA 4OKAA 4I9RA 3O22A 3B2JA 1TVQA 2LBVA 1IJ8A 2XKLA 1TOWA 3BRNA 3KFGA 1SRJA 1DZPA 4WFBE 1SY3A 5HZ8A 1VQME 5DM6E 5D8JA 3RDUA 1I04A 1D3SA 3I17A 2QA4E 2X8FA 2CBSA 2CM4A 2RTKA 3ZZVA 1SY0A 2FHLA 3VG7A 4N7CA 4O4SA 1T8VA 1HBPA 3RSWA 4CPHB 3EMMA 2L68A 3EYCA 1SWBA 2G78A 2BHVA 5F6ZA 2AT5X 2A3FX 3WYQA 3AKNA 2HZQA 3KFFA 1ICNA 1VWIB 3RE6A 1Y53X 1NDJA 4YBPA 3CF5E 1Z24A 2NNQA 3VG5A 1GKAB 3IFBA 4GH7A 4QYNA 3RDMA 4XMGA 2RTAA 1NGLA 2IZFB 4GNWA 2PI3O 1AB0A 1SWDA 3GE2A 3C76X 3EW1A 1N43A 2GJ5A 2FTBA 1A3YA 2IFBA 4IOAE 1I78A 2HMBA 1SRHA 4HPCA 2QEXE 2JU8A 5GADG 4OMWA 1T68X 1VQ6E 4YFPA 1I05A 4CPHA 1QY1A 1K3BA 1NC9A 1BSOA 1G85A 2JW1A 5F6BA 4GJSA 2W2FA 3CD6E 5JR8A 4GU8A 1FELA 4HPAA 4I3DA 5EPQA 2OL7A 1GKAA 3APUA 3U0DA 1ACDA 3JQOA 1K8AG 1NQNA 1X8NA 1KQXA 2IZDB 1M1KG 1U18A 3CR6A 5FAZA 3VG3A 3TF6A 1VWJB 2UZ2A 3WYPA 3WBGA 1JYDA 2VFCA 5HCDC 1S44A 1PBYA 3BS2A 4O4XA 1BM5A 1Y0GA 3VPJE 2OZQA 1Y55X 2P8GA 5BVSA 5LJHA 3CQNA 4K19A 1D2UA 5B3MO 3ZI8A 4NW4A 4CV7A 4ZFXA 1YWAA 1LKEA 4YKMA 2OVSA 3PPTA 1DF8A 3P6FA 4TJZA 3UAQA 4Z2OA 3KZAA 1LICA 2DJGA 1LNMA 1HQPA 1JQPA 3C77X 3PEDA 1JJJA 1BJ7A 2MO5A 1FTPA 1ALBA 4ORUA 4WHIA 5GAGG 4XMDA 4BX6B 3FA7A 1LIFA 1VWKB 1K73G 2CBRA 2EU7X 1X8UA 5F2BA 2JGSA 2JMBA 3FR5A 4O3YA 5K67A 1VWMB 3FR2A 5HWZA 4GUZA 4ZHCA 3FLLA 3FMZA 1KXOA 4EQAC 4NLJA 1SXWA 1IW2A 3D9WA 4TKBA 5L8OA 5MLCH 4ZHGA 2BT9A 5FQ6E 5CE4A 1YUPA 3CWKA 1TOUA 2O62A 1U0XA 4CSBA 1VQPE 3E3CA 4UY8G 3FELA 2QO5A 5BYPA 2LA7A 4YGGA 3KFIA 2OL6O 3STMX 4IMOA 4ID2A 4FBVA 5AN9B 2RTCB 3BX7A 5K06A 1SWLA 2BSZA 4O4UA 1VQ5E 3CMAE 3JSQA 4BX6A 4YBUA 1IKEA 1Y9TA 5H9LA 5EDCA 1O8VA 1E02A 3WJFA 4BCSA 4U3QA 5HL7E 2FRSA 3S5XA 2ZJRE 1NBXA 1U17A 4U8UM 2CM9A 3G4SE 2AF5A 3T2WA 3LHNA 5D45A 1RLBE 4MIRA 4YKOA 1JYJA 1JIWI 2OTLE 1YIVA 1OSPO 4EFGA 1GX3A 5HA0A 1FE3A 1KGLA 1STRB 2IZGB 3IA8A 3FW4A 1I9HA 1QWDA 1SXXA 3KFHA 2WPUA 4YCEA 2R74A 5KIDA 2A8GA 2QM9A 4DCBA 5C0NA 2FGSA 3CXCE 4EXZA 4GGTA 1STPA 2Z4HA 5IRAA 1KT5A 4NP1A 4YFQA 2OFBA 3ZW2A 3HK1A 2LBAA 2OY7A 1DZKA 1GT1A 5F1EA 4GK9A 4Z27A 3ZUIA 5B10O 4B55A 3FIQA 2ACPX 1VWBB 1GGLA 4LKPA 1RAVA 2GTLO 1CBIA 1EPAA 3LTWA 2G79A 2Y3EA 3BDRA 3NR3A 3WZPA 1SWEA 3EBKA 2IZHB 2F01A 5F7GA 2Z4IA 1SWJA 1FENA 2ANSA 4YVBA 2Q2PA 1N0SA 1A57A 1BWYA 2FS7A 2WQ9A 3SZHA 1KT6A 5LJDA 1DC9A 1HQQA 1K24A 5EEEA 5B5GA 1GT3A 2L9CA 3WZOA 4I3CA 1IKJA 3WJGA 4HFOA 3ZW1B 4QNIA 3RDXA 3NQ9A 3S60A 2LKKA 4GKCA 4INNA 4WBKA 2KTSA 1W5RA 4U8UO 5EDBA 1VQ8E 2GTFX 1DFVA 1JJUA 5CHKA 5GAHG 3QKGA 1VWHB 1EIOA 2IZCB 3T1DA 2Y32A 4GNYA 4L1NA 3GAQA 1RJLC 4Y0SA 3I55E 4DQ3A 2GTLN 5H1SI 2RN4A 1VQ7E 1QVGE 2A2UA 1MUPA 2L5PA 5HTDA 4KC8A 1KL4A 2RTNB 4BJ8A 1O1UA 4O49A 3RDQA 1N7YA 1VWFB 3SLTA 5GAEG 1CBSA 3KQ0A 3P02A 3D4RA 1VWLB 3ZW1A 3NX2A 1MVGA 1JV4A 2K62A 3CKGA 2RTRB 2FKGA 2MJIA 1X89A 2ASNX 4HWMA 1SRFA 1EXSA 1VWPB 1QY0A 4Y0QA 4YGHA 3VGWA 2G7BA 1ERXA 3MVFA 4FBRA 4U67E 5LJKA 1GT5A 1Q82G 1VQNE 4LKTA 1NP4A 3PP6A 4IB6A 3BU1A 4U46A 4U8UN 2JN3A 4ZGFA 2CQLA 2X34A 3RY2A 4TKHA 4YMYA 3BY0A 3WZNA 3MM0A 5DM7E 1E06A 1LCZA 1YIJE 4ORXA 3T2XA 3SAOA 4YFRA 4XMHA 3SZIA 1X8OA 5EEDA 4FQBB 4WFUA 1YWDA 1SLGB 3UEUA 3WJCA 3RE5A 2JU3A 4EEJA 2BS6A 5H9KA 1VPRA 4IAWA 5HZ9A 2VFBA 3CCLE 5L3YA 1QG5A 4MVKA 1HBQA 4GDAA 4M6SA 1MDCA 4ZH6A 1GT4A 1BBPA 2RTIB 1QFTA 3FR4A 4GDZA 1X8QA 4HPDA 4CPIA 2RA6A 1P4PA 3B2KA 1HXLA 5IO7A 3APVA 4CDCA 4O9SA 2Q2MA 1LCWA 4I60A 3EC5A 4N7DA 2YMSA 3D96A 4QZTA 5BVQA 5LJGA 3S26A 1OEKA 2FHNX 2RTFB 4A1YA 2RTGB 2JU7A 1MX8A 1OEEA 2CAMA 4ON1A 4ORRA 1YWCA 5B27A 3AKMA 5KICA 1OBUA 5LKFA 1BLRA 1ZNKA 2A0AA 4U9CA 1UREA 5B11O 1DZMA 1YITE 2RTMA 2HZRA 3U9PC 1GX9A 5B2AO 1XCAA 4I6SA 1VWNB 4QGXA 4FBOA 2RCQA 1ERBA 2AL0X 4ZHFA 2ALLX 3VHIA 1SMPI 3V8UA 3CQRA 3CC2E 1X71A 3ELXA 1VWEB 4NNTA 3D95A 1VQ9E 3F8AA 3TGBA 1FJ1E 1RSUB 3HWDA 2WR6A 1SWCA 2CZUA 3EBWA 3P6EA 5IO6A 3BSZE 4IB7A 1BRPA 4KCAA 1ICMA 2A13A 3O2YA 5AJBA 3D97A 1MEPA 2YG2A 2X46A 3EM0A 2GH7A 1SY1A 4ORYA 3STKA 3OD9A 2OY8A 2MM3A 5JVGE 1BRQA 5HTEA 3SLJA 1QY2A 1CRBA 2FWVA 3P6CA 3RY1A 5KHPA 4GZVA 1CBQA 1GXAA 2DJFA 4YDBA 4BGFA 3KVNA 2X8TA 4YDAA 4R0BA 4CDDA 2IZEB 1I4UA 1N4JA 2DM5A 1LF7A 2F09A 1HMTA 2OVEA 4D6AA 4LZUA 1BSQA 3J7ZG 3VG2A 2OTJE 1ZNLA 4IABA 1KFFA 2FS6A 4WFAE 1YJWE 3CCQE 2RTHB 1M90G 1PM1X 1KL5A 1QFVA 1K9MG 4ZHHA 4KIIA 4Z6JA 3CBSA 4IB8A 1TW4A 1R0UA 2RTOB 2ZJQE 5IO5A 1OBQA 4ZR2A 1EALA 4Y0RA 5DG4A 1JJ2E 4GRJA 5H8TA 3CPWE 3P6HA 3MBTA 3Q34A 1SWAA 2MF6A 2X45A 3ELZA 4NYQA 3ZWEA 4ZHDA 4FGIB 5FENA 1S72E 4QQ1A 2QMIA 1Q7YG 3NPOA 1ZNDA 5JVHE 1OPBA 2X56A 4KC7A 1Y52X 2AKQA 4CPEA 3RZYA 3P6DA 5D4AA 1VWOB 4TNNA 4O3ZA 2IZLB 1IFCA 5EZ2A 2X55A 4JNJA 3NBXX 4GETA 2AT8X 1JZUA 4C5PA 1H91A 1SRGA 1LIBA 2JOZA 3PIOE 5LJCA 3RBYA 3FA6A 2OL8O 5IRUA 3TGCA 1OBPA 2POAA 2IZBA 2KW1A 1QABE 2FKJA 4NYRA 1JMXA 4ALBA 1LIDA 2OF9A 1YJNE 4I3BA 2ZAGA 4AYHA 4BQUA 2X32A 3PH5A 3QQ2A 4HPBA 3PK2A 1LUQA 1KOIA 1EI5A 3MG5A 5H9NA 3C78X 4RUUA 4QYPA 1DF3A 1B0OA 1NQMA 3FA9A 3FYFA 4Y0PA 2AMMX 1UZ2X 4OELA 2OVDA 4GGZA 1PTSA 1AVEA 1HMRA 4ZH9A 1SLEB 4A60A 3F6ZB 2RTLA 2NNDA 4JHQA 5FFHA 2FT9A 1ZRYA 1UYNX 3VG4A 2R56A 1WBIA 3K3LA 1CJ5A 1I06A 4QGWA 4NLIA 4AZRA 4MVEA 3CC4E 3CCSE 4IO9E 2FLJA 1PEEA 5B29A 4A8ZA 2BC3A 2Q4NA 1P6PA 2CZTA 3FW5A 4EKVA 1MK5A 1W2BE 3BLGA 3PECA 1HY2A 1MX7A 2Q39A 2OY1O 4GJVA 1SLFB 3IGEA 2PY1A 5F58A 3NQ3A 5HAEA 1QQSA 5B5FA 3HWFA 1SRIA 2X4MA 4RUNA 1SWOA 4WFNE 3UEWA 2G5LA 1KC8G 1KD1G 3PIPE 1B4MA 4OS0A 3WVMA 1SLDB 2N93A 4KH8A 1YHQE 1JJXA 5HBSA 3CKFA 2OFRX 3X00A 4COTA 3BU9A 4ZJ0A 1KQSE 1QVFE 2KT4B 2I5VO 3MX7A 3VHHA 1CBRA 2ZSCA 1YP6A 3FIDA 4TKJA 1N9YA 4OS3A 2WQAE 4EDEA 3DTQA 3ZQ3A 1UYOX 4OEMA 3JS1A 4QGVA 1S2PA 4MVIA 2OFMX 2A5CA 3I0AA 1RBPA 1DZJA 2KD2A 2C4IA 4BX5B 3S5VA 3G7XA 1KZXA 3I56E 4TLJA 1EQDA 1SWHA 1GM6A 1STSB 5HCEC 2NNEA 3P6GA 1Y9LA 3VE2A 4M7MA 4CDEA 3RDOA 4YH0A 1TXLA 5HZ6A 2LFOA 1A18A 3H3IA 2FR3A 2WWPA 5LJBA 2WEXA 3PQSA 2IZAA 1ZNEA 1YP7A 2RTJA 5FQ7E 2QO6A 1IIUA 5AJCA 3B2LA 2BLGA 2XSTA 3G6EE 1O1VA 3VE1A 4ZGUA 1N8RG 1XKIA 3HWGA 5CYBA 1VWRB 3PQUA 5H9AA 3VG6A 1B56A 3Q6LA 3ZUOA 1SWPA 1KL3A 2RTQB 4BOEA 1VYOA 5L8NA 1MOYA 2IZJA 1DV9A 4JO6A 4D6BA 3HTYA 1SWFA 1SA8A 2E4JA 1VQ4E 4BBOA 4OS8A 4BX5A 3T6FA 4IMNA 3SLOA 4I9SA 2UYWA 3STNA 2LB6A 3CCRE 2HNXA 4MVLA 3RWXA 1VWCB 2NP1A 1SWQA 1ADLA 3DLLE 3DSZA 4AZPA 1RXKA 1LELA 4NV8A 1ZNHA 5JD2A 4Y5DA 2QCBA 1L6MA 1JBHA 1SWNA 4ZCBA 5IXGA 3CMPA 4ARHA 3VHMA 3RDSA 3HWEA 2WUTA 3CCUE 5K68A 1RXHA 2HKDA 1MM9A 4IB9A 2AT3X 3PH6A 2QOSC 3OJYC
chains in the Genus database with same CATH topology
5B11O 3CKFA 2OY8A 2AF5A 3IG9A 2OY7A 2OL7A 2OL6O 2OY1O 2I5VO 5B2AO 3IGEA 3AUMO 3CKGA 3EC5A 5B3MO 2OY5O 1OSPO 1RJLC 2FKGA 2G8CO 1P4PA 1FJ1E 2HKDA 5B10O 2OL8O 2I5ZO 2FKJA 2OYBO 2PI3O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B11 O;  3CKF A;  2OY8 A;  2AF5 A;  2OY7 A;  2OL7 A;  2OL6 O;  2OY1 O;  2I5V O;  5B2A O;  3AUM O;  3CKG A;  3EC5 A;  5B3M O;  2OY5 O;  1OSP O;  2FKG A;  2G8C O;  1P4P A;  1FJ1 E;  2HKD A;  5B10 O;  2OL8 O;  2I5Z O;  2FKJ A;  2OYB O;  2PI3 O; 
#chains in the Genus database with same CATH topology
 1WUB A;  1SXU A;  4WF9 E;  5D48 A;  2RD7 C;  2RTD B;  2A5B A;  3N91 A;  4GE1 A;  3FA8 A;  1JMZ A;  3BX8 A;  2RCT A;  1LFO A;  1SWG A;  4QRL A;  1HN2 A;  1FDQ A;  2RTB B;  1EPB A;  4PJ2 A;  3T6L A;  4ALO A;  2ZAI A;  4CDF A;  2ACO A;  1W4T A;  4XMF A;  4IAX A;  4JGL A;  3TZS A;  4Y59 A;  5IRW A;  1VWG B;  3CCJ E;  1KQW A;  1VQL E;  1IFB A;  1G5W A;  1SRE A;  2WSJ A;  2C1S A;  1KT4 A;  3SOT A;  1E00 A;  3EW2 A;  4O3X B;  1SWR A;  1GX8 A;  4NNS A;  3PDF A;  1Q81 G;  4Z28 A;  2QO4 A;  4IBA A;  2AT6 X;  3FEP A;  5FQ8 E;  2HYS A;  2QOM A;  2HLV A;  3WXQ A;  4Z2V A;  3NQK A;  4QAE A;  2OY5 O;  3B2H A;  1W6F A;  3ZW0 B;  3O19 A;  4CPF A;  3FDC A;  2R73 A;  1FEM A;  3NX1 A;  2OYB O;  4BX7 B;  1NP1 A;  2GTL M;  1SWU A;  2VDF A;  3VU1 A;  1PMP A;  4L3R A;  3CCE E;  3WZQ A;  5CSE A;  3UEX A;  2I5Z O;  2M4L A;  4AZO A;  1KZW A;  3HOL A;  1AVG I;  3WJD A;  3AEH A;  1LDO A;  5AQ6 A;  3APW A;  3G71 E;  2RQ0 A;  3UEV A;  1SY2 A;  2W2A A;  1LIE A;  2BS5 A;  4YGZ A;  4MEE A;  1AQB A;  4LZV A;  4CK4 A;  1G74 A;  1NJI G;  3WOV A;  3LV4 A;  4DQ4 A;  1KT3 A;  2WEW A;  1A2D A;  3NAD A;  3NP1 A;  4AW8 A;  3ZW0 A;  2RTP B;  3CBC A;  4TQ2 A;  3SZJ A;  1ML7 A;  2OFA A;  2K23 A;  5BVT A;  4WCE E;  4BX7 A;  2AVI A;  3WJE A;  3U03 A;  4AZQ A;  4Z2P A;  2C1Q A;  1Q86 G;  2KTD A;  2MWH A;  1OPA A;  4QZU A;  1EUO A;  3OW2 E;  2Y3F A;  1RL6 A;  1LPJ A;  2IZK A;  1S7D A;  4I95 A;  1VQK E;  2RTE B;  4ORS A;  4BVM A;  1SWT A;  4A1H A;  4ODD A;  1RST B;  1VWD B;  1SWK A;  2L67 A;  5L8I A;  4ES7 A;  4UU2 A;  2FR2 A;  5HZ5 A;  3AUM O;  1T0V A;  2AH7 X;  4IRW A;  1LDQ A;  1EW3 A;  4IOC E;  4GD9 A;  3TGA A;  4ML7 B;  2ZJP E;  4XME A;  4MIS A;  1AVD A;  4UU3 A;  4PSQ A;  1E2T A;  3B2I A;  2AT0 X;  2W2B A;  3FEN A;  1B8E A;  5HA1 A;  3P24 A;  1HXZ A;  3HOE A;  1ZNG A;  2GC9 A;  3L4R A;  3RKG A;  1VQO E;  5AEO A;  4LQZ A;  4AZN A;  4GGR A;  1YWB A;  1KT7 A;  1SXY A;  2G8C O;  3CCM E;  3HPE A;  1YI2 E;  1PBO A;  4AZM A;  3IG9 A;  2MHD A;  3CC7 E;  1LCV A;  5LJE A;  2IZI A;  1RXJ A;  1BEB A;  1SWS A;  3OE3 A;  4OMX A;  5HCC C;  3F9D A;  1EII A;  2Q9S A;  1AEL A;  2F73 A;  4O3W A;  1VYG A;  4DNE A;  4NV7 A;  2X8S A;  3WJB A;  3FEK A;  5HZQ A;  2A2G A;  1OEJ A;  3APX A;  5DPQ A;  3CME E;  2OF8 A;  1VYF A;  1YJ9 E;  4ORW A;  2OVA A;  1E5P A;  4O4O A;  1BSY A;  5D47 A;  1HMS A;  3CCV E;  4WFV A;  1VWQ B;  3OBL A;  4KT5 A;  1G7N A;  4YCH A;  1VWA B;  4XMC A;  5LKE A;  1N9M A;  1X8P A;  4OKA A;  4I9R A;  3O22 A;  3B2J A;  1TVQ A;  2LBV A;  1IJ8 A;  2XKL A;  1TOW A;  3BRN A;  3KFG A;  1SRJ A;  1DZP A;  4WFB E;  1SY3 A;  5HZ8 A;  1VQM E;  5DM6 E;  5D8J A;  3RDU A;  1I04 A;  1D3S A;  3I17 A;  2QA4 E;  2X8F A;  2CBS A;  2CM4 A;  2RTK A;  3ZZV A;  1SY0 A;  2FHL A;  3VG7 A;  4N7C A;  4O4S A;  1T8V A;  1HBP A;  3RSW A;  4CPH B;  3EMM A;  2L68 A;  3EYC A;  1SWB A;  2G78 A;  2BHV A;  5F6Z A;  2AT5 X;  2A3F X;  3WYQ A;  3AKN A;  2HZQ A;  3KFF A;  1ICN A;  1VWI B;  3RE6 A;  1Y53 X;  1NDJ A;  4YBP A;  3CF5 E;  1Z24 A;  2NNQ A;  3VG5 A;  1GKA B;  3IFB A;  4GH7 A;  4QYN A;  3RDM A;  4XMG A;  2RTA A;  1NGL A;  2IZF B;  4GNW A;  2PI3 O;  1AB0 A;  1SWD A;  3GE2 A;  3C76 X;  3EW1 A;  1N43 A;  2GJ5 A;  2FTB A;  1A3Y A;  2IFB A;  4IOA E;  1I78 A;  2HMB A;  1SRH A;  4HPC A;  2QEX E;  2JU8 A;  5GAD G;  4OMW A;  1T68 X;  1VQ6 E;  4YFP A;  1I05 A;  4CPH A;  1QY1 A;  1K3B A;  1NC9 A;  1BSO A;  1G85 A;  2JW1 A;  5F6B A;  4GJS A;  2W2F A;  3CD6 E;  5JR8 A;  4GU8 A;  1FEL A;  4HPA A;  4I3D A;  5EPQ A;  2OL7 A;  1GKA A;  3APU A;  3U0D A;  1ACD A;  3JQO A;  1K8A G;  1NQN A;  1X8N A;  1KQX A;  2IZD B;  1M1K G;  1U18 A;  3CR6 A;  5FAZ A;  3VG3 A;  3TF6 A;  1VWJ B;  2UZ2 A;  3WYP A;  3WBG A;  1JYD A;  2VFC A;  5HCD C;  1S44 A;  1PBY A;  3BS2 A;  4O4X A;  1BM5 A;  1Y0G A;  3VPJ E;  2OZQ A;  1Y55 X;  2P8G A;  5BVS A;  5LJH A;  3CQN A;  4K19 A;  1D2U A;  5B3M O;  3ZI8 A;  4NW4 A;  4CV7 A;  4ZFX A;  1YWA A;  1LKE A;  4YKM A;  2OVS A;  3PPT A;  1DF8 A;  3P6F A;  4TJZ A;  3UAQ A;  4Z2O A;  3KZA A;  1LIC A;  2DJG A;  1LNM A;  1HQP A;  1JQP A;  3C77 X;  3PED A;  1JJJ A;  1BJ7 A;  2MO5 A;  1FTP A;  1ALB A;  4ORU A;  4WHI A;  5GAG G;  4XMD A;  4BX6 B;  3FA7 A;  1LIF A;  1VWK B;  1K73 G;  2CBR A;  2EU7 X;  1X8U A;  5F2B A;  2JGS A;  2JMB A;  3FR5 A;  4O3Y A;  5K67 A;  1VWM B;  3FR2 A;  5HWZ A;  4GUZ A;  4ZHC A;  3FLL A;  3FMZ A;  1KXO A;  4EQA C;  4NLJ A;  1SXW A;  1IW2 A;  3D9W A;  4TKB A;  5L8O A;  5MLC H;  4ZHG A;  2BT9 A;  5FQ6 E;  5CE4 A;  1YUP A;  3CWK A;  1TOU A;  2O62 A;  1U0X A;  4CSB A;  1VQP E;  3E3C A;  4UY8 G;  3FEL A;  2QO5 A;  5BYP A;  2LA7 A;  4YGG A;  3KFI A;  2OL6 O;  3STM X;  4IMO A;  4ID2 A;  4FBV A;  5AN9 B;  2RTC B;  3BX7 A;  5K06 A;  1SWL A;  2BSZ A;  4O4U A;  1VQ5 E;  3CMA E;  3JSQ A;  4BX6 A;  4YBU A;  1IKE A;  1Y9T A;  5H9L A;  5EDC A;  1O8V A;  1E02 A;  3WJF A;  4BCS A;  4U3Q A;  5HL7 E;  2FRS A;  3S5X A;  2ZJR E;  1NBX A;  1U17 A;  4U8U M;  2CM9 A;  3G4S E;  2AF5 A;  3T2W A;  3LHN A;  5D45 A;  1RLB E;  4MIR A;  4YKO A;  1JYJ A;  1JIW I;  2OTL E;  1YIV A;  1OSP O;  4EFG A;  1GX3 A;  5HA0 A;  1FE3 A;  1KGL A;  1STR B;  2IZG B;  3IA8 A;  3FW4 A;  1I9H A;  1QWD A;  1SXX A;  3KFH A;  2WPU A;  4YCE A;  2R74 A;  5KID A;  2A8G A;  2QM9 A;  4DCB A;  5C0N A;  2FGS A;  3CXC E;  4EXZ A;  4GGT A;  1STP A;  2Z4H A;  5IRA A;  1KT5 A;  4NP1 A;  4YFQ A;  2OFB A;  3ZW2 A;  3HK1 A;  2LBA A;  2OY7 A;  1DZK A;  1GT1 A;  5F1E A;  4GK9 A;  4Z27 A;  3ZUI A;  5B10 O;  4B55 A;  3FIQ A;  2ACP X;  1VWB B;  1GGL A;  4LKP A;  1RAV A;  2GTL O;  1CBI A;  1EPA A;  3LTW A;  2G79 A;  2Y3E A;  3BDR A;  3NR3 A;  3WZP A;  1SWE A;  3EBK A;  2IZH B;  2F01 A;  5F7G A;  2Z4I A;  1SWJ A;  1FEN A;  2ANS A;  4YVB A;  2Q2P A;  1N0S A;  1A57 A;  1BWY A;  2FS7 A;  2WQ9 A;  3SZH A;  1KT6 A;  5LJD A;  1DC9 A;  1HQQ A;  1K24 A;  5EEE A;  5B5G A;  1GT3 A;  2L9C A;  3WZO A;  4I3C A;  1IKJ A;  3WJG A;  4HFO A;  3ZW1 B;  4QNI A;  3RDX A;  3NQ9 A;  3S60 A;  2LKK A;  4GKC A;  4INN A;  4WBK A;  2KTS A;  1W5R A;  4U8U O;  5EDB A;  1VQ8 E;  2GTF X;  1DFV A;  1JJU A;  5CHK A;  5GAH G;  3QKG A;  1VWH B;  1EIO A;  2IZC B;  3T1D A;  2Y32 A;  4GNY A;  4L1N A;  3GAQ A;  1RJL C;  4Y0S A;  3I55 E;  4DQ3 A;  2GTL N;  5H1S I;  2RN4 A;  1VQ7 E;  1QVG E;  2A2U A;  1MUP A;  2L5P A;  5HTD A;  4KC8 A;  1KL4 A;  2RTN B;  4BJ8 A;  1O1U A;  4O49 A;  3RDQ A;  1N7Y A;  1VWF B;  3SLT A;  5GAE G;  1CBS A;  3KQ0 A;  3P02 A;  3D4R A;  1VWL B;  3ZW1 A;  3NX2 A;  1MVG A;  1JV4 A;  2K62 A;  3CKG A;  2RTR B;  2FKG A;  2MJI A;  1X89 A;  2ASN X;  4HWM A;  1SRF A;  1EXS A;  1VWP B;  1QY0 A;  4Y0Q A;  4YGH A;  3VGW A;  2G7B A;  1ERX A;  3MVF A;  4FBR A;  4U67 E;  5LJK A;  1GT5 A;  1Q82 G;  1VQN E;  4LKT A;  1NP4 A;  3PP6 A;  4IB6 A;  3BU1 A;  4U46 A;  4U8U N;  2JN3 A;  4ZGF A;  2CQL A;  2X34 A;  3RY2 A;  4TKH A;  4YMY A;  3BY0 A;  3WZN A;  3MM0 A;  5DM7 E;  1E06 A;  1LCZ A;  1YIJ E;  4ORX A;  3T2X A;  3SAO A;  4YFR A;  4XMH A;  3SZI A;  1X8O A;  5EED A;  4FQB B;  4WFU A;  1YWD A;  1SLG B;  3UEU A;  3WJC A;  3RE5 A;  2JU3 A;  4EEJ A;  2BS6 A;  5H9K A;  1VPR A;  4IAW A;  5HZ9 A;  2VFB A;  3CCL E;  5L3Y A;  1QG5 A;  4MVK A;  1HBQ A;  4GDA A;  4M6S A;  1MDC A;  4ZH6 A;  1GT4 A;  1BBP A;  2RTI B;  1QFT A;  3FR4 A;  4GDZ A;  1X8Q A;  4HPD A;  4CPI A;  2RA6 A;  1P4P A;  3B2K A;  1HXL A;  5IO7 A;  3APV A;  4CDC A;  4O9S A;  2Q2M A;  1LCW A;  4I60 A;  3EC5 A;  4N7D A;  2YMS A;  3D96 A;  4QZT A;  5BVQ A;  5LJG A;  3S26 A;  1OEK A;  2FHN X;  2RTF B;  4A1Y A;  2RTG B;  2JU7 A;  1MX8 A;  1OEE A;  2CAM A;  4ON1 A;  4ORR A;  1YWC A;  5B27 A;  3AKM A;  5KIC A;  1OBU A;  5LKF A;  1BLR A;  1ZNK A;  2A0A A;  4U9C A;  1URE A;  5B11 O;  1DZM A;  1YIT E;  2RTM A;  2HZR A;  3U9P C;  1GX9 A;  5B2A O;  1XCA A;  4I6S A;  1VWN B;  4QGX A;  4FBO A;  2RCQ A;  1ERB A;  2AL0 X;  4ZHF A;  2ALL X;  3VHI A;  1SMP I;  3V8U A;  3CQR A;  3CC2 E;  1X71 A;  3ELX A;  1VWE B;  4NNT A;  3D95 A;  1VQ9 E;  3F8A A;  3TGB A;  1FJ1 E;  1RSU B;  3HWD A;  2WR6 A;  1SWC A;  2CZU A;  3EBW A;  3P6E A;  5IO6 A;  3BSZ E;  4IB7 A;  1BRP A;  4KCA A;  1ICM A;  2A13 A;  3O2Y A;  5AJB A;  3D97 A;  1MEP A;  2YG2 A;  2X46 A;  3EM0 A;  2GH7 A;  1SY1 A;  4ORY A;  3STK A;  3OD9 A;  2OY8 A;  2MM3 A;  5JVG E;  1BRQ A;  5HTE A;  3SLJ A;  1QY2 A;  1CRB A;  2FWV A;  3P6C A;  3RY1 A;  5KHP A;  4GZV A;  1CBQ A;  1GXA A;  2DJF A;  4YDB A;  4BGF A;  3KVN A;  2X8T A;  4YDA A;  4R0B A;  4CDD A;  2IZE B;  1I4U A;  1N4J A;  2DM5 A;  1LF7 A;  2F09 A;  1HMT A;  2OVE A;  4D6A A;  4LZU A;  1BSQ A;  3J7Z G;  3VG2 A;  2OTJ E;  1ZNL A;  4IAB A;  1KFF A;  2FS6 A;  4WFA E;  1YJW E;  3CCQ E;  2RTH B;  1M90 G;  1PM1 X;  1KL5 A;  1QFV A;  1K9M G;  4ZHH A;  4KII A;  4Z6J A;  3CBS A;  4IB8 A;  1TW4 A;  1R0U A;  2RTO B;  2ZJQ E;  5IO5 A;  1OBQ A;  4ZR2 A;  1EAL A;  4Y0R A;  5DG4 A;  1JJ2 E;  4GRJ A;  5H8T A;  3CPW E;  3P6H A;  3MBT A;  3Q34 A;  1SWA A;  2MF6 A;  2X45 A;  3ELZ A;  4NYQ A;  3ZWE A;  4ZHD A;  4FGI B;  5FEN A;  1S72 E;  4QQ1 A;  2QMI A;  1Q7Y G;  3NPO A;  1ZND A;  5JVH E;  1OPB A;  2X56 A;  4KC7 A;  1Y52 X;  2AKQ A;  4CPE A;  3RZY A;  3P6D A;  5D4A A;  1VWO B;  4TNN A;  4O3Z A;  2IZL B;  1IFC A;  5EZ2 A;  2X55 A;  4JNJ A;  3NBX X;  4GET A;  2AT8 X;  1JZU A;  4C5P A;  1H91 A;  1SRG A;  1LIB A;  2JOZ A;  3PIO E;  5LJC A;  3RBY A;  3FA6 A;  2OL8 O;  5IRU A;  3TGC A;  1OBP A;  2POA A;  2IZB A;  2KW1 A;  1QAB E;  2FKJ A;  4NYR A;  1JMX A;  4ALB A;  1LID A;  2OF9 A;  1YJN E;  4I3B A;  2ZAG A;  4AYH A;  4BQU A;  2X32 A;  3PH5 A;  3QQ2 A;  4HPB A;  3PK2 A;  1LUQ A;  1KOI A;  1EI5 A;  3MG5 A;  5H9N A;  3C78 X;  4RUU A;  4QYP A;  1DF3 A;  1B0O A;  1NQM A;  3FA9 A;  3FYF A;  4Y0P A;  2AMM X;  1UZ2 X;  4OEL A;  2OVD A;  4GGZ A;  1PTS A;  1AVE A;  1HMR A;  4ZH9 A;  1SLE B;  4A60 A;  3F6Z B;  2RTL A;  2NND A;  4JHQ A;  5FFH A;  2FT9 A;  1ZRY A;  1UYN X;  3VG4 A;  2R56 A;  1WBI A;  3K3L A;  1CJ5 A;  1I06 A;  4QGW A;  4NLI A;  4AZR A;  4MVE A;  3CC4 E;  3CCS E;  4IO9 E;  2FLJ A;  1PEE A;  5B29 A;  4A8Z A;  2BC3 A;  2Q4N A;  1P6P A;  2CZT A;  3FW5 A;  4EKV A;  1MK5 A;  1W2B E;  3BLG A;  3PEC A;  1HY2 A;  1MX7 A;  2Q39 A;  2OY1 O;  4GJV A;  1SLF B;  3IGE A;  2PY1 A;  5F58 A;  3NQ3 A;  5HAE A;  1QQS A;  5B5F A;  3HWF A;  1SRI A;  2X4M A;  4RUN A;  1SWO A;  4WFN E;  3UEW A;  2G5L A;  1KC8 G;  1KD1 G;  3PIP E;  1B4M A;  4OS0 A;  3WVM A;  1SLD B;  2N93 A;  4KH8 A;  1YHQ E;  1JJX A;  5HBS A;  3CKF A;  2OFR X;  3X00 A;  4COT A;  3BU9 A;  4ZJ0 A;  1KQS E;  1QVF E;  2KT4 B;  2I5V O;  3MX7 A;  3VHH A;  1CBR A;  2ZSC A;  1YP6 A;  3FID A;  4TKJ A;  1N9Y A;  4OS3 A;  2WQA E;  4EDE A;  3DTQ A;  3ZQ3 A;  1UYO X;  4OEM A;  3JS1 A;  4QGV A;  1S2P A;  4MVI A;  2OFM X;  2A5C A;  3I0A A;  1RBP A;  1DZJ A;  2KD2 A;  2C4I A;  4BX5 B;  3S5V A;  3G7X A;  1KZX A;  3I56 E;  4TLJ A;  1EQD A;  1SWH A;  1GM6 A;  1STS B;  5HCE C;  2NNE A;  3P6G A;  1Y9L A;  3VE2 A;  4M7M A;  4CDE A;  3RDO A;  4YH0 A;  1TXL A;  5HZ6 A;  2LFO A;  1A18 A;  3H3I A;  2FR3 A;  2WWP A;  5LJB A;  2WEX A;  3PQS A;  2IZA A;  1ZNE A;  1YP7 A;  2RTJ A;  5FQ7 E;  2QO6 A;  1IIU A;  5AJC A;  3B2L A;  2BLG A;  2XST A;  3G6E E;  1O1V A;  3VE1 A;  4ZGU A;  1N8R G;  1XKI A;  3HWG A;  5CYB A;  1VWR B;  3PQU A;  5H9A A;  3VG6 A;  1B56 A;  3Q6L A;  3ZUO A;  1SWP A;  1KL3 A;  2RTQ B;  4BOE A;  1VYO A;  5L8N A;  1MOY A;  2IZJ A;  1DV9 A;  4JO6 A;  4D6B A;  3HTY A;  1SWF A;  1SA8 A;  2E4J A;  1VQ4 E;  4BBO A;  4OS8 A;  4BX5 A;  3T6F A;  4IMN A;  3SLO A;  4I9S A;  2UYW A;  3STN A;  2LB6 A;  3CCR E;  2HNX A;  4MVL A;  3RWX A;  1VWC B;  2NP1 A;  1SWQ A;  1ADL A;  3DLL E;  3DSZ A;  4AZP A;  1RXK A;  1LEL A;  4NV8 A;  1ZNH A;  5JD2 A;  4Y5D A;  2QCB A;  1L6M A;  1JBH A;  1SWN A;  4ZCB A;  5IXG A;  3CMP A;  4ARH A;  3VHM A;  3RDS A;  3HWE A;  2WUT A;  3CCU E;  5K68 A;  1RXH A;  2HKD A;  1MM9 A;  4IB9 A;  2AT3 X;  3PH6 A;  2QOS C;  3OJY C; 
#chains in the Genus database with same CATH homology
 5B11 O;  3CKF A;  2OY8 A;  2AF5 A;  3IG9 A;  2OY7 A;  2OL7 A;  2OL6 O;  2OY1 O;  2I5V O;  5B2A O;  3IGE A;  3AUM O;  3CKG A;  3EC5 A;  5B3M O;  2OY5 O;  1OSP O;  1RJL C;  2FKG A;  2G8C O;  1P4P A;  1FJ1 E;  2HKD A;  5B10 O;  2OL8 O;  2I5Z O;  2FKJ A;  2OYB O;  2PI3 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...