2OL6O

The crystal structure of ospa mutant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
245
structure length
245
Chain Sequence
b'NSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSNGSSTEEKFNEKGEVSEKIITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer surface protein A
publication title beta-Strand Flipping and Slipping Triggered by Turn Replacement Reveal the Opportunistic Nature of beta-Strand Pairing
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Membrane protein
total genus 44
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2007-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 2ol6O01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 2ol6O02
3AUMO 2OY7A 3EC5A 3CKFA 2G8CO 5B3MO 2OY1O 2OL6O 2FKJA 1P4PA 2OL7A 2AF5A 2HKDA 3CKGA 2I5ZO 2OYBO 1FJ1E 1OSPO 5B10O 5B2AO 2OY5O 2PI3O 2OL8O 2OY8A 2FKGA 5B11O 2I5VO
chains in the Genus database with same CATH superfamily
1O1UA 5HA0A 4YBPA 4BBOA 3CF5E 3FW5A 1KL5A 3CCVE 2Q2PA 4ALBA 5JR8A 4WFBE 1ZNHA 1SRIA 3ZW1A 3QKGA 2KTDA 1NJIG 3DLLE 2OVEA 4ES7A 5F6ZA 3HTYA 4WF9E 2G8CO 1LDOA 3IFBA 1RSUB 2LKKA 1SWRA 3STMX 3WOVA 1GT3A 3U9PC 1KQXA 1VQ7E 5D4AA 5B2AO 4O4XA 1VQ4E 1OEEA 1KC8G 4A8ZA 2HNXA 5LKFA 1JQPA 1VWHB 2RTLA 5DM7E 1BWYA 5FAZA 4NNTA 5F7GA 1HBQA 1VWPB 3CCUE 3PK2A 4LQZA 4EFGA 2ASNX 1Q82G 4EEJA 2GTLO 1T8VA 4ZHGA 2E4JA 4AYHA 2VFBA 4CPEA 4EDEA 1WUBA 1ALBA 2ALLX 2VDFA 2WR6A 3T6LA 4BX7A 4HPDA 1Y55X 4MVKA 1QFTA 1JJ2E 1NDJA 2AT8X 3HOLA 2JW1A 3RY1A 1EIOA 2GC9A 5L3YA 3PIOE 2RCQA 4D6AA 3N91A 2X46A 3DTQA 4GDZA 4ARHA 1T68X 3F9DA 4Y0SA 1SLEB 4Z28A 1Y52X 4WBKA 2RTGB 1SY1A 1SWUA 4L3RA 1SXUA 5HZ8A 4MVLA 3CQRA 3CCSE 2LBVA 4O3ZA 4NYRA 4ZR2A 2LBAA 1K8AG 4R0BA 1VYFA 1SWAA 5K06A 1UYOX 1PTSA 1STSB 3P6FA 2HZRA 1HN2A 2DJGA 1SWQA 1G74A 4IB9A 3B2KA 1NP4A 1GX8A 1OEJA 1QABE 1ZNLA 1BSQA 4GD9A 3VPJE 2OL7A 2Q2MA 5HZQA 3BDRA 4HFOA 3FA6A 1VWNB 2R74A 5H9NA 3K3LA 4CPFA 1HQPA 1SWEA 4XMHA 3RDMA 2HYSA 1Y9TA 3PIPE 2X32A 1MM9A 1BBPA 3G7XA 1SXXA 1YP7A 3O19A 5F6BA 1KOIA 3VG6A 2AT0X 1M90G 1ZNKA 4KIIA 1HXZA 3CCEE 1LUQA 1S2PA 2CM4A 2FS7A 4GJVA 4ALOA 3EM0A 1P4PA 3SZJA 4NV8A 5H1SI 1FJ1E 3Q6LA 4FBRA 2IFBA 1SWSA 3RE5A 5B5FA 3VU1A 1GX3A 3PPTA 1IW2A 1SXYA 1Y9LA 3NADA 3UAQA 3G71E 2HMBA 1VWRB 1O1VA 5LJGA 4PSQA 2OYBO 4ODDA 5GAGG 1IFCA 4NV7A 1MOYA 1ZNGA 4YGZA 4O4UA 3CCJE 2EU7X 1N0SA 1WBIA 2P8GA 4KH8A 1LIEA 3PP6A 4FQBB 3VG4A 3ELZA 3FMZA 4GKCA 4PJ2A 1JJUA 2KD2A 5JD2A 3CBCA 4IB7A 2BSZA 2JU8A 4IB8A 4CK4A 3S5VA 3BS2A 1BJ7A 5AJBA 1TOUA 2QO6A 3WXQA 1DF8A 3T2WA 3FYFA 3JQOA 4AZPA 5AEOA 4A1HA 4YVBA 4AZRA 3WVMA 4GGTA 1MDCA 2WWPA 5HZ9A 1KGLA 1RLBE 1E02A 2MJIA 2HZQA 4O9SA 3PQUA 2LB6A 3CPWE 3WJDA 4CPIA 4IRWA 2PY1A 4LKPA 5HCEC 2MF6A 4KC8A 5HZ6A 1PM1X 2A5CA 1I4UA 1STPA 1NBXA 5CE4A 3NX2A 2RN4A 4UU2A 1MUPA 3PH5A 1LELA 4ORYA 4QGVA 4TKBA 4Y5DA 1HMRA 1JIWI 3VHMA 3I17A 4GNYA 1MEPA 1JJXA 2A13A 3RDQA 3TGCA 1PBYA 1T0VA 4Z6JA 2WEWA 2A0AA 1EIIA 4YFPA 5FQ7E 1FENA 3FEKA 1VWFB 1EPBA 2W2FA 3TZSA 1NQMA 1I06A 1MK5A 1RXJA 3BU1A 3G6EE 3SZIA 1X8UA 4ID2A 3FENA 3X00A 3IA8A 3KQ0A 4Z2PA 3P24A 1LKEA 4JNJA 1VWJB 3G4SE 4DNEA 4Y0QA 3CC7E 4COTA 1SRJA 4ZHHA 3AKMA 1GT4A 1VWLB 1TVQA 1IJ8A 2RTBB 1HBPA 3GE2A 2AKQA 5D47A 1CBQA 1Q7YG 5GAHG 4IAXA 2QO4A 4ORWA 4OELA 4YH0A 2IZIA 2QOMA 2R73A 5EEEA 1CJ5A 2X8FA 3FR5A 4U8UM 1M1KG 4DCBA 2BC3A 3APWA 3RZYA 5HWZA 1ZRYA 1YIVA 4GJSA 5JVHE 1KZXA 1U17A 5IRUA 3RY2A 4XMGA 3SLJA 5BYPA 1AVGI 3EC5A 5LKEA 1VQPE 3U0DA 1YJ9E 2G7BA 4ZH9A 1KT6A 2IZKA 4AZQA 1VYOA 2IZHB 5H9KA 5CSEA 5HAEA 1JJJA 3JSQA 1P6PA 1VQ6E 2RQ0A 3VG7A 1NP1A 3WBGA 4BOEA 1LCWA 1RXHA 4OEMA 2A2GA 1YJNE 5LJCA 3CWKA 2OFBA 2CQLA 1S72E 4D6BA 4QGXA 4CV7A 4QGWA 4YDBA 5IRAA 3P6GA 2FRSA 2FGSA 2Q4NA 3FA8A 3EBKA 1R0UA 1AELA 3KZAA 2MM3A 1VWOB 2GJ5A 1LIBA 4YFQA 1DZMA 4RUUA 4BX5B 4HPAA 4MVIA 1K24A 4CDEA 1RL6A 3QQ2A 4YCEA 1N43A 3UEUA 1SWBA 1L6MA 5B11O 2OFAA 1VQ5E 3F8AA 1GGLA 4FBVA 2IZBA 1KL3A 1Q86G 4IOCE 2BLGA 4EXZA 3IG9A 1MX7A 4WFVA 5EDCA 4AZMA 2XKLA 5MLCH 1KZWA 2BS5A 1HMSA 1EUOA 1KQWA 2UZ2A 5L8NA 3SZHA 2IZJA 3HOEA 4MEEA 3FLLA 4NP1A 4CDFA 4WFAE 2C1QA 1TOWA 4GUZA 2ZAGA 1YUPA 4YKMA 1N4JA 1N8RG 3VG5A 1SREA 4IAWA 2L5PA 4EKVA 3B2LA 4GETA 3MM0A 5BVTA 3NQKA 5EPQA 1DZJA 4BGFA 4EQAC 3CMEE 1YITE 3F6ZB 5B3MO 2R56A 5HCCC 3FDCA 2YMSA 1SXWA 1SLGB 4ML7B 1N7YA 4OMXA 2YG2A 1BEBA 5AN9B 3MBTA 1GX9A 5IRWA 4O4SA 1VWGB 4BX5A 4YDAA 3RSWA 2FLJA 4M7MA 1GT5A 2LFOA 1G5WA 1RXKA 3NR3A 2Z4IA 4A1YA 3CBSA 3BRNA 3MX7A 5B10O 5B27A 1W6FA 4DQ4A 1VWDB 2QO5A 1YWCA 2Z4HA 1AVEA 2RTQB 4ZHDA 2IZLB 3NQ3A 1KD1G 2FKJA 4YGGA 3RDOA 3HWEA 3WZQA 1SWPA 1VYGA 3ZQ3A 4ZJ0A 2X55A 5KHPA 2AVIA 3OD9A 3NBXX 2AH7X 4A60A 3OE3A 4WHIA 1YWAA 1XKIA 4IBAA 1EPAA 4TLJA 2IZEB 3L4RA 4HPBA 1Q81G 4ZHFA 1EQDA 4M6SA 4WFUA 4QQ1A 4IOAE 2Y32A 2DJFA 4LZVA 4I3CA 1YWDA 1I78A 1PEEA 4MIRA 2OF8A 2FR2A 4IMNA 3ZZVA 1HMTA 4RUNA 2L67A 3OBLA 3VHHA 1JZUA 3P02A 1FELA 2GTLM 4HPCA 3HWFA 1IFBA 1B56A 1G7NA 1KT7A 1RAVA 4XMEA 2X4MA 1LFOA 3C77X 4Z27A 2AF5A 3ZUIA 1SWNA 4QNIA 3E3CA 1LIFA 1OEKA 3RBYA 4N7CA 2RTDB 2W2BA 4I9SA 4NLIA 1SLDB 1K9MG 1FTPA 1KT5A 5D8JA 2RTAA 2CZUA 2XSTA 1OSPO 1BLRA 2FKGA 3WJBA 4OKAA 2OFRX 3KFIA 5K67A 4CDCA 2ZSCA 3D4RA 1AVDA 1S7DA 4LKTA 4KC7A 2PI3O 3NX1A 3ZI8A 1BM5A 1E2TA 1A3YA 1LDQA 2OFMX 4TKJA 1JYJA 3KVNA 2IZGB 4IO9E 1GKAB 2BHVA 3CC2E 3I56E 1RSTB 3BU9A 4OS8A 1ZNEA 1YJWE 4QRLA 1SRGA 1IKJA 2K23A 2OY5O 3CXCE 5LJHA 2RTHB 4HWMA 2AT6X 2DM5A 1KT4A 1HY2A 2L9CA 2CZTA 1FEMA 5LJKA 4ZCBA 3KFFA 1SWCA 2RCTA 1B4MA 2RTPB 1CBSA 2X8TA 5HTDA 1VQOE 1UZ2X 5DM6E 2WUTA 2ZJQE 2Q39A 1U0XA 1EALA 4BX6B 1SY3A 2WQAE 2A5BA 2HKDA 3FIDA 1SWGA 4Z2VA 1OPAA 2OTJE 3UEXA 3EMMA 1B0OA 2KW1A 4GZVA 5KICA 3PEDA 4O4OA 1DZKA 4JHQA 5HZ5A 1X8NA 4KCAA 1QY0A 2AL0X 1VWBB 4ZHCA 1GM6A 3LHNA 2A3FX 4YFRA 3ZW1B 2JGSA 3S5XA 1Y0GA 2RTJA 1X89A 3LV4A 2ZJRE 3CKFA 5HTEA 4GE1A 4ON1A 5JVGE 1ACDA 3P6EA 4FBOA 3IGEA 2RD7C 2WPUA 3C78X 4I9RA 1OPBA 2RTEB 3WZOA 3OW2E 3P6CA 3STKA 1UYNX 3D9WA 1QY2A 4QZUA 1LNMA 3HWGA 2JU3A 1VWEB 5AQ6A 2C1SA 1DV9A 2X8SA 1DFVA 2IZFB 1GKAA 3WJFA 3NQ9A 2OF9A 4NW4A 2RTMA 1VQ8E 5LJBA 4GGZA 4N7DA 2OY7A 1MVGA 1K73G 2QEXE 4I3DA 4DQ3A 4I3BA 4YKOA 2G79A 2IZDB 3P6HA 3B2JA 3C76X 4BX7B 5IO6A 2ACOA 5EEDA 4MVEA 5B29A 1NGLA 1I04A 1SWTA 3FA9A 4UU3A 2HLVA 1JBHA 1VWKB 1XCAA 4JO6A 4XMFA 4O3YA 2ZJPE 1VQKE 4BCSA 1JMXA 3SAOA 3UEWA 3RKGA 3ELXA 3VE2A 2FS6A 1Z24A 2BT9A 2RTFB 1SY2A 1MX8A 3T2XA 3Q34A 3SLTA 4KT5A 2X34A 4TKHA 3FW4A 1OBUA 3RE6A 4ZGFA 1BRQA 3EBWA 2RTIB 2FWVA 4CDDA 1QFVA 4NNSA 4OS0A 2QCBA 3HPEA 5FQ8E 1TXLA 2CM9A 2FHNX 1DZPA 5AJCA 4YGHA 4BQUA 4I60A 2VFCA 1SY0A 3LTWA 1BSOA 2OVDA 3FA7A 3PECA 1KQSE 1BRPA 1G85A 4INNA 5L8OA 3S26A 2M4LA 5D48A 4YCHA 1A2DA 4UY8G 4U67E 3CKGA 2GTFX 4U46A 1AQBA 1RJLC 5B5GA 3TGBA 1FE3A 1UREA 1QWDA 4GDAA 4Y0PA 3CCRE 1SWKA 2IZAA 1VQME 2KT4B 3EW1A 4XMCA 5EZ2A 4NLJA 4WFNE 3APXA 3VHIA 1SWFA 4IMOA 4U8UN 1LCVA 3KFHA 2OL6O 4O3XB 5H9LA 3APUA 2POAA 1YWBA 3FEPA 4L1NA 1E00A 5IXGA 3WJGA 1YI2E 2CAMA 3FR4A 2G5LA 3JS1A 3EYCA 1OBPA 4ZFXA 1N9MA 1QVFE 1K3BA 1QG5A 1X71A 3RDUA 2WQ9A 1RBPA 4GGRA 1JYDA 1QY1A 4FGIB 2JOZA 2WSJA 1A18A 2X56A 3S60A 5FQ6E 2JU7A 1VWIB 3O2YA 1SWLA 2RTKA 5IO5A 1ERBA 2L68A 3WZNA 4CPHB 4O49A 2OY8A 4IABA 4TNNA 2A8GA 3AEHA 1X8OA 5HA1A 2JN3A 1VPRA 4YBUA 1KFFA 2QMIA 2O62A 4ORUA 1EI5A 2OTLE 2AMMX 1SWHA 2C4IA 1ZNDA 3WJEA 5H9AA 1JV4A 3FR2A 1NC9A 1SA8A 3T1DA 4JGLA 2IZCB 1D2UA 2OVAA 5GADG 1CBRA 5C0NA 5HL7E 1X8QA 5LJDA 1I9HA 1CBIA 1SWJA 1NQNA 5L8IA 5K68A 3D97A 4GRJA 4MISA 5F58A 3MVFA 4B55A 2ANSA 1KT3A 3ZW0B 3CQNA 1PBOA 3WZPA 3H3IA 2OVSA 2FTBA 4GK9A 1LPJA 1OBQA 2Y3FA 1E5PA 2RA6A 1O8VA 4OS3A 1BSYA 1VQ9E 4GNWA 5FFHA 4U8UO 2UYWA 2WEXA 3I0AA 3B2HA 1LIDA 1X8PA 1ML7A 3CMPA 1VQLE 1JMZA 3KFGA 1QVGE 1QQSA 2ZAIA 3CCME 3CD6E 1ADLA 3U03A 4QAEA 2W2AA 3OJYC 2F01A 2CBRA 3VG3A 2BS6A 4XMDA 1HQQA 4QZTA 1SRFA 2F73A 3V8UA 1VQNE 5DG4A 4CPHA 1SMPI 2FR3A 4WCEE 1AB0A 1SRHA 4ORSA 5CHKA 2CBSA 1Y53X 1HXLA 3BSZE 2Q9SA 3O22A 2JMBA 1DF3A 3CC4E 1FDQA 1VWQB 2Y3EA 2ACPX 2QA4E 3BLGA 4I95A 4BJ8A 1LICA 3CCLE 2I5ZO 1STRB 3ZW2A 3PDFA 2RTNB 2MHDA 4I6SA 1DC9A 4Z2OA 1B8EA 2NNDA 2RTCB 2X45A 3PH6A 1VWMB 3HK1A 1E06A 1U18A 2F09A 4GU8A 3CR6A 1GXAA 4BVMA 3BX8A 3FIQA 5LJEA 4C5PA 2N93A 5HCDC 4Y0RA 4OMWA 4QYNA 3WJCA 3WYQA 2RTOB 1TW4A 1KL4A 2K62A 3FELA 3AUMO 3ZW0A 3J7ZG 1YP6A 2NNEA 1VWCB 3D95A 3D96A 3GAQA 4AZNA 5DPQA 5FENA 2MO5A 1I05A 4LZUA 3B2IA 5F2BA 2KTSA 1A57A 3NPOA 3CMAE 5GAEG 5CYBA 3VG2A 5IO7A 2QM9A 2FT9A 1D3SA 1ICNA 3P6DA 3VGWA 3UEVA 4ZH6A 1KXOA 2RTRB 4CSBA 1SLFB 2OL8O 2I5VO 1ICMA 5BVQA 3PQSA 2AT3X 4U3QA 2G78A 3I55E 3T6FA 5KIDA 3ZWEA 1EXSA 2A2UA 3AKNA 4O3WA 3HWDA 3BX7A 1CRBA 3NP1A 4K19A 5H8TA 3STNA 2MWHA 3BY0A 2GTLN 2FHLA 1W5RA 2OZQA 5D45A 3DSZA 1SWOA 4AW8A 3SLOA 5EDBA 3SOTA 4Y59A 4ORRA 3RDXA 4TJZA 5HBSA 1SWDA 1H91A 4ORXA 3MG5A 1EW3A 3CCQE 2LA7A 2AT5X 1LCZA 3EW2A 3ZUOA 1IIUA 2GH7A 4IB6A 2QOSC 2OY1O 4NYQA 5F1EA 1PMPA 3TF6A 1YIJE 3RDSA 4ZGUA 1S44A 2NP1A 1LF7A 1W4TA 1W2BE 4AZOA 3RWXA 1VWAB 1ERXA 3TGAA 4GH7A 5BVSA 4QYPA 3APVA 1IKEA 4U9CA 4YMYA 3VE1A 1GT1A 2NNQA 1YHQE 1N9YA 4BX6A 4TQ2A 3WYPA
chains in the Genus database with same CATH topology
3AUMO 2OY7A 3EC5A 3CKFA 2G8CO 5B3MO 2OY1O 2OL6O 2FKJA 3IGEA 1P4PA 3IG9A 2OL7A 2AF5A 2HKDA 3CKGA 2I5ZO 2OYBO 1FJ1E 1OSPO 5B10O 5B2AO 2OY5O 2PI3O 2OL8O 2OY8A 2FKGA 1RJLC 5B11O 2I5VO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AUM O;  2OY7 A;  3EC5 A;  3CKF A;  2G8C O;  5B3M O;  2OY1 O;  2OL6 O;  2FKJ A;  1P4P A;  2OL7 A;  2AF5 A;  2HKD A;  3CKG A;  2I5Z O;  2OYB O;  1FJ1 E;  1OSP O;  5B10 O;  5B2A O;  2OY5 O;  2PI3 O;  2OL8 O;  2OY8 A;  2FKG A;  5B11 O;  2I5V O; 
#chains in the Genus database with same CATH topology
 1O1U A;  5HA0 A;  4YBP A;  4BBO A;  3CF5 E;  3FW5 A;  1KL5 A;  3CCV E;  2Q2P A;  4ALB A;  5JR8 A;  4WFB E;  1ZNH A;  1SRI A;  3ZW1 A;  3QKG A;  2KTD A;  1NJI G;  3DLL E;  2OVE A;  4ES7 A;  5F6Z A;  3HTY A;  4WF9 E;  2G8C O;  1LDO A;  3IFB A;  1RSU B;  2LKK A;  1SWR A;  3STM X;  3WOV A;  1GT3 A;  3U9P C;  1KQX A;  1VQ7 E;  5D4A A;  5B2A O;  4O4X A;  1VQ4 E;  1OEE A;  1KC8 G;  4A8Z A;  2HNX A;  5LKF A;  1JQP A;  1VWH B;  2RTL A;  5DM7 E;  1BWY A;  5FAZ A;  4NNT A;  5F7G A;  1HBQ A;  1VWP B;  3CCU E;  3PK2 A;  4LQZ A;  4EFG A;  2ASN X;  1Q82 G;  4EEJ A;  2GTL O;  1T8V A;  4ZHG A;  2E4J A;  4AYH A;  2VFB A;  4CPE A;  4EDE A;  1WUB A;  1ALB A;  2ALL X;  2VDF A;  2WR6 A;  3T6L A;  4BX7 A;  4HPD A;  1Y55 X;  4MVK A;  1QFT A;  1JJ2 E;  1NDJ A;  2AT8 X;  3HOL A;  2JW1 A;  3RY1 A;  1EIO A;  2GC9 A;  5L3Y A;  3PIO E;  2RCQ A;  4D6A A;  3N91 A;  2X46 A;  3DTQ A;  4GDZ A;  4ARH A;  1T68 X;  3F9D A;  4Y0S A;  1SLE B;  4Z28 A;  1Y52 X;  4WBK A;  2RTG B;  1SY1 A;  1SWU A;  4L3R A;  1SXU A;  5HZ8 A;  4MVL A;  3CQR A;  3CCS E;  2LBV A;  4O3Z A;  4NYR A;  4ZR2 A;  2LBA A;  1K8A G;  4R0B A;  1VYF A;  1SWA A;  5K06 A;  1UYO X;  1PTS A;  1STS B;  3P6F A;  2HZR A;  1HN2 A;  2DJG A;  1SWQ A;  1G74 A;  4IB9 A;  3B2K A;  1NP4 A;  1GX8 A;  1OEJ A;  1QAB E;  1ZNL A;  1BSQ A;  4GD9 A;  3VPJ E;  2OL7 A;  2Q2M A;  5HZQ A;  3BDR A;  4HFO A;  3FA6 A;  1VWN B;  2R74 A;  5H9N A;  3K3L A;  4CPF A;  1HQP A;  1SWE A;  4XMH A;  3RDM A;  2HYS A;  1Y9T A;  3PIP E;  2X32 A;  1MM9 A;  1BBP A;  3G7X A;  1SXX A;  1YP7 A;  3O19 A;  5F6B A;  1KOI A;  3VG6 A;  2AT0 X;  1M90 G;  1ZNK A;  4KII A;  1HXZ A;  3CCE E;  1LUQ A;  1S2P A;  2CM4 A;  2FS7 A;  4GJV A;  4ALO A;  3EM0 A;  1P4P A;  3SZJ A;  4NV8 A;  5H1S I;  1FJ1 E;  3Q6L A;  4FBR A;  2IFB A;  1SWS A;  3RE5 A;  5B5F A;  3VU1 A;  1GX3 A;  3PPT A;  1IW2 A;  1SXY A;  1Y9L A;  3NAD A;  3UAQ A;  3G71 E;  2HMB A;  1VWR B;  1O1V A;  5LJG A;  4PSQ A;  2OYB O;  4ODD A;  5GAG G;  1IFC A;  4NV7 A;  1MOY A;  1ZNG A;  4YGZ A;  4O4U A;  3CCJ E;  2EU7 X;  1N0S A;  1WBI A;  2P8G A;  4KH8 A;  1LIE A;  3PP6 A;  4FQB B;  3VG4 A;  3ELZ A;  3FMZ A;  4GKC A;  4PJ2 A;  1JJU A;  2KD2 A;  5JD2 A;  3CBC A;  4IB7 A;  2BSZ A;  2JU8 A;  4IB8 A;  4CK4 A;  3S5V A;  3BS2 A;  1BJ7 A;  5AJB A;  1TOU A;  2QO6 A;  3WXQ A;  1DF8 A;  3T2W A;  3FYF A;  3JQO A;  4AZP A;  5AEO A;  4A1H A;  4YVB A;  4AZR A;  3WVM A;  4GGT A;  1MDC A;  2WWP A;  5HZ9 A;  1KGL A;  1RLB E;  1E02 A;  2MJI A;  2HZQ A;  4O9S A;  3PQU A;  2LB6 A;  3CPW E;  3WJD A;  4CPI A;  4IRW A;  2PY1 A;  4LKP A;  5HCE C;  2MF6 A;  4KC8 A;  5HZ6 A;  1PM1 X;  2A5C A;  1I4U A;  1STP A;  1NBX A;  5CE4 A;  3NX2 A;  2RN4 A;  4UU2 A;  1MUP A;  3PH5 A;  1LEL A;  4ORY A;  4QGV A;  4TKB A;  4Y5D A;  1HMR A;  1JIW I;  3VHM A;  3I17 A;  4GNY A;  1MEP A;  1JJX A;  2A13 A;  3RDQ A;  3TGC A;  1PBY A;  1T0V A;  4Z6J A;  2WEW A;  2A0A A;  1EII A;  4YFP A;  5FQ7 E;  1FEN A;  3FEK A;  1VWF B;  1EPB A;  2W2F A;  3TZS A;  1NQM A;  1I06 A;  1MK5 A;  1RXJ A;  3BU1 A;  3G6E E;  3SZI A;  1X8U A;  4ID2 A;  3FEN A;  3X00 A;  3IA8 A;  3KQ0 A;  4Z2P A;  3P24 A;  1LKE A;  4JNJ A;  1VWJ B;  3G4S E;  4DNE A;  4Y0Q A;  3CC7 E;  4COT A;  1SRJ A;  4ZHH A;  3AKM A;  1GT4 A;  1VWL B;  1TVQ A;  1IJ8 A;  2RTB B;  1HBP A;  3GE2 A;  2AKQ A;  5D47 A;  1CBQ A;  1Q7Y G;  5GAH G;  4IAX A;  2QO4 A;  4ORW A;  4OEL A;  4YH0 A;  2IZI A;  2QOM A;  2R73 A;  5EEE A;  1CJ5 A;  2X8F A;  3FR5 A;  4U8U M;  1M1K G;  4DCB A;  2BC3 A;  3APW A;  3RZY A;  5HWZ A;  1ZRY A;  1YIV A;  4GJS A;  5JVH E;  1KZX A;  1U17 A;  5IRU A;  3RY2 A;  4XMG A;  3SLJ A;  5BYP A;  1AVG I;  3EC5 A;  5LKE A;  1VQP E;  3U0D A;  1YJ9 E;  2G7B A;  4ZH9 A;  1KT6 A;  2IZK A;  4AZQ A;  1VYO A;  2IZH B;  5H9K A;  5CSE A;  5HAE A;  1JJJ A;  3JSQ A;  1P6P A;  1VQ6 E;  2RQ0 A;  3VG7 A;  1NP1 A;  3WBG A;  4BOE A;  1LCW A;  1RXH A;  4OEM A;  2A2G A;  1YJN E;  5LJC A;  3CWK A;  2OFB A;  2CQL A;  1S72 E;  4D6B A;  4QGX A;  4CV7 A;  4QGW A;  4YDB A;  5IRA A;  3P6G A;  2FRS A;  2FGS A;  2Q4N A;  3FA8 A;  3EBK A;  1R0U A;  1AEL A;  3KZA A;  2MM3 A;  1VWO B;  2GJ5 A;  1LIB A;  4YFQ A;  1DZM A;  4RUU A;  4BX5 B;  4HPA A;  4MVI A;  1K24 A;  4CDE A;  1RL6 A;  3QQ2 A;  4YCE A;  1N43 A;  3UEU A;  1SWB A;  1L6M A;  5B11 O;  2OFA A;  1VQ5 E;  3F8A A;  1GGL A;  4FBV A;  2IZB A;  1KL3 A;  1Q86 G;  4IOC E;  2BLG A;  4EXZ A;  3IG9 A;  1MX7 A;  4WFV A;  5EDC A;  4AZM A;  2XKL A;  5MLC H;  1KZW A;  2BS5 A;  1HMS A;  1EUO A;  1KQW A;  2UZ2 A;  5L8N A;  3SZH A;  2IZJ A;  3HOE A;  4MEE A;  3FLL A;  4NP1 A;  4CDF A;  4WFA E;  2C1Q A;  1TOW A;  4GUZ A;  2ZAG A;  1YUP A;  4YKM A;  1N4J A;  1N8R G;  3VG5 A;  1SRE A;  4IAW A;  2L5P A;  4EKV A;  3B2L A;  4GET A;  3MM0 A;  5BVT A;  3NQK A;  5EPQ A;  1DZJ A;  4BGF A;  4EQA C;  3CME E;  1YIT E;  3F6Z B;  5B3M O;  2R56 A;  5HCC C;  3FDC A;  2YMS A;  1SXW A;  1SLG B;  4ML7 B;  1N7Y A;  4OMX A;  2YG2 A;  1BEB A;  5AN9 B;  3MBT A;  1GX9 A;  5IRW A;  4O4S A;  1VWG B;  4BX5 A;  4YDA A;  3RSW A;  2FLJ A;  4M7M A;  1GT5 A;  2LFO A;  1G5W A;  1RXK A;  3NR3 A;  2Z4I A;  4A1Y A;  3CBS A;  3BRN A;  3MX7 A;  5B10 O;  5B27 A;  1W6F A;  4DQ4 A;  1VWD B;  2QO5 A;  1YWC A;  2Z4H A;  1AVE A;  2RTQ B;  4ZHD A;  2IZL B;  3NQ3 A;  1KD1 G;  2FKJ A;  4YGG A;  3RDO A;  3HWE A;  3WZQ A;  1SWP A;  1VYG A;  3ZQ3 A;  4ZJ0 A;  2X55 A;  5KHP A;  2AVI A;  3OD9 A;  3NBX X;  2AH7 X;  4A60 A;  3OE3 A;  4WHI A;  1YWA A;  1XKI A;  4IBA A;  1EPA A;  4TLJ A;  2IZE B;  3L4R A;  4HPB A;  1Q81 G;  4ZHF A;  1EQD A;  4M6S A;  4WFU A;  4QQ1 A;  4IOA E;  2Y32 A;  2DJF A;  4LZV A;  4I3C A;  1YWD A;  1I78 A;  1PEE A;  4MIR A;  2OF8 A;  2FR2 A;  4IMN A;  3ZZV A;  1HMT A;  4RUN A;  2L67 A;  3OBL A;  3VHH A;  1JZU A;  3P02 A;  1FEL A;  2GTL M;  4HPC A;  3HWF A;  1IFB A;  1B56 A;  1G7N A;  1KT7 A;  1RAV A;  4XME A;  2X4M A;  1LFO A;  3C77 X;  4Z27 A;  2AF5 A;  3ZUI A;  1SWN A;  4QNI A;  3E3C A;  1LIF A;  1OEK A;  3RBY A;  4N7C A;  2RTD B;  2W2B A;  4I9S A;  4NLI A;  1SLD B;  1K9M G;  1FTP A;  1KT5 A;  5D8J A;  2RTA A;  2CZU A;  2XST A;  1OSP O;  1BLR A;  2FKG A;  3WJB A;  4OKA A;  2OFR X;  3KFI A;  5K67 A;  4CDC A;  2ZSC A;  3D4R A;  1AVD A;  1S7D A;  4LKT A;  4KC7 A;  2PI3 O;  3NX1 A;  3ZI8 A;  1BM5 A;  1E2T A;  1A3Y A;  1LDQ A;  2OFM X;  4TKJ A;  1JYJ A;  3KVN A;  2IZG B;  4IO9 E;  1GKA B;  2BHV A;  3CC2 E;  3I56 E;  1RST B;  3BU9 A;  4OS8 A;  1ZNE A;  1YJW E;  4QRL A;  1SRG A;  1IKJ A;  2K23 A;  2OY5 O;  3CXC E;  5LJH A;  2RTH B;  4HWM A;  2AT6 X;  2DM5 A;  1KT4 A;  1HY2 A;  2L9C A;  2CZT A;  1FEM A;  5LJK A;  4ZCB A;  3KFF A;  1SWC A;  2RCT A;  1B4M A;  2RTP B;  1CBS A;  2X8T A;  5HTD A;  1VQO E;  1UZ2 X;  5DM6 E;  2WUT A;  2ZJQ E;  2Q39 A;  1U0X A;  1EAL A;  4BX6 B;  1SY3 A;  2WQA E;  2A5B A;  2HKD A;  3FID A;  1SWG A;  4Z2V A;  1OPA A;  2OTJ E;  3UEX A;  3EMM A;  1B0O A;  2KW1 A;  4GZV A;  5KIC A;  3PED A;  4O4O A;  1DZK A;  4JHQ A;  5HZ5 A;  1X8N A;  4KCA A;  1QY0 A;  2AL0 X;  1VWB B;  4ZHC A;  1GM6 A;  3LHN A;  2A3F X;  4YFR A;  3ZW1 B;  2JGS A;  3S5X A;  1Y0G A;  2RTJ A;  1X89 A;  3LV4 A;  2ZJR E;  3CKF A;  5HTE A;  4GE1 A;  4ON1 A;  5JVG E;  1ACD A;  3P6E A;  4FBO A;  3IGE A;  2RD7 C;  2WPU A;  3C78 X;  4I9R A;  1OPB A;  2RTE B;  3WZO A;  3OW2 E;  3P6C A;  3STK A;  1UYN X;  3D9W A;  1QY2 A;  4QZU A;  1LNM A;  3HWG A;  2JU3 A;  1VWE B;  5AQ6 A;  2C1S A;  1DV9 A;  2X8S A;  1DFV A;  2IZF B;  1GKA A;  3WJF A;  3NQ9 A;  2OF9 A;  4NW4 A;  2RTM A;  1VQ8 E;  5LJB A;  4GGZ A;  4N7D A;  2OY7 A;  1MVG A;  1K73 G;  2QEX E;  4I3D A;  4DQ3 A;  4I3B A;  4YKO A;  2G79 A;  2IZD B;  3P6H A;  3B2J A;  3C76 X;  4BX7 B;  5IO6 A;  2ACO A;  5EED A;  4MVE A;  5B29 A;  1NGL A;  1I04 A;  1SWT A;  3FA9 A;  4UU3 A;  2HLV A;  1JBH A;  1VWK B;  1XCA A;  4JO6 A;  4XMF A;  4O3Y A;  2ZJP E;  1VQK E;  4BCS A;  1JMX A;  3SAO A;  3UEW A;  3RKG A;  3ELX A;  3VE2 A;  2FS6 A;  1Z24 A;  2BT9 A;  2RTF B;  1SY2 A;  1MX8 A;  3T2X A;  3Q34 A;  3SLT A;  4KT5 A;  2X34 A;  4TKH A;  3FW4 A;  1OBU A;  3RE6 A;  4ZGF A;  1BRQ A;  3EBW A;  2RTI B;  2FWV A;  4CDD A;  1QFV A;  4NNS A;  4OS0 A;  2QCB A;  3HPE A;  5FQ8 E;  1TXL A;  2CM9 A;  2FHN X;  1DZP A;  5AJC A;  4YGH A;  4BQU A;  4I60 A;  2VFC A;  1SY0 A;  3LTW A;  1BSO A;  2OVD A;  3FA7 A;  3PEC A;  1KQS E;  1BRP A;  1G85 A;  4INN A;  5L8O A;  3S26 A;  2M4L A;  5D48 A;  4YCH A;  1A2D A;  4UY8 G;  4U67 E;  3CKG A;  2GTF X;  4U46 A;  1AQB A;  1RJL C;  5B5G A;  3TGB A;  1FE3 A;  1URE A;  1QWD A;  4GDA A;  4Y0P A;  3CCR E;  1SWK A;  2IZA A;  1VQM E;  2KT4 B;  3EW1 A;  4XMC A;  5EZ2 A;  4NLJ A;  4WFN E;  3APX A;  3VHI A;  1SWF A;  4IMO A;  4U8U N;  1LCV A;  3KFH A;  2OL6 O;  4O3X B;  5H9L A;  3APU A;  2POA A;  1YWB A;  3FEP A;  4L1N A;  1E00 A;  5IXG A;  3WJG A;  1YI2 E;  2CAM A;  3FR4 A;  2G5L A;  3JS1 A;  3EYC A;  1OBP A;  4ZFX A;  1N9M A;  1QVF E;  1K3B A;  1QG5 A;  1X71 A;  3RDU A;  2WQ9 A;  1RBP A;  4GGR A;  1JYD A;  1QY1 A;  4FGI B;  2JOZ A;  2WSJ A;  1A18 A;  2X56 A;  3S60 A;  5FQ6 E;  2JU7 A;  1VWI B;  3O2Y A;  1SWL A;  2RTK A;  5IO5 A;  1ERB A;  2L68 A;  3WZN A;  4CPH B;  4O49 A;  2OY8 A;  4IAB A;  4TNN A;  2A8G A;  3AEH A;  1X8O A;  5HA1 A;  2JN3 A;  1VPR A;  4YBU A;  1KFF A;  2QMI A;  2O62 A;  4ORU A;  1EI5 A;  2OTL E;  2AMM X;  1SWH A;  2C4I A;  1ZND A;  3WJE A;  5H9A A;  1JV4 A;  3FR2 A;  1NC9 A;  1SA8 A;  3T1D A;  4JGL A;  2IZC B;  1D2U A;  2OVA A;  5GAD G;  1CBR A;  5C0N A;  5HL7 E;  1X8Q A;  5LJD A;  1I9H A;  1CBI A;  1SWJ A;  1NQN A;  5L8I A;  5K68 A;  3D97 A;  4GRJ A;  4MIS A;  5F58 A;  3MVF A;  4B55 A;  2ANS A;  1KT3 A;  3ZW0 B;  3CQN A;  1PBO A;  3WZP A;  3H3I A;  2OVS A;  2FTB A;  4GK9 A;  1LPJ A;  1OBQ A;  2Y3F A;  1E5P A;  2RA6 A;  1O8V A;  4OS3 A;  1BSY A;  1VQ9 E;  4GNW A;  5FFH A;  4U8U O;  2UYW A;  2WEX A;  3I0A A;  3B2H A;  1LID A;  1X8P A;  1ML7 A;  3CMP A;  1VQL E;  1JMZ A;  3KFG A;  1QVG E;  1QQS A;  2ZAI A;  3CCM E;  3CD6 E;  1ADL A;  3U03 A;  4QAE A;  2W2A A;  3OJY C;  2F01 A;  2CBR A;  3VG3 A;  2BS6 A;  4XMD A;  1HQQ A;  4QZT A;  1SRF A;  2F73 A;  3V8U A;  1VQN E;  5DG4 A;  4CPH A;  1SMP I;  2FR3 A;  4WCE E;  1AB0 A;  1SRH A;  4ORS A;  5CHK A;  2CBS A;  1Y53 X;  1HXL A;  3BSZ E;  2Q9S A;  3O22 A;  2JMB A;  1DF3 A;  3CC4 E;  1FDQ A;  1VWQ B;  2Y3E A;  2ACP X;  2QA4 E;  3BLG A;  4I95 A;  4BJ8 A;  1LIC A;  3CCL E;  2I5Z O;  1STR B;  3ZW2 A;  3PDF A;  2RTN B;  2MHD A;  4I6S A;  1DC9 A;  4Z2O A;  1B8E A;  2NND A;  2RTC B;  2X45 A;  3PH6 A;  1VWM B;  3HK1 A;  1E06 A;  1U18 A;  2F09 A;  4GU8 A;  3CR6 A;  1GXA A;  4BVM A;  3BX8 A;  3FIQ A;  5LJE A;  4C5P A;  2N93 A;  5HCD C;  4Y0R A;  4OMW A;  4QYN A;  3WJC A;  3WYQ A;  2RTO B;  1TW4 A;  1KL4 A;  2K62 A;  3FEL A;  3AUM O;  3ZW0 A;  3J7Z G;  1YP6 A;  2NNE A;  1VWC B;  3D95 A;  3D96 A;  3GAQ A;  4AZN A;  5DPQ A;  5FEN A;  2MO5 A;  1I05 A;  4LZU A;  3B2I A;  5F2B A;  2KTS A;  1A57 A;  3NPO A;  3CMA E;  5GAE G;  5CYB A;  3VG2 A;  5IO7 A;  2QM9 A;  2FT9 A;  1D3S A;  1ICN A;  3P6D A;  3VGW A;  3UEV A;  4ZH6 A;  1KXO A;  2RTR B;  4CSB A;  1SLF B;  2OL8 O;  2I5V O;  1ICM A;  5BVQ A;  3PQS A;  2AT3 X;  4U3Q A;  2G78 A;  3I55 E;  3T6F A;  5KID A;  3ZWE A;  1EXS A;  2A2U A;  3AKN A;  4O3W A;  3HWD A;  3BX7 A;  1CRB A;  3NP1 A;  4K19 A;  5H8T A;  3STN A;  2MWH A;  3BY0 A;  2GTL N;  2FHL A;  1W5R A;  2OZQ A;  5D45 A;  3DSZ A;  1SWO A;  4AW8 A;  3SLO A;  5EDB A;  3SOT A;  4Y59 A;  4ORR A;  3RDX A;  4TJZ A;  5HBS A;  1SWD A;  1H91 A;  4ORX A;  3MG5 A;  1EW3 A;  3CCQ E;  2LA7 A;  2AT5 X;  1LCZ A;  3EW2 A;  3ZUO A;  1IIU A;  2GH7 A;  4IB6 A;  2QOS C;  2OY1 O;  4NYQ A;  5F1E A;  1PMP A;  3TF6 A;  1YIJ E;  3RDS A;  4ZGU A;  1S44 A;  2NP1 A;  1LF7 A;  1W4T A;  1W2B E;  4AZO A;  3RWX A;  1VWA B;  1ERX A;  3TGA A;  4GH7 A;  5BVS A;  4QYP A;  3APV A;  1IKE A;  4U9C A;  4YMY A;  3VE1 A;  1GT1 A;  2NNQ A;  1YHQ E;  1N9Y A;  4BX6 A;  4TQ2 A;  3WYP A; 
#chains in the Genus database with same CATH homology
 3AUM O;  2OY7 A;  3EC5 A;  3CKF A;  2G8C O;  5B3M O;  2OY1 O;  2OL6 O;  2FKJ A;  3IGE A;  1P4P A;  3IG9 A;  2OL7 A;  2AF5 A;  2HKD A;  3CKG A;  2I5Z O;  2OYB O;  1FJ1 E;  1OSP O;  5B10 O;  5B2A O;  2OY5 O;  2PI3 O;  2OL8 O;  2OY8 A;  2FKG A;  1RJL C;  5B11 O;  2I5V O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...