2OLDA

Bence jones kwr protein- immunoglobulin light chain dimer, p3(2)21 crystal form
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
217
structure length
217
Chain Sequence
b'ESALPQPASVSGSPGQSITISCTGTSSDVGGYDLVSWYQHHPGGAPKLIIYEVTNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYASGSTPRIFGGGTRLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bence Jones KWR protein structures determined by X-ray crystallography.
pubmed doi rcsb
molecule keywords Bence Jones KWR Protein - Immunoglobulin Light Chain
molecule tags Immune system
total genus 45
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oldA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oldA02
3PWNB 5F88A 5DLML 5HGBA 4U0RB 2AV7A 5MP6L 2VDOL 3I2CH 3OXSB 4ZUVA 5CKAA 3OAZH 1UH2A 3MBXL 4AG4H 3S36X 1ORQA 2BC4A 2EEDA 4NT6A 2YD3A 4KK5D 5IP4A 4N0YH 4MMZC 2OM5A 5HI3C 3GMLB 2NCMA 4U05A 1DVFB 5IIEB 2VC2L 1U8IA 1IQWL 1WWWX 1L6ZA 3RTQB 5MENE 1SHMA 3G6DH 4Q0XL 5IK3B 3PGCB 3X13A 1PQZB 4HSQA 5EC1B 2DMBA 3ESVF 8FABB 5IBTL 1DQQA 5IHUL 4WIQA 2EDXA 5GHWL 4PJCA 3C5JB 2ICWB 1MFAL 3HFML 2XOTA 4DGYH 2HVJB 3JSSA 4C56B 2D7MA 5I17A 4WU5A 1JPTH 4PJIF 3W9EB 5F7EH 1E0OB 3X17A 4YDKH 2RB8A 3JV6B 1J18A 4JFDD 3IAPA 5A2FA 5JTWA 2F5BL 1MJ8H 1KXTB 4OM1H 2VXTH 3QZWG 1NC2B 1DSFH 2YEZA 4HWEH 5HGHB 3F62A 3V9FA 1G7IB 4U1JB 1JK8A 4QTHB 1MCPH 3SDCC 4LPUA 2OMBA 1Y6KR 2GY5A 1XGUB 1XGRB 4Z78A 4K3JH 3OWEA 3LHPH 4XBEL 1K6QH 2DJ4A 5C08B 1YEDB 4ZUWA 4DK3A 2P45B 5DT1H 5IG7B 2P47B 4R0LC 1OF2B 4M6MH 3ZE2E 3VRJB 5MERA 4JLRB 1NMBL 5L9DH 1A6AA 1DBJL 1FDLL 2F54D 4ALAL 3RRQA 2A9NH 2BSSB 2DI8A 4JGMA 3O6FB 3OKDA 2AV1B 3MXWL 1OTTC 4F8TA 1VPOL 2RQ8A 1EH9A 3UBXI 4X99A 4H20H 5DJCB 1BBDL 4NYLB 5I0DA 1JWUA 2IGFL 1AJ7H 4MAUL 5TDPB 5ENWB 4JZOB 1YMMB 3M8OH 4CN6A 1RIHL 3Q0HA 5E95B 2NY4B 2G75A 5J12B 4ZAKA 2QR0A 2OL3A 3QUXD 3BH8A 5INDA 3OMZA 3O4OC 1ZHNA 4GKZA 3ETBF 5EOTA 1EO8H 3LEXB 4I0KA 3JTSB 1CBVL 4ODUA 3DX8A 3B9VA 2WBKA 3WSQL 1L4IA 2XQBL 3F7RA 2V5SA 2XA3A 3O2VH 3RL2A 2DLFH 4AEHH 5IESL 2ITCB 5M95B 4HLJA 3WFDH 1A2YA 3D85D 1T20A 1GGCH 2C3HA 2EE2A 4HPOL 2EH8L 3EJJX 1CG9B 3DVFA 4RMQA 4PRDA 1T7YA 4KMTL 1NFIA 4H1LA 5FB8B 1BEYL 1DQLL 1F42A 3HMXL 4M4RA 5ECJE 5FM5O 1KXQE 5KVEL 2ZCLH 3A6CH 4OCYH 2EIEA 3E2HC 1ZGLP 2YWYA 3GRWH 4XCCL 4RAVA 4CADB 4HH9A 4YJZL 1DBBH 5CJQL 1YEJH 3L9RB 4KV5E 5F70A 2HTKC 4PJHE 5DRWB 1NC4D 2DKUA 4ODHL 1YYML 3DPBA 2F53A 3HI1B 1N0XH 5F7DB 5D96C 5J3HC 2E7HA 1ADQL 1E28A 1AO7A 5JW4N 1RI8A 2OX5A 3TBSB 4M3KB 1UWXH 1EERB 3BUYB 4LNVA 5DD0H 3HI6H 5C9JB 4XMKH 3KPOA 3VXME 1T6VN 1A7PL 4XXDA 5HDQL 4NHCH 4JG0L 4OV5A 2DQIL 4JKLA 3KPRA 4N5UA 3GSUB 3VGDA 4BFIB 5IBUB 4GAGH 5F9WC 1C7TA 3RWJA 2WW8A 1I1CA 4ODTL 2XTJB 4YBLB 4K3DH 3QEGH 4RIRA 1LO4L 3EYSH 2HJKA 4PJDE 1I9JL 2ESVA 2X4OB 4B53A 4N8CL 1T0MA 2K9UA 2Y5EA 3BOVA 2FX8H 1MPAH 5IQ9B 4RZCB 5HBBA 2X89A 4L3CB 4DTGH 1Y6NR 3VXRA 4UNVA 3TLRA 5CGYD 3JTTB 5C0JA 3GMQA 2EIZA 1BVLA 1Y0LA 1MQKH 2CR3A 3DXAB 1DEDA 3PWJB 2W9EL 1NEUA 1G6RB 1LE5B 1BOYA 5JHLL 3T0DA 1UADC 5EC2B 5DMYA 5BVPH 4ZYKA 4WUUA 1UA6L 4MXWL 4B5EA 3NGBC 3LN4A 1GVIA 4K94C 1L7IH 1XH3A 2BVEA 1CFBA 3EYFB 1I9RL 3ZTNH 1YECL 2A6JB 2DMKA 5IT2H 4L4TE 4MLSA 2FJGA 3MGAA 1DBML 3QEQE 4KTYA 4G8GA 3N9GL 3QDGE 3MLUH 4M00A 5BOPA 5K9QG 4LP5A 5DJ8B 4PLNC 1QD0A 1A3LL 3RWFA 4GKSB 4RGOH 3BPNB 4U2ZA 2IMMA 3HLAA 3SDDD 4AQOA 3O11A 4LVOC 4DN4L 4MJ2A 1IFHH 2E9WA 4LPVA 4DZ8B 3X3FL 1MJUL 2VDQH 1KC5L 4HD9A 3JV4A 3UJJL 1F45A 1DJSA 2JB6B 3ARED 2Q87A 3TN0A 1A4KA 2VO5A 4Y4HB 3L3DB 2ZUQB 4JFYB 3V0AC 4R8WL 4X7TB 3CK0H 3OB8A 2Q7YB 2R1WB 4R2GC 3QWRD 2VQTA 3UJTL 1HKLH 3U2SB 1YY9C 2UWEA 2YZ8A 1VFUA 4P4KB 3VFVA 5SWQA 3O0RL 3PWNA 5L7XL 4FQHB 3VXQB 1XIWD 1A7QH 3DX9B 5DJAB 4M7LL 4H1LH 2KUTA 3VMOA 5E56A 4Z0BL 2OP4L 3UX9B 5HHPA 1KEMH 3SCMC 3OXSA 1U3HC 3WN5A 4M8QA 4OFVA 2AJXH 4XXCC 1OAKL 2ZOKB 5BCAA 4E41D 3PP3K 1NLBL 4FNLL 1D9KD 2UZXB 4LCIL 4EI5C 5JQ6H 1UACH 2H2SD 4QRUA 3GMLA 1MFBL 1CICC 1WK0A 4Q9CA 5IVXB 3X11B 4JPIA 5A3IC 5IIEA 4HWNA 3ULUE 5J1SC 1T1ZA 3A0OA 4OFIA 2XZCL 4XBGA 5TE6L 5IK3A 3RUGB 4OZHE 4ELKB 1PQZA 4ONGL 1SMOA 3GKWL 4PJGF 4R26H 2FIRT 1KIQB 3PHOB 3MLYH 3DRTB 5IF0B 1S7RB 2DQCH 5C09D 4D3CL 1HHHB 3WEXB 2ADIB 2AJ3A 2CIKB 2HVJA 3KPPB 1CGSH 1VESA 4XNUH 4JEGB 1H3VA 2FJFA 5T5NF 3ULSB 3W9EA 1ZT4B 2I9TB 4K3EL 4MJ4A 3NCEB 4JGJA 1J05B 4N8VG 2LU7A 1MJ7L 4RGMB 5F9OH 4TQEL 4EUPG 3ARYA 3SDYL 1NBZB 3BDXA 4LLMA 5JOPE 2VSDA 3H2WA 3IDMB 1DANU 5I1KL 3SE8L 1UWEH 4G80B 2IC2A 4AY0A 4NO5B 2BY0A 5F1OB 1NC2A 2D7TH 4PS4L 4F15B 3SHSA 1YPZE 5HGHA 5E00A 4UT6L 3DI2B 2X05A 4QTHA 4UTAH 4ZS7L 1BM3H 1N6QL 1N4XL 2X4TB 5C86A 1XGUA 1XGRA 1CD8A 1A21A 4RBPH 5F1NA 3WHE0 2FATH 1KELL 5C08A 2W0FA 4UINL 4AMKL 2DL2A 5CINL 1A3RL 3IRZA 3VRJA 2P43B 4JLRA 5INCB 3GSQA 3D0LB 3KLHD 4ERSL 3QDMB 3WO4C 4CVXB 2F5AH 3OZ9H 3OGOE 4JVWA 3RNQA 1IKFL 2AV1A 3TJEH 3HHRB 3MLZL 4PRBA 4FXKB 3QXWA 1AKJB 4CVZA 1ED3B 3UPRB 4XMLL 2X4UB 1KPRA 3BE1L 4M1DH 5DJCA 4DW2H 4XP9H 4D0BA 5A40E 3DX6B 2DWDB 5TDPA 5ENWA 4JZOA 1YMMA 3JV5A 4Y1AB 4F7MB 1PG7H 2EDNA 1VKXA 1RZFH 4C58B 2PXYD 3U48A 1YEKH 3LEXA 2QHRH 2VDKH 1QFPA 1WLHA 2ZPKH 1YEFL 3CD4A 4QRRA 2YRZA 3VFRB 3KNBB 2VDPL 2CDGB 3PGDB 2ITCA 4KI5E 3IT8D 2HYMA 5I1EL 2F8OA 4JJ5B 4PY7B 3AB0C 3O4LA 2YPVH 5FUOH 4HXAL 5C0CE 3OJMB 2MPAL 4PJCF 1BZ7B 2V17L 5DWUH 4HX1B 1EMTL 5EUOB 4OUOA 1G9NH 3T4AB 4A6YL 2AK4D 3RNKA 3CZFB 1P1ZB 2F8VA 4CADA 3SDCB 4HULB 4ZS6C 3L9RA 1EHLH 4UDUB 3O6MH 3T04D 1I1AB 1X5ZA 2BNQB 2MFNA 4ZXBC 3HI1A 3RFZC 4PJ5B 5DRZA 3KPQA 4JVUA 1HWGB 4W6XB 1CU4L 1U6AH 4XCYA 5ICYA 3D18A 2M1KA 3TBSA 3E3QC 5F89B 3BP4B 3QJHB 1YNKL 3O41B 3VW3H 1YJDH 4GW5B 1INQB 2D9CA 4JO3L 4BYHA 5TFSH 3U9PH 4LIQL 3TA3B 1CGWA 3GSUA 1TITA 1RHHB 1VGKB 4BFIA 3DUUB 5M7QA 1FAIL 4G9DB 3UPCA 4JFDE 2IAND 4PPTA 4X6CE 4HFWA 1HOCB 4R6UA 2X4OA 4L4VA 4S1RH 3KR3L 3FN0H 3O4OB 1WBXA 4L3CA 2NY5H 5JW5B 1AGDB 2DQTL 4P2QD 4PR5A 5F9JB 3RDTC 4K2UH 4B0MM 1BOGA 3CVHL 4N5ED 4AL8L 3JTTA 1GSMA 4IRSD 1QTYT 2JJWA 1EJ6A 3HZKA 4M4PA 5FHAL 3T0VA 1KCVH 3PWJA 4PGJA 2CGRH 5KVMC 3AM8C 5B4MC 1B0GB 1T1XA 2R56L 5EC2A 4EBQL 1EFQA 4JRXA 1G7JB 4YHZH 5EZOH 5FYJH 2BY1A 4XCFL 4OIBA 25C8H 4D9LL 1CK0H 2A1WH 5GS0C 2F54E 3EYFA 1WBYB 3P3YA 3VFOB 2V5RA 3K2UH 4W70A 3E2HB 1DBKH 4KAQH 1MHCB 2N7AA 5F7MC 3H7LA 3LD8C 3MNZA 1T1WA 4NKMA 3FT2B 1BZ9B 5DMGD 2AJVL 5D96B 4CNIB 1CXIA 1E4XL 3NFNB 1W72B 2HMID 3WDHA 4NM4H 1P53A 1KOAA 5I71C 4GKSA 2AS5M 4DOHB 2FIKB 2YBRB 5E2UH 4P5KB 2V9TA 2NY6B 4DGIL 4JRYD 4FA8A 1ZGLB 3FO9B 1BVZA 3R06B 1Q1JL 3OKOB 1AXIB 1FVEB 2JB6A 2HLFC 2P5EA 2P5WD 5E8NB 4KK9D 1M7DB 5F9WB 5FO9B 4Y4HA 1VACB 4HG4K 5CCKH 3L3DA 5DUBB 2E3VA 1JNNH 4TNVF 3S35X 1CQKA 3NIFE 4XVSH 5C6TL 5AAWA 4F2MA 4P4KA 5SWSB 1ZTXH 3QIUC 4FQHA 4XNYL 3MV7A 2DAVA 3DX9A 3IFLL 1TETL 1EK3A 2AK1H 5E2TH 2IQ9H 2Y06H 4J23A 2B4CC 5TPWL 5IWLC 3EZ8A 1CFNB 4P3CH 2RGSA 2ZOKA 5DJ6B 2H2PC 4JPVH 1I9IL 2L4OA 2AEQH 3DHJA 1SEQL 1L7TL 3ARPA 2O5XL 4OZGB 4UB0L 3NGBB 2F15A 3R0MA 4XCNA 3VXTA 5IVXA 3VXUA 4FQXD 1RIVL 4M6OH 3STBA 4L8SC 3EFDL 1IC4L 3QDJD 1XGPB 1TQBC 2Z35B 1KIQA 3PHOA 3DRTA 3T09A 2CIKA 1DQJA 5JA9A 1WZ1H 3KPPA 5IFJB 3TVMA 3LKQB 5F7KC 4UOJA 2J6EA 3QNYB 3SKNB 3ARUA 4YQXL 1V3MA 1ZT4A 1A1OB 4NZRL 3U0PA 1J05A 2JELH 2A83B 1ZA3B 1MWAA 2WBJD 2Z8VC 4LVOB 2QQQA 2D31B 4G80A 5ESAB 4BZ1H 3S3SA 1UFUA 1WCBB 3QFJD 1PY4A 4U3XA 1UJ3C 3I2CL 4KRPC 2X4TA 1VFBB 4KJWD 3BD4A 4R2GB 3WIFA 4AG4L 1W8NA 1HQ4B 4X6FB 4PJ7E 5E8DH 4ZMAT 4URTB 5LWYH 3RGVD 3GGWB 1H3XA 4UI2A 1N5YH 1SYSB 2HRPH 4U6YB 5LQBH 1MRCH 4RISH 4U7KA 3G6DL 1U3HB 5I73C 4KC3B 3VGAC 2ADFL 2UWEF 2KQNA 1HILB 3IKCB 3GI8H 3QG6B 1AKJA 3CMOL 3SQBA 5CWSB 1ED3A 3BW9B 3UPRA 2X4UA 4DGYL 4LPTA 5DHXB 5H37H 3FHAA 1CICB 5IM7B 3DX6A 2DWDA 1JPTL 1FIGH 5F7EL 2C4FU 5DZLA 4YDKL 2ERJC 4F7MA 4JKWA 3NIGF 4EDWH 1MLBB 2CLRB 1MJ8L 2BZDA 4NUGH 1T5XA 2VXTL 2VSCA 4U0QB 4NFBA 3VFRA 1A3QA 5L2KD 4HWEL 2DM3A 3PGDA 1QHOA 4QRQA 1X5IA 2OSLA 4NUJB 3S96B 1MCPL 1R5VB 3KPMB 5FF6B 4K3JL 4Y5YC 1XR9B 1BZ7A 4DFHA 3LHPL 1WAAE 5GGVY 1K6QL 5I8EA 4QWWD 2K1MA 1PX3A 5DT1L 2L0DA 1DDHA 4NNXB 1NGXB 4M6ML 3ARBC 2HFTA 4TVPL 4X4XB 3CZFA 4E41E 1UG9A 2XN9B 5D2NB 4L9LC 4CN1A 2A9NL 4UDUA 2Q6WB 4KZDH 3I85A 3GSRA 1FL6A 3IKKA 4PJ5A 4QY8B 1TENA 3V6OC 4H20L 4PJ8C 4R0LA 5GGRB 1LVEA 1AJ7L 3V2AR 3P0VH 2CQVA 2R9HC 1BMGA 3M8OL 5C09E 4LPYA 3WO4B 1IEBB 1INQA 4Y5VC 3LRSB 4LASH 4X6DE 3D25B 3SY0A 1ZT7A 5ESQB 2A9MH 3QQ4A 3UMTA 2R2HB 5C0BB 1EO8L 1RHHA 4PJXA 1VGKA 4G9DA 4PRPA 2F74A 1Q9LB 3O2VL 2D2OA 4HLZH 4AEHL 2DLFL 1SJEB 2W07A 3WFDL 4L8CB 3MJGX 1GGCL 1HOCA 3OSKA 1RZKH 5E2WH 2J6EH 3MCLH 2Q76A 1I8MB 1RZ8A 2EXWC 5JW5A 4MAYD 5DHYA 5F9JA 2AI0H 4YXLL 4NRXA 4OLWL 1MWAH 2ZCLL 1L9NA 5AYQA 5IJKA 4OCYL 2QKIB 4XX1G 3FO1B 3SGEH 3AB0B 4WEMB 1B0GA 5T1MB 1DBBL 3V8CA 5D6DC 1YEJL 5C7XH 1G7JA 4K8RC 1RHFA 5CHNB 4KUCF 4F58H 2XACC 2O26U 1XCTB 1ERNA 1QLFA 1N0XL 5EZJB 1D5XB 3FOLB 1WBYA 3LB6D 3VFOA 1D3CA 1OLZA 4NP4L 2VXVH 4QXTB 1MHCA 2QHLA 3K0WA 4X5LA 5DD0L 3HI6L 1G0YR 3N0PB 4QHLB 5F44A 5EO0B 5T3ZH 1R5IB 4LHUD 4NHCL 1K85A 2IQAA 1I7UB 3MUZ1 2P24B 3GM0A 4ZXBB 5D7KD 3FT2A 5FGCE 1F4AA 2PCPB 2ATPB 4L4JA 4CNIA 3ZYIA 3KWWB 5J6HA 3NFNA 1T2JA 3HE7A 3P9LB 1OP9A 1S9XA 4YHMH 4K3DL 1AI1H 1IAKB 2YBRA 3QEGL 8CGTA 1CLCA 4P5KA 3EYSL 2CLVA 3FO9A 4BUGA 1MPAL 3TJHC 3R06A 3OKOA 4DTGL 4RMSA 3AMLA 1FVEA 2OTWB 2KBGA 5E8NA 1M7DA 4LCCC 3FRPA 3NZ8B 1VACA 2QSCH 4PG9B 5DUBA 1MQKL 5JDJA 4ZO9A 1UZ6F 3T8XB 5GIRB 1NJ9A 1O5DT 3FFCB 1CD0A 2EH7H 3KGRA 5DGQA 2AK4E 2FR4B 1BBJB 1OCWH 1N8ZA 2WQ8A 1MRFH 3RDTB 4PY8J 3BPLC 3ZTNL 3MCG1 3HE6D 5IT2L 1F6AA 4ELMB 5DVOA 4UDTB 5E9DD 1XZ0B 5DJ6A 1U8QB 5EBWB 4P57B 4M5ZL 1QFWI 1XF4B 1OGAB 4U1IB 1CLZH 3WIHA 4HUMB 5DZNA 2R2CA 3QI9D 5EB9A 4QEGA 4RGOL 5KN5B 1XGPA 5I30H 4PRIB 4FZ8H 3ZYJA 1IFHL 3SE9H 1MY5A 1MJJB 3LD8B 1YY8B 2J88H 3CIQA 2IANE 4M9PA 4U1SB 5IFJA 1GC1C 2VDQL 4Y19B 3LKQA 2VL5A 3MOAH 4Q7DA 1IGTA 2ARJQ 3SKNA 2OL3L 2EDFA 3PWUB 5ID1B 4HKBB 5I71B 4WW1B 1AGEB 3FQRB 4N0FA 5DRNB 4ZSOB 5TDNB 2UV3A 1ZA3A 4P2QE 3CK0L 4LCWA 2UVFA 3BD3A 5FUCE 2CLZA 5C3LD 2D31A 1HKLL 5BVJB 1CE1H 2MQ3A 5I16B 2GHWB 1WCBA 3VDCA 4F9PC 3ARDC 1A7QL 3V4PH 3S88H 1FORH 4ZDHB 1KEML 1VFBA 5EU4B 3OF6A 4GBXA 1C16B 4NO0A 5E6ID 1HQ4A 4HC1A 4NQEB 4X6FA 5EZIL 3DURB 1DUZB 3MFFB 1KG0A 3QIUB 4GRLC 5JQ6L 1UACL 1UKQA 3GGWA 3QNZA 4U6YA 1XAUA 1DE4B 2VL4A 3SCMA 1U3HA 4PD4J 4XXCA 4R26L 2AEPH 2VAAB 3MLYL 5CIPA 5HPOA 2H3NB 3SGEI 2DQCL 4PJIE 4EI5A 3ABZA 2IPTL 3P2TA 1CGSL 2CDFA 5IM7A 1AXSA 1QOKA 4XNUL 2OZ4A 1FYTB 4N0UA 1PDKA 4JB9H 2YOCA 3DUHA 4JRYE 4P2RE 4L8SB 3EJZC 3WNKA 1UGNA 3O2DA 4BH8B 1FL5B 3I6GA 5F9OL 4LIQE 1KIPB 2EDJA 1Z9MA 2CLRA 2P5WE 4EKXA 4E0RB 5I8KH 5IVXF 1UWEL 2YZ1A 1U3ZA 3ULUC 2D7TL 4ZPTB 4OQ1A 3TNNB 2KPNA 4ZAKD 4NUJA 4UTAL 3JWOC 2HT4D 2NXYC 1BM3L 4N8VB 5GISH 1R5VA 1DTUA 4EUPB 1S3KH 4PP2A 2FATL 2IPKB 1JPSH 1BJ8A 2X40A 3QZWA 1X5XA 1VFMA 3QIWA 1M7XA 3E6HB 2YPKB 4Y2DC 2ZG1A 3NCYP 1UJ3B 5BXFB 5F6HJ 4MNHB 2NX5B 5K9JH 4KRPB 2XN9A 3HS0A 2H45A 2HG5B 2F5AL 3DGGA 4EIZC 2Q6WA 4G6MH 4MVBC 3TJEL 4S1DC 3F5WA 3ZT7A 4QY8A 5IKCB 3MR9B 3QDJE 2HRLA 5EN2B 1JNJA 5GGRA 3I50H 4DW2L 4S0TD 1I7ZA 3E0GA 1IEBA 3NAAH 3FZUC 4OCRH 2A2QT 3WIHH 1FG9C 2DI9A 3LRSA 3VGAB 2F53D 3D25A 3BRFA 2EC9U 1PG7L 2VZUA 1RZFL 5ESQA 4S2SB 2XKUA 2R2HA 3RIAF 1AO7D 1LO0L 1YEKL 2VE6A 2QHRL 2VDKL 5I1GH 2BHYA 3TH4T 1V5JA 1SJEA 1OSPH 3OXRB 3K7UA 4L8CA 5MEOA 4KKBC 5JIIA 1C5DA 1NFDA 2ERJB 2VDRH 2YPVL 3KPRD 1CFVH 2JIXB 1TDQA 5FUOL 3DETD 3OAYK 3V4UL 2R29H 4I77H 1I8MA 5DWUL 4QHKI 3QFJE 5DSCB 3FL7A 3WUWG 1INDH 3MGTB 4WI3A 1U91A 1BWMA 5A2JH 1G9NL 1PBYA 1B4RA 5SV4A 1GGBH 2ESVD 4NM8H 2QKIA 3IGAA 1E6OL 4ZTOH 4A2MA 4AH2A 3MSPA 1I3RB 3BD5A 2X89D 4JFPA 3QDHA 1KUMA 4KGJA 1EHLL 4Y5YB 4DKAA 3VXRD 2UVEA 3O6ML 4LNRB 1HI6A 2PO6D 1OGTB 5I76A 1XCTA 5HHQB 1XGYH 3WS3B 1CVRA 5EZJA 1U6AL 4JQXC 4CW1A 3ARGA 1CVSC 5E1AB 3UZVB 1M1SA 3ARBB 4J3SA 2R23B 2FJHB 4HC1H 4WTZG 4QXTA 4WUUD 4ENED 5DEZA 3WFCH 2WWKT 3QIBA 5I2IB 3VW3L 1YJDL 2OXGA 4QHLA 3O6LH 4N0CC 4PP1D 5EO0A 4XZUB 1YEHH 4NCDA 1S7XB 4NWTL 4TULH 2CXGA 5TFSL 3U9PL 2P24A 4OLYH 4Q6IC 2YUXA 4WI9A 4ZXBA 3ARFC 1FQ9C 2N1KA 2ATPA 4HK3J 3KWWA 4PJ8B 4Z77B 4OGYH 2MQ0A 3P9LA 5CIPH 3PNWB 4G8GD 3WXVH 1NCAH 4FQ1H 1IAKA 3IJYB 4RMUA 1ZLWK 1N0LA 5DF0A 4S1RL 3BDBA 4NQDA 2OZ4H 2CDEB 3FN0L 1KCLA 4OBRA 2NY5L 4G6FD 4NBYB 5DK0B 2OK0H 2E9BA 5KSAD 3O2DH 2IAMB 2OTWA 3B2UC 1RK0A 4K2UL 2LFGA 2OR8A 3NZ8A 1CTNA 4PG9A 1PD6A 3GSOB 1IGJA 4ISVA 1QBLH 1HNGA 2CGRL 3T8XA 5GIRA 3ZE0F 1UC6A 3FFCA 1I1RA 3QXTA 4YO0B 3B9AA 4P48A 3MMEB 1UEMA 3PHQB 4YHZL 5EZOL 4PJXF 3ELAT 5FYJL 4RRPG 3RI5K 4XH2A 2UY6A 1CK0L 1ZHKA 2HFFA 1MCBA 1T66D 4M93C 4OI7A 4XC3H 1MI5A 3K2UL 1A7RH 1DBKL 4CKVX 4KAQL 1U42A 1XZ0A 2A73A 1U8QA 4BFGA 4YDJB 4P57A 4UT9H 3QHTC 4G3YH 1UT9A 4BQ8A 1MSPA 4NM4L 1G9EA 5KN5A 1MHEB 3TT3H 1X3DA 4F7CA 4PRIA 5E2UL 3VFTB 1G0XA 1QLEH 3V95A 2VLMD 4TYUA 4HS6B 3VXSB 3G5XB 4Y19A 4ZTPH 2D0FA 4PLKD 4WHYG 3PWUA 5GRJH 1L0XA 4HKBA 5BZWA 2YPLD 4MJ6B 5CCKL 3FQRA 5DRNA 4ZSOA 1R5WB 5TDNA 1JHKH 1RUKH 2PW2B 4XVSL 5BVJA 3IETA 3GMOB 4HKXA 4HMDA 5T33H 5EOQL 1ZTXL 1G1YA 2H26B 3QUXC 5E1HB 3G04B 4LCCB 1T1YA 1UCTA 4ZDHA 2AK1L 5E2TL 1T5WA 2IQ9L 3H9HB 2Y06L 2FEDC 1U92A 4XRCB 2Y36H 4P3CL 4YAQB 3RVTD 1J11A 3VD7A 4JPVL 1CDGA 2AEQL 5C70A 1C16A 4Z9KB 1VGEH 4NQEA 5D6CA 3QIUA 5FYJD 4J8RA 4PJGE 5IEKA 3QUMB 1AD0B 3BPLB 4M6OL 1CI5A 1DE4A 4U1GC 1ZV5A 5IWLA 5C08D 3BDYH 3KPLB 3V5KB 3ZT5A 4KI1A 2B39A 5D7KE 3RVUC 4X5WB 2VAAA 1XGQB 2OYPA 2H3NA 1ZVSB 5DK3A 4FQLH 2B20A 1D5BA 3VGBA 1WZ1L 5I1IH 4QT5B 3BAEH 5KVGL 3LIZH 4I3RH 4P2OC 4KVCL 3MROB 3SPVB 2JELL 4BH8A 1FL5A 3OAUH 3JV0A 4GAYB 3E1F1 2FD6H 1FHGA 1TFHA 1TIUA 1TNMA 5CJOH 4NPYB 5IFHH 5MI0C 2XQYG 4BZ1L 4ZPTA 1TVHB 3HR5B 5H94B 1JIBA 4L4TB 3D2UA 2HVKB 1A1MA 3QEQB 1A6VH 4JZJB 3DRQB 2FHFA 2JTDA 3DYPA 4QRRD 4G43B 4KUCD 2IPKA 5HD8C 1AQDB 5E8DL 3X12B 5L2JB 3HKFA 4LFHG 5DUPH 5LWYL 3E6HA 3O4LD 5E9DE 3ARDB 1N5AB 5F3BB 5BXFA 1UJ3A 5LG1A 2HRPL 4KKAD 1F3JB 2NX5A 4RISL 5LQBL 2HG5A 3EW3B 5CGYC 4OZFG 4HJ0C 3TZVD 3GI8L 5DC0A 5DMIH 5JA8B 3O8XD 2EE6A 3QUZC 4GRLB 3UYPA 5EN2A 1OM3H 2E9JA 2FYYB 2VDLH 5EBLA 5HJ3A 4MA7H 3TBYA 1AGFB 4HEPG 5GGQH 4NZJA 2BMKB 5IVOA 2G2RA 3QCUL 4NUGL 1ZLVH 4ZUSB 1KN4H 3REWA 1IBGH 5D8JH 2A38A 1A9EB 4PJCE 3IS0X 3VD3A 3BZ4B 3OXRA 2Q8AH 1MOEA 3PG2A 4QO1A 5KANG 1KJMB 2WV3A 2JIXA 4X9BA 1QYGH 1MRDH 1GZPB 2XTJD 4OFKA 5GGRY 3SDDC 4L4VD 1I3RA 1KLUB 1NAMB 2NXYB 3FCTA 2O5YH 4HWZB 2FGZA 2VXSH 2EDRA 4N8PA 4KZDL 4JQVC 1JUFA 1OGTA 4QRSB 2XV6B 5HHQA 3WS3A 4M02A 3QT2A 2Q1EA 5E1AA 3VFSB 3FAXA 3ARBA 4Y2DB 1LP9A 2E8ZA 2FJHA 3P0VL 4JRXD 4QRPD 3O3EA 1LO3H 4L9LA 4DN3H 4LASL 3B6SA 3HNTH 3RWHA 2H8PA 4YDIH 5HHNB 2A9ML 2B4CH 3IJHB 1A9BB 4XNMB 3V6OA 4WUKH 4Z77A 3L7EB 1SJXA 1D9KC 3CUPB 3UC0H 2H2SC 3IJYA 4FRWA 3AGVA 3QCTH 4Y5VA 3MLXH 5J9PB 1RZKL 4JGUA 2X4NA 5E2WL 2J6EL 4LVHC 1HDMB 4MJIA 5LGJB 1SY6A 3MCLL 2CDEA 5KSVB 1TVBB 2AI0L 1MWAL 1OARH 4QKXB 3GSOA 1ND0B 1P4IH 4Z8FH 5D1QC 6FABH 4FFWC 1KTKE 5C7XL 3PHQA 2APWA 2P5ED 1JTPA 5GRZA 4OIIH 4F58L 4Y4HD 5C0GB 4GQ9H 1ZLUK 2KQMA 1JZ2A 3WNNA 1T7VA 4RAUA 3S35H 1NFDF 5FO8B 2D7OA 2VXVL 1URLA 4P4KD 1A7OL 5E5RB 3EDFA 5T3ZL 4YDJA 1EBAA 3U1SH 4KKCC 5ABDE 3MV7D 4F7EB 5GRVL 2BCKB 4K7PX 4HAGA 4KKLC 5SX5K 3RPIB 3AS0A 3D48R 4M03A 1PVHA 4Y2OA 1IC1A 2IEPA 3UBXG 2YUVA 2F53E 1T7ZA 4YHML 3MJ6A 2Y9RT 4WDIB 2X4QB 5C0CB 4YHIB 1AI1L 4K7PY 1AO7E 2IH1B 3VFTA 5KAQG 5CBAB 3VFMA 4GOSA 4HS6A 1FJ1B 3VXUD 3KLHC 3VXSA 3G5XA 4Q6IB 3ARFB 3B5TA 3KPRE 1MAJA 3MFGB 1MNUH 3KAAA 2QSCL 1ZS8B 4WJ5B 4FQQB 5H2BB 2YKLH 3KPNB 4DJMA 4MLIA 3TVMD 2GFBA 2PW2A 2EH7L 3TO4D 3VH8G 1WJ3A 2W0KA 4BQ6A 2ESVE 2H26A 2NYYD 5A2LH 3G04A 4LCCA 2QSVA 2PXYC 1I1YA 3VXRE 1NAKH 3H9HA 5DJ2B 3VFWA 2R2EB 1MFEL 3EYVB 4YAQA 1EGJA 1A6TB 4TN9A 3B3IB 4JY5H 3UZQA 5K9OB 4WUUE 3SQOH 1MCNA 1CLZL 3NIDF 2C1OB 3ZTJH 4X6CB 1AD0A 3VI4F 4M93B 4FFZH 1QHPA 2DJSA 2XWJA 4LSDA 4F8QA 3DWTA 1DBAL 3IAQA 5I30L 3KPLA 4HGWB 4QLRA 3CFKA 4FZ8L 1ZT1B 3BKMH 1ZVSA 1P4BH 3SE9L 2FECL 5T3ZD 5IOPA 2J88L 1D6VH 4G8GE 5JR1H 5IJVB 4QT5A 3ZDYF 2D9QB 4M1CC 4XC1H 4J3OC 2V2XB 4UBDC 4Z18A 2ZP0T 3K46A 3MROA 1AKJD 3SPVA 2HFEB 4GAYA 2HKHH 2QJDA 2WANA 4TNWK 5HI3D 4U1MB 3VGHA 4RX4A 1CE1L 4OCNC 2F54B 5CD3B 4JFFD 1TVHA 3HR5A 4XVJH 1I7RA 5H94A 4EDXA 4NC1E 3V4PL 1F4WH 1SY6H 1Q72L 3O45B 3S88L 1FORL 4YHOH 3CMGA 2ZNXA 3DRQA 1RD6A 4LLWA 4JCLA 3QCVH 3PXJA 5GPRA 4XAWH 1AQDA 2MWCA 4X5XB 3TYFB 5F71A 3L3IB 3P0GB 1VCAA 2UWEE 3OPZH 3ARDA 3QUXB 1N5AA 5F3BA 1P2CB 3QB7C 1F3JA 4Y16C 4L5FH 4YWGL 1REIA 1MCLA 1T7XA 2YS4A 3PIQA 4LSPH 3V7AE 1UEYA 4IRSC 3OR6B 2AEPL 5F7LB 5TQ0H 1G84A 4AIOA 3D6GA 2RAMA 3HC0B 1HH6B 1FVCA 1G9MC 5I1LB 3C08H 4J1UB 5SV3A 4K8RH 2FYYA 1SBSH 3EO9H 5JQHC 1YC8A 2VLME 4JB9L 4PYHA 2XFXA 4U1GB 2GSIA 4BM7A 2VOTA 4PJ5D 3WJLC 3QXDB 2DIBA 1QG3A 3CSGA 5I8KL 5EG6C 5A2KH 4G6JH 2YPLE 3T2NH 1YN6B 2ADJA 1CF8H 4KTEH 3IB4A 5BJTA 2X70B 3BZ4A 4GRMB 1HSBB 5E8OA 5GSVA 1JF6A 2ZUUA 4P2OB 5HVFB 4GSDH 1OTTD 5GISL 1KJMA 5FDWB 2WWMD 4UTBH 4A2LA 1S3KL 4Z7VA 2XY1A 2HMIC 5T5NG 4PRPD 1GZPA 1KV3A 2DYPB 1JPSL 1UYWH 1OOAA 2YMXH 2WQRA 1N26A 1FNHA 3SKOB 3JUZA 3L95B 3P73A 2YWZA 2BHUA 2ZSWB 5HI5C 3CU7A 4GRWB 1UH4A 5K9JL 2D7QA 4HWZA 1F2QA 5FYJE 1I8IB 4G6ML 1MIMH 3MYZA 4JHAH 4QRSA 5A43C 5GS2H 1BFTA 5IV2B 4PJFE 1VSCA 3BMVA 1EGJH 5C0DB 2J8UB 4P99A 4Y2DA 3I50L 4JM2A 3NAAL 4OCRL 5B8CC 3WIHL 5MEQB 1F90H 1FNFA 5HHNA 4H0IA 4HW6A 3IJHA 2FH6A 4XNMA 4DVRH 1RULH 1FIEA 1X5HA 1X5LA 2NY0C 1OSPL 2HTKD 3CUPA 4HUVB 4WFHD 5EIVA 1OAZH 1GHFH 1KEGL 2D7NA 2VDRL 1OVZA 1CFVL 2MCPH 4FQXC 1HDMA 4WTWA 5LGJA 4PJ7B 4AM0B 5J3HD 2R29L 4I77L 2X9YA 5MEPB 5LKNA 3HE7D 1BF8A 1INDL 1YNTB 1TVBA 5ISZA 5KSVA 5HVGB 4DUWA 4XHJD 1FNGB 1LEIA 1ND0A 1QPXA 4QRRE 1GGBL 4NM8L 4ZTOL 4TSBH 3ZYOA 1CCZA 1R3HA 2VB5A 3DO3A 1UZ8B 1MCSA 5JXAL 1DL7H 1K9TA 3QULB 2SEBB 3O4LE 3WUWB 1JI2A 5C0GA 4PJ9A 4O02H 1F4XL 4LVEA 1XGYL 2WBJC 3SDDB 3IVKB 3ZL4H 1J0JA 9CGTA 3W0WA 5FO8A 4HC1L 1A14H 1IGFL 1TZHB 2R4RH 1TTUA 2ARJB 2RR3A 3OGCB 3WFCL 2DBLH 3BH9B 1MVUB 3OBAA 2ICEB 3O6LL 3MLTB 1QSED 1YEHL 4F7EA 4TULL 5DD3H 1JZ3A 2F19L 5JMOC 2BCKA 2AQ2A 3G6JA 4OLYL 3RPIA 3IXTA 1QRKA 1JBJA 1DCLA 4JQXA 4OGYL 5A2IH 5E2VH 4WGWB 3WXVL 3I75A 4WDIA 2X4QA 1F11B 3DX7B 2GT9B 4FQ1L 4YHIA 1L9MA 1HYRC 1XIWB 1IGMH 4ONFH 5C0FB 1PY9A 4IJ3C 3LN5B 2OZ4L 2GSGB 3ARFA 1UZ6E 3IJSA 1LP9F 3O2DL 5E8PB 3V6ZA 4O4YH 3CCHA 4PJAB 2Z92B 4E41B 3T0WA 4XNZC 4WI8A 1D9KB 4IRJD 4FQQA 4PFEA 1QBLL 5H2BA 4K9EC 1F13A 2XTJE 2QSQA 4I0PC 2PTUA 4LVHB 3Q5YA 2HJFB 1F00I 4NOFA 5T5FH 4L4VE 5CAYB 4K23H 5C09B 4LCWD 4XC3L 1A7RL 4I13B 3P77B 5DJ2A 3MRNA 4X6DB 1R3LB 2L7JA 3C6SB 3EYVA 2I07B 4U1LB 5D1QB 3MRDB 1KT2B 4Z7UB 5EZLA 1A6TA 1KLFA 1JE6A 1UH3A 4YFLI 3ZE2F 3TBTB 1BECA 3IXAB 4OCWH 4JRXE 4UT9L 1U58B 2C1OA 4QRPE 2DQFB 1F6LL 4G3YL 2NNAB 1I85C 3NACH 4YE4H 3OF6D 3LZFH 1RJYB 4FQPA 2N56A 5DC4B 4GBXD 4XB7A 4NOBA 5I18H 4U1NB 4NO0D 3TT3L 1I3VA 4HGWA 3JVGC 1QLEL 3D3VA 2H32B 4JM4H 2VUYA 2DKSA 3R1GH 1C7SA 3NFPA 5IB4B 4D8PA 4ZTPL 5DD1H 3G5YB 3SCMD 1U3HD 3MX0A 5DS8B 5GRJL 2DI7A 2V2XA 3RKDC 1CDCA 2HFEA 1MIEH 2PNDA 1JHKL 3I84A 4EI5D 4WTXA 1A6WL 4JY4B 4KHXL 3C2AH 1QEWB 1RUKL 5DTFB 2DRUA 5CD3A 4HUXB 2A6IA 4L8DB 5D2LB 4BH7B 1H8NA 1JZ6A 3O45A 3MRKB 3MJ9A 4OFPA 5JPMA 1S7TB 1SBBA 1IKNA 2P5EE 2Y36L 3QO0B 1Z0MA 4WFED 1T0PB 2Y07H 4P4RA 3MRPA 5FGCB 1VGEL 4X5XA 1KFAH 5TDOB 3VXOA 4JY6B 3T0BA 1U2HA 3L3IA 2VABB 4J12A 4F9LA 3QO1B 4MZ3A 5FK9B 2PXYB 5FO7B 3ARQA 3MV7E 4ORGB 5LVEA 3BDYL 1FL3B 3OR6A 1MCQA 3QIWD 1TPXC 4FQLL 4MD4B 3HC0A 1HH6A 4WGVB 5I1LA 3N85H 3MRHA 4J1UA 3SKJH 2JLLA 5I1IL 5B39B 3BAEL 3LIZL 4Z6AT 4M7JL 3V5HB 4ZUTB 3CXHJ 4LOUD 4NQTA 5IVXE 3VXUE 1HHKB 4IDLA 3OAUL 2AK4B 2K3TA 3QXDA 1D6EB 5CJOL 1C12B 4I1NB 2VQUA 3IDYC 5IFHL 2KZWA 1NKRA 3BQUC 3EYUH 4EZMA 4GH7B 1RUQH 2X70A 4NC0B 3BKYH 2AXFB 1HSBA 4GRMA 3QPXH 4ODWB 2V7HB 5FYJU 5IB5B 1WEJH 5JXED 4P2OA 2DQUH 4JO2H 3V6BR 2W38A 1U95B 3ORJA 5FDWA 3CH1B 1BLNB 2A6KB 4G9FA 1A6VL 3RIFK 12E8H 2NXZC 2DYPA 1CXFA 1RVFH 1AP2B 4TSAH 4UUJB 5DUPL 1EO5A 4B50A 3U4EB 3GJEB 1TJIH 4IMKC 4F33A 3MACH 4W81A 5B22A 4NN7C 2IANB 2UUDK 5DMIL 5IV2A 3HC3H 1MREH 5LAXB 4HIJA 4OI8A 1OM3L 5C0DA 2J8UA 2VDLL 1XF5B 3KDMB 4I5BB 4MA7L 2EIBA 4Y16B 2EDQA 5T3ZE 5GGQL 3P4NB 1GAFH 4OZFB 2R1XB 1JWMB 2H9GA 4IRSB 3HE6C 3MLSH 3ARGD 1KN4L 3QUZA 2J4WH 3OB0K 3SDAC 3U0TB 5D8JL 2V9RA 5DEGB 4MHHI 4XPGH 3QIBD 3GFUA 5HHMB 1T7WA 4ZS6D 5GGTA 2Q8AL 4HUVA 3HCVA 1J1OH 5TE4H 5CUSH 4XCEA 3HMXA 5HHOD 4K7FB 3G5ZB 3V7AG 4MD0B 4ZXBD 4KPHH 4HBCH 4JFFE 4AM0A 2BVYA 1NUNB 4A6YB 1QYGL 3QI9C 1MRDL 3GHBH 1QP1A 2OMNA 5MEPA 1CFSB 2AEWA 2AW2A 1YNTA 3B83A 4KH2A 4MXQC 5AUMB 3C5ZD 3C8KB 1KPVA 1FNGA 4XHQA 1HYSD 4LCUA 1JNHA 3LQAH 3MCKB 2V2TA 1UM6H 4NQDD 5DHVA 4L3EB 2CR6A 4KZEH 5JORB 1J8HB 2VXSL 4FOMA 4PJIB 3QULA 1B0RB 5ITBH 1E27B 2SEBA 3WUWA 5ESVB 3SDDA 4NQUA 4OCXH 4P2RB 3FFCD 5D7JA 4LSRH 2GKIA 1NANI 4Z7VF 1TZHA 2ARJA 4RNRB 3BH9A 1MVUA 1C1EL 2ICEA 4DN3L 2P5WB 4MZ2A 3MLTA 4YDIL 3ULUF 3LS5H 1MI5D 3ZSSA 2B4CL 2QTEA 3DLQR 3T2QA 1GH7A 4WUKL 3U83A 2PYFB 1F2XK 4P5TC 4PJ5E 4WTZA 4X80H 5E6IC 2CRZA 1F11A 3DX7A 4L1DA 3VA6A 3UC0L 3W39B 3FONB 3VGFA 3QCTL 5KOMC 5B8CB 3MLXL 1WAAA 3N1FC 1NDMB 3CVHB 1RAMA 1LO5A 3FN9A 4NC2B 1I3UA 3GMPA 3D39B 4JM2F 2AVGA 3I3DA 3ZE0E 4PJAA 4ODSL 1OARL 2X44D 4E41A 5HI4D 2AERT 1U8JA 4PJXE 2VTFA 1P4IL 2NY0B 3MRLB 3MUJA 4GW4B 4PRPE 4Z8FL 1UM5H 4Y19D 3LQMA 4FQXB 2Q8BH 3FQTB 2HJFA 2C4FT 3FFDB 3M45A 5JHDD 2DTML 2ORBL 5JDSB 3QDJB 4GQ9L 1EAJA 1WZKA 1TJHL 3EZJB 5C09A 2VITA 5ELIA 1H15B 2VXQH 4LDOB 2WLYA 1R3LA 4U1LA 5D1QA 3EOBA 2AAVA 1VDGA 1KT2A 4Z7UA 4YHYC 4RFEA 2XA8H 3VRLF 1W0VB 4D2NA 3U1SL 4OTXH 2HLFD 4ZAKC 4YIQA 1XCQB 4GRWH 2HT4C 3RAJH 1MCWW 4XWGL 5IEHB 2ZUVA 4NNPH 2DQFA 2NNAA 2WBJB 3BP5B 4GKNA 1RJYA 3LDBB 1LO2H 4W6YB 4WRLA 2CO6B 4W68A 4HWBH 4OD3H 1KBGH 2NY3D 3LKPB 1LDPH 2JJTC 2H32A 1I4FB 1ONQB 1TLKA 5AG9A 5IB4A 3FB7B 3TCXA 1YEIH 2UZIH 3G5YA 4WFHE 3UBXB 1NCNA 1MNUL 3QEHB 1KSRA 3RGVB 1W0WB 4YPGA 2YKLL 4JY4A 4DOHE 3G6JF 5F6IC 5DTFA 5GGTH 4ODXB 2AXGA 1HWHB 4HUXA 4JE4B 5ADPH 4LU5H 5C0ND 5EU6B 5D2LA 4BH7A 4GAFB 4YDLC 1WT5C 3WKMH 3MRKA 1S7TA 4XNZB 4RQQB 5ACZB 1NAKL 1MAMH 1OSZB 3QO0A 3DNKA 4F7PB 2VLKA 4I0PB 3VH8B 4JY5L 4JY6A 5DHVH 1WWAX 3D2UD 2EEBA 4QGTA 3SQOL 5AD0B 5FK9A 1ZMYA 1AR1C 1J12A 5FO7A 4FFZL 2L7UA 4MCYB 5JO5A 1QSEE 4KK8C 2LU4A 1CXEA 4AENA 2E5EA 3FQWB 1FL3A 2CPCA 2HTLD 3BKML 5E24E 5E94B 1P4BL 4YNYA 4NHUA 3W9DB 1D6VL 2XT1B 4CUCA 5JR1L 3G5VB 2J2ZA 3GSWB 4KRPD 3Q6GH 4HF5H 4H8WC 4X8XA 4XC1L 3V5HA 2PO6C 4ZUTA 2YRLA 3L3HB 2X2YA 1DUYB 1HHKA 1BD2A 2Q7NA 3O2WH 4M61B 2AK4A 4GLRH 2HKHL 3INUH 1C12A 1CDBA 1FZJB 1CQYA 5ANMB 5KW9H 4XVJL 4PP1C 5CMAB 2EYTB 2AXFA 2YD5A 3U46A 3RWIA 1F4WL 1BWWA 1SY6L 5DEFB 2R0LH 3KYAA 1U95A 4OZ4A 1XFPA 4YHOL 5E5MB 2P4AB 3CH1A 1BLNA 2A6KA 5EBMB 2AEIT 1JYXA 3QCVL 1IAIH 3AVEA 4LKXA 5H37G 4XAWL 1AP2A 1S78D 3TYGH 4UUJA 1FFOB 4LCWE 3VWKD 1OB1B 5KVDH 3OPZL 4I48B 2RBLA 4NRYB 3U4EA 3GJEA 2EDLA 4LLVB 4L5FL 5KSAC 1NMCC 2P48B 3L5XH 3ZE1F 2ZG3A 1HQRB 5TQ0L 4H0GA 1QBML 2BY2A 3O3AB 1I7TA 4DKEL 1S9YB 5LAXA 4NC1C 3C08L 4PJBE 1GPOL 1U8LB 3GJFA 3ZKXC 4K8RL 2VXUH 1SBSL 1YEEH 3EO9L 3KDMA 4I5BA 4Y16A 4MAYB 3P4NA 1UKTA 1NDGB 2OTPA 3BP6B 4OZFA 4PGBB 5CFHA 1YUHA 1G9NC 3X3GH 4JHBA 1FZOB 1ORSB 3K1KC 1TPXB 1G7LB 2FDBP 5DJZB 3ARBD 4G6JL 3T2NL 5DEGA 4KTEL 1DEEA 1MCFA 2DQHH 2XY2A 4HH8A 1KJ2B 1EXUA 3CGTA 3BIKA 3G5ZA 4UTBL 4N0UE 3QISA 3WJLA 2CK0H 4GJTB 4G8EB 1IMHC 1CFSA 1UYWL 1JCKA 1IEHA 3S37H 4NQXB 2YMXL 5CZKA 2R9HD 1U8MA 3BQUB 5AUMA 4NDMB 4G8IB 2EE9A 1KCUH 3MCKA 4P2YA 4WFEE 1JRHH 3EO0B 1G0DA 4K55A 1RJLA 4MJID 2VRAA 1S5IH 4L3EA 1BFOB 4KHTL 1FNAA 1EEYA 4HUUB 1J8HA 4WHYH 5J13C 5JORA 1B0RA 2NXZB 1E27A 5TE7H 3WFHA 5ESVA 4JHAL 2CKNA 4HLZG 3FB6B 3NCJH 3MLRH 1A5FH 4LLUB 1EGJL 4NCC2 4P2RA 1NBVL 1ZSDA 2NY5C 2EXWD 2K7PA 2EDYA 5F7HA 2NW2B 1F90L 1HIMH 4NN7B 3VXPB 3IDIB 1YN7A 1JYVA 3V7MA 4DVRL 4JZNB 1RULL 4AZ8A 4GRWF 5L0QC 5FGSA 5IMLB 2NY2C 2ZKHH 4OF7A 5SX4H 3A6BH 4K8RD 3BHBA 1OAZL 3FONA 1GHFL 3GBNH 5B8CA 4UILL 4GMSH 1FNLA 1H3TA 2MCPL 1NDMA 1G7PA 1A02N 3BGFB 3HE6B 1CL7I 4RMTA 3D39A 2J5LC 2J8UF 4LF3A 4RAHA 5E9DB 1BQSA 5D70H 5B38G 2YN3A 1KN2H 5HGBB 4WV1C 3MRLA 2AV7B 4TSBL 2YUZA 3TFKC 4CMMA 1GC1L 1OWWA 3VXSD 2YD4A 3TBWA 1UB5B 4FQXA 3WV0A 1X5FA 3HTLX 1DL7L 4QYOA 3FQTA 3QI9B 1NFDE 1D5MA 2LAAA 3FFDA 5JDSA 2BC4B 4HKZA 1UXSB 4GLRI 4O02L 5T1LB 3ZL4L 1A14L 1RZIA 2VLJA 2DBLL 3RU8H 3L3OB 1XCQA 4LRIC 3K3QA 4UNTA 5IEHA 4PJCB 3RA7H 2YRPA 5GS2D 3BP5A 2WBJA 4L9DA 1IAII 5E2VL 2WBWB 3VCLA 4ZOAA 4O9HL 4WEBH 4ETYA 1Q0XH 4UIMB 1IGML 2BP3A 3GJFH 4UT7H 1I4FA 4ONFL 1MUJB 1ONQA 2QADC 1KTDA 3FB7A 4OZFH 4LSTH 4O4YL 2WUBL 5HHOE 4YK4C 4P5TB 3TZVC 4XMPH 3MRMB 5E6IB 2YEZB 3ES6B 2OXHA 2HLAA 3T3PF 3O8XC 3R4DA 4TSCH 1G9MH 1JK8B 1W0WA 2NR6C 5ILTH 5L8KB 1CT8B 2VIRA 5EIQA 3GB7A 4ODXA 5T5FL 4ZG1A 4NQDE 5EU6A 1TZGH 2EC9T 3HZYA 3IDXH 2WSKA 1I8KA 1L6XA 4K23L 5ID0B 4IOFC 5MERB 4RQQA 2Z8WC 3PV7A 5IVZA 4RX4D 3Q3GA 3ULUL 3NIDE 1OSZA 4U2YA 4HV8A 4I0PA 2P8MB 3MRRB 3VFGH 3FFCE 4PJAF 3JWOL 5JOFA 4LPWA 4X99B 3ARXA 3NACL 4KJPD 4YE4L 3LZFL 3SJVB 5I18L 3ROOB 5IROC 5BZDA 1MI5E 2VWEC 3FQWA 4YHYB 2ENSA 1DZBA 3L3KB 1JRHI 1EEUA 1A8JH 1T4KA 3FQNB 5E94A 4ZAKB 2QR0B 4GQPH 3ARDD 3W9DA 3BH8B 5INDB 1F02I 2P44B 3R1GL 4JFHD 4LAQH 1WBZA 1ZHNB 3G5VA 1CDYA 3GSWA 5DD1L 4ODUB 1I85A 5I19H 4BUHA 3ZO0A 1WC7B 1CGTA 4WHTB 4Z7UF 1DUYA 3FQXA 1RUMH 4M61A 1H9VA 1MIEL 3ZKND 1T20B 1V3KA 1OP3K 1OP5H 3C2AL 5CGTA 1FZJA 3QXAB 4H1LB 1T0NA 5ANMA 4QCIB 2JJUA 3D69A 5ALBL 2EYTA 3Q5OA 4X8JA 5C2BL 1J0YA 4X4MA 4Y19E 2BVQA 1HINH 1K8DB 5E5MA 5BV7C 1I1FB 4NKIH 3TBVB 3B9KC 4PTUA 5JHDE 4XAKD 4RAVB 4ZSOE 5SX4I 2Y07L 2ED9A 5F7FA 1LEKA 3FOMA 1FFOA 1KFAL 2D4FA 5EPMB 3GMNB 4PY8I 4NRYA 3K8KA 2ICCA 1AO7B 3MRFB 4UV4H 2AGJH 4OLXH 4POZC 3WFBH 5DK2B 1HXYB 2FHCA 3KPOB 4XXDB 3RWEA 1MHHB 5D2LF 1PGRB 3O3AA 3SEPA 4WFFD 2XZZA 3N85L 2DJUA 2NXYD 3SKJL 1U8LA 1W2KT 1NUFA 3VI3F 3EDJA 3RWJB 3QQ3A 1NDGA 4PGBA 4RIRB 1CXHA 1FZOA 1I3GH 4DFIA 1ORSA 5LXGH 1X5YA 1G7LA 2ESVB 1NCCH 4Y2DD 3WDJA 3EFFA 4JM2D 1RV6X 4HDIB 4MMXC 1KIRA 3O3BA 2KL6A 3VXRB 3S4SG 3BKYL 3QPXL 4G6AC 2PO6B 1KJ2A 2DQUL 4JO2L 1BVLB 1Y0LB 1J87A 1GGUA 5D1XC 4S1DD 4LEXH 1T2QH 3G9VA 4G8EA 12E8L 4PRNB 5I1HH 4OGZA 1WSST 4WUUB 2AJZA 4TSAL 3BQUA 4H0HB 3LN4B 5CJ8A 4NDMA 5GGUB 5ICXA 3RY6A 4U6XB 4MX7B 3EO0A 1S9VB 1R3KB 1TJIL 4KXZH 5EWIH 4IDJL 1BFOA 1YEGH 3P30H 5EH1A 4HUUA 3LV3A 4JN1H 5J7CC 3MACL 4I8DA 5ISZD 1HSAB 5FA3A 4G8GB 3HC3L 1MREL 1IILE 4K9EH 4KKBD 4LLUA 4TUOB 4IEFB 3RWCB 4N90D 3TVMC 4F37K 2BOCA 3TO4C 3WHXB 4X7FC 4G6FB 4IMKA 3GZKA 1BHGA 5KSAB 1NMCB 2C3GA 3MUHL 1SVCP 1GAFL 4PJ9D 2WWKO 4KUZH 2NW2A 1IJ9A 3PWLB 3MLSL 3IDIA 1OW0C 4G7YH 2FH8A 3AXLB 3W0WD 2J4WL 3DARA 3U4AA 4AYFA 5IMLA 3ZKXB 3IYLW 1A4KB 1K4DA 3V4VH 3MA7B 3SO3C 2C7UA 4KPHL 4HBCL 2OBGA 1Z9SA 3GHBL 4RA0C 3T0EC 4GFTB 1KLGA 3GRWA 5E9DA 3SDAA 4AEFA 3F7QA 4NGHH 4N0CD 3LQAL 1UM6L 3NFSH 3FO2B 3GBLA 5HHPB 3WN5B 1UB5A 3ARFD 4KZEL 4M8QB 3QI9A 2YD8A 2Y25A 1I75A 3VGGA 3MJ9L 1CGXA 1UXSA 5HPMA 4CN4A 3HAEH 4OCXL 4IHOA 4QRUB 2DD8H 3FMGH 5T1LA 4M43H 4XVTH 2DM7A 1BZQK 3OKKA 4LSRL 4JPIB 5F6HI 1T1ZB 4GMTH 4XBGB 4LGSB 3I6KB 3L3OA 4U6VL 3B2UD 2BY3A 1Q9OB 2YPLB 4BA8A 3LS5L 1D5ZB 4OKVA 3PWPD 2AJ3B 2IF7A 3UJIH 4X80L 2ICWJ 3GSVA 2FJFB 5J0BA 5ADOH 5JUEL 3RL1B 1PLGH 1LP9E 4MCZB 4UIMA 1MUJA 4LLMB 1N59A 2ED7A 5L0QB 4HMEA 4P5TA 3MRMA 5E6IA 3ES6A 3D3VD 3V6OE 1CGYA 2VDNH 3DJ9A 5E00B 2ATKA 3SKMB 1CT8A 2EYSA 1UM5L 4ZOBA 1KJ3H 1ZOXA 4OT1H 1KJ2H 4PJFB 5F1NB 2J5LB 2W0FB 4MJIE 4H25B 3OJVC 5ID0A 4WV1B 4POYA 2VXQL 1FNSH 3GSQB 4DZBA 5J11C 5DJXA 3U9UB 3FAWA 5EOCH 1U3JA 2XA8L 2P8MA 3MRRA 3RNQB 4OTXL 1T03L 3RAJL 1FFRA 4QXWA 1E4KA 2WWMC 4PRBB 5HGDB 2APXA 4P9HH 4NNPL 4CVZB 3IDUA 3SDXA 1KPRB 3FB8A 3AS2A 1BVKB 4PLJC 3REVB 3SJVA 4D0BB 3K1DA 4JKMA 3ROOA 4HWBL 2BRRH 3EAKA 4OD3L 4YXHH 1KBGL 1CE6B 3GDBA 1HCVA 3L3KA 1LDPL 4O5LH 3FQNA 4KXZI 5LGHH 1VKXB 3L6FA 2GIYA 2J12B 1YEIL 2UZIL 4QRRB 4FTVA 2FEDD 3TT1H 2Y6SC 3BN9C 1J5OH 1PKOA 1WC7A 4WHTA 4BQBA 5IB3A 5IJKC 5EU7C 2GJZA 1NCBL 3O4LB 1VFAA 5EA0H 2JJTA 5FAAA 5GGTL 3QXAA 5J1AA 5DQ9B 5I1AB 2QADB 1OD7A 4QCIA 5ADPL 3MBEC 1NBQA 3VXSE 4TOYH 4YK4B 3TZVB 3RNKB 3RVUD 1K8DA 1DQTA 1I1FA 4WO4A 3TBVA 3O8XB 1MAML 1WITA 4MD5B 1U8PA 5HDLA 4YLQT 3BESR 4Q74A 2ADGB 2GUOB 1UB6A 3IDNB 3GMNA 5EPMA 4P2OD 4P46A 1EDQA 4BFEA 1FPTH 3KPQB 5DRZB 5AWNH 2FBJH 2I9LB 3QXUA 4G9FD 1JTTA 1WT5A 4XCYB 5KAQF 5CD5D 3MRFA 3DV6B 3HE7C 5ICYB 2DLIA 3D18B 4MA8L 5B21A 2DYPD 2Z31C 4XHJC 5DK2A 1HXYA 3HI5H 2E7CA 4IBLT 1FZMA 1MHHA 5F8RC 1Q8MA 4ZOCA 1NEZG 4DEPC 3I02A 3RHWF 3Q6GL 4HF5L 5FV2A 5E2JA 4ZO6A 4G42B 4WW2C 5HD8D 5L8JB 4HFWB 3O2WL 4YC2C 5C07B 4GG8A 4L4VB 3TH3T 3INUL 4LLYB 4HDIA 4DKFH 1WBXB 1LK2B 3FO0H 5KW9L 4PR5B 1BOGB 2PO6A 1CZ8H 2R0LL 4HJ0D 4WI5A 3HZKB 2VZVA 3I6LD 1IL1B 2MKWA 3DVGB 1BJ1J 3BGAA 3QUZD 4PRNA 1T1XB 5K93A 2PYEA 4JVPA 1IAIL 4JRXB 5D7SH 4NWUH 4QRPB 4XPFL 3TYGL 4XP4H 43CAB 3B2VH 1RIUH 1WUNT 4U31A 1X5JA 5GGUA 5KVDL 1GGIH 4U6XA 4MX7A 1S9VA 1R3KA 2QL1A 5LBSH 3B9KB 4M62H 1EHXA 1A64A 5BO1H 3L5XL 1HSAA 3QUKA 2IPUG 4IRJC 4LEOB 2DQJH 4JR9L 2PTTA 3MNZB 4TUOA 1T1WB 4NKMB 3RWCA 1RJCA 3X14B 5SWZD 3WHXA 1KENH 2A77H 3H9YA 1UM4H 2VXUL 1YEEL 5HYQB 1UKSA 1MFNA 5D7IA 5KSAA 5KOVC 3H42H 5DFWH 3LEYH 5DYOB 4JFHE 1NCUA 3PWLA 3X3GL 1KNOB 4N9GB 3VU2A 5D7JD 3AXLA 3RVXC 5HY9B 2Y1VA 2DQHL 2PKDA 5KZCD 2P5EB 1V8HA 3PP3H 1C5BH 2Z0BA 4YH6A 1MH5A 3L5IA 4OSUH 3MA7A 2H1PH 2CK0L 4QF1B 3ARZA 2Y72A 4GBXC 3S37L 4M1GH 4F2MB 2APBA 1JMXA 4CL7A 3OV6A 4XAKE 5E6YA 3UTPE 1AQKH 1KCUL 3MV7B 1RZJH 5JLZB 1MCJA 1JZ5A 1JRHL 5AEAA 3FO2A 1V7MH 5D1XB 1S5IL 2VQ1B 3GM8A 2CRMA 5DJYB 5AZEH 5JPNA 1YDPA 3MLPA 4Z7VE 4UQ2B 2YK1H 3NCJL 3FT4A 3F12B 3MLRL 1A5FL 5JW3H 3UROR 3CFBA 5F96H 5I15H 4XCNB 3VXTB 3VXUB 4HK3N 2C3XA 2VR5A 4LLDB 4WFFE 3I6KA 1E6JH 1DR9A 1CLYH 1Q9OA 4S0SD 3WFEH 1HIML 2YPLA 1FG2A 5E5UB 2OJZL 5DI8A 1D5ZA 5IGXH 1DQJB 2DF3A 3DBXB 4Z7WA 5I66A 1T21B 3SBWA 5D1QD 3TVMB 2EICA 3B4NA 4FFWD 1S7QB 3TO4B 2ZKHL 3A6BL 4U6HB 1Q9WA 2E6QA 1II4E 2DL9A 3RL1A 3GBNL 4MCZA 5FFLA 3U0PB 4GMSL 5A1AA 5HYFA 1MWAB 3VFNB 1DLFH 1ZE3C 3RX8A 2DKMA 5FV1L 4DAGH 3QIWC 5D70L 3NTCL 4IIQC 1KN2L 4ZUUA 5HYJA 1A7NL 4KKCD 1QSVA 3WJJC 4F3FA 4O58H 3SKMA 3SE3C 1GZQA 1EBPA 1Z3GH 4J6RH 2F58H 4H8WH 4CJ0A 3HG1D 4KKLD 1WF5A 1X4ZA 3VFUB 2Q20A 4Y7MA 4PJFA 1J0HA 4KJYB 3WIFB 4LOUC 4LSSL 2V5YA 4MGXA 4XI5D 5J57B 5B38B 3K81A 1FYHB 4H25A 1MLCA 2G9HA 3VRLE 1QKZH 5ISZE 4WV1A 3OQ3B 5CSZA 3U9UA 2DOCA 4I3SH 2CRIA 1NLDH 3MV9A 3RU8L 4MB5A 2LVCA 3FB5B 5BRZA 1P7QB 5JXEC 3O3UN 1B4JH 2LABA 4N90E 2DBJA 2FX9H 5HGDA 4UAOC 3RA7L 4JJHA 2EKJA 2YXMA 3LRHA 2X42A 5CP7B 3F58H 1BVKA 2UYLA 2VLKD 3REVA 4JFFB 3L3GB 4WEBL 4XX1E 1CE6A 3W0WE 1Q0XL 4EN3C 2CUMA 4UT7L 1MVFA 4WY7H 4D9QD 3RBSA 3CAFA 4LRIA 3TWCH 1T5XB 4LSTL 4W4NA 3G6JE 3VXNA 3CFIC 3UTTA 5JMRA 4YR6A 4QRQB 4TSCL 2OSLB 4DUVA 1G9ML 5ILTL 2A0LC 3EGSB 3ZTJG 5DQ9A 1FC2D 5FHBL 5I1AA 4MDJB 5I8EB 2QQLH 2HN7B 1CS6A 5HDOA 1TZGL 2O93L 1BD2D 5FEBA 3TZVA 3IDXL 1FFNA 1DDHB 3ARGC 5EU3A 3O8XA 1RU9H 4MD5A 1S9KC 2X9XA 3QIBC 4OB5H 4OF6A 2ADGA 1LE9B 4M1CD 3VFGL 2GUOA 4KTDH 2XWBA 3C6LC 3GSRB 4BSWB 3GBMH 3IDNA 4UBDD 1FL6B 4C83B 2Y4SA 3RWDB 2I9LA 3L5WB 1A6UL 4ZFFB 1Y18A 4KMLB 1I9EA 4R0LB 3DV6A 1Q94B 3P4LA 4OCLC 5J11B 2DLHA 3HPLB 1Q0YL 4WNQA 5DMJB 4DGVH 3C5ZC 2X1WL 3RKPA 3PWPE 1HYSC 3GUTB 1RZ7H 5FOBA 4X7DC 4HUKB 4JPWH 3SY0B 1ZT7B 3QQ4B 4LAQL 5DA4A 5GSRB 4F7TB 3RWGB 4PJXB 4P23D 4PRPB 4NJ9H 2F74B 5I19L 2FGWH 4G42A 3T4YB 5EO1B 2BJMH 3WBDA 3MRBB 5IROA 3RQ3A 4LFHD 3K4DA 5C07A 2YUWA 2I60L 3WD5H 1NGWB 3KLDA 4MNGA 3OHXB 4LLYA 4JFZH 3WNOA 2MNUA 3SDXF 2Q76B 2J7LA 1RZ8B 3D3VE 2XXMB 1LK2A 4Y16D 4FFVD 1GGYA 5DHYB 1QFWM 4NRXB 1IZKA 1HINL 3QWOB 1XT5A 1PKQB 4NKIL 1IL1A 3DVGA 3OJ2C 1A22B 1C08A 4J4PC 3SGDH 5HHMD 3IU3A 4QRPA 2BNRB 43CAA 1NL0H 2QQNH 3MBEB 1A6ZA 4OD1H 3EKCA 3ZE1E 1QLFB 2R69H 4E42B 2XPGB 1AE6H 4HZAA 4UV4L 2AGJL 3B9KA 3DIFB 1CBVH 3WFBL 3WSQH 5HI4C 2G5RA 1K3ZA 3OG4B 5EULV 3FHQA 4LEOA 3S5LA 2FWOB 4MNQA 1EZVY 3FTGB 2IQAB 3BO8B 1FZKB 2EH8H 2X4PB 3X14A 4L3ED 3MV01 4XBPA 2JJSA 4U4BA 3RZCD 5HYQA 5J6HB 1J8HD 1DQLH 3HE7B 3VE0A 1S9XB 5BOZG 2XZQH 4N1CA 2EO1A 5DYOA 4KDTC 1R24A 2LVEA 3MA9H 1I3GL 3EYQC 5IW6A 5LXGL 1KNOA 4N9GA 4P2RD 1NCCL 2CLVB 2FRGP 5HI5D 3EYOA 1WFOA 4DEPB 5HY9A 5HVHC 5J8OA 4S11A 4FQ2H 3OG6B 32C2A 1QFHA 3OKLA 1KCKA 4LEXL 3P4OA 4DVBB 1PG7X 3BYYA 1T2QL 4MXVF 4IM8A 4YC2B 1IVLA 1ZAGA 1NJ9B 3GSNA 4QF1A 5IBUG 3I9GH 5I1HL 3P9WB 4M3JA 1OTUD 2NY3C 3ALWA 1N8ZB 3MNVB 4MJ5B 4PRAB 2NZIA 5D93C 4ZQKB 1QSEB 5JLZA 3WHE1 1QRNB 5JIKA 5CEXB 3HA0A 3P0YH 2BVTA 2D3VA 5D1XA 3GO1H 5EWIL 3VD9A 1YEGL 1F6AB 3P30L 5HHXH 2VQ1A 3D39D 4JN1L 4XP5H 5DJYA 4AQ1B 1ACYH 1IEAB 3RVVD 5AG8A 1TMCB 4G9FE 4UQ2A 2NY0D 5H8DA 1ITBB 3F12A 4K9EL 3CVIH 2APTA 4JO4H 2LU3A 3DGCR 2CO7B 3MJ8A 5C0NC 4LLDA 5L6YL 1WZMA 4GRWE 1PSKH 4KUZL 5J56B 2APVA 4IRJB 1CN4A 2W9EH 4G7YL 2B2XH 3DBXA 5JHLH 1T21A 4FN0A 4KRMB 2VLJD 2VL5B 2NTSP 1S7QA 3TO4A 2Z93B 1P9MC 1IGTB 2HWZH 1C5CH 1UA6H 4FG6C 4MXWH 4U6HA 2J8UE 5FXCH 2OS7A 4Y88A 4N0FB 3V4VL 1AIFA 1HNFA 4LCWB 3VFNA 1OW0A 5C0AB 4ONHB 2CLZB 3TPUB 1KACB 4M6NH 3I6LE 5J89A 4NGHL 5FM4A 4UV7H 5D7IF 2HTLC 3N9GH 5C0RH 5LJYH 3NFSL 3VFUA 2WNGA 4KJYA 4GBXB 3T0EA 4PJBB 4NO0B 3NPSC 4Z7OF 3CC5B 5B38A 4W4OC 1KG0B 5DQDH 4N0YL 3MLWH 2DD8L 2EDBA 5DJDB 3FMGL 2GTZA 3QNZB 4M43L 4XVTL 4RMWA 2FZ3A 1KYOK 4GMTL 2W0LA 3SCMB 3FB5A 1P7QA 5EU6D 3L1OH 4U0RC 5SWZE 5CIPB 5BV7H 1OTSC 5K59F 1QFUH 4EI5B 4Q9QH 3HPJA 5CP7A 3Q2CA 3SGDI 2CDFB 4OM0H 3UJIL 5DD6B 1QZ1A 4I0PD 1S78C 1AXSB 4N0UB 3OKMB 3VWKC 4JFFA 5ETUB 3L3GA 5ADOL 4NFCA 1PLGL 3NOIA 3CXDH 4OAWB 1J10A 1E4JA 3I6GB 1DVFC 1DFBH 1I8LA 1IAMA 1ETZA 3T3PE 4OM1L 2OP4H 3Q1SH 1K2DA 5I9QC 3K8LA 3SOBH 3EJYD 3C60C 5GXBB 1DSFL 2VDNL 1DN2A 4MHHG 2FLRT 1QFWH 3BPCA 1XR8B 1A4JA 1WWBX 3DO7A 1YQ2A 3EGSA 2XZCH 2Z4QA 1H3GA 1KJ2L 4OT1L 4MDJA 4PP2B 4Z7WF 4D94A 3CPLA 3KYKH 3QZWB 2HN7A 2E6JA 1RURH 3QIWB 3GSNH 2W60A 4IIQB 1P5VA 3L3JA 4PJAE 5L9DL 1FNSL 1BFSA 3HS0B 3SE4C 1LE9A 3MUGB 4LLAA 3DGGB 4BSWA 1J0IA 1B90A 3RKDD 3F5WB 4C83A 4YGVB 4P9HL 5ERWA 3RWDA 4PB0H 3L5WA 2MSPA 4ZFFA 3NCMA 1J1PH 1MCHA 1Q94A 3V0WH 3HPLA 1I7ZB 2BRRL 4PJFF 4R90H 1ZXQA 3MRGA 3WNLA 3GUTA 3ZDXF 4O5LL 4DKDC 1QA9A 5LGHL 4Z7UE 5GSRA 4F7TA 1U3YA 3RWGA 2I5YH 2VE6B 4WI2A 3KPSA 3O6FC 1KELH 1JFQH 1J5OL 3T4YA 5EO1A 3ULVH 2HT3D 3MRBA 5MEOB 2X09A 4JDVA 4NQVB 2V7NB 4C4KT 1C5DB 1NFDB 5EA0L 3BMWA 4EN3B 1NGWA 5L88H 3OHXA 1FBIH 2G60H 5CJ5A 2VISB 3ARTA 2IBGA 2NY4C 1U91B 3BZEB 4J3VA 1N2RB 4TOYL 4NFDA 2Q3ZA 2XKNB 3HG1E 3MPCA 3QWOA 3V6FA 5F1SA 2HAZA 4CU8A 3A6CL 1PKQA 3IGAB 4AH2B 4KDVA 3GRWL 4QHUA 2BXYA 2B8OT 4JFPB 4Z7QF 1HHIA 1MCOH 2BNRA 4Y4KD 4LSQH 1HI6B 2GW5A 1JGVH 3MBEA 4QHNA 5I76B 2R39A 2W9LA 3B43A 1FPTL 5AWNL 4E42A 2FBJL 2XPGA 2W65A 2XQYK 4CW1B 3ARGB 3C5SB 3MYJA 2WMPA 5D2LE 3DIFA 3BZFB 3B8SA 1K8IB 2NY1C 3QIBB 3BQUD 3HI5L 1D7FA 4XMKL 1NGYB 2FWOA 1A47A 3VI3E 1KB9K 2OCFD 3C6LB 4X7EC 4G8FA 5HHOB 3FTGA 3BO8A 2VLKE 1FZKA 2E7LC 2X4PA 1IM9A 2H6PB 1FH5H 2VMFA 2V17H 4GAGL 3N1MC 1M4KA 2Z9TA 2NXZD 3KJ4C 3LS4H 4D9QE 4FP8H 2Z31A 3C5ZB 5AYUH 1FO0B 3M1BB 3B5GA 2C5DC 2B1AH 4NQDB 1NEZB 2FX8L 3U4BH 1HKFA 1Q38A 4DKFL 4AIZB 3FO0L 4QOKA 3CFDA 4M7KH 1J9CT 1K3IA 1RK0B 2XRAH 1CZ8L 4WW2A 1IGJB 4ISVB 1NGZA 2C4XA 4DVBA 1EO7A 3MREA 1O7SA 1BD2E 5BVPL 5D7SL 4NWUL 4JKPH 2VLLA 4XP4L 5DFVC 3VMNA 3B2VL 3MNVA 1VEOA 3NMEA 4XH2B 4MJ5A 4PRAA 1ZHKB 2HFFB 4ZQKA 3S4SA 1MHPH 1L7IL 1QSEA 4JO3H 1QRNA 1GGIL 5CEXA 3ZZ1A 1MI5B 5LBSL 1V7NH 4MA3B 1FN4A 4EEEA 4M62L 1F3RB 5BO1L 1IEAA 1FAIH 2EIDA 3SDAD 1M71B 2A73B 5GJSH 2IADB 4JDZB 5CEZH 4I0CC 2FL5B 4AJ0A 1FC1A 3MLUL 2AXJA 1PFCA 2DQJL 2ITDB 5DVNA 3WYRA 3U36A 4RMRA 3T1WA 3U6RB 3BPOC 1KENL 2A77L 1UENA 1LNUA 1QPPA 2DQTH 5CS7A 3S36H 1EFXB 3H42L 4FFYH 2DICA 3LEYL 4F7CB 1ACZA 3U7AA 1S9WA 4MXQD 5A16A 2G5BB 2R2BB 4IRJA 5I8OH 5D9SB 5T1LD 4HHAA 1ZLSH 4NNYA 1JP5A 1JVKA 2Z93A 3AS3A 5JHDB 4X9GA 4RDQF 1C5BL 5BZWB 2OQJB 4OSUL 2H1PL 1CLOH 3CSYB 4KJPC 2Z91A 4XGZB 5C0AA 5HYEA 4ONHA 3TPUA 5IVNA 3E8UH 1JHTA 3LY6A 3IETB 4HKXB 4M1GL 2V6HA 5HVHB 2DQDH 4D0CB 1RZJL 4PRHA 1T1YB 4NSKA 2XIDA 4Q6YA 1V7ML 5HHME 1NH6A 1T5WB 2YD6A 5J6GA 1U92B 3GIZH 5DURD 2AJYH 5AZEL 2AJXL 5GS3A 4P5TD 1WIOA 4PJBA 2BNUA 5D6CB 3CC5A 2YK1L 3PGFH 3ZKNC 2NY3B 4J8RB 5D93B 3CU1A 5DJDA 5F96L 5I15L 5IEKB 4JHZA 5F3HA 1P84K 3QQ9D 1QLRB 4NN5C 3SKUD 1QVOB 1E6JL 3WFEL 4L3EE 1J8HE 4WHDA 3MJ7B 1D5BB 2VN4A 5BS0D 5DD6A 4I2XE 3OKMA 5ETUA 4O51A 4XNYH 4WCYH 3UYOD 4OAWA 4UMGA 1TQBB 3IFLH 3S98A 1DLFL 1VB9A 1GL4B 4DAGL 5FIEA 3SJVD 4GXUM 5DFTA 3BJ91 4HIHA 4G6KH 1SEQH 2KDGA 3D2UB 4O58L 3ZSTA 4X4YA 1XR8A 1A1MB 1Z3GL 2F58L 4H8WL 3ULVF 3ALPA 4FTVD 5DUMH 2E7MA 2GJ6D 4Z0XA 3LPGA 1BIIA 2EDEA 4ZNEA 5TQ2H 3D1MC 4IIQA 3D39E 1QKZL 4JM2C 2CIIA 3WJJA 3H9SA 3SE3A 4I3SL 1NCDH 1NLDL 3OZ9L 1ZKAA 3MUGA 1B4JL 3QP3A 1CFQB 1PAMA 3NPSB 4H5SB 4YGVA 4WO4D 1EUUA 1YZZA 2BX5A 3F58L 4M1DL 3HR6A 2VZ1A 3OAYH 4XP9L 5EBLB 5HJ3B 4FQIH 4JQIH 4PUBH 3WS6C 3TBYB 3S9DB 2JCCA 2R1YB 4P46D 5I73B 5JXEA 2VLRA 5D71H 2K7QA 4WY7L 4YDVA 4O2CB 2VLJE 3GEWB 2BVUA 2G2RB 5DVKA 1GOFA 1WCQA 3TWCL 2BRQA 2ZPKL 1FLRH 5CZXD 2IH3B 3REWB 3S34H 1IC7H 1HH9B 3VWKB 5C2UB 1EJOH 1BX2B 4L29B 4NQVA 2V7NA 3GNMH 4EN3A 3STZB 5K9KA 2VISA 3DHMA 1AR1D 2XWTB 2QQLL 4KK8D 3EHBD 4PJ9C 1LD9A 3BZEA 1N2RA 2ADFH 5I9QB 2XKNA 3C60B 4QHMB 2YA2A 3CMOH 2W59A 1RU9L 1TXKA 2J8OA 4HJJH 3OAZK 4OB5L 3FCTB 5GRYA 2DWEB 4KTDL 1JUFB 5EIIA 1TCRA 3GBML 3NZHH 1ZK9A 3HNSH 1ZLWH 1T89C 3C5SA 4GG6B 1KTLA 5EU6E 1LP9B 3WXWH 3BZFA 2PYED 3RJQB 1ROWA 4L8BA 1K8IA 3O3EB 4DGVL 4JKKA 4L9LB 4H88H 1E4WH 1NGYA 1RZ7L 3B6SB 4I9WD 4XB8A 3RWHB 3QFDB 3C6LA 2H8PB 4LP4A 2QQKH 3CDYA 4JPWL 4RFOH 5HHOA 4X7SH 1HHJA 1E4XI 4N9OB 4O2FA 3BXNB 4QRTB 4TUKH 1IE5A 4R4ND 2H6PA 3GIVA 4AK1A 3BVNA 3KLSA 4MS8C 3PL6A 1I1AC 4NJ9L 2FGWL 3VRIA 4OCSH 2BJML 1RZGB 3DUSB 3MXVH 3C5ZA 3UTQA 1FO0A 3M1BA 1DN0B 4Y5VB 4MDIA 3WD5L 2X4NB 4TVPH 4MJIB 1NEZA 4JFZL 4NKQB 1AXTH 4AIZA 1BJMA 1FFQA 3CFEA 4HT1H 4XVUC 5D5MB 3SGKC 3MRJB 5C8JA 1S7VB 5EU5B 3TA3C 3C8HA 2NTFB 1KCVL 5BW7C 5DO2C 1OPGH 4HQQH 5I0ZA 5KSBA 4IRZH 1NL0L 2QQNL 3F7YA 25C8L 5DRXB 5D7LD 4OD1L 1CIUA 2A1WL 4ZODA 2R69L 1AE6L 5ANME 4MSWA 4RAUB 1OL0A 4MA3A 4PJEE 4WEUD 4X4ME 1LK3H 5IW1A 1KB5A 2J8HA 1JPST 1M71A 1JHLH 4GW1A 1MELA 2IADA 4J4PA 4JDZA 4XWOD 2FL5A 4TVSa 5E7FA 2ITDA 1EPFA 5E70A 1MY7A 1CDUA 4JANA 5F97E 3U6RA 1R3IH 4RFNC 1WWCA 4WI7A 3DTXB 1EFXA 1VERA 2XZQL 4YXLH 4M9OA 4OLWH 3QRGH 2NY1B 3MA9L 3VFMB 2Z8SA 2G5BA 2R2BA 5LGKA 5D9SA 4OCMC 3U7YH 3IAGC 3LQAC 3W2DH 1H8OA 1ZWIB 4FQ2L 3QBTB 3BWAA 3QQNA 1UQSB 5JHDA 3KJ4B 1GRWA 4JHWH 1IKNC 2OQJA 2EZ0D 2D03H 4KDTA 1JNNL 3CSYA 4XGZA 2OR7A 3I9GL 4NP4H 2GFBB 3PXHA 3VG0H 3DSNA 3H7BA 1EA9C 4YBQD 2GTWB 3SGJC 4D0CA 5IQ7H 2EYRB 2J3SA 5KSUA 2NY6C 5CEYB 2VKWA 4X9FA 5F9DC 4F9LC 4Y89A 3P0YL 1I1YB 5GS1C 3GO1L 4NIKB 5HHXL 1F97A 3VFWB 2PETA 4XP5L 1RJZA 1ACYL 2W92A 1G7MA 2NY2D 3QJFA 3KXFB 4NQCB 5HYJD 2X4RB 2VKXA 3CVIL 3MZTA 3MRQA 4WW2F 4JO4L 4M48H 5D1ZC 1UWXK 3K4ZA 1QLRA 1QVOA 2XWJB 5C92A 4UIKH 1PSKL 3CFKB 2HJLB 2B7DT 2GCYB 3MJ7A 2VZSA 5IOPB 2B2XL 3IFOB 3UO1H 4OLEA 5EOCJ 5JZ7D 3TFKD 3AS1A 3QHZH 3MGOB 3BPOB 3MV9D 5BRZD 2HWZL 1C5CL 5KTEH 2R15A 1EHAA 5T1KA 4X9IA 2I26N 1MCCA 5FECB 2WZPD 4E5XB 5CD5C 3QEUB 1RUAH 3CFCH 4LSVH 2PUQT 1S8DB 2CRYA 1X6NA 3VWJC 1FNEB 3VDBA 4M6NL 1CD9B 1FO0H 1I7RB 4EDXB 4UV7L 1P9MA 43C9B 4PGEA 3WDIA 5C0RL 4M5ZH 1S7UB 1U8KB 5D72H 4WU7B 2WK2A 3LRGA 3THMH 5CJXC 4LLWB 4J7RA 3BIAX 4I4WA 2X10A 3UTTD 1EUTA 1OLLA 3DMMA 5DQDL 3MLWL 3HUJA 5GRUH 3WO3B 2CMRH 1N5YL 1VEPA 3HRPA 1MRCL 2QADD 3PIQB 2OL3H 3L1OL 4YEEA 4RA3A 2RIKA 1CFQA 5BV7L 4H5SA 1QFUL 4W4OA 1IRAY 4Q9QL 1FVCB 2NR6D 1KB5H 4OZIE 4OM0L 4NN5B 1FIGL 2P7TA 2XFXB 2GSIB 3CXDL 2R1YA 4PYGA 2ARWA 4PJBF 2VERN 4O2CA 4EDWL 1DFBL 2N7BA 3R0NA 3MO1B 3Q1SL 4IOFD 4QXGH 2IH3A 2ADJB 3SOBL 3FKUS 3QNXB 5BJTB 4N1HB 3U0WH 3Q6FB 1N6VA 5EZIH 1HH9A 5E8OB 5GSVB 3VWKA 3NCYS 4X98B 1BQHG 1BX2A 4L29A 1QFWL 3F65A 4YFDB 3STZA 4Z7VB 2PW1B 1DVFA 4X9HA 3RI5F 1ZVYA 4XNXH 2XWTA 3RTQA 1B88A 1CTOA 5HYSG 4CJ1A 4LKCB 3RGHA 3KYKL 5E8EB 3PGCA 5EC1A 8FABA 1RURL 2PTVA 4KY1H 3C60A 3GSNL 4QHMA 5C07D 3P73B 5D7JC 3C5JA 1SMAA 2ICWA 2IPTH 4C56A 1MEXH 3O3DB 4ZD3H 5KG9B 4J3UA 3TIDB 1LWRA 2DWEA 2WINB 5MHSD 3STLB 2MTPA 1HN1A 3JV6A 1M6OB 2E7BA 4PB0L 1TTGA 2Q86B 1J1PL 4GG6A 4JM2B 3V0WL 4R90L 3W5NA 4C59B 3SE4A 3R8BB 4KRNA 3QFDA 1G7IA 5BS0E 4U1JA 5GGSB 3RP1A 5D2NC 2I5YL 3BXNA 4QRTA 3B9KD 1SJVA 2BK8A 2V2WB 3TCLB 2W9DH 4CAGA 4KWUA 4ZFGH 1JN6B 1JFQL 4TNVK 3SDXE 1JGLH 1RZGA 1YEDA 3DUSA 3ULVL 4MNQD 2IMNA 5IG7A 1ZLUH 1DN0A 3SJVE 1BGXH 1OF2A 3GI9H 5L88L 3BRGC 5IW3A 1FBIL 2G60L 5JNYB 1X4XA 5CILH 5D5MA 1UVQB 5ISZB 3MRJA 1CR9H 2BSSA 3ET9F 3N1QC 6CGTA 4POZD 3O6FA 3L5HA 3G9AB 4UQ3B 1S7VA 2JCCF 5EU5A 1LEIB 4FTVE 2NTFA 5IHLB 2GJ6E 4UNUA 1G6VK 1R3HB 4HGKC 1JPGB 1LEGB 4NYLA 5SX5H 3S97C 4RBPK 1QFOA 1CFTB 1MCOL 4LSQL 1JGVL 1P4LB 5DRXA 5EUKB 4PJ9B 1MFDH 1K5NB 3UYRH 5KS9B 1UXWB 1LO0H 4M6AA 3W0WB 3JTSA 3P11H 4RGND 5DMKB 2ILLA 5T1DH 4CBPA 4G6AD 3W81A 1MCWM 3G6JB 1CG9A 2I25N 3IS1X 5D1XD 3IXTB 3V4UH 1FH5L 5FB8A 1NGQH 3LS4L 4FP8L 3DTXA 4XI5C 2BDNH 3I75B 4EI6B 5EDXA 5AYUL 3KS0J 2YC1B 2B1AL 1E6OH 2M8XA 1NSNH 3U4BL 2E7LA 1ZWIA 3MTRA 4ESKA 4FHBD 4MXVE 4M7KL 3IJSB 3V6ZB 4FMFA 3CCHB 5DRWA 1UQSA 2FO1A 2XRAL 1AFVH 3WUZA 4OGAC