2OLDA

Bence jones kwr protein- immunoglobulin light chain dimer, p3(2)21 crystal form
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
217
structure length
217
Chain Sequence
ESALPQPASVSGSPGQSITISCTGTSSDVGGYDLVSWYQHHPGGAPKLIIYEVTNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYASGSTPRIFGGGTRLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bence Jones KWR protein structures determined by X-ray crystallography.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Bence Jones KWR Protein - Immunoglobulin Light Chain
total genus 45
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oldA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oldA02
1S7UB 4XGZB 1VFMA 1TNMA 1XGPA 3VG9C 5DUPH 4ZTOH 1FQ9C 2HT4C 4DFHA 3OPZH 3R4DA 1UQSB 3CPLA 4L5FH 2YPLA 2D31B 4XNZC 5DJCA 3WIIL 4OFIA 3WHXB 1SBSL 5JHDB 1D9KC 2DIBA 1CDCA 1JK8A 1RK1B 3KPOA 3HE6C 4G6JL 4FXKB 1NAKH 1OB1B 4OCWL 3UTPE 5IV2B 1WC7B 2AXGA 3GM8A 3HN3A 4Y19B 2Y06H 4PJAF 3KPQA 5KVFH 5JO5B 3JTSB 2VXSL 3P30H 2VDRL 4K94L 4JZJB 4U6YB 2YR3A 4A6YA 3K4DA 4DN3L 4XPHH 4R2GB 1CFTA 4FQJH 4WEBH 1NGYA 4HUVB 3D85A 1ACYH 2OSLA 2IFGA 4M1CC 3CXDL 3KPLA 1Y0LB 4JR9H 3O4LB 2ADIB 4Y4KD 5DGRA 2EH7L 3RPIB 5C0NC 4WTZA 1IKNC 3IYLW 3IRZA 4CN1A 1J10A 2X4TA 4XC1L 4HLJA 2QKIB 1BWMA 1MFCL 4N9OB 2EZ0C 3WUWG 3PQYB 1T0PB 3BZDA 4CADA 4U1IB 1IARB 2V9RA 1UG9A 1GAFL 3IGAA 4OCNC 4CW1B 4MJ6B 4U1JA 4MAYD 4OTXH 5EU3A 3D25B 1PZ5B 3JXAA 3ARFC 1CGSL 2XKUA 3HZYA 3I50H 4PJ7B 5D6DA 4MS8C 3MRJB 1KTKE 5D9SA 3KPMA 2A6KA 3RIFF 1MJUH 1CVSC 4KRPB 2ATKA 1X7QA 3BAEL 4L9LC 3EOBB 1R5VA 4PS4H 4NIKB 3V79C 3TJHD 1CFQA 3BQUD 3GSWA 4JDZA 4RISL 3BGAA 4LF3A 3R8BB 3C8DA 2X2YA 4EI6B 1U8MA 4MA1B 1VGKA 3WUWA 4PRNA 5K93A 2NZ9C 1J0IA 1GGBH 3VFWB 2NZIA 3G5YB 3P9MB 2VISB 3LPFA 3ESVF 5IBLD 1DEDA 2AJZB 5FB8A 3OKOB 5GSRA 1WZLA 5MENB 1A3RH 5EWIH 1CLOL 4U1MA 2H6PB 4PRPA 4Z7WE 1MFNA 5I2IA 4ZAKB 4OZGE 1DDHA 4RGNB 3IDXH 3L7FB 5MEPB 1KC5H 2Q8BL 3L5WA 4M6OH 2HT3C 1JZ5A 1AGFA 5ALCH 5T3XE 1RJZA 3VMPA 2CK0H 5EUOF 2AI0L 3W9EB 3OAZK 4I18B 3RWJB 1MI5D 1J5OH 5IVOA 3BDYL 5T3ZL 3KDMB 2B1AH 2UUDK 3GNML 4P3WA 4DGIH 2PYFA 1J8HE 3B43A 3C9NB 4OM1L 2VQ1B 1NC4A 2CIKB 2R8SL 5D7IA 3QT2A 2WBWB 2OL3H 4GRLA 1UM4H 2IJ0C 5HVHB 1D5IL 1N5AB 5D70H 1G6RH 1LO0H 4ZFOL 2BXZA 3O2VL 5I9QB 4HWBA 3VXRA 3S96B 1IEHA 5HGHB 2E7HA 3G5ZA 1DBKL 3QUXC 5HHOD 1OPGH 3DTXA 5J4MA 1OTSC 1YY9C 1SJEA 2WP3T 1F4YH 2ZUUA 4ZO7A 3BRFA 2IGFL 3KPQB 3MJ8A 5C2BH 3CC5A 4NQVA 2YD6A 2C3GA 5IMKB 2O61B 5TQ0L 4XMKH 4GG8B 3ARRA 4OLYH 4KTEH 3OSKA 3P0VH 5DJDA 3PWNB 3WUZA 2UUDH 4NUGL 4GLRH 5IGXL 3WO4C 3OKKB 3NACL 4Y4HA 4PJXA 2PXYA 4P4KC 3O41B 1CGSH 3D85B 4WW2F 2QQKH 3E6FA 2Q8BH 2FX9L 2L0DA 1BM3L 4LGPB 3KLHD 5LWYH 3BN3B 1RURL 3L6FA 1LP9E 1MAJA 4UOW0 4QHUB 1DQTA 1WWCA 2V6HA 5GRVK 3O6LH 3U6RB 2DYPB 3QXDA 5JHDE 2R23A 2UV3A 4HLZG 3SDAB 3T0EB 5C8JB 4GW5B 1U8KB 3GI8L 3RWHA 1YEFL 1ADQH 4P9ML 3MYJB 5F7EL 5IB1A 4Y19A 3NIFE 2IANB 3A67L 5AD0B 5K59F 1NFIA 1E6JH 3CU1A 3DARA 5B38A 1OGTB 2NY3B 2O26U 1YEHL 1MWAH 3RTQD 3I3BA 2B8OT 3L1OH 1CICB 4G9FD 5E8NA 1J8KA 1AFVH 1S7SB 3UTZA 4K9EL 4QXGH 1UJTA 1ZA3B 3RVXC 3QQ9C 1GAFH 3T0VA 5SWQA 1U3YA 3MLXL 4LLUA 3OHXB 1T5WA 3IF1B 3FMGH 3S36H 4M7ZC 3DTXB 4M1DL 4GW5A 2P49B 3S4SG 35C8L 1BZ7A 2MOVA 4IRJA 4DCQB 3NAAH 3PNWA 3RDTD 1IC5L 1I1AC 4XCYB 4XB8A 2DJSA 2X44D 1J0JA 2XFXA 2VLRA 4CJ0A 2EDEA 3MLXH 1N26A 4KDVA 2BVEA 3ZKMD 4YHLH 4ZFGH 4JFHE 3LVEA 1M4KA 3ARTA 5K9QG 4Z7UF 1S8DB 2YPLD 4PV9A 3QEGL 4EJ1C 5EZIL 2I9TB 4MDJA 4I3RL 2W9LA 1L0XA 2VDOH 2XWJB 2HTLD 3FQRB 3DGGB 2SEBB 3CAFA 5JHDD 3DX6B 2Q3ZA 1G7JA 2ICEB 4H26A 3B2UD 2IAMA 3U0TB 4EEEA 4EDWL 5I66B 3LZFL 2GAZA 1BD2D 1H15B 2G75B 1T1XB 2A1WL 1GHFL 4PJDA 3FT4A 3C87A 1NLBH 3UJJL 4Y1AE 5F1IB 2E7LC 3L3DA 1TQBB 4C56E 3RWFA 3ECBB 2YD4A 1J1XL 3T1WA 2WWKO 4UAOC 1BQHA 4G43A 3SDDD 4AL8H 2XKNB 2DQDL 3MLRH 3FO0L 5MENA 4NNPH 1T1WA 3H9HA 2NR6C 4LARH 4UBDC 1GCFA 3NACH 1SM3L 2F53E 5C0DA 3HNVH 4Z7UA 3VXSE 4I8DA 4P46C 5DQDL 2CKBA 2WBJB 5DD0L 1JGLL 4RX4D 1FG2A 5DJ8B 2EC9T 3PL6C 2I24N 3UJIL 3MLSH 1RIVL 4F57L 3UBXB 4MGXA 2R4RL 1UZ6E 2JJTA 1RZKC 1OP3K 3VD3A 2CDGB 4YBLC 2X40A 2PKDA 4K55A 1NCNA 1BQUA 2P5WD 3MCLL 3UO1L 2PETA 4LEOB 4KMQA 5JQHC 3T4YA 2XQYG 2VRAA 4PRAB 3BGFC 2OTWB 3F6LA 4NJAL 2L7JA 3STBA 4FN0A 1JWMB 3TA3C 1P7KA 4XX1G 4X9HA 5KANG 3LN4A 1YPZF 4WFFD 4X99A 5J13B 3QNYB 5GIRA 1N5AA 5I8EA 5I1JH 5IJKA 4PJAA 2LVEA 1Q9OA 5F1NA 4RQQA 4IRSB 1QFUL 1CIDA 2W0LA 1MQKL 5F96H 3QDMB 2X70B 5DVMA 3MRFB 3TWCH 4ODUB 2BVOB 2Z4QB 5EBMB 1QBAA 5ICXA 3SE3C 1IC1A 4NQCD 2AV1B 2DI8A 4X6EB 3LKRA 1K6QL 4XNXL 4QHKJ 1BVKB 2MQ0A 3EJZC 2AV7A 3FQTA 2H32H 4JFOA 2V9QA 3O2DH 3ZYOA 5KVFL 1BM3H 1UH4A 4ODXA 5E8DL 2Q8AL 5F93C 5J6GA 4D0CB 1KUMA 3IFLH 3UMTA 5F7HA 1IQDB 4BKLA 3E1F1 3KR3H 4LPXA 1PYWA 4IRSC 5BVPH 1C5CH 5E6YA 2M26A 1LE9A 2FIKB 2EECA 4D8PA 4RGOH 4U1SB 1FAKT 5SX5K 1FYTD 4KY1H 1S9WA 2AGJL 5GHWL 3SDXA 1IC4H 3P3YA 5IJVB 1DCLA 3QUXA 2XQYK 3TJEH 4JO4H 4LIQL 3N9GH 1NFDA 3KJ6H 4G5ZH 2PW2A 2I26N 2R2HA 1AD0B 4K3GA 5HDBF 4KUZH 4APQD 4OZFG 4IMLA 1B90A 1AIFB 1XF3B 3CVHL 4XPGH 3FB5B 4P23C 1MFEH 4HJJL 4M7LL 4ZFFB 3WFBH 4BZ2H 4Q9QH 3BMVA 3UJJH 4JQVC 4N8CH 4NOBA 4MDIB 4ALAH 4F7TA 3ULVC 3MJ9A 3MRQA 3TCXA 1JNNH 5FYKE 4XTRD 4OLZL 4HUXA 4YFLF 4YAQB 4Y2DA 4V1DB 2ED8A 2WWMD 3TNMA 4UINL 5CSBA 3FQWA 5DJDB 1V7ML 1ZXQA 1NJ9A 3I2CL 3CCHA 4C54A 4NO0B 5ESAA 1RZ7H 5C0FA 5T5FL 2N4IA 1R3KB 5D7LE 1WCBA 3RWJA 3P0GB 3RNQB 1M6OB 2Y6SD 3Q1SH 5DMKB 4FXKA 5DWUL 5LKNA 1FN4A 3QEGH 2K7PA 2ZCKH 1FFOB 5IHZB 1OAXL 4JDTH 3MRDB 1BOYA 3OKDA 3FQTB 2J1KA 4KK9C 2JELL 2YEZB 5J8OA 1UWGL 5E2VL 3KPPB 4R0LA 3Q5YA 4LSQH 2OJZH 1KV3A 1HKLL 4K7PY 5HY9B 2P5WE 3MUJA 5DJ2A 2W0PA 2A9ML 5CZXD 4GKNB 5EO9A 2XI9A 2X89A 5MP6H 1BP3B 1KPVA 4FQIL 3W39A 5CBEB 2J6EA 3FCTA 4MD0B 3MV7D 1G7IB 2AJUL 4OI8A 3MXVH 4QXTA 2X4PA 3Q1SL 3ES6B 2R2HB 5F97E 2HMIC 1I3RB 4GJTB 1MHHA 3MJ8B 4MSWB 4P2YA 4HPYH 3LKNB 3NTCL 3IF1A 1TJIL 1OT2A 2WNGA 2C1PB 3KPOB 3TH4T 4POUB 2Z8VC 3AXLA 4JQXA 1CCZA 4ZFOB 3FO1A 2AJXH 2HFEB 5EZOL 5E9DB 3G6DH 4MYWB 3LKOA 3RVVC 1AO7D 2RJMA 4WV1B 1QPXA 4KROC 4ZUSA 4DN4L 5KAQF 1XR9B 2OQJB 3MJ9H 5I1EL 5F9WB 3DLQR 3SGEI 1CK0H 3VMNA 3RTQB 2OP4L 3ULUF 3UDWC 1QLRA 1IGYA 5EBLB 3MXWL 5LJYH 4FFZH 1HYRC 1EEZA 3PP4L 5FK9B 1MPAH 1A22B 3RA7H 1J1PL 3LPGA 1ZEAH 2P8PA 2PW2B 1PSKH 2AKRA 1EIBA 4HT1L 2YSSA 4P2CG 3W9EA 1KCRH 1DUZB 3DYMA 4PR5A 3QHTC 2E7MA 3P9WB 1QNZH 5K9KB 4S1RH 2Z0BA 5E6ZA 3QDAA 4D8PB 4JEGB 1BREA 1FZKA 4MB3A 1OD9A 3HR5B 3OL2A 2E8YA 2RR3A 3T0DA 1IMHC 2Q76B 1QBLL 1N0XH 1NGZA 4QY8B 4WW2A 3UTSD 4I48B 3O2WL 3DVNA 4RAVB 2MKWA 2DWDA 2JLLA 3T2PA 2YRZA 2WQRA 3GSOB 3KYAA 1EBAA 1YMME 1AGEB 4JRXB 2Y5EA 3G08A 4XT1C 1U93B 2CH8A 1W0VB 2OK0L 4RMQA 1F42A 3MBEC 2VQ1A 2P5EA 4OGXH 4F7TB 3QWRD 4F9LC 3QO1A 2NXZD 4RZCB 2AEQL 1KTDB 4IOSD 3ARGA 3RY4A 4LASL 3EJJX 4TNVK 1U91A 4N5EC 1P4LA 1IGMH 4V2CB 4OQ1A 1NSNL 1UZ8B 4KGLA 4YZFF 4X5WA 3SDDB 3E6HA 4ODTL 4LNVA 5T1LA 3RJQB 1T1ZA 4JPKH 1N0LA 1YYMH 3EYQC 4ZS6C 4JG0L 4L3CB 3WO3B 1DR9A 2D0FA 5EU6D 2GAZB 2OJEA 1NUDA 1UA6L 2NY4B 2CJUL 2DQGL 1X3DA 2F54A 3RA7L 2IANE 5EBWA 2EDTA 4OBSA 5BS0A 4NDMB 1IBGH 3IFOB 4PGEB 3U36B 5IKCB 1NC4D 5C0AA 4ORZC 1P2CB 5CEZL 1G0DA 4JO1H 3ME0A 1MI5B 3PGFH 3DRTB 3DROA 3Q5TA 3MFFB 1I3UA 5IB1B 5FUOH 4H1LA 3TIEA 4AEHH 4Y2DB 3R0NA 2P8MB 1IM9D 3E6FB 5JW3L 3ZTNH 5CLWA 1FGVL 1R3LB 3EYUL 2BDNL 2JIXD 3L5HA 4XNUH 4JLRA 5E2VH 5ID1A 1A47A 1CZ8L 1ZV5A 3JVGA 1MWAL 4ZXBC 2CLVA 2EDYA 4M6ML 1N7MH 4KVCL 2ZZUT 4NO5B 1CLCA 5JW3H 5DMKA 3MRCB 5FAAA 2IQAB 3HC4L 4GS7B 3WHE1 4FOMA 1T2QL 2VDLH 3J7HA 1XIWA 5IVXE 1DQQB 3GJFA 3MO1A 4GSDH 4NKQB 4Y16B 1KIUA 3RGHA 3T04D 1PX3A 4Y1AB 4JJHA 2VLJD 4GG6E 2AJUH 4C83A 4Q6YA 2AEQH 2EH8H 3O8XC 2AAVA 4MAUH 5HGAA 4U3CA 3BUYB 3FTGA 3HI5L 2D9QB 4JREC 1JHLH 2XT1B 4QRUA 4TVPH 4JQXC 1CFSA 3AREC 1WFNA 2IG2H 1M1SA 2FD6H 3PWUA 2J8UE 2G2RA 4W4NA 3TO4C 3VXUA 5FKAB 1YYML 2OXHA 3N85H 1FYTB 4WUUD 1CI5A 1BVKA 2BX5A 3TO4D 5DJ6A 4BFIA 3GMMA 4KRNA 3BVNB 5KN5B 3JV4A 4PJ7F 2AEWA 2Z31C 4OIIH 4OGYL 3ZZ1A 2X4OB 4Q2ZB 3GSUB 1T7YA 2VDKH 1FBIL 1MCPH 2OCFD 2ADJB 5T3XH 1YY8A 5DRXA 3OZ9H 2EEDA 2GTWB 3H9SD 3O6KL 1E6OL 3LEVL 4M8QA 3ZDYF 1OGAD 1T6WA 3NAAL 4R90H 1A5FH 1TTFA 1P7KB 1S7WB 3QWOA 2H2PD 2F53A 1I3VA 3NN8A 1J11A 4X4MA 4HT1H 2EC9U 1YPZA 1UC6A 2EC8A 5C2UB 5HHVH 4JHZA 3T3ME 2JCCA 4HKJB 3V0AC 3L3KA 3FFDB 5T1MA 2JJWA 1YEJH 2OR8A 4NCC1 1FG2B 1HCFX 1QSVA 4F7EA 2DQCH 1CU4L 3ZKXB 3NIGF 2OTUA 2VWEE 3D69A 4H0GA 3UJTH 2ICES 4MXWH 1FG9C 1QR1B 3HNTH 4U4BA 2G60L 3B3IA 3FHAA 2OBGA 1QBML 5KSVA 5HHQA 4HUXB 5I1GH 1ORQB 4NBYB 1YEEL 4XPTL 5FB8B 5FYLE 5DO2D 4L9LA 2CK0L 5DHVA 2IPKA 1SVCP 1IILE 2O5XH 3P11L 1MCOL 3WXWH 1I4FB 3UTPD 1TTUA 4OQTL 5C09B 3PWLA 3UDWA 3K3QA 4GBXB 3PWUB 5SWSE 4LMQI 2ZCHH 3SPVB 1WBYB 1BFTA 3PP3K 1NFDE 4J3UA 4TUKL 3UTQB 4YEFA 4QRRA 4HXAH 1MREH 1U8NB 8CGTA 5CIPB 5GPRA 4JN1H 1AQDA 1INDH 3H9SB 3WFHA 5HYSB 1QLFB 2F74A 3HS0A 5F89B 4KQ4H 1T1YA 5H35B 2IPKB 5DEGA 2RFXB 2VDPH 1DDHB 2D7PA 5GSVA 3W5NA 3U0WH 1PG7L 3FAXA 1S7RA 3VGDA 4XVJH 3NPSB 3VFVA 1F4YL 2B4CC 3NPZB 1TJGL 4V1DE 3FZUC 3DBXA 3I6GB 3CSYA 1OCWH 4KQ3H 2FSEB 4FQXB 5C7XL 4PJIB 4TVPL 4F2MB 3CUPA 2ZCHL 4Z77B 3IAQA 4GXUM 4P3DB 4UOJA 5BO1H 3BT2L 4W4OA 4NZJA 5KSAC 4LF3B 4P4RB 4F33A 4HH9A 4U1HA 1G0YR 4NUJA 1GVIA 1QSEB 4PPTA 4Z5RA 4JN1L 4BH7B 2GJZA 3OG4B 2F58H 5HI3D 2YRPA 5B4MD 3EDEA 1HXMA 3QG6B 2P7TA 2Q1EA 1S9YB 4JVUA 4X9GA 6FABL 1WIUA 5KANI 1ACZA 4OFYA 2KH2B 3OKLA 3KPPA 2NY5H 1UCBL 5DEZA 2DB8A 5J89A 1CTOA 2DD8H 3F8UB 4JZOA 3TN0C 2P5WB 1X5ZA 4ZAKA 1JI2A 5DJAA 4D0BB 1MCHA 4FFYL 1NH6A 3IB4A 3RUGA 2HJFA 4HGWB 2HN7A 3MBEA 5TE7H 3QIUD 1HHGB 4OCSL 3ARBC 5E2WH 1R3JB 3O8XA 4YQXH 4KJYB 1PKOA 4GW4A 5EU7E 5DJ6B 1UZ8A 3K4AA 4UNVA 5GGUB 1JZ3A 1NGQL 2A0LD 4G6FD 1AIFA 5DLML 5JXEC 1KIQB 5EC1A 4U6VH 1HNFA 5GHWH 3OAZH 3DYPA 3QQ3B 4JKWA 5MHSD 5EOCL 4NHUA 4WW1A 4DVBB 1QKZH 4A2MA 4LSSL 5C08A 4G80A 2MJWA 2VLKB 2NY6C 5E7FA 1QR1A 1AXTL 4U31A 3EJYD 5TGBA 2CQVA 4M02A 2JJVA 2BJML 1AC0A 3VXUE 3PXHA 2Z91A 4DGIL 3VWJC 4XZUA 1K6QH 4XNXH 5DJ0B 1VFAB 3RGVC 5GS1B 3PDDA 4Z95L 5ISZB 1MCEA 2EH7H 3QIBA 2H2SC 2YD5A 4FABH 3ARBB 2BSTB 4Z76A 4U0RC 5D2LA 1J18A 3RX5A 1HXYA 1C08A 3T3PF 2NY4D 3TBSA 3SEPA 1YECL 4NRZA 6FABH 4JGMA 1TPXC 5LQBL 1RMFH 2M2DA 2Z8SA 4ZUTB 5JW5A 1KLUB 2X09A 1M7DB 3L3HB 4XMLH 1WBXA 4PRID 3QBTB 1IM9B 1BQLL 1NC4B 2AJVH 1VEMA 3VGEA 4NFDA 4OUUA 4JFXA 2K3TA 4AM0A 5I76B 2BSSB 1GOFA 1MCWW 3MRMA 4DGVH 4WI7A 3H7BA 1KG0A 3TFKD 1N0XL 5ITBH 2ORBH 4QTIL 2VLLA 2CIIA 3O8XB 5TFSL 5IB2A 1BBJB 1BZ7B 4LPTA 4EQ3A 3DVNB 2GTZB 2FHCA 4Y8AA 2ZOKB 4XP5L 1A6ZA 4Y16C 2QQQA 4WJ5A 1NEZA 4X6DB 4NC1C 3C8KB 3WXVL 4Y4KC 1F2QA 2DMCA 1T1YB 5H35A 3EFFA 3ULSA 1CL7I 3IETB 1M7IB 3D3VE 3SE9H 3EHBC 1UJ3A 4NKOB 4Q9RL 3NIDE 1VADA 1QTYT 1WIOA 3VXUD 4OCYH 3L7EA 3VXSA 2NX5D 2BNUA 2VLJB 1CU4H 5IR1B 2Q7NA 1RUML 1F6AB 5E2UH 4Z7VA 3U9PH 3P4MA 1LEKA 1G1YA 4OD3H 4CL7A 3D18A 4PLJD 1FNSL 5FYKD 3IRPX 4JFEA 1VEOA 2WIMA 4P2OC 5D7IF 2IH3A 4PYHA 3OAYH 3OX8A 9CGTA 3HE6D 3ZKMC 1U8MB 4KZEH 1FL6A 1KXQE 4RAVA 1LEGA 3H2WA 3L3KB 2V2TB 1TIUA 4PRHD 3O9WA 3ZHLA 1HSBB 3D0VA 1U8PA 4OZFH 1KN4H 4JO3L 3F7RA 1XMWA 2G9HB 2XZQH 2DL2A 3L3IB 2X4QB 5EU5B 4YHPB 2CUIA 2PYEB 3PP3H 4I4WA 3HZMA 3BESR 4ELMF 4M1CD 2YA1A 3PHOA 2SEBA 4XCEA 2CDGA 2VDML 5I17B 1UYWH 5I8OH 5IESH 5KSBF 4P3DA 3P4LA 1KPRA 2Z4QA 5KG9A 2OSLB 1J5OL 1K2DB 4M43L 3HNSH 3HMWH 3MCKA 1D9KD 1I8MA 1A2YB 2V7HB 1K8DB 2Z93A 4MXQC 3Q6GL 4GQ9H 3WHE0 3DVFA 4IRJD 1JWUB 2VITB 3VMOA 3MV01 3QO1B 4RZCA 4GG6A 1XF5A 1I7TB 3CZFB 2XFXB 1ITCA 4HXBL 5BMFL 5IJKC 3KLAA 2A6KB 1JGVL 5HHXL 4YPGA 3H3PH 1LEIB 4I3SL 2FO4B 1G9MH 2DLIA 1PKQB 4HKBA 1UXWA 2MWCA 3BP6B 2HJFB 3FQUB 5IOPA 2EE6A 4L4VE 1XEDA 4M7ZB 1EJOL 5FEBA 3DHMA 1KCRL 3BPNB 4PJGE 2UWEF 1JNNL 1X9QA 1UH3A 3RPIA 1MRCL 3FQXA 2H8PB 2ENYA 5DHXB 5L7XH 2ENSA 4X98A 1SVZA 4GG6B 4KUCD 4D0CA 1IT9H 1TQCB 2GJ6A 4JPWL 4P5MB 3G5XB 1HCVA 1JF6A 4KRMB 1BQHG 3QPXL 2EKSB 1ED3A 3L3HA 4L9LB 4TRPL 4BH7A 5F44A 1PG7X 3VGFA 3CFEB 4GKNA 3V8CA 4JFDA 2AV7B 1J7VR 1FZOB 3V5DA 2EDHA 1FZJB 4U0RB 2Q6WA 2DQEH 3QB7C 2CO6B 1G9ML 3X11A 1UM5L 4U1KA 1N6VA 1QSFA 4HC1A 1X5HA 5GJTL 1A7PH 1NEUA 1DVFB 2AJSL 2PW1B 5FHBH 4MZ3A 1BEYH 2JJSC 3DWTA 2CR3A 1L7TH 2LU4A 2P24B 3NFNA 4FQXD 4WEMB 3C5ZC 4P48A 5EZLA 3K7UA 4WDIB 1UZ6F 5KSUA 4FQQA 5GGRB 3A6OA 1L6ZA 3BHBB 5HYEA 3FZUD 1A7NH 4FQ2L 1IM3B 4OAWB 1W8NA 1S9XB 3MR9A 3QIWA 4N8PA 4XC1H 3LD8B 3A0OA 4LL9A 5IMKA 5B38B 1MCWM 5F7FA 5FCSH 3JUYA 4DVBA 4RFEA 2HG5A 4F15B 1T04A 4IHOB 5KJRL 3F5WA 5M95B 5I71B 4FQHA 1CD0A 4X4ME 5J06A 3SJVD 3RDTC 2A73B 3PDGA 3PWLB 3E3QC 2R2EB 2R29L 1JZ7A 2HKFL 5CP7B 3AM8A 1WQVT 3CJJA 4G6FB 5E2TL 4RQQB 2OTPA 5L2KE 5C08D 4Y2DD 1T0NA 4EUPA 1ZGLM 4NO2A 2RCSL 3TBYB 3U4AA 1MIEH 3K2MC 3QDGA 1Q9KB 2X1XR 4E5XB 1KJVB 1LO2L 4PLOB 2F74B 2FBJL 3HS0B 5DMGC 3RGVA 5AWNH 1PFCA 5ALBL 3VE0A 4L5FL 3S36L 3BYYA 4HS6A 5DUMH 5IEKB 1IKNA 1T66D 1Y6NR 1IQWL 1FBIH 1LK3H 3RWEB 3UTSE 4ODHL 5DQDH 4KU1A 4B53A 1ZGLB 2OR9L 2CSPA 3GHEL 3STLB 2HKFH 2EO1A 2MPAH 3MCG1 4P2RA 5I18L 5FGSA 5EUKA 3VI3F 3RY5A 4J4PD 2AW2A 3LH2H 1FFNA 3G04A 4R4ND 4UV4L 2APWA 2IMNA 4Z6AT 4UTAH 1KJ2L 1P6AB 3U1SH 2FBOJ 2X4OA 2JE8A 3QUKB 5IHLB 3CFDB 4FS0A 4RGNE 5HGBB 1MJJB 2ESVE 2DM2A 4JFPB 1HOCA 5F89A 3HI6L 2B4CH 1CBVH 2QSTA 4TQEL 2V2XA 1J8HD 4Y5XB 1QLRB 2H45A 5EZJB 3VXSB 4HIXL 5JXAH 4J23A 1QSEE 2XZAL 5F6HJ 5DYOA 1X5AA 2OJEB 2FL5A 4OFVA 5KTEL 1MHPH 3C09C 4XVJL 2AJSH 4MA1C 1HKLH 3U4EA 1NBZB 1NCUA 3HCVA 4G6AD 1NANH 1NGWB 4QEGA 5AZ2L 3OKMB 1JPFA 5IBUG 2NY3C 2QKIA 3MJ6A 1N6QH 4WTZG 3TT3L 3ZKND 4HIXH 5JXAL 1XGTB 4Z78B 5BOZG 1ONQA 5HHOE 2FRGP 1JWUA 2VITA 2P7TB 4XP1L 4YHIB 1AR1C 5DMIH 4Y5XA 2NX5B 4F8QA 1IGTB 3EYSL 5SX4I 1S9KC 4G7YH 3IS0X 1CBVL 5JPNA 3A6CL 1ZWIA 4LLYA 4WWKA 2BJMH 1LNUB 5L7XL 2XYCA 3GHBL 3Q6FB 2EEBA 5EO1B 2DKMA 5GJSH 4BYHA 3BZEA 4HEPG 5C70A 3L1OL 25C8L 5EOQH 4M8VA 3WJLC 2A1WH 3QDMA 4Z95H 1A6VL 1IE5A 3V9FA 2WW8A 4NN5C 1SY6L 3E2HB 4U1GC 3MLWH 4JFZL 1YEEH 1REIA 4XI5D 4Z7NE 5IG7A 2HT3D 4M5YH 4OAWA 3PJSB 1LO4H 1R3HB 1T2XA 4R3SB 3QUMB 3V7MA 3WD5H 2D7OA 5C08E 1RU9H 1D5XB 5HYSA 1ODAA 2Z35B 4HGKC 3T4YB 1N4XL 3ZT7A 3CFBB 4YBQD 1HI6A 5D7JB 4UU9B 3V7AE 4QRQB 2DLTA 3QIWC 1KXTB 3WNOA 3RZCD 1JI1A 5EZJA 1CXKA 4HUNB 2VXQL 4QHNB 5BOPA 2DQFA 4AT6B 1CICC 1ZT1B 2HVKA 1LK2B 3FL7A 4KPHH 2VH5L 4QYOA 2VKXA 2R0WH 3EFDL 4CNIA 3H9ZA 1A3RL 2C3VA 5SWQB 2W60A 1WICA 1W72H 4MA3B 4NPYB 1BBDH 3LZFH 3GBLA 2PXYC 3QZWG 1YEKL 2YD7A 3GMRB 2D7TH 5F7NC 1BIHA 3ARDC 4KKCD 2BHYA 4AIZA 3HTLX 2DN7A 1W0YT 3FO9A 5DRZA 4Z7OF 3E0GA 2R56H 4LCUB 4UT6L 3MLTB 3ARGC 4ZAKD 1OWWA 4K7PX 1S7QB 4JO4L 1H5BC 1AGCA 5F7YC 1FORH 4GRWB 5BCAA 1FE8H 3HE7B 5E1AB 4UIMB 3B5HA 5IB4A 1PSKL 2ARWA 4JZNA 1A7NL 2APXA 15C8L 4NCDA 2F5BH 2B1HL 1XGQB 5DXWA 3U83A 1D3CA 4MCYB 1U9KA 1NCTA 1S7VA 4V2BA 3V4VH 3FQRA 2E27L 4Q6IB 5EIQA 5L8JB 4AENB 4TSAH 4LCWE 3DX7B 4X8JA 1HIMH 3JVGC 4ONHB 3RP1A 1C8PA 2DI7A 5FXCH 3HMXL 4YHZH 1Y6KR 5LAXA 4GAJL 4K07A 5CSZA 4O00A 3AAZB 1HEZA 2E3VA 4I0PB 4IMKC 4JM4H 1LP9F 4YC2C 1ES0B 2B7DT 3ZDZE 2QV2A 1XGQA 5KZCD 5SWSD 5DZNA 4BSJA 3FO0H 3HMXH 3S37H 4YHZL 5DGQA 5HD8C 2Y36H 4ELMB 3BZFA 1Q94A 4WEBL 3ZHKA 5CMAB 3F5WB 3D39A 3RUGF 3VFGL 5BW7A 2W9DH 4QRRB 1NFKA 1JYWA 4H8WH 1R3KA 3D0LA 2E27H 4CVZA 5DVNA 5DA4A 1DQLL 3NVQA 3KPSE 4HHAB 4PD4J 4AIXA 4I9WE 4FXLA 1A7BA 1RULL 5DK3A 4PJ5D 4I0PC 4YC2B 5MP6L 3LKSA 4NQEA 1MRDL 2IANA 1LHZA 4ETYA 1U6AL 3B9DA 3CZJA 1JGVH 5HHXH 1JTOA 5A40E 2XOTA 2BHUA 2M1KA 3KYKL 4M6MH 4P0DA 5MHSE 4LSTL 4HG4K 4I3SH 5DC4B 3REVA 5FO8A 5KBNC 1DVFA 2HP4A 5F71A 3LH2L 1AP2B 1F6LL 4Z77A 5FDWA 1YQVL 1T7XA 3RTQA 1YN7B 1K3ZA 3WSQL 1KPVB 2XXCB 5CJ8A 4TPRH 1Z9LA 4YHNB 4PJGA 2G75A 1OSPH 1QD0A 1NUFA 3QJHA 4CVXA 1I8LA 3NFSH 1IM3A 3SKOA 3MACH 4TSAL 3QFJB 3GBMH 4U49A 3JTTA 2DF3A 1QFWH 4P46A 4POZC 1FN4B 5JR1L 2FZ3B 4J3VA 3DVGB 5EPMA 3TIDA 43CAA 3PL6A 4G6KL 3FMGL 3S98A 5C6WH 4K7FB 4IOIB 5J1AB 2AABH 1ES0A 3RWGB 4YDIL 1Z2KA 3CCHB 2XWJA 3QG7H 2UWEE 4XHJD 5EULV 5E2TH 1HZHL 1TQCC 2DBJA 1QSED 1R6VA 1RJYB 3VXRB 3VW3L 2GQHA 4OCRL 2H3NA 4MLSA 1X5LA 4NPYA 4RMWA 3QDHA 4PJFE 5J11B 4ORGB 4JB9H 5DTFA 1F4HA 1PQZA 4QGYA 1Q9WB 1B6DA 1H3PL 5L6YH 2IH1B 2BK8A 1QFWI 3JV4B 2WAHA 3VXNB 2OK0H 1JZ6A 4OF6A 4LP5A 5EN2A 4OLUL 4UB0L 4C4KO 1BPVA 4NGHH 5BJTB 2BZDA 3FFCA 1UFUA 1YNTB 5FM5O 4GRWF 3BQUC 2XXMB 4R97B 2KQMA 3RBSA 2PYEA 2W38A 3WSQH 3T2NL 1EEQA 3QHFH 4OFPA 5LG1A 1FJ1A 4OB5H 4XBEL 5FYLD 5F7DB 5DJYB 1URLA 2D7QA 5GISH 1UVQB 1T2QH 3KHOA 3BPOC 2W60B 1LD9B 3QUKA 1NMCC 3I75A 1ADQL 4L8SB 1YMHB 3N06B 4F33B 3GK8H 4DKEL 1EEYA 5F9AC 1OQOA 1DBAH 3DROB 1CYGA 1RUKH 3DO3A 4KKAC 5BQ7B 4BSWB 1MRCH 3W81A 5C0BB 2NNAA 1I75A 2J88L 3P73B 3HPLA 4KKAD 1I85C 3Q3GB 3IDYC 2M8XA 4NM8L 1LK3L 3JWDC 3MA9H 4E0RB 3EJZD 2W65B 2ZUYA 3IAGC 3ARYA 4UI2A 2IMMA 2R8SH 3FONA 2X7LB 3QSKB 4GKSA 4HFWA 4PS4L 4OLXL 1FZKB 4HS3A 1ADQA 4C55A 3WHXA 2HLFD 3TVMD 4MCYA 5CEZH 4WNQA 2LVCA 2VSCA 3OWEA 5SX5H 4ERSH 4Z9KB 1ZVSB 4JM4L 1K4DA 1HWHB 5KSBA 2ZUQC 1MCOH 2R1WB 3QEHB 4WHYG 3WXWL 3JWOL 4XTRC 4KK5D 5BVJA 2IFFL 3BH8B 5DRNA 1BHGA 2D4DA 5BZWA 4E41A 1FIEA 2VDQH 2AVGA 3TN0A 3SQOL 4PGDA 2DRUA 4TUKH 3DXAD 4ZAKC 5EO1A 4EN3A 4PY8J 1FNAA 1F6AA 5FM5M 4X6DF 4DTGH 3DV6B 2ILLA 4QF1B 2DIJA 1KLFA 3THMH 1T3FB 5FYKL 5I8EB 2NY1D 3QUXB 3IVKA 4AIOA 2HT4D 1UGNA 3T0AA 1NDGA 1YEGL 3SDXE 2NY7L 2ITCA 2R0LL 3BH8A 5DRNB 5JXEA 1F90H 2ESVB 1AGEA 3SHSA 1VACB 1K8IA 1LP9B 4N5ED 3PWNA 5FFLA 1BVLB 2ZPKH 5E2WL 3FB8B 5GRJL 4Z7QE 5IMMA 4D9QE 3SGEH 4RWYH 4HWZB 2G5BA 1LE5A 3HE7D 4PR5B 1I8KA 4WFHE 2AJ3B 4ZPVB 3C6LA 3PABA 5ILTH 2Z91B 4JFEE 2XACC 3MODH 3BZEB 1KULA 3BEVB 1CFBA 3NCMA 2ATPB 5C0CB 1KC5L 4U7KA 4YLQT 4XAWH 5CGTA 4L4VA 5E5UB 3MGOB 4Z0BH 3IJHA 3T4AB 4L29B 3SJVB 3GMRA 3MV7B 1IGIL 1A1MB 1G7LB 3CSPA 4MJ5A 1K8DA 2Z93B 4NP4H 5DURB 1AFVL 4X6CB 2YPVL 2YS4A 2AQ1A 5HHNA 3O45B 4XP9L 1INEL 5HPMB 3MV11 1WVZA 4NC0B 3QEQA 1BQSA 4ZPVA 2DYPD 3EFFB 3M1BA 2FATL 1PZ5A 3QEUB 5HVGB 1P4BL 4HWBL 1CDBA 3GI8H 2BNQB 2F5AH 1SYVA 1RJZB 1I9JH 5E99H 3SBWA 1L0QA 1BX2A 3PXJA 2FH6A 5I19L 2C7UA 4QXTB 1A4JA 8FABB 4O2FB 2VIRB 2ITCB 3FO2A 1BQLH 1HIML 1W72L 4G9FB 1CD1A 3KPLB 1CE6A 5E7BA 5IEHA 2QTEA 12E8H 2VDLL 4CRPA 32C2B 1FL6B 3GMMB 1TETL 4F3FA 4C57C 5D7IB 4G8GD 1QR4A 5C0BA 4HUKB 1CTNA 1AXSB 3QQNA 4ZUUA 1DQDL 5CJBA 3X14A 5E2JA 1OW0A 3TT3H 1DBJH 1OY3B 3SQBA 3BFOA 3NFPA 4ZO9A 1FZMA 1YNLH 4J7RA 4FQCH 3RY6A 1RJCA 3QQ9D 5B39G 4X80H 3EO1A 5ANME 2VKWA 1S3KH 1CIUA 2X4NA 5CIPH 4CU7A 5DURD 4WW2C 3MRHB 3NN8B 1QZ1A 4OF5A 3MLRL 5JW4R 3MMEB 1J0HA 4G8IB 3SKJL 4XP6H 1AGDB 1U3HC 5TE4L 1P6FA 4LCWB 4I77L 2OM5A 4QHMB 3OKMA 1ORSA 3QCUH 2H41A 3I9GL 2NXYD 2EDJA 4S1SL 2XZCL 4AH2A 2WUCH 1PKQA 3RPKA 2YPKA 3QHZL 4M61A 2NY2D 4FFZL 4XVTL 5HDQH 4MB4A 4LSRL 5GGVH 5TQ2L 3H7LA 1MJ8H 3MBED 1QPPA 2A6IB 4X7TB 5TF1H 1A7RH 1NAML 4PRHE 3MJGX 5GGQH 1T83A 1Y0LA 2NXYC 2N1KA 4H8WC 1NFDF 1T0NB 1HINL 5H2BA 1I3GH 3F7PC 4YNYA 4LLQB 3UTZB 2VIRA 4K8RH 2R2CA 4JDVB 3REWB 4JRXA 1MAML 3VG9B 3MV8E 5I75C 1AJ7L 3BUTA 2CRZA 3EO9H 5HVHC 2YEZA 2JB5H 3F7YA 4UILH 1LMKA 1MWAA 3BISA 1BIIA 3IJYB 1NAMA 2AERT 5DDHA 1ZHKA 4AQ1B 4EN3D 4NWUL 3BDXA 4NQCA 5D5MB 2CKNA 4U7SA 3IDMB 1DJSA 4X5WB 3SDDA 3O3EB 5T1LD 4PJ8C 4OBRA 3SO3C 4K3EL 4KTDH 3MXWH 2F5AL 4I3RH 3IFLL 4RISH 4PJXF 1KJ3H 3HZVA 2PW1A 4HS8H 1MAMH 3BPLC 2JJSA 5KG9B 4M48H 1AY1L 1LO5A 4UT9L 1TFHA 2KDGA 1XF4B 3FB6B 3WIHL 5I30L 3VRJB 4PJ8B 4M1GH 1NBVH 3R0MA 2OTWA 4O9HL 1FDLL 5LCVL 4TNWF 2X1PA 3IDJB 4M1DH 4QY8A 1CLYH 3LN4B 4X99B 4ZUVB 4LSRH 2FWOA 2OL3B 1VB9A 4X0KB 5EU6B 2NPLX 5JPMA 4O2FA 2GKIA 1RJLA 3C5ZA 4OLZH 4H88H 3HRZA 4LSSH 1L6XA 4Z7NF 4NT6B 1JPSH 1Q72H 4HS8L 2P44B 3DRQB 4P57B 4J3XA 4Y5YA 4NN7C 1QLEL 1UKTA 3GJEB 5JW4N 2ICCA 2ZSVB 4Y7MA 2R69L 4N90E 1Z0MA 3ARFB 3EJYC 3MLYL 2WIIA 4RAUB 4QKXB 1HOCB 3O0RL 4HKZA 1FRGL 2VLJA 4LLWA 2C3XA 2AJYL 4LKXA 4ZNCD 1NCWH 4CU8A 4OT1L 5MEQA 4JJ5B 4N8VA 5JXED 1OGAB 4HGWA 1NBQA 3O6MH 4HZLB 5IT2L 4I5BB 3PWJA 2J4WH 3H3KA 1ZVSA 4PFEA 3DJ9A 4R4NC 1ROWA 3D69B 1IAKA 3SGJC 5C0CA 3TCLB 3RRQA 4NWTL 3LEVH 3IKCB 4KKLC 5EUOA 5DR5L 4OQTA 4XWOC 1NEZB 1FFQA 5T3ZE 1V5JA 1IGJB 3S3SA 3OJDA 4MNQD 1OSPL 3FKUS 3QNXB 5FO9A 2B2XL 2JK5B 1KN4L 1ZLSH 1WAAF 3UTTD 3MREB 4KUCF 1H3WM 2DD8L 3C2AH 3H3BC 4ISVA 2A83B 3TH2T 5CBEA 4PJ9C 4UZGA 1QVOA 4POZD 2ICWA 1IAIL 1JRHI 3NCYP 2CO7B 3OR7A 1PVHA 5AZEL 3DUHA 5CCKH 4G6AC 4LHUD 2XY1A 3NMEA 3QDJD 5GS0L 4P2QB 4PRPD 2W9EL 1FIGH 2B5IB 4JO3H 3MCKB 5L8KB 4WRLA 2DKUA 2D9CA 3IETA 3GSNH 2XZQL 3QUYB 5EBWB 4S1DD 1AD0A 2A6JB 3B83A 2CXGA 1NGWA 5DZOA 3U2SA 1H8SA 3LN5A 1RZFL 4KRLB 5FYLH 1LWRA 4FG6D 1H15A 5GZND 1P53A 1F3DJ 4M9PA 4BQ8A 5C0GB 3NOIA 5ESQB 3VFMA 4LVNC 4LHUG 1IJ9A 4F57H 5TPWL 1BECA 2QADB 5E8NB 1JPST 4FHBD 4HWNA 1GGIH 2FECL 5TJWK 4ZUVA 5ABDE 2VUOA 3PV6A 3UPRB 1CZ8H 1U3JA 5ID1B 3MRKB 3VWKD 5I1GL 2XN9D 3L6FB 4XNMB 4YWGL 5TDOB 3B9EA 5HI5D 3CSGA 1JV5A 2HKHH 4YIQB 1C7SA 2R0KL 3MYZA 5CUSH 3PHQA 5C6TL 4R26L 3IT8D 3TYFB 4PY7B 1V05A 1IBGL 1D7FA 3OR6B 1H8OA 3D3VA 3GZKA 3LHPL 4W68A 5CP3H 3FT2A 3CVHA 1G6VK 2HJLA 3DUSB 3Q0HA 1EHLL 4MMXC 1TZGH 4JPVL 1MJ7L 3LEYH 1KBGL 2BVUA 1NGZB 2JCCF 4JANA 4XBPA 2CRIA 4YEEA 3KLSA 4EI5B 4QRTA 4ZODA 3ULVL 3QUML 1IAIH 2YPLB 1GL4B 2XTJE 2A9NL 1WEJH 4OZHA 4WI8A 1FNGB 1MNUL 3KPMB 4HDIB 4HJGB 4XMPH 3QIUB 3VFSB 3VXOB 3ARDA 4LASH 3V6OE 2DQTL 1NBYA 2EDXA 1DE4B 5D70L 2GJZB 2NXYB 4WI2A 3V5KA 2A2QT 4NO5A 4MXVF 3GDBA 1J1XH 2AV1A 4F15C 1DBKH 3W5MA 3V5HA 4EI6A 4WVRA 4KROB 3C60C 1I4FA 2J5LB 1GPOH 4M3KB 1JCKA 5BQ7A 3MRQB 4RFNB 5C0DB 1ZLSL 4JVPA 1FZJA 1ZVHA 1U42A 3VU2A 4QXWA 4R0LC 4ONFL 1EGJH 1OAZH 3T09A 1DTUA 4KMTL 4WHYH 2GSIB 5T3ZH 4MXQD 2HA1A 4M7KL 2HFTA 3K2UL 2VERN 4S1QL 1MHEB 2UZXB 2PF6A 3O2WH 3AU1B 1EUUA 3ORJA 3ARXA 5INCA 3MUY1 3ULUC 5L2KD 3PUCA 5E70A 5A3ID 2QBWA 4IIQA 2WP3O 3GBNH 2C1PA 5DQJA 5SWZD 1EZVY 3V6BR 5GGRA 5EWIL 4JG1L 3MRDA 2JK5A 5CD3B 5FHAH 5I73C 1ZHBA 5TE6L 3NGBB 3O3DA 5EDXA 2J8HA 4NSKA 1XH3B 1ZE3C 1I7RB 4WO4B 3SDCB 3TBVB 4D2NA 2ZJSL 4YFDB 5E03A 3QUZB 2DJ4A 2P4AB 4PTTB 1FV1A 4JLRB 4KKBC 5C7XH 3GRWA 3HB3C 4HH8A 4P3CH 4X4XB 3DXAB 1Y18B 3K1DA 4JDZB 2CLRB 3BE1H 4XPAH 4L8SC 4RA3A 4YUEL 3UC0H 4JRYE 4ZO8A 3MRKA 4E42A 1JFQL 4KTEL 5FKPA 4B0MM 1CF8L 2QQLH 2NY1B 3VA2C 3SE8L 4PJ8D 4LEOA 5D72H 5A16A 4NQCB 1A9BA 2QSCL 1CD1B 1AH1A 3AXLB 4ZFOA 1I1FA 3BKJH 4XVSL 2ESVD 4Y19D 1GSMA 1EHLH 2EDDA 4PRHA 3GSNL 4XP9H 1ND0A 3I50L 5L2KB 3V0VB 2CPCA 3F7QA 3QR2A 3ZE1F 3S5LG 3O6FD 4HUUB 4N9GB 4JJ5A 4N8VB 3BZ4A 3SKOB 5H2BB 1CQYA 4JY4B 4BQCA 5E4EB 2BOBA 1KEGL 3UTOA 5EC1B 3WMSA 3O6FC 1B0WA 1F58L 3IJHB 3C08H 4YHNA 1KIPA 2QQLL 3RIAF 1G7IA 2VLRD 3OJMB 4JKPL 4WU5A 3GNMH 2V5SA 4Y8DC 2LAAA 3S35H 3T1FA 4PRIB 2NW3B 1JGEA 1PKQE 3MUGA 3K1KC 5E1HB 3GIZH 2HG5B 3UZVB 5FO9B 3RL2B 1GZPA 5DD1L 3L3JA 3DX8A 3SGKC 1RJLB 4U6HA 2RIKA 1DUYB 4KPHL 5GRVL 2BVTA 1WBZA 4LFHG 1AGFB 3IFNH 4UTBH 4X8XA 5D7JC 1ZLWK 3ULUH 2AEPL 1U6AH 4PRDB 3P30L 4KRPD 2HTKD 3IDIB 2D0GA 5TF0A 5D8JH 2FHBA 5F7WC 1OF2B 2GI7A 1MHEA 4LCIH 3NABL 4JRWA 1ZANH 2EDLA 3HC3H 1KCSH 1F6FB 4PRBA 1VPOL 3MUGB 4IIQB 4R7NB 1BD2A 2ZG2A 4PG2C 4JKLA 4OF7A 3VXTA 3E2HC 4U1GB 5DHYA 4NN5B 3VWJB 4JG0H 3W9DA 4N0UB 1KENL 2GTWA 2A74B 3OZ9L 1GZPB 4DCQA 4IDJL 5DK0B 2H1PH 5BV7L 2PCPB 1QFHA 1MF2H 3B8SA 1IGTA 2Y4SA 2DQCL 5GS2D 4YAQA 1SY6H 2ED9A 1IQWH 3D1MC 4HIJB 1PEWA 3B9KA 1RJYA 3O3EA 4OZGB 3LQZA 3HI1B 1JPFB 4KDTC 4P9HL 3HG1A 4OZHB 1TETH 3NH7L 5FV1L 2FHFA 2IPUK 2PTTB 1FJ1B 3G6JA 3X3GL 4Z76B 2FL5B 5D1ZD 3GJFB 3PHSA 4UAOB 3BIKA 3VFUA 1MIEL 3ZYZA 2A6DB 2NY0D 3NCJH 5CKAA 3W0WD 4I1NB 5BO1L 3GMQB 1CVRA 3P4OA 3BXNB 4EBQH 2E9IA 4NKMB 2VL5B 5H37H 4LFHD 4JKMA 1W2KT 3VRIB 2O5XL 4I13B 4KXZH 1FORL 4NQXA 3OKNA 2P47B 2VDPL 5I74C 1S5IH 5DSCA 4WO4C 5CWSB 3SDCC 1N64L 4YXHH 1A0QH 5DVOA 3PGFL 1X5FA 3WFZA 1ZHNA 5I18H 3BSZH 2MPAL 3LEXB 5IFHH 3KXFE 5IB3A 4QRRD 5J6HB 1S78D 3U1SL 3X12B 3VXTB 2BFVL 5CD3A 3SDYL 3MLZL 3CFKA 4ZO6A 1EJOH 4GRWH 3L3IA 2NTFA 4K3DL 1ZHKB 4PJHB 4J2XA 2D03H 1WAAA 1NL0H 4K2UL 3ZE2F 5IKCA 1S7XB 4MWFA 5ALBH 5BJTA 5DI8A 1UWEL 5DS8A 3KPNB 4M6AA 5DRWB 4YPGB 4XWGL 2BOCB 3KHQA 3WLBB 1XR8B 3D39D 5JPMB 4HBCH 3O3AB 4TSBH 2MTPA 4Y4FD 3CXDH 4YH6A 1F3RB 3FOMA 3FQUA 1VGEL 1E27B 3C60A 2O5ZH 2OR9H 1G7QB 4YJZL 4X6BA 4HMDA 5I8CA 4NO3A 2QLVB 4HFUH 1BBJA 1XGRA 1TITA 3ZLQC 4PIRF 1JGDB 4D9LL 4ODSH 4IDLA 2VTFA 1C1EH 4YDKH 1JGEB 5IM7B 3AREA 3OKEA 1NMAH 3QXDB 4KAQH 1KTDA 3U9UB 4WHCA 4MHHI 1A6UH 3TN0B 15C8H 1EFQA 3T0EE 3I6LD 4NNYB 4MQSB 5FO7A 1NCDH 5EO9B 1DL7H 4UU9A 4Z7VF 5MEOB 4N1EA 3LPWA 4LDOB 4C83B 5HI3C 2APVA 3HRPA 1SYVB 4WI5A 4F7MA 3PHOB 4XCEB 5GQBA 2Y6SC 1G9EA 3DGGA 4F9PC 2MHAB 1JYXA 4RFOH 5GRZA 5LGKA 3ULVD 3C5SB 3I6KB 3SDXF 1AQDB 1M05B 5T1KA 1TZHB 4LMQE 3U0TA 3SDAA 4F7CA 5AZ2H 4PBVC 4QLRA 1NAKL 4GQ9L 3LIZL 3GEWB 1GPOL 2R0ZL 3BW9B 2V2XB 1CXLA 4TSCH 2Q6WB 4AM0B 1ZT4A 1RZ7L 4XCYA 1EH9A 2P8MA 4KJPC 4FQLH 2EXYD 4H5SB 4S10A 5DO2C 2Y07L 3QXUA 4XBGB 4EOWH 1FYHB 2PXYB 4XH2A 3KPSB 4YZFE 4FTVD 2HMID 1MNUH 1S7VB 1MFAH 1OP5H 2DQFB 3VXSD 2J8OA 1E4KA 2DTSA 4S0SD 1BF8A 1YNKL 4J4PA 1XGRB 4HFUL 3S37X 1RZGB 3MJ9L 4MB5A 4UOW1 4B7IA 3QPXH 4PRBB 3P9LB 3O3DB 4BM7A 4JPWH 2NY5C 4LHJB 4U6XA 5JHDA 3FJTA 4W4OC 4XP4L 1FVEB 1BMGA 1IVLA 3V52L 2W0KA 4KZEL 1NMCB 4GKZA 3FO9B 4P59L 4OTXL 3VH8B 4ONOA 1K9TA 4QXUL 2BSSA 4K71B 1FL3A 5JW4Q 4B50A 4MNQB 1AO7A 4KDWA 1RZFH 4AEIH 4NZTH 3QCTH 4X4ZA 1DZBA 4LKCB 2ADFL 4K3HA 3HAEG 1MFCH 1G9NC 5IROC 2GSGA 3OR7B 1U58B 1AE6H 2DLHA 3TBYA 2YD3A 3ILPA 2WBJD 3ZO0A 4S2SB 4LSQL 4NGHL 5IB5A 4IJ3B 4ZDHA 3G5VB 3ARBA 1ITBB 3KAAA 2R15A 2OX5A 4NQCE 3GK8L 3NCEB 5D7JA 4X8JB 1OM3L 2NMSA 4YHIA 1KB9K 2GUOB 4Z7WF 1ZT4B 4TSCL 1PZUB 3KJ4B 4XXDB 1WSST 1OSZA 1RZIA 3S4SA 3JTTB 1A1NB 3OF6A 3HMWL 4HIHB 2FEDD 5IFHL 4NO0A 3B9KC 3JWOC 4U1LA 4ZOAA 5D7JD 4JHAH 1V7MH 3WIFB 1LO0L 4G8EB 2I9TA 2Y07H 4MQXD 1H3PH 3RZCB 3FN0H 2VDNH 2F8XC 2O5YL 4YHLL 2VJXA 3OX8B 4YXKL 3G5VA 1JP5A 4UTAL 5HYJD 3P9MA 5F9OH 3AREB 3T1FB 1TZIA 1MRFH 5A43C 3BIAX 2VXVH 1J8HA 4IBLT 2VC2L 2ICWI 4PY7A 2J7LA 2XRAH 3MTRA 4HIIB 1VGEH 3SDDC 3VDBA 2YPKB 5LGHL 5HDLA 4XAKD 2VR4A 3WEXA 1FO0L 1ZHLA 1OQXA 1OAUH 2FJFA 2NXZC 1BBDL 2VZOA 1O7VA 4ODSL 3SCMC 4KVNL 4QHNA 2BOCA 1ND0B 4K3JH 5ID0A 3GRWL 4JQVA 4JGUA 3IDNA 3STLA 3FQXB 4OJFL 2HWZL 1KLGB 3C60B 3V7AG 3FRPG 3QHZH 1WISA 1BAFL 3SDXB 5HXMA 3F12A 1E4WL 3IDXL 4YR6A 3ARDD 4KKCC 4ZNEE 5B3JE 3DECA 1GGCH 3QRFM 1GGTA 2BVQB 3WKML 2EDWA 1JZ8A 5ITBL 3F7VA 4YDJA 1R3HA 4R3SA 3F6IA 1HILA 5BV7H 3M07A 5JA8B 4RMSA 4PRIA 1N59B 2ZPKL 4HJ0D 3JUZA 5AAWA 1CGUA 3TWCL 3QRGL 3W0WB 5C9KA 1NJ9B 4ZSOE 3LDBB 4MJIE 3RBGA 5GS0D 4MD4A 5F7KC 3FFCE 1DBBL 3FRUA 4PJ8A 1F13A 3EDJA 3BPCA 4TTDD 2IAND 4OV5B 4PB9H 3CFIC 1B6UA 5HYJB 3BAEH 1OARL 2H26A 1EFXD 5IVZA 5DQ9A 2UVEA 4OB5L 1HQ4A 5L2KA 2H2SD 3M45A 7FABL 2JKXA 4XXCA 4LVOB 5T1KB 5CIPA 4OZFA 3V4UH 1BFSA 1OLLA 4ZNEA 1P7QB 4M93C 4UQ3A 5I1JL 2Y36L 1U95B 2R2BA 4PLKC 3RTQC 4NYLB 5F8RC 4XP1H 4X4YA 4OLUH 2P5EE 4K94C 4NKOA 5I1LA 5HDBE 1KOAA 2UWEB 5FCUH 3UXFA 4IS6B 4TUJB 4OCXH 4I5BA 4RSVA 4QOKB 3KLAB 4YK4C 2CGRL 2CJUH 2H6PA 4PRPB 3EO9L 3QJHB 4CVXB 4XNQA 3TA3B 4EUPB 1U8LB 1P4IL 3HG1E 4YGAB 2FR4A 4P9MH 3LEXA 2R23B 2NY6B 4NQTA 2AK4E 4OZHE 5ELIA 4ODVL 3D87B 1TCRB 4QO1A 2X4SB 2D7TL 2GFBB 5I1IH 4N0UE 5JQ6L 5IMOA 3DMMB 3F7VB 5CINH 2R1YB 4RMUA 5D93B 3BP7B 2L4OA 3UROR 2P1YA 4HK3J 5DJXA 3RHWF 1TVHA 4HC1L 5DUBB 3KS0J 1MEXL 2VB5A 3O4OC 5DRWA 4NM4L 4QNPE 5EIIB 4OF0A 4MXWL 4XB7A 1JFQH 3HUJF 1NFIB 1CLOH 2XN9B 1BOGB 4RGMC 4PJ9B 1CN4A 1EEUA 2WSKA 1JGLH 4X0KA 3QHFL 3PG2A 1P7QD 3GMLB 2EO9A 4ZS7L 3QWQB 2BRRH 2YSSB 2RB8A 3ZYIA 1YYLH 4QRPD 3J8F7 2IH3B 2MCPL 3MLUH 2F54E 1ZLVK 5J6HA 4NQDA 1UB6B 1RQ5A 3OXRA 4KHTL 5GS1C 3KPRB 3DURA 5EA0H 2H2PC 2HLAB 1T0MB 1G7HB 3MNVB 5AWNL 4OLWL 3KYMB 1GIGL 1ZANL 2VXTL 3GSUA 4H1LB 4HC1H 4JFFD 4PJHE 2VLRB 2ZNWA 3IJSB 4ZUUB 1DN0B 5D2NE 2E8ZA 4O51B 5DJ2B 3OKKA 4KQ4L 1X7QB 4EN3B 1A7QH 5A2FA 4G7YL 3KXFB 4ZXBB 3UTTE 3OHXA 2BNQA 5E8OA 3MRRB 4FQQB 1VFBB 3BN9D 2FJGB 4KJPD 1OF2A 3V0WH 2H9GA 3CH1B 4JFYB 4JM2F 4KJWD 3U4BL 2C7UB 2VZTA 5H37G 4YHML 1MHHB 4MSWA 3S6CA 3U2SB 4GRMB 3QDMD 1ZTXH 4LSVL 5AYUH 5IROA 3BP4B 2NNAB 5TH2A 2YC1B 3B5GA 4JFPA 1U91B 4UQ3B 1TVHB 5E9DE 5IMLA 4JHWL 5CSZB 5D1XB 4AIZB 1P5UA 1E6JL 4U1MB 1T7ZA 3QJFA 4HKXB 5D5ME 3VD4A 5FDYA 3TIEB 4WGVB 1FFPB 1X6NA 2YRLA 4X7TA 1MCSA 2YN5A 1HQRA 4HIJA 4OUOA 1HQ4B 1D9KA 1Z5LB 3MZTA 3UPRA 1B9ZA 1RUQH 3VDAA 4K9EH 4QXGL 5F7DA 2BVYA 1U3ZA 3LB6C 4ZS6D 1CR9H 1EMTL 1B0GB 5IVXA 1RHFA 1RURH 1CFQB 1F2XK 2QHRH 1MI5A 1OLZA 4YFLI 5EPMB 3TIDB 3CFJA 3OV6A 4ENEC 1MRDH 3BDBA 2BNRA 4OQTH 4B5EA 4PJEA 2DLGA 2HLFC 1UACH 4PRHB 3RWDA 4FZEL 4YBQC 2ARJA 5B8CC 4PRAA 1JHTB 1KEMH 2NW2B 2Z92B 5BV7B 2DL9A 1MREL 4PJFF 5C9JA 5DFWH 3L3OB 4X7DC 3G5ZB 5FUCC 3UBXA 4NN7B 2DWEA 5BRZA 3GSXB 1AQKL 4MX7A 1YEJL 5F3BB 3DMMA 5L6YL 1EAJA 5GGUA 2ERJB 3U46A 4EIGB 4MNHB 1G6RL 4PYGA 1TMCB 4NQEE 3BKMH 3U0PA 1I1CA 5F6IB 4AH2B 1N8ZB 1JUFB 1F5WA 3CFBA 4F58H 3MR9B 3QIWB 4U1SA 2Y25A 1MCCA 1OD7A 1OL0A 4YDIH 1HNGA 1L9MA 5D4QA 1V8HA 1ZT7A 4BJLA 5DYOB 1HWGB 1Q38A 5JORB 4FRWA 2OL3A 3BH9A 3C60D 2N56A 3RKPA 4H20H 2W0FA 1RUAH 2JCCB 1QG3A 2LAGB 3C5SA 3I6KA 3HPJB 1I7UA 5AUMB 1I3RA 5FYJL 4LLMA 3CD4A 5EUOB 3KWWA 5FCUL 2AXFA 3DUUB 1EPFA 1ZEAL 4RGOL 2PO6C 4Y4FB 2B0SL 5FGCB 1FGVH 4PP1D 3HB3D 5CLTA 1CFVL 1NC2B 5FF6B 3W2DL 2XTLA 3VD7A 12E8L 4NN6C 4OGZA 5I16B 2EE2A 4O5LL 3WL9A 1T7WA 2X5PA 4MNGB 4CGTA 1H3VA 3IU4L 4DW2L 1FV1B 1H3GA 3O9WD 1KPUA 2YA0A 3S34H 43C9A 3VD9A 4S11A 5FHBL 2HAZA 3G6AB 5IW6B 3VXMD 2VQTA 3HFMH 3ZDXE 1T5XA 4CN4A 5CJ5A 1KACB 5FKAA 1N3NA 1BJ1J 4MQ7A 5F7EH 1P5VA 2X1OA 3KYKH 1IGFH 3H0TB 1NKRA 3SBWC 5L88L 5T1KD 1QFUH 1DVFD 4PJBB 1X4XA 1FC2D 4XZUB 3RVTD 4PLNC 1RUMH 2VE6A 4I2XB 4TOYL 4LQ1A 2EYSB 1WCBB 4TULL 5BZWB 4HPYL 2ADFH 4K8RC 2LTQC 3VWJD 3ZDZF 1MFBH 3INUH 5EOQL 1ZA6B 5GJTH 3IKKA 1XCQB 5ESVA 2R9HC 43C9B 4OCLC 2VZ1A 1FLRH 3W39B 1IGIH 1G0XA 3EO1B 4QRPE 1NGYB 4HUVA 4U0QB 5HY9A 1ZTXL 1LK2A 3T77B 2I27N 5LGJB 4Z0XB 4H1LH 4JFXB 2W59A 4Q7DA 1W8OA 4OGAD 4EKXA 4EI5D 2DMKA 2AXFB 1DQDH 3EHBD 1UKSA 4X7CC 5EZOH 2E7LA 1KJ3L 1T1XA 2Q86B 4PV8B 3DVGA 3P77B 3RVXD 4LAQL 4O02L 1OW0C 5TDPA 3TH3T 4ENED 3WFCL 3K8MA 1QQDA 5F9OL 2DQJH 3HAEB 4LBEA 2ID5A 4P23B 5GS0H 4OZIF 5SV4A 4KDTA 5T33H 4F80A 4L4TD 1S8DA 4WU7A 1OGAA 4GLRI 4FQJL 1XGYL 3K4ZA 1XFPA 4HH9B 5JZ7D 2J2ZA 1ACYL 3MX0A 3T3MF 3WNKA 2XTJB 3WV0A 1UM6H 1JMZA 3O4LE 4P5TD 5KSBE 4GXUN 2DYPA 2D7NA 1JV5B 2I5YH 4R4FL 3CFDA 3IDUA 5DWUH 1ED3B 2WV3A 4NJ9L 3QQ3A 5C0EB 4MZ2A 2YBRA 3QXWA 3MA7A 4HK3N 3MNWA 4N1CA 5KAQG 2O5ZL 2XZZA 4X6DE 5CGMA 5DA0B 4CMMA 2BRQA 3RDTB 4R2GD 4EUPH 3MLYH 4A2LA 3ECBA 5EU6E 1D5XA 3WFBL 4PJ7A 2XN9A 1MRFL 5F8QC 5DI8B 4ZFZB 1CDIA 5C09E 5ESQA 1C1EL 4TRPH 5FECB 1HI6B 4PY8I 3SE3A 5JOFB 2ZOKA 1XGUB 2C5DC 1F4WH 2OP4H 2ZCLL 2XNAA 4I18A 5F88A 4XPFL 2C4FT 2QR0A 4U1HB 4ODVH 5C07D 5DQJB 3KYNB 4FZEH 3KXFD 1X5KA 5CFHA 5I1IL 3LS4H 4LVEA 4GFTB 4FZ8H 2XWTA 1J86A 1ZHNB 3U6RA 4CBPA 1YC7A 3RFZC 3EYSH 1QLEH 1RZJL 1KJVA 1QRKA 2EIZA 1JBJA 3MV9B 5GGTH 4UMGA 3NFPB 4OFKA 1JPGA 1JVKA 3NABH 4FQCL 2DQUH 5EBGA 5GSVB 2MMXA 3G6DL 1C5DB 5ICYB 2LFGA 1LDSA 1JWMA 1KIRB 4Y1AD 2X4UA 5ITFB 4ZQKA 2YK1H 5E94B 5GRXG 1P69B 1JZ4A 1VKXB 4PJAB 3EBAA 5E8DH 5DD5H 1MCFA 3KR3L 4Y16D 1IL1A 2IAMB 3B8YA 3V6OA 3MCLH 5HI4C 2QQKL 3OBAA 4XI5C 1HH6A 5ICZB 2XA8H 3CSBA 2YK1L 3VFSA 2FZ3A 4JHWH 2VLKA 4Y16A 1RUAL 4JM2D 3ETBF 1QYGH 5C0JB 5BXFB 5E8PB 4JANB 1DFBL 4DK3A 3GUTA 1SJVA 3FRUB 2HVKB 1EFXA 3UPAA 5ACLA 4FP8L 1RUPL 4XPGL 2AS5M 4I0PA 1H3UA 1U92A 2UZIH 1JZ2A 2VDMH 4U1KB 4JFEB 5IB5B 4MA3A 2HH0H 4NO3B 1YJDL 1KCSL 5DSCB 2ADIA 1J9CT 3DRQA 3O11B 1VPOH 1C12B 3UO1H 4I2XE 1EHNA 3N1PC 1ZHBB 1IAOA 3DX9B 3GIVB 5BZDA 4YDVB 1GYAA 4IDJH 1RZJH 3C8KA 1QBMH 1RK0B 3HAEA 1WZ1L 3ROLB 1YYLL 1XAUA 2I07A 4TNWK 5L2JB 3OGOE 4U6TA 2YPVH 3JTSA 4NQDD 2ZCKL 3UTTB 2EIDA 2DQIH 4LARL 4HS6B 1IC4L 1X5JA 4PJ9A 5D5MF 4UT7L 3GSRB 3UCRA 4HWUA 2VLLB 5EOCH 4PRDA 2GCYA 4IOFD 4JFFA 4N0CD 1I9EA 1LDPH 3JWNC 4G7VL 5E5MA 3ES6A 1T2JA 2ICWJ 1YN7A 4KUZL 2BVOA 5EBMA 2F8OA 3PWPB 5SX4H 5F6IC 4MA8H 4L3EE 1XF4A 3ISWA 3LQMA 5ACZB 5J0BA 4CVWA 2LQRA 3O6ML 2FJHB 5ADOL 4J4PC 5FHAL 3MNVA 2NQCA 3S8WA 2ZKHH 5CJQL 3D85D 1CT8B 1NANI 4LLYB 3BP4A 4NNXB 3WN5A 1NCAL 2KKQA 4OGYH 4OIIL 4WFGD 5D7IE 1MVUA 2DQEL 4ESKA 3GUTB 1MLCA 3BN9C 4MCZA 3HE7A 5E1AA 3T65B 5HVFB 1F58H 3VFGH 4NC1E 4LAQH 4HS3B 5J1AA 4QRQA 1TJHL 3TJEL 2IQ9L 3QDJA 3OQ3B 4ZPTB 5EZLB 5HHMB 4I4WB 1BEYL 5JOPD 1VFOA 1DBJL 1UB5B 1EZVX 1QA9A 2Y7QB 2IBGA 2GTZA 1SEQH 3DV4A 3PL6D 4RRPA 2X4PB 3QUYA 4PG9B 1XF1A 1U8IA 4L4TE 5IF0B 3QUMA 5J11C 2QQNH 4JY5L 4HMEA 3D0VB 4U3HA 1G6RB 1EUTA 3NCJL 2AK4D 4NQUA 1FNFA 3ROOA 4XCFH 1CK0L 1U2HA 4R7DA 5IFAL 4YE4L 1JUFA 3QA3B 4P49A 3RNKA 5CBAA 2YUZA 2VAAB 4CMHC 3CFEA 4M7LT 3SE4C 4XVSH 3QNZA 3K46A 2V17H 4EXKA 4HLZH 2PCPA 5GGSA 3U0WL 5EO0A 1RVFH 1AHWA 3W11C 1QO3A 1MJJA 2YOCA 3HFML 5H8DA 4L1DA 3STZA 4G8GB 2FLRT 4WCYL 2ZSWB 1A7OL 1AC6A 5ILTL 4AYFA 4JFFB 1UM5H 3LMJL 1KJ2H 4HSQA 4XPTH 1JMXA 1S5IL 4MXVE 4Z7VE 4JKKA 4P5MA 3LEYL 1OAKH 2H1PL 5FYJD 3VFPA 4L3AA 3WLWC 2RBLA 1RK1A 3WJJC 1CDYA 5ESVB 1RZGA 5DD0H 3Q5OA 1NMBL 2Y23A 2CMRL 4UQ2B 4AQOA 3RX7A 4PP2A 4KKNA 5BRZD 3O3BA 4DKAA 1R3IH 3VXQB 2ZUXA 1YEGH 1EBPA 5EH1A 4WV1C 4YHYC 3C6SA 2XG4A 5IQ7H 2VSDA 1UXWB 4R9HA 1KYOK 4ODBD 5CCKL 3X3GH 3DV6A 1NPUA 4I18C 4GBXA 4UIKL 3TPKA 2CDEB 4X6FA 4FABL 4YO0B 5JDSB 2DWDB 1MLBA 3UBXG 4LCCA 2AABL 1I1AB 3FO2B 4G3YL 1H3XA 3SCMB 2DQDH 2WBKA 1OAZL 3MJ7A 4JKPH 5F1SA 1BF2A 3ROOB 5B4MC 1J0YA 5JMOC 5HBBA 1IRAY 5D1QD 2HVJA 4JY6A 1AQKH 4JVWA 5GXBB 3ZDYE 5KVGL 3ZL4H 3D25A 2B0SH 3FOLA 5JO5A 1V3KA 4XCCH 2WANA 3MOBL 4YPJA 5J7CC 1FL5B 1U0QA 1A3LL 1SHMA 3PDOB 5CILL 5EORH 4HJ0C 4OKVB 1I7ZB 3ULUL 5DJCB 2OZ4L 5IB3B 2IALB 5T5NG 4N0FA 4OZIA 4HXAL 5BRZB 3KPSD 4DKEH 1JGDA 3KS0H 4MDIA 3GMPB 1JNLL 4ONHA 1IGFL 3V6ZB 2NY0C 4MQTB 1W72A 1QNZL 2K9UA 3GKWL 1XIWD 3EOAB 4GUPA 4TSBL 5E4EC 1Z3GH 3QPQC 5J9PB 2OXGA 3S35L 4JFQB 2WINA 1XCQA 5TPWH 3AS1A 1A4KB 4PJ9D 4FXGB 3VFNB 2HFEA 3MV9D 2WWMC 4DAGL 2A73A 2AXJA 4TTDC 3RUGE 5IHBA 3CLFL 2I60L 5HDOA 2FJGA 1EO7A 1SJEB 4FTVE 4HV8B 4H0HB 3O3AA 4Y5VB 4QHMA 5BVJB 1KJMB 1KB5H 3L9RB 4LU5H 2EH8L 3GMNA 5JDJA 1KYOJ 2I9LA 4RNRB 3BKYH 3OTTA 4KK5C 2I60H 1JNLH 4PB9L 1S78C 4JR9L 1IM9A 3QG6A 4Y2OA 5EIVA 3T2QA 5GGSB 5FUOL 3CVHB 2V9TA 5KVGH 1HHHB 1YNKH 3Q3GA 4MD0A 4OD2B 4DN3H 5FM8A 5A2IH 5LGJA 5HJ3B 1C5BL 4LSVH 1A3LH 3O6FA 1MCPL 4QHUA 2FLBT 4APQB 4GAFB 3OAUH 3HMXA 3RIAK 3T0EC 2UZYB 3SGDI 3W2DH 3MFGB 2VYRE 5DC0A 2G5RA 5I73B 3MUZ1 3X17A 4XC3L 2FEDC 3RVUC 5JW4M 4P4KA 5LBSH 2F19H 2MHAA 4LCWA 3F7YB 2VLME 1UVQA 2YD9A 3QCVL 4ZUWA 1P7QA 4XXDA 3SGKA 3GKWH 3N1MC 5DUBA 3UYPA 4TPRL 4NYLA 5BV7C 5CJOL 2IPTH 4G80B 4NO0D 3WJJA 2LV4A 3NBNA 2ZUSA 3BP6A 4ZXBA 1P84K 1CXEA 5FO8B 2FX7H 3X3FH 5IR1A 1U58A 5HYSG 4IRJB 4XBGA 5FIEA 3AS0A 2Y06L 4OLVL 4X6CA 2Z31B 2H3NB 2C3VB 3EYFB 3MROB 3WKMH 5D71L 5DTFB 1WT5C 4JZJC 4W6XB 1NGQH 5ALCL 3G04B 1A2YA 2V7HA 3DURB 1T21B 3TO4B 1LO3L 2R4SH 4GKZB 1U8OA 2MCG1 4RGND 4N0UA 1Q1JH 1FAIL 1HYSD 3PP4H 3TZVB 1AHWC 3IXTB 3U36A 4UBDD 4GG8A 3ARQA 5FECA 1Q94B 5JQ6H 4HX1A 4OT1H 5HHMD 4ZTOL 4WI4A 3C8HA 3DX6A 3I6LE 5CINL 3K0WA 4BK5A 2IADB 2P24A 2J8UB 1PW3A 1QFPA 2CR6A 3FCTB 1YJDH 4HAGA 4X9FA 3CFKB 2KZWA 4O2EA 4P5TA 3CZFA 4QRSA 4JPKL 2X1QA 3VG0L 1ORQA 3MGAA 4G43B 3TM6A 1A6VH 4BSVB 5C0IA 3N0PB 1OAYH 1RZ8B 3HA0A 1CLZH 4HIIA 1MCRA 3REVB 4OCXL 3G5YA 3LV3B 4P59H 4MJIB 4XX1E 4ONGH 4WO4A 1UM4L 3RQ3A 3SDCA 2IQ9H 3FT3B 4XCNA 1AY1H 4WW2B 4WHTA 1AGCB 3BH9B 1QYGL 2Z92A 4QRUB 5JOFA 3CLEH 3IKCA 1MJ7H 4PJDF 3MV8B 2I9LB 3DSNA 3FN3A 5E6IC 1XF2B 3KXFA 2D31A 3ELAT 4CVZB 4DJMA 4LGRB 4QT5B 1JNHA 1JL8A 1KF9B 5CHNA 1EDQA 3CFJB 1LEGB 5FOBA 5C08B 5CZVL 5AD0A 1FVCA 2GITB 3O9WB 1KNOB 3P40A 3WFDH 4OIBA 3UAJC 4F37F 3DMMD 2P5ED 3MV9A 4RAUA 3VXMB 3QEQB 4OJFH 5GGQL 3NIGE 2UYLA 2FCBA 4O58L 4QOKE 3SDAC 4JPIA 1G9NH 1HKFA 3TFKC 4BSWA 5GGRY 2JELH 3MNZA 1GGIL 3MBEB 2Y5TA 3DMMC 4OCRH 3MC0A 5IW1A 1PD6A 2ZUWA 3GMNB 3NCBB 4UV4H 4FQXC 4NRZB 1KLGA 4M7KH 1LDPL 4R7NA 3KLDA 1IZJA 4C59B 5EOCJ 5C07E 4QHLA 5ETUA 2YMXH 3A6BH 5I2IB 1WC7A 2AXGB 1E4KC 6CGTA 1BJ8A 5C0RH 4Q9BA 5FYKU 3SKMA 3GHBH 3VFTB 2BVPA 3NZHL 4PJ7E 4I0KA 1E4JA 4ELMA 2W1NA 4G8GA 1QSFE 1RIHL 1H5BB 4IOFC 4FXGA 3VFNA 4ELKA 2ED7A 2AEPH 4CDGC 3GB7B 4M93B 2Q8AH 1Q9KA 2OYPA 1JHKL 3L5XH 3FN0L 2HRLA 5EBLA 4G3YH 2K7QA 1CE6B 1T89A 2EIEA 4F37K 4GH7B 3S97C 1N6QL 3QFDB 5I30H 3BPNC 2P5EB 1YZZA 4DQOL 5FOBB 3JV6B 4R8WH 2FDBP 3QEQD 4MAYB 4QCIA 1PGRB 4GG6F 5AYQA 3HC0A 3WFHB 3QFJE 5ECJE 2VC2H 1BD2B 4EQ2A 4A6YB 3BOVA 1OGAE 1G9MC 2W91A 5IVXF 1T04B 4IHOA 4E41B 1EO8L 1NUNB 4QRTB 5A3IC 5EC2B 1T80A 1DBBH 3RWIA 4AG4H 1IKFH 4U1JB 4K8RD 5IQ9A 1N7ML 3T0BA 3OGCA 5D2LF 5SWSA 3JWDH 1U36A 5IBTH 4OKDA 2C4XA 4X83A 4E42B 4FQ1L 4DEPC 4J8RA 3T0WA 3GMPA 3V6ZA 3QI9B 2V2TA 2GUOA 2R69H 4P2QA 3ALWA 3B9AA 5ISZE 1NCCL 1YMHA 3B6SA 1M7DA 4HWBH 5EOTB 1UB6A 3MLSL 3MODL 2VN4A 5GRUH 1NC2A 5F1IA 5C0AE 5FF6A 4Y4HB 1IEBB 4N68A 3INUL 1F02I 4BZ1L 3HNVL 3LSOA 2HFFB 1ZKAA 3EZ8A 1MQ8A 4OGXL 3IDGB 3RI5F 2EDNA 4DVRL 1E27A 1KCVH 1M6OA 1FNHA 4NT6A 1FLRL 1XGTA 1RIVH 4RBPH 1K8IB 1LP9A 1JPTH 1QA9B 2Y7QA 3KPRE 3QAZB 5CD5D 5GRWA 3U48A 4DZBB 2D2OA 3TGXA 4NRYB 1AGDA 3SE9L 3TBTB 4CMMB 1NBZA 2BNRB 2H32B 4LCCB 1S9VB 2HRPH 1KELH 4L8DB 5IWLA 3NA9L 3Q6FA 4M5ZH 4IRSD 1LEIA 4ZFFA 4OM1H 4X7EC 4B41A 3UJIH 2CIKA 4NKIH 5EO0B 4M62L 1CL7H 3I3DA 3VXUB 2GHWB 1I9RL 1RPQA 1MFAL 3FHQA 4DZ8B 3M17B 2JJUA 4PREA 3T4AA 1I8IA 4HK0A 4WFGE 1NFDB 5TDNA 4EN3C 1JGUH 3L3GB 3L95B 1R5VB 2R0WL 1A8JH 1UJ3C 3GO1L 4DGYL 1GGUA 2QL1A 4M62H 4XRCB 4P5TC 3RZWA 3O2DA 4OF3A 1FNGA 2PN5A 3ARZA 4O58H 4R2GC 3BXNA 1UCTA 4J1UA 5F9JB 5D2LB 1JTPA 3OB0H 4L8CA 2HRPL 4JCMA 5GGSY 5JTWA 3KGRA 4YHPA 2P43B 5J6GB 1NCBL 3B9VA 1QUNA 1EV2E 2FX8L 2V7NB 4NNYA 5FO7B 5MERB 3WD5L 4HIHA 1CFNA 3X3FL 4LLWB 4WFHD 1GGYA 4GKSB 1UQSA 4HFWB 5BS0D 1C5DA 3ILQD 3MRMB 3VCLB 3D18B 4RGMB 3I85A 2PYED 4XRCA 1FFPA 1NL0L 1H0DA 2ZNXA 1VEPA 3FN9A 5I15H 3ZKQD 1WFUA 2BSRB 4IRZH 4NM8H 3OR6A 3GSVA 1AD9B 5GRYA 1OP3H 1WWWX 5FM4A 2C1OA 5C71A 2YC1A 2ARJB 4HJJH 4KH2A 4NQDB 2GY5A 4PGDB 4XPAL 1T89C 3S88H 4JQIH 5INDB 3BEVA 1V3MA 4HX1B 4AL8L 1YPZE 4FQHB 4LK4A 3A67H 3EOTL 5F3HB 1VADB 4KKBD 4MNQA 3VFTA 3FOMB 5F1KC 2F53B 4UDUA 1WBZB 2BFVH 2DM3A 4L3CA 2C3HA 2VABB 4HDIA 4HJGA 5TE7L 3SE8H 4G9DA 4PGCB 2D4FA 4F9LA 2F54B 5TQ0H 3V6OC 3AS2A 3TO2B 4YK4B 3C5ZD 3KPSA 3QDGB 3BP7A 1RI8A 4X6CF 4KHXL 3ABZA 5LAXB 5MI0C 4GT7A 5E08H 3V0WL 2QJDA 3ZTJH 3HZVB 4GAGH 4PUBH 2VAAA 1P1ZA 3MLZH 3LV3A 3DX7A 4OLEA 5L0QB 1SQ2N 5EU4B 2W92A 4K3EH 1NLBL 4ISVB 4EVNA 4MNGA 1Q9LB 2FSEA 4FQXA 5DVKA 3RVWC 4PTUB 1EFXB 2JCCE 4JZNB 1I7UB 3HPJA 4FQIH 5AUMA 3S3PA 4JRYB 4X7SL 5EU5A 2V5RA 5T5NF 1AO7B 4U6VL 4C58B 4ZPTA 4G8FB 4NRXA 4Y4FA 5D7LD 3H6JA 2BSTA 2XWBB 5CGYC 1JGUL 1J0KA 3WNPA 1DQQA 5D93C 3X13A 5TDPB 1KCLA 4NDMA 3VDCA 3GMQA 3Q6GH 1KFAL 1IGJA 3WNNA 3OKOA 4EZMA 1YQVH 1FO0H 2UVFA 5FGBA 5JR1H 3IS1X 3MYJA 3S7GA 3WS3A 2QEJA 4G6KH 5I71C 2HJKA 1I1YB 2BSED 3DYOA 3HLAB 4G6JH 3WBDA 1ZLWH 2FO1A 3B9KD 3GI9H 2A6IA 1ERNA 4KI5C 2EYRB 3QDGD 4GW4B 5DHVB 3MACL 4IM8A 5M7QA 4URTB 3CMOH 2MQ3A 4OFDA 3FAWA 3TA3A 1GIGH 5FA3B 5FDWB 5KS9A 1CE1H 1HDMB 4RGNC 2HYMA 1MF2L 1LILA 1DQLH 1PLGH 1G7PA 4M3JA 4QT5A 4KK9D 4OZIE 5BS0E 2DWEB 1U93A 2FB4H 1A9EB 4WI3A 3MGTB 2GJ6E 2J8UF 4M61B 4NQSB 1GGBL 4LCWD 4GAGL 4LP4A 3SQOH 4I2XA 4M6NH 1NUGA 5CZXC 1BZ9B 4U2YA 5K9OA 5DJXB 2P5WA 5FA4B 1XR8A 3M1BB 3FO1B 2FIKA 3QDME 3THML 3G6AA 5IW6A 1MPAL 3U9PL 3D48R 4PGBB 2YZ8A 5HGHA 4HIEB 3S36X 1QO3B 1TCRA 2W9DL 1TNNA 3QXVA 1H9VA 5IHUH 3WFCH 3C08L 4X5XB 1G1CA 1AR2A 5IB2B 1OPGL 1D5ZB 3QH3B 5DD6B 1ZVYA 3TESA 1SMOA 4N0RA 4EDXB 2AK1L 3DSFH 2IFFH 3ZMRA 1LO5B 3CK0L 1KFAH 1OP9A 4OLYL 1I9JL 1MHCA 3IFPB 5E99L 2VXUH 3F58H 1EO8H 3MV9E 4P2OB 4YDJB 1S7TA 2FYYA 4BH8A 2X4QA 2XQBL 3TVMB 2BC4B 3VXQA 3BD5A 3DO7B 3EOBA 2GK2A 1IAKB 2B1AL 4Y5VA 1P84J 5LXGH 1LO3H 2R4SL 3OXSA 5D6CB 2CLZB 2YA2A 5DHVH 1MCDA 1RUKL 3VFPB 5DQ9B 3B4NA 1XIWB 5TDNB 2OL3L 2DQHL 1GC1C 5DRZB 3RKDD 3W82A 3OKEB 4UTBL 2VXUL 3D2UA 3HPLB 3S9DB 3T08A 2PNDA 1BD2E 4ZSOA 2BNRD 1QSFB 4DK6A 5IK3A 2GIYA 1GRWA 2LE9A 5EZIH 1UADC 3MRBB 3VWKA 1R5IA 1OTUC 2EDFA 4JGJA 4MQXC 3OF6D 4WU7B 2JIXA 5E00B 2VWEC 4PJBE 3SKMB 1FL3B 4G8EA 3OJ2C 4L4VB 5E5RB 3GMOA 3QULB 5CEXB 3QRGH 5DFVC 4O2CA 3H42L 2YD8A 4Q97A 1IGCH 4GRMA 4WJ5B 1CS6A 1F90L 1WTLA 5ISZA 1MJ8L 5TF1L 2O61A 3LOWA 2DQHH 2JTDA 1FVEA 2DJUA 5K9KA 2A77L 3UYOD 1UEYA 3OAUL 4TTGA 4OLWH 5L2JA 5GS2H 2R1XA 3OG6B 4F9PA 4R97C 1ZHLB 1F3JB 3HUJE 2C1OB 2NW3A 3ULUD 3WIIH 4NM4H 1U2CA 1WEJL 5GJSL 2BP3A 4H25B 4RAHA 2F19L 1NGXA 4QNPF 2F58L 1WBXB 2XQBH 3CSYB 2GSGB 1NDGB 1IAIM 1MELA 4KJQD 5KS9B 4DN4H 1X5IA 2FNBA 4LVNB 4M1GL 3SO3B 2J6EL 2IPTL 4QF1A 2IBZY 1QACA 4YX2H 5DJYA 3OKDB 4AENA 5HYIA 4HW6A 1YEHH 1KGCD 1F4AA 1OARH 1P4IH 4R26H 4IMLB 1TZHA 1TVBA 4AJ0A 1OGTA 4LRNL 2YD2A 1DVFC 1S9VA 1TJIH 3VFRB 3RI5K 1D6VH 1EAPB 1SEBA 5HHOB 4Z78A 2Q20A 3TLRA 1P9MA 4HD9A 1TZGL 5D1QA 4L4VD 1CICA 2F53D 4HF5H 4ZTPL 4Z7QF 4JAMB 1OOAA 1X4YA 1QRNE 1OP5K 2B1HH 3LQAC 3P73A 3PWJB 1I9RH 3O9WC 1XGPB 5IVZB 3SGJA 4M6OL 4QOKD 4GSDL 1OAKL 1WZKA 1U8HA 3MOAL 4CNIB 5C09D 2A9MH 3E3QE 5IM7A 2LU7A 3GFUA 4OZIB 2EKSA 1OVZA 4BQ9A 3LS4L 4NZTL 3G08B 5DHYB 3U82B 3VWJA 5FK9A 3TYFA 5D2LE 1V7NH 3VGHA 3GJEA 1AKJB 1XZ0A 3QNZB 3U7AA 4LCYB 4RMRA 4WWID 4P3CL 3VFVB 3QIBC