2OLDA

Bence jones kwr protein- immunoglobulin light chain dimer, p3(2)21 crystal form
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
217
structure length
217
Chain Sequence
b'ESALPQPASVSGSPGQSITISCTGTSSDVGGYDLVSWYQHHPGGAPKLIIYEVTNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYASGSTPRIFGGGTRLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bence Jones KWR Protein - Immunoglobulin Light Chain
publication title Bence Jones KWR protein structures determined by X-ray crystallography.
pubmed doi rcsb
molecule tags Immune system
total genus 45
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oldA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oldA02
5KVGL 5KAQG 2VXVH 3DUUA 3GHBL 1MCOL 5FKAA 2FO4A 3IJYA 3PGDB 1A2YA 4H20H 3KPSB 4ZAKD 1C1EH 1DSFL 4W4NA 1BPVA 1PZ5A 2XACC 4UIMB 5EZOL 2Y25A 2CRZA 5TDOA 1AO7B 4DEPC 3SHSA 1N64H 3GMRB 4V1DA 4P2RA 5TFSL 4JFFE 4Y19B 2V9TA 5J1AA 4JEGB 5DSCB 1WV7T 5TF1L 5DQDH 3E6HA 15C8L 4MQ7A 3S6CA 1NJ9A 4WGVB 1PLGL 1JF1A 1UM4L 4NN5C 4EI6B 5JHDD 4LAJH 4HGKC 3P4MA 5DJ0B 1ZANL 1VEMA 2DQJL 5CUSL 1KPVB 3S5LA 3K46A 1YMHB 1G7JB 2Q6WA 1GPOL 1RUAH 4PJFE 4JFOB 1SMAA 4ZPVA 3CZFB 1G9EA 1MFCH 4ODSL 2DD8H 4W6WB 5HGBA 4Q9RL 4G8GD 4ZYKA 5HD8C 4TTDC 5CJ5A 4OD3L 3WFBL 2P49B 4FQJL 5IT2L 2ZSVA 4OGAD 4NZRH 4X98B 4L3CA 5HGAA 5LGJA 2YPKA 3VDCA 1FPTL 2WINA 4P2QA 4WWID 4CMMA 3GMOB 3OAZH 3KLAB 1TQCC 4U31A 1H3PH 4RFNC 4MJ2A 2DKSA 3S96A 4TSCL 3CFKA 3WIIH 2Z91A 5E00B 4XPAL 5D7LD 1JPSL 1KENL 5T33L 4MJ6B 3GSXB 2Z8RA 1MLCA 4QRUA 4R4BB 1HH9A 4U6XA 5L9DL 4Y2DA 2YK1H 2GTZB 1OAUL 3PQYB 5CGTA 1UFUA 4G6FB 5I66A 5I6XC 5AWNH 4NNYA 3I50L 5E5MB 1GGUA 2VB5A 4HUVB 4XWOD 3OXRA 3WIFA 1JNHA 4X5WA 5B39G 3BWAA 4CRPA 3D25B 1DQQB 3MNVA 1TZHA 3DRQA 4GG6A 3DARA 4EDXB 4KQ4L 4N8VG 4YNYA 4P5KB 3STZB 5DK2A 5SWQB 1WTGT 4X5LA 2MCPL 3GSWB 1MUJB 4YH6A 2HFEA 5KTEL 5C0IA 3ALPA 1FSKC 1HZHL 3B2VL 3MLXL 1I8LA 1UC6A 3MNWB 4GAFB 3ZKXB 5KSBE 2A83A 3MA9L 2IQ9L 2NY0C 3O3UN 3CNKA 2YSSA 4BK5A 1UQSB 1U3JA 1D5MB 1B2WH 5D1XD 4MNGE 1NMAH 1WEJL 3LS4H 3GEWB 1SM3L 2VOTA 3T0WA 2L7JA 5E7BA 1TZGH 4M7KL 4RGMC 3UAJD 4G6JL 5EU6E 1Z3GL 3ZSSA 5DMIH 2AK4E 2HT4D 4X6EA 3U79A 2DQIL 5GS2D 2HKFL 4TUOA 5BZDA 3NCMA 5E1HB 5IB2B 3I6GB 3WNMA 5GRVL 2NY4D 3EOAA 1BWMA 2PXYB 4GXVH 1GHFH 2UWEB 2HLFC 4OV5B 3LPWA 3GBMH 5TE6H 4EZMA 5HBBA 2NXYB 2Z93A 4LBEA 4ORGA 1OWRM 5CAYB 1S7UB 5JDSA 1LVEA 2E7HA 1ITCA 3O3EA 1NMBH 1M7DA 1EFXB 3RNKB 1JJUA 5CEZE 3UPCA 1HKLH 1MELA 1XEDA 3NABL 4P4RB 3BHBA 5CIPB 4F37K 3OKLA 3ZYIA 1OGAB 3LKOA 5KVGH 1MF2L 3OJDB 3MCKA 4P3CL 1MCOH 3MROB 5FV1L 5FV2A 1C5CH 3U82B 3SKMA 3C09C 3BKML 3OWEA 1DSFH 2O5YL 2VIRB 2IBZY 5EZOH 1W72L 5D4QA 4FFVC 4X7SL 5IEKB 2A9NL 4PJ9A 2F54D 3MLWL 1IARB 3EYQD 1HDMB 1MCEA 4LGPB 3VXNA 2HRLA 4WI2A 4Y16D 1DBJH 1IGJB 4LMQI 5CGMA 1ZSDA 3HR5B 5TFSH 1NBYA 4K7PY 4LIQE 1YPZF 2VERN 3FQUB 3GHEH 3B5HA 4M6NL 4XHQA 1PLGH 4JDVB 2XZCL 5I19L 4NHCL 4P3DA 1CDUA 1J1PH 2DL9A 2BVYA 4EVNA 5IKCB 1ZANH 2F53B 3OF6A 1CDYA 3TCLA 5C1MB 5CUSH 1N3NB 2J5LC 4BQBA 4K8RC 4LCIL 3QI9B 5MEPA 5CBEA 3EYSH 2VN4A 3LVEA 3G6JA 4GG8B 4HUNB 1KCSH 5FO9A 1OD7A 2JB5H 1QNZH 4IMLA 3TVMC 2B4CC 4X6DA 2DQTH 1E4XL 4R4NC 4QY8A 5ALBH 5HYJA 2B8OT 3QDGE 4HKJB 1ES0A 4H0IA 4CMHB 4L4VA 3MV7D 4FQJH 3AS1A 5FYKD 4UIKL 3W5NA 1KCRL 3VH8A 3SCMB 3D18A 4HH9A 1ZGLA 3L9RB 1FPTH 5DD3L 3IXTB 4G6KL 1CLYL 4ZTPL 4HWBA 1Y18A 4FTVD 4Z18A 2AKRA 2VNCA 4HX1A 3HHRB 1WWAX 3OJVC 3V7AE 5JQ6L 3IFLL 3L7EA 3GMLB 3IF1A 4OAWB 2MQ0A 1LE5A 4ESKA 2XWBA 2AEQH 4XPAH 1NEUA 1P7QD 1JPSH 1JL8A 3JVGC 4WWKD 5L9DH 4KAQL 2RGSA 3TN0D 2BZDA 5AG9A 3EFDH 1F8TH 4W6YB 3DETC 2PYFB 5IR1A 1NBVL 1V8HA 4ZXBB 3I50H 3ZDYE 3IETA 4UT6H 1EMTL 5DRXB 4AH2B 2NY6C 2QSTA 1WJ3A 4OF0A 4DAGL 1IRAY 1MCRA 3CFJB 2R2EB 1BZ7B 2DLIA 2MCPH 4YHML 4YHPA 3BZFB 2XN9B 5I1AB 4G6AC 5KTEH 5F9WC 1GGIL 2DWDB 1C5DB 3B2VH 3MLXH 3MXVH 5DZOA 3N9GL 3Q6GL 3RVXC 2FH6A 3UC0H 3IFPB 1KEML 4IHOB 5CD3A 4XBGB 4HJGB 1UXWA 5DJDB 2VLLA 3RWFB 1U8QA 4WRLA 4RQQA 1I3UA 4OF8A 3J7HA 3GSNA 3TT1L 1TJHL 3F65A 4HAGA 3TJHC 2JIXA 1K4CA 3ESUF 1T1WB 1Z3GH 1PJ9A 2ZG1A 4EKXA 4PJIF 3ULUC 3OG4B 4OI9A 3QHFH 3MGTB 3MOBH 4KUZL 2OR7A 1S3KL 5CEZL 3V8OA 5I0ZA 5DHVH 4UNVA 3S97C 4BFIB 1JTTA 4J4PD 1GGCL 3ROLA 1FL3B 3NPSC 5IW1B 1WISA 1DL7H 4FQLL 5JZ7C 3BVNA 1F4WL 4NO0B 2OTWA 3TBTB 3MOAH 4P57A 4HZLB 2BSTA 3KLDA 3QEHA 3P0VH 5IB5B 2XICA 3MCG1 1GGTA 3BPLB 1MIEH 4UAOC 3HPLB 1SEBB 3ARDA 3T3MF 5IHBA 2AERT 1CICD 3NA9H 4PB0H 4NM4L 2PCPA 4Y5XC 2DLFH 2V5SA 5LVEA 3CAFA 4JRYE 1T4KA 5JORA 4P3CH 5EUOB 2R0KH 3V7MA 1IC7H 4NQVB 3C6LB 4FQIL 3ZT5A 5CILL 1CGWA 1ZHLB 2O5YH 1LQSR 1ZT1A 1W72H 2DOCA 3QIUA 3L7FB 3GIZL 4UQ2B 4PRNB 3V4UH 2A9NH 3LN4A 3MLWH 3WJLA 4HC1H 4RRPG 2ATPA 3BX7C 3TNNB 3DRTB 2BNUA 3GSOA 4AIZA 3ROOB 3QDHA 1HQRB 3T1FB 1G6VK 4MSWA 4OZGE 4ZSOE 2IANA 2ORBL 3FCTB 5GISL 2A6KB 4DOHB 5BV7L 1A3LL 5CGYC 3HNVL 3RVWC 4HC1A 1NUFA 4NKIL 5DZNA 2HVJB 5FGSA 4MD5A 3ABZA 3UX9B 4JFHD 5I8CB 2BOBB 5HY9B 4KXZI 1NGXB 3HAEH 2C3VA 4MD4B 2LU4A 5E5UB 5ITFB 3ZZ1A 3S35X 4G6ML 3DMMC 1I1FA 3FQWA 4XTRC 5ESVB 3O3BA 1MY7A 4JFYA 1I7ZA 1NFKA 3BP4A 5FIEA 5K59F 1I7TA 3QSKB 1IAOA 3BH9B 3WLWC 3LS5L 2NR6D 2Q20A 1MCKA 4Q6IB 3FOMA 3RRQA 4ONOA 4XAKD 4UIKH 1DR9A 1KCRH 3FFCD 3CFBA 3S34L 4PY8J 5FCSH 4FABL 1GSMA 2R0WH 4O2FB 1B88A 5TQ0H 4KGLA 4L4TA 2DI9A 1CLYH 1A1NB 4PRPD 1D6VL 1WT5C 1XIWD 4ZO6A 5A1AA 1HHIB 3DVIA 2EICA 3PGFH 4I0PA 4LHUG 5EOQH 2WUCH 4WI7A 4WU5B 4ZUTB 5JQ6H 2FEDD 1JV5B 3DTXB 3X14B 3D87B 1BMGA 5HYSA 1F6FB 4UT9L 4XC3L 4QEGA 2HJLB 4JJHA 1CFQB 3ZMRA 3MLTA 4FMKA 4PP2B 3L3OA 3P4OA 5GGTA 3G5ZA 4OFIA 4KAQH 5JUEH 2XTLA 1A1OA 2ZSWB 4HBCL 3D5OF 2CSPA 4Z9KB 2EYTB 5ICXB 1P6FA 4HIIB 4YHYC 5K9OB 4QXGH 2EZ0D 3VFNB 1KSRA 1MI5A 4UU9A 1I7RA 2C1OA 3INUL 1NCCL 2VISB 5DA0B 4XCNA 2CLRB 3H9YA 3NCCB 4N0UE 3KPMB 2NX5E 3PV7A 3OGCA 5HPOA 5EFIA 4Y4KD 5A2JH 2WP3O 3X3GL 2IBBA 3MFFA 1IGML 2ZKHL 4ERSL 4R4FL 3Q6GH 4Y0GA 2H2PC 2EXYD 1KEMH 2OI9B 3ARFB 1KNOA 5JW3L 1GVIA 1RZGA 3VG9C 3N1PC 5JNYA 1CU4H 1BVZA 4PJHA 4LKCA 1QR1A 3MRIB 3B9KA 3O3AA 5TE7H 3TT1H 2P1YA 3C5ZA 5EC1A 2X10A 3QXUA 1MCWW 3S88H 1IZJA 4H25B 5C07D 1T1XA 5FOBB 2DTML 1GGCH 3AU1A 4HBQA 4KWUA 2G60L 3P77B 4FQLH 3DUSB 5B38A 1S8DA 1F4WH 4HFWB 3DROA 1A9BB 1X5JA 4K7FB 3UBXA 3B8SA 2OMBA 4JFDD 4YJZL 1WGOA 4NQDE 4WNQB 3DURB 1KLGB 3Q1SH 5FKPA 5MEQB 4MX7A 1ND0A 1HHHB 3RL1A 1UT9A 1RIHH 3TA3C 4NM4H 4IOIB 4K3DL 2VLJA 4LDEB 1FYTA 4MYWB 1EO8H 3T0BA 2F8OA 5E2WL 1S5IL 3KHQA 1TJIL 4M6MH 3MJ9H 3EO0A 4D0BB 3ZE0F 5C9KA 3T0XA 3DXAD 1UM5H 1EJ6A 3K2UH 5E8OB 2IMNA 1FNSL 3WBDA 3O8XD 1QSFB 1QRKA 4XP9H 1NMCC 1DUZA 3MJ9A 4N0FB 1GYAA 4PGCB 2A73B 1MCNA 1YY9D 3QG6A 4MAUL 3OXSA 4PJEB 1U8HA 1FGVH 3DX8A 3QFJB 1U3HD 3U4EA 1A4KB 3FO2A 4KKLD 1A7PL 1KN4H 3MX0A 3HNVH 4N68A 3OAUL 4JKMA 5DFWH 3VGBA 3IGAB 1FFNB 4OZFH 4FG6C 4G9FA 1SBSL 4PGDA 1FP5A 1F6AA 4HS8L 1P2CA 3QQ4B 2Y23A 1EHAA 2XQBL 3CD4A 1AFVH 1Z0MA 4OZIA 3SE9H 4NKDA 4Z76B 2YR3A 1IMHC 1U95B 1QFUL 4WIQA 3LS5H 4B50A 4AL8H 2DQDL 3O6FA 2VABB 4KZDL 3RNQA 3W0WB 4EQ3A 4IRJA 3S34H 3LKRB 2PTTB 1G7MB 3QEUB 4YFLF 3B8YA 5HVHC 4O51B 1QLFA 4OI7A 3MRCB 4TNVK 3IDNA 2GJZB 1J0JA 5EO1A 4DZ8B 2V2WB 3MYZA 1RJYB 4YXLL 4QRSB 3MRRA 3CK0L 1RZJH 5T3ZH 4OCRL 4PBXA 2IALB 3EBAA 1ZA3B 4HK0A 2EO9A 3WO3B 3SE3C 3QNYB 5F6HI 4WUUB 2BXYA 3ZLQC 5MEND 4ODTL 5I16A 1Q9OA 4LLVA 2BVPA 2R2HB 3L3KA 2V2TA 2VDQL 1C08B 1T83A 4M61A 1UWXH 1F4YH 1NCCH 3CDFA 3PGCA 3RWCA 4GS7C 2ATKB 5GRZA 3CFIC 4JE4B 4RDQG 3MA7A 4LVOC 4XP4H 3VA6A 5A3ID 3FRUA 1I1AD 1QPPA 5FHAL 1KULA 1IGMH 4L9LB 4N5UA 1FZMA 4Z7VA 4ERSH 4UV7L 3VE0A 4RISL 4R4FH 4TSBH 2NXZD 2FIKB 1JRHH 5JW3H 4NO5A 4APQC 3BQUA 4X6CF 4E5XA 2YRLA 4NP4L 4LEOA 1RJZA 3BPOB 1X6NA 3OSKA 4KJWD 2VO5A 3LV3A 4WI6A 2IWGA 2ICES 3G5YA 3MREB 1LK2B 2CIIA 1NKRA 4JG0L 4WO4A 4JO4L 3D39B 2R2BA 3T0ED 4C4KO 3DNKA 1IAII 5DJZA 4PJXA 3MJ7A 4TYUA 4QYOB 1S9WA 4YDKL 3FMGL 3UJJL 4M1CD 1QRNE 2HLAB 5CEYB 3THMH 4WHYH 3WJJC 5BVPH 5I1LB 2YD8A 5J6GA 4NQEE 3BRDA 1P6AB 5BQ7B 3IJHA 2JJUA 4R0LB 1AQDA 3F5WB 5E2WH 4ZFOL 5GRJL 1CR9L 3CSPA 4Q0XL 5KSAD 1BFSA 2OP4H 4PJFF 1BBJB 3QEQB 3QXAA 3S7GA 5H2BA 3QDME 4ODXA 2VYRE 1TPXB 4U0RB 5E9DA 4ZTOH 5EH1A 2ITDA 1VACA 4Y2DD 3ZHLA 1A4JA 3SY0A 3RUGB 1UACH 1JGUL 2R8SL 5F21B 1UENA 5TE4H 1AKJA 3NZHL 4MAUH 2ZNWA 5H94B 5L2KB 2ZJSH 1S9XB 1FO0B 3VWKB 1A7PH 4M48H 4WJ5B 3OAUH 4ZFFA 2JTDA 2J6EL 4LCWA 4UOJA 2AAVA 4YDIH 1E28A 3H42L 4JO1L 1MCFA 4AK1A 5ID1B 5GS0D 4HS8H 2E9BA 1U3ZA 3O3DB 2XQBH 1M7IA 1IGTB 1CGUA 2YC1B 4PJBA 4OCWL 3L3DA 3R06A 5HVGB 2R23A 3MV9A 5HI4D 3SDDC 2IGFL 3U0WH 2VQUA 2AV7A 4I3RH 4NZJA 2V2XB 1YN7A 3HG1A 4OJFL 4YZFE 4XMKL 4JFEE 1I7UB 3MACL 3HZVB 4HIEB 1F11B 3WL9A 4KZDH 3S3PA 1G7QB 2CQVA 4QOKE 2UUDH 1B9ZA 4Y7MA 3MGOB 3DBXA 3U7YL 2D7NA 3P3YA 2CKBA 3H3BC 4MCZA 1FNGB 1R5IB 4KTDL 1MCDA 4DKEL 4YC2C 1EXUB 1UG9A 3QIWC 1HSAB 1J18A 3BJ91 1J12A 4YXLH 5HGDA 1MPAH 4PUBH 5HPMA 1NGYB 1B0RA 2YRPA 5J6HB 4DUVA 1PQZA 1XF5A 3SDAD 1SVZA 4ZD3H 3SDCD 4JPVL 1YUHA 3GSRA 2VAAB 5KSBF 2ED9A 2W60B 2Y7QA 1N5AB 4P4KC 1CL7L 1UCBL 3LMJH 1QZ1A 4JQIH 1FG2B 4ODTH 2XY2A 2J7LA 3VCLB 1JZ3A 1ZTXL 4XXCA 1CTOA 1YNTB 1Q0YL 3GMQB 2EEAA 2AV1B 2R0LH 1M71B 4QHLA 1KC5H 1T7WA 4WUKH 3GK8H 1J87A 1KGCD 1WQVT 3DUUB 2FO4B 3IJYB 1A2YB 2FCBA 1PZ5B 4U2ZA 2DBLL 1DEDA 2BNRB 4UB0H 3LKNA 3EZJB 5TDOB 2O5ZL 5FUOL 5FHAH 4ZOBA 5DJXA 5IBUB 1IAMA 4V1DB 4UV7H 4P2RB 3AS3A 3IS0X 2B1AH 2P5EA 3MV7E 3Q3GA 1KTLB 5DGRA 5J1AB 2VSDA 1JGVL 3E6HB 3VWJB 1W0VA 4MQ7B 3OAYK 4NP4H 4JKPH 3HTLX 3VXRA 1NJ9B 5CP7A 1JF1B 4I9WD 4MQTB 4P46D 2PYEA 3CLEL 3P4MB 1BZ9B 4HXAL 4P2OD 1IAIM 1CFVL 4OKDA 2NCMA 5ANMA 4X9BA 4GQPH 1D6EA 4F3FA 4UZGA 5FHBL 1UB6A 2R4SH 5C3TA 4JO4H 4MLIA 2Q6WB 5BO1H 5IVXA 1HK6A 1BGXH 5D7JD 3DWTA 3LQAL 3KXFE 4O2CA 4XPGH 3QR2A 4ZPVB 4OTXL 1A6WL 2FWOA 4GRMA 2DMBA 5DFVD 5HGBB 1RD6A 4L4VD 4U1GB 1LHZA 2G2RB 4ZYKB 4JZOA 1ZLVK 2X9XA 3PHSA 1MVUA 3VXMA 2ZSVB 3KYAA 4MAYC 4POZD 4NN7C 4L3CB 5HGAB 1H3TA 1J88A 2IAMA 2WINB 4Z8FH 4P2QB 5KW9L 3WIHL 4CMMB 1V7NH 5GRJH 1JI1A 1BLNA 1WLHA 2D4DA 1EBPA 1NLDL 4L8DA 4XNZC 2YD1A 3MRNA 3BUYA 1AXIB 3IDXL 2XXCB 3S96B 5GSRA 1BJ1J 1JNJA 3CFKB 2WWMC 1TTFA 3QPXL 4OFYA 2Z91B 3DV4A 2Q7YA 1QBBA 3MOQA 1TLKA 1RK0A 5GZND 1OP5K 1W8NA 1MLCB 1IC4L 4KUCD 4QRUB 2DB8A 4Y5YC 3VXSA 4B7LA 3U6RB 4U6XB 2Q8AL 2Z31A 2R8SH 1QSEA 2NTFA 4LSSL 5I66B 1I4FA 4I2XE 1NSNL 4HUKB 2O61A 2J6EH 4J3UA 4X5WB 4HPYH 3BWAB 5E2VL 3MNVB 4JO1H 4NQCE 1TZHB 4GG6B 2EH7H 3CXDH 1S9VA 2ZOLA 4YNYB 3OGOE 2B4CH 5DK2B 2P5WD 2YXMA 3CVHL 3NACL 1CLOL 4OCWH 3P4NA 3MRJA 2HFEB 4L3EA 1YN6A 2HYMA 2ZPKH 2GJ6E 3TIEA 2VDKL 2BXZA 3IU3A 2A83B 4J6RH 4WW1A 5J89A 4FQXC 3VFWA 2XWTA 4NFCA 2YSSB 4OJFH 5C0FA 1XF2A 3TVMA 4OM1H 4F7MA 4H5SA 1BX2A 4NO2B 4UOW0 3ZDYF 1RZFL 2PW2A 2RFXA 3BGFC 2XZQH 3U7YH 3FO1A 3TBWA 3OR7A 4XP6H 3PF2A 4X6EB 5GIRA 4DKEH 3VFTA 1H5BC 4UDTA 4TUOB 4X4YA 5IFJA 5BZDB 4R2GB 2ESVD 3T0VA 1Q9KA 5KS9E 5C0EA 2JCCE 4YHIA 4M93C 1BQUA 5J56B 2DYPD 2V6HA 1KLUA 2HWZL 4M62L 1YJDC 4LBEB 4ORGB 1UCBH 4LCCA 3ARSA 5CBAB 5JDSB 4LFHG 4TPRH 4YHNB 3SKUD 5AD0A 3O3EB 1T66C 1I85C 1M7DB 2IPUK 3JVGA 4KKCD 1Q0YH 5GQBA 4A2LA 3OKLB 1VA9A 1DN0A 4JFHE 4YFLI 3LKOB 4D3CH 4Y1AD 1CD1B 1FVCA 1A02N 1NC4A 4JY5L 4D9RE 3SKMB 4HCRA 3QIUD 4QRRD 7FABL 3QXWA 4U1JB 4O9HH 5GXBB 2O5ZH 5FUOH 4PJ9B 2VZSA 3VXNB 1DFBL 4MHHG 2A6JA 1ZSDB 3HA0A 1NBYB 4XAKE 8CGTA 5LBSL 1FLRL 2V9RA 2XTJD 3EAKA 2A9ML 1I3RB 3ULUH 3PP3K 5FK9A 3WFZA 2P48B 5DUMH 4P3DB 5JA8B 3OKMA 3CLEH 5MHSD 3TFKD 4JG1L 3MODH 1NGPL 3TCLB 5LJYH 1KJMA 4K2UL 4XI5D 5GGVL 5TDPA 5BRZA 1CD8A 5MEPB 3TM6A 2XG5A 1HHGA 5CBEB 5I1KL 3AMLA 5ID0A 3OKDA 2VLME 5FO9B 4ZMAT 4IMLB 1U0QA 4NRXA 5TQ2L 5IV2A 1MEXL 4KRLB 3PE9A 2ARJQ 2EDRA 4KPHL 4QY8B 2QQLH 3REWA 2KBGA 5HYJB 1ES0B 2VLKA 4HEME 4OZGF 1I9RL 4JRXD 3VGDA 3VH8B 1C5BH 1ZA6A 4HH9B 1ZGLB 1T80A 2J12B 3LN9A 3FONA 1I9EA 1OW0C 1Y18B 2YMXH 3V7AG 2GAZA 1FZKA 2AKRB 4PY7B 1NLDH 3PL6D 4HX1B 4MA1B 3EIFA 5KVEH 3N50A 1S7XB 3IF1B 2VKWA 1EEQA 4K71B 5J57B 2HG5A 1HXMA 3KPOA 2ZCHL 2J8UF 4J1UA 5SX5H 5IR1B 5GZOD 1MI5D 3IETB 1XGYH 5GJSH 1UZ6E 2OJZL 1J8HD 3KDMA 2KZ1B 1ED3A 1BD2B 4LDLB 5E2VH 4U1MA 4XVTH 4JO2L 1XGQB 4RMUA 4YQXL 4YHPB 1ORSA 2JJSA 1CLOH 4F7EA 1JNLH 4JFDE 3BFOA 5KVMC 1RZKL 1BM3L 2O5XL 1NEZA 2VDKH 4IEFB 3NN8A 4JO3L 2C1PB 3RZCA 3DMMA 3W9DA 5CSBA 1KB9K 5CD3B 4NUGL 1UXWB 3L3GA 2VLLB 5IHUL 1U8QB 4RQQB 5BS0A 4HUUA 4PJAE 1DVFD 4LSTL 3C5ZD 4FP8L 1MWAL 1NUNB 2JIXB 1K4CB 2SEBB 4HPOL 2R1YA 4WFHD 4B53A 4OQTL 1AGEA 3IYLW 3DXAE 4UV4H 3PWPE 4N0CD 3AS2A 3ROLB 1EO7A 2MMXA 1B4JL 3BVNB 4CU8A 4RGNB 2OTWB 5DT1L 3VMPA 4P57B 3HI5L 2BSTB 3QEHB 4KRPD 5D1QC 3BPCA 2I07A 3QZWA 3ARDB 1KN2L 2UZYB 2VLJD 1J5OH 5FM5M 2MQ3A 2PCPB 2NY3D 4ZS6D 1K3ZA 5AYUL 1X5XA 1N2RB 1T4KB 1MQ8A 5JORB 4FHBD 4QRPA 5EZJA 2P46B 4NC1E 4WHYG 2X9WA 1A47A 2NY1D 1A7BA 2W9LA 5I1HL 1F6LL 3C5JA 3RTQD 1LP9E 3CUPA 1G9NL 3L5XH 2ATPB 1DFBH 5L0QC 2BNUB 3GSOB 2YWYA 4AIZB 2AQ2A 1RMFL 1HXYA 4IRSC 5F3BA 3BXNA 3IU4L 1OAKH 5LBSH 1FLRH 2QADC 5E4EC 4MSWB 5GGQL 1FL5A 2IANB 1YZZA 4FFZH 4CN6A 1KCVL 3DX9A 2FSEA 4RX4D 4WI4A 5HDOA 1FH5L 4MD5B 4Y89A 5CZXD 4JG1H 1WBXA 5DA4A 1ZHBA 4E41A 2G9HA 3QWRD 2BSSA 5C08D 5DJ8B 3FQWB 3MRFA 2VWEE 4MQXD 3O3BB 4HMEA 2XZAL 4J8RA 5AAMA 5J3HD 1JZ6A 1MEXH 1I7TB 1IAOB 5C2BL 4KPHH 4JR9H 3HAEB 3C60D 3UBXI 1LGVA 2N56A 3FOMB 3U30C 3V6ZB 1JMZA 4V2CB 4RMRA 5JHLH 3CFBB 3LN5A 2CLVA 4HHAA 2F19L 5MEOA 2QSCL 3PWUA 1NCAL 4L4TB 5F96H 1B90A 1U8NA 1WCBA 3RDTC 1YNKH 3LKPA 4I0PB 2K3TA 4J3VA 3QIBB 1X5YA 4N8PA 3EJJX 1J0KA 3E8UL 2F74A 3G04A 3STBA 4GO6B 4F7TA 5HYSB 4ZAKC 3SDXB 1JWUA 1L0QA 4M7LL 3ZKND 3L3OB 3MRLA 3P4OB 1CDHA 3G5ZB 2ERJB 2J88L 4N5ED 4ZDHA 1A1OB 4I3SL 4OF6A 3QDJE 5HHVL 4G42A 4U6YA 3MUY1 4UU9B 1I7RB 2C1OB 1TVHA 4XCNB 3WS6C 3LDBC 4OLYH 5CJOL 3GM8A 3G9VA 3OGCB 4LSRL 3ARZA 2UZIL 5I1EH 5EFIB 3TH2T 3OKOA 4MMXC 5CSGA 2AQ3A 2HN7A 2EDXA 2YUXA 1RZKH 1BJMA 3QUYB 4XH2A 5EIQA 2A77H 1KNOB 3WHXA 3GJFH 1JVKA 5K9JH 1U8KA 1RZGB 5JO5A 5JNYB 4PJHB 3ZT7A 1X3DA 1QR1B 3B9KB 2ADFL 3O3AB 1T0PB 4Z7UA 1LO3L 2BP3A 3ARGD 4EDWL 1FQ9C 1ETZA 4O58H 4WO4D 3D2UD 5FYLD 1YYML 4OQTH 5DK0A 4OGAC 3GJFA 1T1XB 1HYRC 3UPRB 5B38B 1S8DB 1ZLWK 4C56A 5DT1H 1WICA 5SWSE 1X5AA 3V4PH 3UBXB 2AGJH 1K8DA 4KU1A 3AXLA 1K5NA 4HMDA 3ZTJG 4AMKH 5FKPB 5I30H 2OLDA 4MX7B 1ND0B 3RL1B 1OM3H 4P0DA 3SE3A 4WFED 3BRGC 3FB6A 3DSNA 3RVVD 3VJ6A 1GAFL 1FYTB 2QLVB 2Y5EA 1J0HA 1FFOA 3RFZC 4U1SA 3GKZA 4DN4H 2KKQA 1T6VN 3AVEA 2DKUA 1AY1L 1N4XL 2WK2A 5E8EB 5I1HH 4XWOC 1DQMH 3QA3A 5BXFA 3I84A 2B2XH 3B9EA 3MRBA 4U6HA 1KUMA 2EDNA 2ARWA 4UTBH 4MS8D 3QCTL 4OLXH 2DQGL 5FGCB 3KPPA 4Z7QE 5T1LA 3QG6B 3KVQA 4RBPH 5GGQH 3OXSB 5IWLC 3V0VA 1U8HB 3PDOA 5LKNA 3DX8B 1F2QA 4APQA 3U4EB 1KCVH 4G43A 3FO2B 1Q72L 1I9IH 1BWWA 1FH5H 2NPLX 5D1XC 4G9FB 4PLJD 4PGDB 4RMVA 2RAMA 2N7BA 1HKFA 4D8PA 1P2CB 4R8WL 3HI6L 1JRHI 2NY5C 2DICA 2QQNH 4MJIE 2HT4C 3BKYL 4NQUA 4BM7A 4QKXB 2XZAH 3FAXA 2AJXH 4NKDB 4XCFL 4OZFB 4KY1L 5I8OL 2ARJA 2NY4C 4X99A 5EOCL 5KVDH 3EOTL 3O6FB 1KGCE 3HNTH 3WJJA 4IRJB 3A6BL 4PJFA 2PN5A 2R9HD 2UVFA 1QLFB 4ETQA 1NCAH 3IDNB 5EO1B 2YN3A 1X5ZA 4MNQE 5EUKA 5F89B 5C6WH 4ZO9A 3MRRB 2EO1A 2W0KA 1HHKA 3QBTB 4HK0B 4P23B 2ZG2A 3AB0C 3HC3L 4GBXD 5EC2A 4EN3B 5HYQA 4YZFF 3IDYB 1EDQA 2RHEA 4LP5A 4I9WE 3KPSE 5I16B 2BVPB 5C09D 3EYQC 3DX6A 1OAZL 1MREH 1ZK9A 3L3KB 4I3SH 4PJ5A 3ILPA 3HZKA 4Y16C 2V2TB 1ZV5A 3LQZA 2J3SA 3QNXB 3O4LD 2WIIA 1AO7E 1MRDL 4QHMA 4XPHL 1FNHA 4JFXA 1PSKH 3PGCB 1H8NA 1IQWL 2RCSL 3RWCB 1QVOA 4P5TB 4PJCF 5F6IC 3QQ9D 4KKAC 4X4ME 1V5JA 3MA7B 4WHDA 4WEBL 3FRUB 2FZ3A 5I17A 1A6TA 1FZMB 1SJVA 4Z7VB 2P5ED 3QEGL 3VE0B 4P9ML 3V5KA 3LAFA 4KI5E 4K9EL 4BA8A 2C4FU 3WDJA 5HHQA 3SDDA 4NO5B 5C0BA 2LTQB 5C70A 4E5XB 1BIIA 1DBBL 2GFBA 4LEOB 4PBWD 2I25N 1SMOA 3LV3B 4Q6IC 2FATH 1OTSD 2VXSH 3O41B 3G5YB 3RAJL 1IM9D 2ENSA 3O6KH 1UH2A 4XP1H 4C57C 3RWHA 4IIQB 5IMLA 4QRQB 3CFEA 5KSBA 5J0BA 2R2BB 3QIWA 3HI1B 3KR3H 1FZJA 2JELL 4MNGA 4JN1H 5D72L 3ARED 5DJZB 4PJXB 3MJ7B 1D5XA 1S9WB 4WDIA 3BSZL 1CE1H 2CD0A 2X4SA 5DMGC 1N8ZA 5DUPL 5J6GB 3ULVD 2NZIA 4P4KA 2CMRH 4KDVA 4JM4L 3IJHB 4LK4A 1GAFH 2GSIA 1AQDB 4WWKC 1A3RL 3TN0C 4L29A 3EKCA 2DIBA 3BIBX 1VFBA 3H7BA 4JAMA 3QXAB 1N4XH 4X9HA 5H2BB 4G9DA 3WYRA 5E9DB 4N90D 1CYGA 2P8LA 2ITDB 4AIXA 1VACB 1JZ4A 4DEPB 5LQBH 1IT9L 4U33A 5GHWL 3QCTH 4D94A 3SY0B 3IAGC 5E6IA 3VGHA 4PRDA 1AKJB 3AGVA 1BQHG 2GI7A 3S37L 2GHWB 2VH5L 1LO2H 3ARFC 5D2NE 2BNQD 1RI8A 1Q72H 4ZFFB 3FO9A 3MLPA 2J8OA 4LCWB 1WBYA 4GAJL 4I48A 2F8XC 2ESVE 3ET9F 1CG9B 2W9EL 1FFPB 1M7IB 5DC4B 1RFDL 4X9IA 3TIDA 4OLWL 4PJBB 3BZDA 3L3DB 1AGFA 2R23B 1A6VH 1MFDL 3MV9B 4I0KA 5DJCA 5KN5A 3BE1H 3MXWL 4WENB 2AV7B 4J4PC 2QSVA 3LRHA 2VXQL 1YN7B 3LRSA 3HG1B 1SEQL 5EOCH 3FTGA 3R1GL 5DR5H 1IGYA 2XKUA 5GRUH 2OM5A 3WL9B 3QUXA 4Y1AE 3WUWA 5IJKC 4JZNA 4M7LT 2YD5A 3A6BH 4MQSB 5ILTL 3DBXB 5FO8B 1NPUA 2BMKA 2UWEE 4PIRF 2CKBB 5CP3H 5JMRA 4U6VL 4HGWA 3RIFF 3CSGA 3E6FA 3SGJC 3U2SA 1CICC 4B7IA 1PX3A 4AT6A 4KTEL 5JXED 5HPMB 5EWIL 1B0RB 3VD3A 1FG9C 1PEWA 4KQ3H 1KBGH 1MAML 1YEEL 3L1OL 3V9FA 5IW6A 1TQCB 3VFRB 1PQZB 4N0RA 1XF5B 1DEEA 1FN4A 2LAAA 4PV8B 1MLBA 1YUHB 3GSRB 2Y7QB 4NZTL 5F9JA 1TNMA 2XTJE 3CH1A 3I6KB 1JYVA 4RIRA 3V0WL 1XF1A 4KKNA 4LQ1A 4MGXA 5E8NB 3ZDXE 4Y5YA 2V5MA 4QHLB 4C59B 1KYOK 2M2DA 1KXVC 3NVQA 1MRDH 4LHUD 5I6XB 3MUZ1 4L3AA 1IQWH 1WFNA 3MRPA 5DEZA 4LQFH 1TENA 3K3QA 1RUPH 1UCTA 2IFGA 2B5IC 2P43B 5EA0H 3VXUD 5KS9F 4TVPD 2JCCF 3U7WL 5DJXB 4NPYA 1XGPA 4WW2F 4PJ7F 3Q3GB 1T03H 5IBTL 3PV6A 2F53E 2VJXA 1PG7L 1FSKB 3KYMB 1IE5A 3SGDH 5KZCD 1W0VB 5A40E 5F1OB 3VXRB 2NY0B 5CP7B 4O02L 4OF5A 1G7PA 3MLSL 2PYEB 1P4BL 2E27H 2NR6C 2B0SH 4TUKL 3RAJH 5ANMB 4OGYL 2ADGA 3WFHB 4RGMB 1D6EB 1D3CA 4F3FB 1UB6B 1UJ3C 1QD0A 3PJSA 4NGHH 3Q6FA 4FZ8L 5IVXB 4BH7A 1H5BA 1YJDH 1DBKL 4O2CB 4V2BA 3EO9L 1XIWC 2FWOB 2JELH 4GRMB 5D72H 1ZHKA 1OAYL 1T5WA 2GSGA 3BSZH 4R97C 3X12A 5ISZD 4JZOB 5DJ2A 4LAQL 2FEDC 1NGWA 2X9YA 5DUPH 3K4ZA 3VXMB 1BEYL 2HKHL 4DKAA 4JM4H 4XNQA 1H3UA 2CK2A 2IAMB 4G7YL 1AR1D 1I85A 1MJJA 1A3RH 2YPLD 4P59L 1GCFA 5INCA 5T5FL 5FA3A 1BLNB 1CLCA 2JJTA 4L8DB 2EZ0C 3HN3A 3BUYB 3MRNB 3PNWA 2CO7B 3C09B 3A0OA 3TBYA 1RY7B 1A0QL 5LAXA 3VXOA 2XXMB 1BP3B 3EYFB 1UWEL 1SBBA 2Q7YB 1CDCA 1RK0B 4Y4KC 4NRYA 4JRYA 3VXSB 1GRWA 4MA3A 2WBKA 3OMZA 4RFOL 4XVUD 2Z31B 4LNRB 2X89A 1QSEB 2NTFB 3ZL4L 4OUUA 1NCDL 3S37H 1I4FB 2VH5H 3OPZH 4LVHC 1TIUA 2O61B 2EXYC 5IFAH 2XN9E 1EEYA 1Q1JH 4OGZA 1UYWL 1VFUA 4LMQE 5JOPD 2DWEA 1MSPA 2W9EH 4U1IA 1RFDH 3ZYZA 2X5PA 2C3WA 2J5LB 2BY2A 3MRJB 3RZCD 4L3EB 1YN6B 3TIEB 1I3GH 1MFDH 4R26H 3VRLE 3IU3B 4ZSOA 3MXWH 1VDGA 1R5VA 4WFGD 3LEYH 1NGZA 4WW1B 2VXQH 3VFWB 2XWTB 5C0FB 2P8PB 1XF2B 3R1GH 3TVMB 1TZIA 4H5SB 3O6ML 4R90L 5EU7E 3ULSA 3QXTA 3P4LA 4FMFA 2PW2B 2RFXB 4UBDD 5F9DC 5ILTH 1UZ6F 3FO1B 1IM3A 3TBWB 3OR7B 4CNIB 3JTTB 1UB5A 4U6VH 5I1IH 5GIRB 1UZ8A 3VFTB 4UDTB 1HHJA 4K7PH 5B8CC 2FX9L 4X4YB 3AS0A 5HHMD 5B4MD 4G3YL 4KTEH 4Y8DC 5EWIH 4DKFL 1OW0A 1AQKL 3L1OH 3P9MA 1YEEH 2J8UA 1MCWM 5C0EB 4YHIB 1RPQA 1U8IA 2WUBL 1KLUB 5HHOA 4NZTH 3D3VA 4RAVA 4BZ2H 3BAEL 4LCCB 2ZZUT 5EBLA 3OKKA 4FZEL 5CKAA 3O8XC 4PJAF 1CN4A 5AD0B 1LD9B 4HLZH 2H45A 1ZEAH 4M5ZL 1AHWC 3O2DA 4KK8D 2VE6A 1DN0B 1NUDA 3ZYJA 1FVCB 2BHUA 4XMLL 1NC4B 3VFGL 5C08E 1YY9C 2ZCKL 2CR6A 3VWKC 1HNGA 5JDJA 4TRPL 1U3HC 3JWOC 4KKLC 4GW5A 1AGCA 3SEPA 3U7WH 2C3HA 1CCZA 3VI3E 1TETH 3UZEA 1LO0L 1TTGA 4DOHE 4HWEH 2A6JB 4LF3A 3TV3L 2FD6L 2MTPA 5IBTH 5F9WB 1YEHH 3NFPA 3MV8D 5AZ2H 4YXKL 5FK9B 2NX5A 5GRVK 5C71A 4BQ6A 4O02H 3DSFL 1K85A 3OKMB 3O6LL 2P8MA 4OCYL 5DK3A 4XT1C 1NCWL 4MB4A 2EDDA 5T1KA 4S0TD 5SV3A 1P69B 1KJMB 5FGBC 3CDYA 3VXTB 4X5XA 2DQCL 3MV01 2D7MA 1KIQA 5TDPB 5BRZB 3K1KC 4FZ8H 5CMAA 3TYFA 3OKDB 5LXGH 3RL2A 1LP9F 4JB9H 3NPSB 4XXDB 1TNNA 2F5AH 3DUHA 3K2MC 4NRXB 5IV2B 4EUPG 3REWB 4J3XA 1INEH 2DQHH 5FUCE 4LAQH 5K93A 2VLKB 1XH3A 2WQRA 3MUGA 4UAOB 2HKHH 2Z8WC 1G6RH 1DQDH 1GC1C 1P1ZB 4MJ5A 1HEZA 1IEAA 3FONB 4Y5XB 2A0LD 4P59H 1YEIL 2XWJA 3X11A 3K0WA 1F4XL 5T5FH 1FZKB 2FBJH 2OR9H 3ARVA 5IQ9A 1ONQB 3OV6A 4OUOA 5D7KE 3ETBF 3EJZD 2FR4A 1G6RA 2BVUA 1RVFH 1UEYA 1AC6A 1A7QL 1A0QH 2GT9A 1H8OA 3ARBD 1UWEH 2HG5B 4Y4FD 1HXMB 4KHXL 3KPOB 3S3JA 2VXTL 3CSYA 5A3IC 2ZUSA 1I1AC 3UTTA 4RFOH 4J1UB 2V9QA 5GSVA 4GQ9H 4IRSA 1JF6A 4OZHE 2NXZC 1CIDA 4LARH 5FYLE 4B0MM 5DEFA 2W38A 3VRIA 5CD5D 2GYSA 2DQEH 3TCXA 1ED3B 4JZJA 4EIGB 5D1ZD 5E1AA 5EBWA 4G5ZH 1GZPA 1OB1A 4JHWH 1ORSB 1CXIA 4F7EB 4MA7L 4WTZG 3S4SG 2BX5A 3GDBA 3PABA 4L8BA 4JGUA 1NEZB 2CRIA 5EZIL 5D70H 1F3DJ 3DMMB 2QHRL 3W9DB 3NGBC 3SGKA 5DJYA 3FQRA 4WFEE 4Y4HD 3T0EC 3L3GB 3QXVA 4CVUA 4OD1H 4R90H 5BS0B 4HUUB 4E42A 1GGBL 3ZYOA 4M1CC 4XGZA 1RUKH 6FABH 1AGEB 3LEXA 2FX9H 3QCUL 4PLOB 4HK3N 5E0QA 4G3YH 1ZHNA 3O2WH 4DKFH 3I9GL 3RDTA 4O00A 4L1DA 1BOYA 4K3JL 5I1GL 2WBWB 5KSAC 1INDL 3BPCB 1BIHA 4ZAKA 2I07B 4Q58C 3QZWB 2P42B 2I9TA 5CS7A 4FZEH 3T0AA 4JM2F 1R24B 3U83A 5F7EL 4Y2DC 1VPOL 5D8JH 1WWCA 4B41A 3IKCA 1MHPH 4PTTA 4QRPB 4D9LL 4XMLH 5EZJB 1ZLUH 4YHYB 1QSFE 4DTGL 1ACYL 3C5JB 3VMNA 3RY4A 4F80A 4M5YL 3H8NA 4JY6A 4PJEE 5JHDA 3QFJE 1WITA 35C8L 2ED8A 3CUPB 3KYOA 2E7BA 1QP1A 3QAZC 3TH3T 4NCDA 3TV3H 5F3BB 1HXYB 2FD6H 2R0ZL 5T1LD 1F4AA 1L0YA 3BXNB 3HCVA 1MOEA 2EC9U 5HI4C 1FL5B 3QFDA 2EC9T 2ICCA 1WZLA 5C0RL 4KGJA 3SJVD 3DX9B 2FSEB 3DSFH 4XWGH 1UM6H 3VG9B 3RHWF 1ZOXA 3EFFA 2CRMA 2YPVL 3DI3B 1NCWH 1Z5LA 1WBXB 1OQXA 1ZHBB 4G8GA 1T2QH 4E41B 1TCRB 1U8JA 2G9HB 3WV0A 2H9GA 4JFFD 2BSSB 5DD0H 4ZUUB 4CUCA 5F7NC 3W0WE 2ZWLT 2VTFA 2CK0L 4J8RB 4I18A 3MLZL 3V6OE 1E27B 5IQ7L 4TNVF 2WIMA 2R29H 4Z95H 4Z7QF 2FH8A 3RPIA 3SDAC 1LEKA 3OJMB 3TP4A 3SDCC 4ISVA 5E70A 3LN5B 4RWYL 2CLVB 4HHAB 1H8SA 1SY6H 3NMEA 4I3GA 5MEOB 4NM8L 5E99L 5D7LA 3PWUB 3TA3B 1DE4A 5JW5A 2NNAA 1U8NB 5ETUA 1WCBB 1F4XH 3LKPB 3VG0L 2H2SD 2NYYD 3E1F1 4LLYA 4WUUE 5FYLL 2DI8A 2E9WA 2F74B 1HSBA 3E3QE 1JWUB 3BUTA 1KCUL 1JPTL 4HDIA 3MRLB 2ZUTA 2VXTH 2E7LA 1D5IH 4ALAL 4ZDHB 1WUNT 3VI4E 1JNNL 1NMCB 4S1QH 1CQKA 1HINL 4G42B 4U6YB 3BGMA 5IWLA 2DLTA 3BYYA 1TVHB 1FV1A 3S35L 5D71L 4Y8AA 4P46C 3HE6D 1MCBA 3OKOB 5D1XA 4P2OC 1KYOJ 4K07A 3WIHA 5ESAA 3UYOD 4XBPA 4DCQA 5KSUB 4U1HA 5EZIH 2FGWH 1WFOA 3PWLA 1HILA 2ICEA 4XH2B 5E8DL 3LPFA 2VZVA 3WHXB 1KTKE 1LO5A 1MVFA 5D7JC 1U8KB 5JO5B 4LASH 3B5GA 1VADA 5DFVC 3VU2A 5BZWA 1CGSL 1VKXA 3D39E 4X6FA 2XY1A 4Z7UB 1BFTA 2W9DL 5D7IE 4HWZA 1MRFL 4NKQB 1ETZB 1YNLL 3JV6A 3MUHL 5DK0B 1FBIL 3GJFB 4XB7A 4POZC 5HVHB 3EHBD 1KJ3L 1FVEA 4C56B 3JWDC 4DZBA 5JQHC 3NTCL 5HI3D 3PWNA 4K3JH 1K2DA 1K8DB 2DMCA 4QOKA 5EU6D 4KI5F 1INDH 3PWJA 1PD6A 3AXLB 4HF5H 1K5NB 3EOBA 1MJUH 2AK4D 4W6XB 1Z9LA 1CXEA 1IGFH 4OB5L 3FB6B 4XPTL 4PJCA 3QEQE 3VJ6B 5GZNC 5HJ3A 2PKDA 2F54A 1K8IA 3VFMB 1FFOB 4U1SB 3LZFH 4XVSL 4AEIL 4Y16A 4OFKA 2E6PA 4LLUA 1S9KC 5D9SA 3RUGE 1ADQL 3I85A 3QA3B 3QHZH 4GS7B 4CVZA 5BXFB 4FFYL 4HUWA 4EI5D 5CEZD 5L2KE 4O4YL 3MRBB 5F7FA 4LVOB 3VGAC 4U3XA 4U6HB 3K1DA 4LFHD 5D2LB 1J1OL 4MCYA 5E6ID 4EXPX 4LPYA 1T6WA 3KPPB 1EPFA 1QO3A 2JLLA 3V0VB 4APQB 1JZ5A 4G43B 5D5MB 4OLZL 1I8KB 3HMWH 3SQOL 2YPVH 1RIVL 5J9PB 1GGYA 4HJJH 3AROA 5EG6C 4NRZB 2B7DT 4D8PB 5CCKL 3BZ4A 4TN9A 5F93C 2A74B 5FA4A 4BKLA 3MV7A 5D2NC 5J1TC 2MCG1 4XBEL 4QXUL 2OR8A 5CWSA 3FHQA 4Z78A 4BELD 1M05A 3QJHB 2ARJB 1NAMH 4F8TA 1RU9H 1CS6A 3U9PH 3QUXD 2IFFH 5TPWL 3F6LA 4FTVA 1QBML 1KXTB 4RA0C 5BOZG 3OKNA 3JUZA 4TVSa 3W9EB 1DCLA 1ZMYA 1HWGB 5E99H 4ETQB 1CDIA 3KXFA 2BY1A 3VXUE 4KKCC 2X4NB 3HE7D 3RA7H 3QDGD 2FJHB 5BMFL 3TN0A 3ZTNL 5EUKB 2O93L 2AXGA 1T1ZB 1HHKB 5EU5B 3QIUC 1KCUH 5EC2B 5I8KH 1JPTH 3N85L 1A22B 5CJXC 4ALAH 1EV2E 3AY4C 1IKFH 3DX6B 1R6VA 4PJ5B 3QO0B 3LQZB 2BNRE 2UWEF 1HINH 1FDLL 2WIIB 2W1NA 3FN3A 4QHMB 4DW2L 4JFXB 5IVNA 2BC4A 4V1DE 1QKZL 4KV5E 1QVOB 1WFUA 4P2RE 5D71H 1KIPA 1X5LA 4M9PA 4JANA 4HLZG 5IHZA 2IADA 1JYWA 4FQ1H 4EN3D 4R3SA 4YHOL 3TFKC 5JPNA 2FZ3B 5I17B 4QTIL 4XI5C 4XP5H 3V5KB 1G0DA 4I2XA 3ALXA 5DHXB 3KPRB 5HHQB 5EORL 3SDDB 5T3ZD 3WXVL 5C0BB 3FO0L 4XRCA 4MWFA 4J4PA 3KPLB 3N06B 4TQEH 2GFBB 2HFFA 3ZDXF 1YEGL 4KVNL 5IEHB 5J7CC 2BVEA 2YPLE 1H3VA 4S1DD 2OX5A 5HVWA 5JR1L 2W9DH 2WNGA 5IJKA 1T22A 3B9VA 2VQ1A 5F72S 1FBIH 4YXHH 3RWHB 4H1LA 5IMLB 4KJPD 4Z5RA 3CFEB 3RWDA 4FXLA 2APTA 5EBMB 3SGJA 1CICA 2D03H 3FKUS 4XHJC 1N6UA 3QIWB 4YFDB 2XRAH 2OL3A 1FZJB 1U36A 2YKLL 4KMTL 4G8IA 1D5XB 4WDIB 1BVKA 1YY8A 3BRFA 1IAKA 3PL6C 2X4SB 4P2QE 3HUJE 1N8ZB 3MTRA 5IB1B 3FL7A 4P4KB 4XX1E 2HTLD 3GMMA 3O4OB 1FO0L 2C5DC 4OB5H 4XPTH 3RGVD 4Q2ZA 4HKZA 4NJ9H 4FQCL 5HDQL 5LGKA 1WWBX 4AEIH 3MBED 5GZOC 4JCLA 4WW2A 3NCYS 4PJ7A 1U8PA 1VFBB 5DTFA 3MCLH 4JAMB 3V79C 3T1WA 4LLQB 1AJ7L 1MWAA 1JWMA 2JK5A 1M6OB 3QPQD 4DVBA 2XYCA 1MNUH 4FFYH 2VDMH 1KPRA 4G9DB 4JRYD 3HMXH 1J1OH 5DVKA 3I2CH 3PHQB 3S98A 5IK3A 1QYGH 4PRDB 4ZQKA 5DURB 4OCNC 2OXHA 4ODWA 3NCEB 3HMXA 3FO9B 4OLZH 3R0MA 3SQOH 4HIXL 3BJLA 1RZIA 1WBYB 3Q0HA 4GKSA 3B9KC 4I48B 1UKSA 3OKYA 3B9AA 1DVFC 3C5ZC 3FOLA 2AK1L 4URTB 2ICWI 4LU5L 3TIDB 4NQSA 3SGDI 3D69A 1PKQA 1UJ3A 3FFCA 1WK0A 1EGJH 1AGFB 3GUTA 4QXUH 4GW4B 5DJCB 1OCWL 3X3FL 5KN5B 5DQJA 3LIZH 4N0CC 3T4AA 3QT2A 2WBJD 4S1SL 3U9UA 1XIWA 1T7VA 2XOTA 1NFIA 5TPWH 1IGYB 1QBMH 1XZ0B 5EU3B 2R39A 4C83A 5F9AC 3EJYD 3BP7B 2A6IB 4KRPC 3WUWB 2Z8VC 1T7ZA 2CDEA 5IMOA 2M1KA 2BMKB 4OQ1A 5L6YH 4MAYB 2RJMA 4NN7B 4R96A 3E6FB 3U2SB 2VXUH 3BP5A 1MY5A 4NNPL 4OM0H 4ZS6C 2NY3C 5DD5L 3VMOA 3VXPA 4LOUD 4AT6B 5BMFH 1CGTA 4CADB 3FT2B 5IW6B 1ZVYA 4F15C 2IF7A 4A6YH 1DEEB 1FN4B 2VXVL 3OBAA 3CU7A 4XNZB 4H20L 1MLBB 4K55A 2PW1A 1C1EL 2NY1C 1CFNA 3MV8E 3N85H 3CH1B 4RIRB 3RTQC 1KF9B 3EUUA 3WXWL 4Y4KA 4ACPA 2G5BA 1N64L 4Y5YB 4A6YA 3O45A 4NSKA 3UMTA 3IDGB 3IDIA 4JVPA 2V5YA 3MRPB 1QBAA 1NDGA 4M00A 4PJ8D 1F5WA 1KEGH 4YHOH 1PX4A 5CZXC 4NPYB 3I3DA 4MVBD 1XGPB 2Y36L 2Q1EA 2YUZA 5KAQF 1RUAL 2AJZA 2D7OA 5C07A 1GH7A 2X42A 4J3TA 1OAXH 4MQXC 4M7ZC 4HWUA 4R6UA 4ETYA 5J3HC 1YEGH 3G6DH 5DDHA 4KROD 1MFCL 1OP3K 1G7PB 3C60C 1NH6A 3R4DA 1S7TA 5FYJL 4JFDA 1EHLL 4NN6C 4ZUSA 3BGFB 3RGHA 3PJSB 3Q6FB 3FB8A 4NZRL 2IBZX 4RWHA 1H5BB 4NHUA 3RI5F 5B8CA 3BMVA 3QRFM 2D0GA 4IS6A 3VI3F 4TULL 1TMCB 1ZHKB 4PJAA 5IGXL 1T5WB 4U1LA 1IC1A 2GSGB 3D85D 3X12B 1KG0A 1SQ2N 4M93B 5DJ2B 3HB3D 2AW2A 4DFIA 5KANG 3RVUD 1V05A 1NGWB 4K7PX 5T1DL 4GW1A 3DXAA 2AJVH 1FO0H 3KJ6H 3WIIL 4IMKA 3PWPA 4XNQB 3ZKNC 3BIKA 3O8XA 4N5EC 1AXSA 1MJJB 2Q76A 4UMGA 5IMMA 1PEZA 1TDQA 4NQDD 5INCB 5FA3B 5HDBE 3R8BB 1CI5A 5AWNL 4M8QA 3PNWB 1HI6A 5C7XH 3TBYB 5LAXB 3VXOB 3QXDA 4IOSD 4J7RA 2LV4A 3HC4L 3CX5K 4BZ1H 5DRZB 1BD2E 4KK9D 3PUCA 2HTKD 3PG2A 4I0CC 4I77L 1JMXA 1CE6A 4OUUB 3GFUA 3BQUC 1CFTB 1KELH 2LTQC 4WCYH 3IFNH 5I15H 5IP4A 1ULVA 3HZYA 1P5UA 1EEYB 4ONHA 4HIXH 4NKOB 2DWEB 3EYVA 1NMAL 2QQKH 3LS4L 3P0YH 3ARGC 4U1IB 5TDNA 5FGBA 1O5DT 4XCEA 4WO4C 5DMIL 5IBLD 1B0GA 1YMMD 3X3FH 1R5VB 4K3EH 2HAZA 4EBQH 4S1SH 3BESR 1UXSA 4GXVL 2DDQL 1GC1H 1GHFL 1ZVSA 1BFVH 4OZHF 5DVLA 3GBML 1IGIL 3MPCA 5TE6L 4G80B 4PRBA 2VLRB 4RGNE 1IM3B 3UTSD 2AJYH 1UB5B 1K6QH 3T09A 3MV11 1UZ8B 4X6BA 2FX8L 1HHJB 4QXTA 3ZHKA 5DVNA 1NMBL 3RVVC 5MENA 1NBQA 1HKLL 3O9WA 3P9MB 4J3OC 2J8UB 2FGZA 4P9HC 1NCBL 3H9SD 3V4VL 1U8IB 1C5CL 1YECH 1A7NH 2X4PA 5HHOB 2Y6SC 3D3VB 1AR2A 2F15A 4RAVB 4YHZH 5EBLB 3SJVE 3OKKB 3WXWH 3LOWA 2YD3A 1BQSA 5DI8A 1I1AA 2VE6B 4MS8C 5C0CD 1DBJL 3PHOB 4LLAA 3RP1A 1IQDA 3WNLA 1A7RL 1MFAH 3PXHA 3GHEL 4CN1A 4L8CA 3N1MC 3AMKA 5CHNA 1AGCB 2CLZA 1J1PL 3VFSB 2IANE 4PLJC 3DX7A 2Y36H 4PR5A 4YGVA 4OCXL 3VFPB 4LF3B 5FEBA 3EYSL 1MQKL 1KCSL 3DETD 2VZ3A 4ODHH 5DWUH 2JB5L 2NX5B 1QNZL 1X44A 3T0EA 1SJEA 2VDRL 2P8MB 5JIKA 3A67H 2DQTL 1TJGL 2NY6D 5ALBL 5FYJH 1EFQA 2UZXB 5J06A 5T1KB 1EHLH 2IEPA 5IUSA 3DLQR 4X5XB 1KIQB 4WEMB 2NW2A 4F7PA 2QEJA 5CMAB 2R9HC 5CEXA 2COQA 4PJEF 3RL2B 2YA0A 4JM2A 4TULH 5IGXH 2D31A 3T0DA 3RVXD 1N0XH 1DZBA 4F58H 3BT2H 5KJRH 4L4TE 1XH3B 2WLZA 3QUMA 5D1QB 5T1DH 5KSAA 5ITBL 3MUGB 2EKJA 3UXFA 4GBXC 2AEQL 3FN0H 3RY6A 1KFAL 4BUHA 4XXCC 4MJ5B 1HEZB 3SDXE 5K9KA 2XWJB 3EFDL 1WIOA 1F8TL 3X11B 5JIPA 1QRND 2FEEL 5IQ9B 1GOGA 4UT6L 4NQED 5ALCH 5I9QC 1G6RB 3B5TA 3QNZB 3T2NH 2BY3A 2GT9B 3QQ9C 4AEHH 4PYHA 2BJMH 3HC4H 3CSYB 1HQ4A 3G5VA 4LRNL 3UTTB 4NZDA 3M45A 5L0QB 4I77H 5GSVB 4IRSB 5E7FA 3QDMD 2X4OA 3MXVL 4PRHB 2BFVL 3E3QC 2QADB 5E4EB 3UC0L 1A7OL 3D9AH 1F02I 3NCJL 5E1AB 5EBWB 3BIAX 1OTSC 3QISA 5ADOH 2JJVA 4ZNEA 4L8BB 3MJGX 3PABB 4PJHE 5I76A 2YEZA 1MFNA 2GCYB 3QHFL 3MOBL 2BSED 1C16A 2VRAA 5FDWB 7CGTA 4JHZA 5DJYB 3RJQB 3FQRB 1DL7L 4IRZH 5IW3A 2H6PA 3TNMA 2DDQH 5GGSA 1NC2D 3BKCL 4E42B 4OKVA 5KANI 3MOAL 1IGIH 3P0VL 4PBVC 2Y5TA 3U30B 3SDAA 4XGZB 1MIEL 2DQUH 2FJGA 4MJIA 3RIFK 3SDCA 1JFQH 3ULVC 2FX8H 3LEXB 3KYNB 4KVCL 2IAMC 3DVNB 3KJ4C 4ODUA 5C0AB 3NA9L 4PB0L 1ZHNB 3TO4A 4JFED 2DLFL 3RDTB 4QOKD 1NCBH 1V3LA 1G7HA 3V4VH 2R0KL 4XMPH 1IC7L 4GKOA 3ULVF 4M7JH 3WLWD 4ZAKB 2I9TB 3V4UL 3SPVA 3TT3H 4HS6A 4JHBA 2Z31C 4PY8I 2Z92A 4HC1L 5D7IF 5I73C 4ONGH 1YQVL 3TYGL 3IKCB 4PTTB 3JWNC 1Z0NA 4KK5D 4ENED 3CX2A 1A7RH 5A2LH 4QT5A 1FZOA 4U1NB 2QTEA 5FGCE 3LDBB 3SN6N 3FRPA 2VZTA 5JHDB 3EYOA 4OCLC 4P46A 1T2JA 1XMWA 4GRLD 3BEWA 3KYOB 4P2OA 1BAFL 2EDFA 4OCXH 1AO7A 3HCVB 3KAAA 4FQ2H 4G9FE 3QULA 1MQKH 1K3IA 3QFDB 3L6FA 4CN4A 3WLBA 2KPNA 1W0WA 5D7JA 3S36H 4GKZB 2VDRH 4AYFA 1BECA 1TJGH 1G9MC 1RZ8A 5ENWA 1R3JA 4HWBH 4OLUL 1Z5LB 1F42A 1JPGA 4G8GB 3RX8A 2G5RA 4XNXH 2A2QT 1QACA 2H9GB 1Y6KR 4Z0XA 4YX2L 5DJ0A 5J13C 3A6OA 2FHCA 2R0WL 1Q94A 1LEGA 5TQ0L 2GKIA 5ACLA 4LCYA 3TPKA 2NY2D 1XGTA 5JXEC 2H2PD 3PGFL 3GSVA 5EOQL 2WUCL 5F7WC 1RJLA 3UTOA 2AEWA 3RPIB 5M94B 1LEKB 5ITBH 4ISVB 4LCCC 5AUMA 3GNMH 3FZUC 3QJFA 1A1MA 1KFAH 3KXFD 5DS8A 2ADIB 5D7LB 2H3NA 1DE4B 5JW5B 2NNAB 5EULV 5JUEL 2V7NA 1O7SA 3MLUL 2IH1A 4LLYB 5F88B 2VDOH 4QXGL 4TNWF 3IXAA 3IB4A 3RWIA 1HSBB 5D6DC 2X1QA 5T3ZE 1DLFH 4M8VA 1DQLH 4HDIB 4LSQH 2XG4A 2DKMA 4LRNH 2X7LA 2L7UA 4W81A 3BKJH 3GSNH 2P5WA 4OBRA 4R7DB 2BFVH 4FXGA 4TTGA 1JZ7A 1A7OH 3BGMB 3UJTH 1U92B 5DF0A 1TTUA 2BVQB 4KDTA 4Z7VE 3NCJH 1FV1B 5FB8A 2EYSA 1CU4L 1XCQA 1F3JB 5D1XB 5TE7L 2W92A 2HA1A 1AH1A 2XQYK 4NYLA 4XBPB 4U1HB 4DCQB 3S88L 2PO6D 3KPQB 3PWLB 1HILB 2ICEB 5D2NA 1N5YH 2AXFA 3VW3H 3VD9A 1LO5B 4NQCD 1VADB 3BKCH 2ESVA 1WZKA 2NY4B 3BEVA 4LSUH 5BZWB 1VKXB 4X6FB 2GJ6D 4X4XA 4HWZB 2DYPA 2VKXA 3Q1SL 5DD1L 4KV5F 3JV6B 4PJXE 5CINL 5FF6A 4KVCH 4Q74A 5IMKA 1RIHL 2AJSH 3QQNA 1FVEB 4KJYA 1AR1C 1CD0A 1EO8L 4GRWH 1L9NA 2X1XR 1JPFA 4DZBB 5I1CH 3OAYH 3PWNB 3O2VH 1K2DB 4Y1AA 2VUYA 4M6ML 3PWJB 4AZ8A 1CQYA 5IB2A 1MHHB 3MJ9L 3EOBB 1UM5L 3D6GA 3K2UL 4OV5A 2BK8A 3AB0B 1QA9A 2A6DB 4JDZB 4NT6A 5BOPA 4QRRA 5CJXA 4PJCB 1OLLA 3HFML 2XNAA 4XP9L 5HJ3B 3V6BR 1YQVH 2F54B 3AY4A 5SWZB 4XVUC 3TYGH 5HGHA 1K8IB 43CAB 1YQ2A 5E9DE 4Y16B 5AZEH 3D1MC 1IJ9A 4LLUB 2R69L 2XPGA 4PRID 4YDLB 1FGVL 5D9SB 1KN4L 5F6IB 4CVZB 1MFEH 1ZLVH 5BCAA 4HUWB 5A2KH 3N0PB 2FB4H 2N7AA 1X9QA 2JJSC 4MCYB 3BYTA 1BAFH 1XF3A 4UNTA 1XF4B 3HUJF 4LCWE 3TPUA 4D9RD 3BD5A 1AFVL 3RZCC 1LO4H 5IEKA 5T3XE 3MR9A 1CTNA 1L7IL 4QO1A 3SE9L 2NW3A 4PJBE 3CX5J 3MV9E 1JYNA 4OLUH 4LVNC 4AL8L 4HWNA 2HT2D 4JY4A 2VR9A 4QF1B 3BZ4B 3HG1E 4UBDC 4YX2H 4PJGE 1JPST 5FA4B 3MV7B 4BKLB 2RB8A 4P3WA 4JRXA 4MNHA 4ZO8A 3F7YA 5CWSB 2FNBA 1M05B 5GGTH 2W0LA 2BVTA 2CR3A 4FTVB 4QHUA 1X7QA 3OKNB 1RZJL 1S7VA 3PL6A 1MFBL 4WTWA 5T3ZL 2J2ZA 4LLWA 3C9NA 2VLMD 4HKJA 4IOFD 4K94C 1NAMB 1P7QB 4R9HA 2CRYA 3UO1H 2V17L 5TH2A 2I60H 3UTPE 2UV3A 1JZ2A 4WWKB 3JV5A 2A38A 3MLUH 3TN0B 3FQXA 1AIFA 2X2YA 2Y4SA 3IXTA 4DWHA 1F4YL 1KB5H 1J8HA 1UADC 4ZS7L 1NANH 3IJSA 4I4WA 4XP4L 1QFPA 2X1PA 2D7TL 4YDVA 4OFDA 5BW7C 3ZT6A 5IBUG 3BO8B 4LPVA 3MRKA 2OTUA 3U0PA 5FGRA 4TSBL 1KB5A 3RY5A 1FCGA 1JRHL 2BC4B 4M3JA 1SHMA 1KIPB 5FM5O 2DLEA 5F71A 4UDUB 4JANB 1QR4A 5IHZB 3GI8H 1T20A 2IADB 1DVFA 4R3SB 3K74B 4POUB 2YUVA 4WHCA 3AC0A 5JPNB 3ECBA 3CFJA 5AEAA 3VXRE 4YWGL 4DVRH 2QHLA 4I2XB 3T3PE 1A6UL 4P49A 3OJ2C 3BZFA 2MHAA 3V5HA 2XN9A 3T77A 4XRCB 4U7KA 2DWDA 4OSUH 2ZCLL 4OT1L 4RDQF 5DUBA 5IVXE 1E6OL 1Y6MR 2IH3A 1JHKH 2IMMA 4IHOA 4ELME 3WKMH 1JCKA 3THML 2VR4A 1T22B 5DD1H 3RWFA 4Z7WF 5BVPL 5CINH 5E6YA 4H1LB 2E9IA 4Z5RB 3HPJA 3RWDB 3TZVD 3MFGB 1CICB 3ARUA 2LU3A 2A0LC 2OL3B 3MGTA 1F90L 3FB7A 4JREC 1BVKB 1YY8B 3PP3H 1TXKA 3CVIH 1IAKB 4XX1G 5TF0A 5IW1A 1TCMA 5INDA 2OP4L 12E8L 4NO0A 2HMID 3EJZC 4M1DL 1LE9B 3WSQH 3TH4T 3PWPD 4HZLA 3B2UD 1Y6NR 3ARBC 2VMFA 4Y4FC 4ZTOL 3RTQA 2Y07H 3HFMH 2HT3D 2GIYA 1YEDA 3I6LD 4Q2ZB 4HKZB 4X4ZA 3W39A 2ID5A 1UACL 5T3XL 5TE4L 1IL1A 2R69H 4PJ7B 1U8PB 5DTFB 2ZJSL 3VXSE 4MA8H 3BISA 2JK5B 1JWMB 1YMME 1V3MA 4M48L 3LEVH 4DVBB 5CD5C 1QSEE 2OZ4A 1XGUA 1KPRB 5D1ZC 5E2TL 4OFPA 2JJWA 3WFDL 4YDIL 2B5IB 1E4KC 4RX4A 1EEUA 2GTWB 3NAAH 4JGJA 4GT7A 1D5BB 1FIGL 5JA9A 5IK3B 3QWRA 4X80L 5C08A 4ZQKB 1L7IH 3U0WL 3UTSE 4PB9L 2NY7H 4YBLC 4O5LL 4XCCL 3RHWK 2CKBL 4LPUA 1HQRA 4I3RL 3T1FA 3OHXA 4L3EE 4Y4HC 4GKSB 1RZIB 1UA6L 5HDBF 3C60A 4H8WC 3FOLB 4PD4K 3H9SE 3QUZD 3D69B 1PKQB 1UJ3B 3FFCB 3Q5TA 5FCUH 3GUTB 5DFTA 5KOVC 5C0JA 2DS4A 5DQJB 5HVFB 1ZLSL 3T4AB 4HIJB 1EX0A 3LHPH 4DQOH 2JE8A 4NJAL 5B3JE 3OB0K 1SJHB 1N6QL 1MPAL 3U9UB 4PUBL 4PRPB 1XIWB 2HJFA 1NFIB 5I71C 1TITA 5ESVA 4HXBH 3WFEL 4R97B 5C0CE 4BZYA 1MFBH 1AE6H 5F1IA 4ZD3L 2CDEB 3SDYH 3LMJL 5DMYA 4JQIL 4GKNA 1QOKA 2AP2A 5I18H 1MCCA 3BP5B 2V17H 3O9WD 1P7KA 3VXPB 4RNRA 1ITBB 1FC1A 2R0LL 1RAMA 1KC5L 3G6AA 4WUKL 2OSLA 3GK8L 1Q8MA 2DIAA 2FECI 4N1HB 4P48A 1MJ8L 2PW1B 3ELAT 2I26N 5EOTA 1CFNB 4ZS7H 1TQBC 4ZUTA 1VGEL 4UB0L 3MBXH 1CBVL 2D7TH 4NQXA 4Y4KB 3IT8D 4A6YB 1ACZA 4HSQA 2B1AL 3FQTA 5GGVY 3IDIB 4ODVH 4LVHB 5DQ9A 4ZO7A 1JGEA 3CSBA 4JKPL 1PGRB 3VFNA 2VISA 4LCUA 5F9OH 5B39A 1X4XA 3KPMA 1MH5A 3H3KA 2CUIA 3ARGA 4YWGH 3QDJD 2Y1VA 4N8VA 3FN9A 4OZHA 2R4SL 3ZO0A 1A6UH 3D2UA 1WWWX 5BO1L 2AJZB 4C55A 5C07B 2MQCA 1JE6A 1BGXL 4XPGL 2BRRH 2ZCLH 1YYLH 4OT1H 5BRZE 3ULUE 1E6OH 4GXUN 5HHXH 2CXKA 4GAYB 1S7TB 5ERWB 2QKIA 4JFDB 1A14L 1R3IL 4P9HH 1MJ7H 4PTUA 1PKOA 1RHFA 3FB8B 3VH8G 2VLKE 4NHUB 4D2NA 2OMNA 3D0VB 4JM2D 4MDIA 3ARTA 5B8CB 4Z8FL 4IS6B 5DJ6A 1F90H 1V7NL 3CC5A 4H25A 4U1LB 2H2SC 4NZUL 2NYYC 4O2EB 1P4LA 4FQXD 1KG0B 1IC5L 3H9HA 12E8H 4FXKA 4M1DH 2EH8L 3EO1A 4GW1B 2H32H 3DXAB 5GS1C 1N0LA 1OPGH 5KVFH 3BIKB 3O8XB 5SWSD 1AXSB 3S3SA 2Q76B 5IMMB 1AHWB 3BMWA 5T3XH 5C6PB 4HT1L 4XNYH 4E9LA 1D9KD 4CVXA 2H32A 5MP6H 4M6OH 4M8QB 5IHLB 1HI6B 4KDWA 5JLZA 4K8RL 3EYUL 1U3HB 1P53A 5E2TH 3WFDH 4HPYL 2X4RA 1NUGA 3ME0A 5DMKA 1CD9B 2EH7L 3CXDL 3W81A 3HE6C 2B4CL 3ISWA 1FIGH 4X80H 1T66D 1CE6B 1P4IH 2G75A 2ZPKL 5IB3A 4PB9H 3BOVA 4K23L 4O5LH 4XCCH 5K59E 4JHAH 2CKBH 3B6SA 4J6RL 4Y88A 1KJ2A 4ONHB 3SDXF 5F3HA 2A73A 1UA6H 1RUQL 3PIQA 4OM1L 2FRGP 3EYVB 4J3SA 3MMEA 2EXWC 4U4BA 5TDNB 2Z35B 4UILL 5GGUA 1IILE 2CDFA 2XZQL 1V7MH 4XCEB 2LU7A 4XP6L 5BS0E 1B0GB 4X7FC 3U4BL 1U91A 4UQ3A 1ZLSH 2WAHA 3N1QC 3QQ4A 3EHBC 4NJAH 2PETA 1JUFA 1N6QH 1UXSB 3BD4A 1J05A 1ZVSB 3H6JA 3WFEH 3MRHA 4PGJA 1BZQK 5EIVA 3VXQA 4Z76A 3O0RH 3BPNC 5EU4A 4MJID 4PRBB 3O81A 3KPNA 3U36A 3L5WB 3O4OC 4GBXA 4HCRL 3V6FB 4X6BB 1DN2A 3RWEA 4QXTB 3W0WA 4TPRL 3TO4D 1KACB 2BVOB 3V6OA 2C26A 5MENB 4B5EA 4LKXA 3LKRA 5C09A 2PTTA 1J10A 4D3CL 4KZEH 4PJHF 2VITA 5FKAB 1RJYA 3O4LA 5DVMA 1MJ8H 2X4PB 4OIAA 1NLBL 4QRPE 1T7XA 5FXCH 3CCHA 3LCYA 1VGEH 4EI5C 4O9HL 1CBVH 4UINL 4MNQD 5MI0C 3X17A 1I1AB 2DF3A 5E6IC 4WUUA 5ECJE 4OIIH 1ZLWH 2NXZB 1IQDB 3ULUL 1OY3B 4L8CB 9CGTA 2EDLA 1FJ1A 3KPSD 5CHNB 5DUML 2CLZB 2VAJA 1A6AA 3DX7B 2ATKA 3MODL 3HRPA 3S5LB 4YGVB 1AO7D 3TO2A 1IM9A 4YPGA 4QRTA 3U1SH 5E6ZA 4F2MA 1CDBA 4E41E 3NGBB 4DFHA 4PJDE 4Y19D 5IVOA 3CH8A 3T0EB 1SJEB 2GUOA 3LRGA 2EDKA 3DO7A 3AREA 3QUXC 1MIML 2QQLL 3HAEG 1A14H 1R3IH 4KI5D 4BH8A 5F7YC 2OQJA 3JBG7 1BFOA 4JFPA 2NW2B 1FVDA 4F7PB 5KSVA 1C5BL 4N9OB 4QHKJ 5LGJB 5CEXB 4DJMA 2YPKB 2XKNA 3NZ8A 5BV7C 3HE7C 3QP3A 3PWVA 2YMXL 1D5ZA 4NZUH 2LVCA 4UT7H 1IC5H 1KOAA 4Z0BH 3C87A 5D7IA 5C9JA 3MSPA 2EH8H 3QUMB 5KSAB 5KVEL 4WVRA 1G84A 2NQCA 2MJWA 5HYSG 2Z0BA 1S7SA 1YPZA 5I1DA 2X6MA 5I1LA 2WLYA 1HH9B 1RURL 4X0KA 5BQ7A 4Y2DB 5K9KB 3UTQA 3T4YA 2DM2A 4HT1H 1VFMA 2CH8A 4NNYB 3TEUA 4EJ1C 3BZEA 1XGYL 5E2UH 3CLFL 5GJSL 5E08L 4K8RH 3EYUH 1AD0A 2BNQA 3OXRB 3WIFB 1JNHB 3KGRA 3QEQA 3DRQB 4XVTL 3NH7L 1HQ4B 3G5VB 4P5MA 2VZOA 1CZ8H 4QCIA 3QAZB 4PREA 1JNLL 1G9MH 1FLTX 3HNSL 4MXWH 4RRPA 5DXWA 5C0IB 4K23H 1GIGH 3FHAA 3PQYD 4G6FD 1EEZA 2J4WL 1RUQH 5H94A 5L2KA 3BDYL 1JZ8A 3M07A 4WJ5A 5JOEA 4UILH 2EE3A 1QSVA 2I5YH 3LD8C 5I76B 2YEZB 3S36X 3U4BH 2BDNH 4KJPC 4L1HA 1C16B 4Z7UE 4DK6A 4UV4L 3F6IA 2HVKA 3EOAB 1I8IA 4NC2B 5B38G 1OF2A 5GGSB 4X8JA 3TNMB 2WQ8A 5JXEA 3GIVA 1F3DH 1Z9OA 3UBXG 4J23A 2Y5TB 3SDAB 3V52H 3OL2A 3QCVH 2IPUG 2Z93B 4C56E 4F7CA 5TGBA 4OI8A 3SDCB 32C2A 4PRIE 4Z7VF 3HZVA 4HCRH 4PGBA 2HTLC 2R2CA 1E6JH 4ODUB 1J5OL 3RGVC 3T04D 1FGNL 1FHGA 3BHBB 4JJ5A 4PGEA 4TVPH 5F8RC 2JJTC 3MCKB 1G7HB 3MBEC 5B22A 3MLVL 3JXAA 2OJEA 2PXYD 4L5FH 4ORZC 4LHUA 3SKJL 5J6HA 1NLBH 4JQXC 3QPQC 5D6DA 2NXYD 5L8JB 5KBNC 3VXUA 4UINH 1X5GA 2FEEI 2IQAA 3SPVB 4HS6B 2Z92B 3L5XL 5E5RB 3VDAA 1EFXD 5K33A 1J1XH 1H15A 1G1CA 4ODBD 3QUKA 1OAKL 2MKLC 4DN3L 1V3JA 3UDWA 1OGAD 4KRNA 3ZSTA 4PJIA 5D2LE 3TLRA 4QT5B 4FFZL 1FZOB 5J4MA 1MCPH 4JGMA 4EVNB 4WEUD 1I75A 3EYOB 4P46B 2D0FA 1O0VA 3BEWB 4YBQD 4P2OB 1MCHA 5D5ME 3ZHDA 1JHLH 1EVUA 2B20A 2ICWJ 2BNRA 2BCKA 4XVJH 1R5WA 3G6JB 3QULB 5J1SC 4AEFA 3L6FB 4GSDH 4CU6A 3WLBB 2V7HA 1W0WB 1FRGH 5D7JB 4OZFG 1KTLA 2WBJC 1OGTA 3P9WB 4X6DB 4JR9L 1MIMH 5DMJB 3VWJA 1RZ8B 5ENWB 1R3JB 3EJYC 2PTVA 4L4VB 1JPGB 5ISZA 4XZUA 3ZE1E 1E0OB 1Z6JT 2EDYA 2F53D 5JW4Q 1PVHA 2YN5A 4YHLH 5JHLL 4Z0XB 1BZ9A 3RI5K 1YEFL 1FAIH 3D18B 3C8DA 5AYQA 4W4OC 3SGEH 1Q94B 1LEGB 4CVWA 3QI9D 4DUXA 1EVTC 1T04A 1L6ZA 4IDJH 5F96L 4LCYB 2FBOJ 1H3XA 2IPTH 2YPLA 4LOUC 2IPKA 1XGTB 4NFDA 4PD4J 1YNKL 5T1MA 3GSVB 3GB7A 1RJLB 2AEPH 4CDGC 1WZMA 3L7EB 1LE5B 5AUMB 1UGNA 2XWBB 4U1KA 3QJFB 4PJBF 2G2RA 1CFSA 1A1MB 4P99A 3VFVA 5DS8B 5CJBA 4YDJA 4EOWL 1HH6A 2H3NB 3SCMD 1RURH 1T0MA 4MJ4A 3GRWH 2V7NB 1Q0XH 1XGRA 4BYHA 1QBLL 2E9JA 2IH1B 4PJGF 1NDMA 3K80A 5FDYA 3BH8A 1QFOA 3CLFH 3HUJA 2J8HA 5E08H 3M8OH 3C8HA 3IXAB 3RWIB 3DHMA 4HEPG 1Q38A 2E7CA 4WFFE 4PJ5E 3ZKSD 4OLYL 3GRWA 5I1EL 3NH7H 1A6PA 5GRXG 4PJ8C 2X7LB 3VGAB 2Q8BL 5L8LB 4MVBC 3PP4H 2P5WB 3HNSH 4H8WL 3F62A 4FXGB 3TGXA 3U6RA 1T89C 3G5XA 5CKGA 2A77L 2K9UA 4ZXBD 1ZGLM 2J4WH 1KPUA 5K9JL 5FB8B 2YD2A 5I2IA 5F7UA 2EYSB 3AAZA 4KROC 4U7MA 1XCQB 3BDYH 3WEXA 1RJCA 3KPRE 4HFUL 3GSNB 1CXLA 5C0BE 1A5FH 3SKOA 5LWYH 3WFCH 1T3FA 4HZAA 5IVZA 4NYLB 4O58L 2A1WL 1FE8H 2XN9D 5D2NB 2AXFB 1AXTH 1SYVA 4K94H 3I6LE 4RFEA 2ESVB 3BEVB 4WI9A 4N9GA 3V4PL 1CVSC 1FORH 2AGJL 3UTZA 3HB3C 4X4XB 3RVUC 2DYPB 1G1YA 4AMKL 5I30L 1DBAH 4NO2A 2R1XA 5FF6B 3MLRH 4NWUH 1OM3L 1LK3L 3MC0A 5GGSY 5IMKB 1FGNH 1Q9LA 4KJYB 4I1NB 5E95B 1JPFB 3MLVH 3W11C 4Y1AB 4DN4L 4NO0D 3T3PF 3C8KA 3HC0A 4JPWL 3SKJH 1ZT1B 3QIUB 1DQML 1QA9B 1HOCA 2B2XL 4NT6B 4QRRB 4GRWB 3LN4B 5IVXF 5CFHA 4HQQL 3RBSA 5I1JH 1BQLH 2XNAB 1U8MA 4UTBL 4ELMF 5K9QG 4L9DA 5CBAA 4BQCA 4NWTL 5BW7A 5HGHB 4OLXL 4KK9C 1NBZA 2HTKC 4YHNA 1NGQH 3MLYH 4KHTH 4DN3H 2VUOA 2XPGB 3CFCH 1NANI 2XTJB 4JZJC 3MV8A 1CD1A 3C6LD 2D9QB 3T8XA 3GHBH 4HG4K 1I9IL 3X13A 5I75C 3SQBA 3TBSA 2AXHA 1XF3B 2C3VB 2AJUL 2W65A 4U1JA 3TPUB 2QQNL 5IBLC 4YLQT 1EAJA 1I1FB 3MR9B 4Z7WA 5SWZD 3SGKC 4JFYB 2ZNXA 3A6CL 1I7ZB 2AJXL 2NW3B 3BP4B 5TF1H 1MCQA 5F7LB 15C8H 1I3RA 5KVDL 3F7PC 4JY4B 1UM4H 4KKAD 4LLDA 3HNTL 1YEFH 4JRXB 4MNHB 1J7VR 3F7YB 3IFOA 2DQJH 4WU7A 1GPOH 4UUJA 3U0TA 4FQHA 4QHUB 1X7QB 4FQPA 1S7VB 3PL6B 2W0FA 4ODSH 2X4TA 4LLWB 2R1WA 2RBLA 4Q9RH 3C9NB 4U3HA 1T7YA 3MLTB 4PV9A 4YFEA 3ARBA 4EOWH 2CJUL 4Y4FA 3L5JA 4OD3H 3WFBH 3K8MA 1KIUA 4F57L 5IT2H 5TH2B 3E2HC 4RA3A 4HJ0D 1QBLH 3C2SA 4RGOL 1MREL 3FQXB 5CLTA 1AIFB 3F12A 2E8ZA 4F9LC 1MI5B 1PSKL 5B3JF 1LWRA 4PY7A 1J8HB 1MCSA 2DLHA 3IJSB 5D1ZA 5DMGD 4I4WB 1DLHA 1E4KA 4TSCH 3EZ8A 1HYSD 1S7XA 2Q8BH 4YDVB 5E94A 3MFFB 3MRMA 1KENH 3MRKB 5D7KD 5T33H 4H8WH 1MHEA 2OTUB 3U0PB 1KB5B 1OAUH 1JYXA 4S2SA 1EZVY 1TFHA 2B39A 2YA1A 5F1SA 4Y4HA 1WIUA 4LKCB 4HFUH 1T20B 2FATL 1DVFB 2VXSL 3C5ZB 5EC1B 1BD2A 2N4IA 1F97A 1XR8A 3ECBB 1ZWIA 4P2CG 5DRNA 2BRQA 2W91A 2A1WH 3O6KL 1UKTA 4KQ4H 4XP1L 1XGQA 2WWKT 3NFNA 2J1KA 3NIGE 3AU1B 2MHAB 3V5HB 3T77B 4I18C 3BW9A 3DROB 4QWWD 2PF6A 1HZHH 3DYOA 3KR3L 2C1PA 3ARFD 5DUBB 4JN1L 3DV6A 1KJVA 1G7IA 2IH3B 3MA9H 2IQ9H 3U7AA 4M3KB 3QB7C 1CE1L 4KRPB 2EDOA 1R3HA 5F44A 4G8FA 3V5DA 1WEJH 1BF2A 1SM3H 4BSVA 5FFLA 1LK3H 2CMRL 3HPJB 4M7KH 2SEBA 4G6JH 2OXGA 2VLJB 4UTAL 3MO1A 3WHE0 2NY3B 3FB7B 2DQIH 2HKFH 1MHCA 4KJQD 4F15B 4XAWL 4JPWH 2BOCA 3EO0B 5INDB 2WW8A 3LY6A 3W5MA 4EIZC 2NY1B 4X6CA 2H41A 3ULUF 2E7LC 3RTQB 4AQOA 4NDMA 2JF1A 4HQQH 4AIOA 1YEDB 2XV6B 5DHVA 5A2IH 3LQAC 5LQBL 4NWTH 3W39B 1DUZB 4HW6A 2I24N 3IKKA 1IL1B 3NFSL 4HV8A 3NABH 1LO2L 1N2RA 1DP0A 1OTTD 1OHQA 4LIQL 4G8EA 1MF2H 1E4JA 3SJVA 2WWKO 1XGUB 4H0GA 3BKMH 1L7TL 2AJUH 4BQ8A 1F6AB 4S0SD 3UAJC 1QSFD 3MJ8A 4JFFA 4X7SH 5C08B 4OZIB 3REVA 3I75A 1A6VL 3A6CH 3BE1L 4M7ZB 3OHXB 4DGIL 1FNAA 3N1GC 3QFJD 1W72A 2XFXA 5DR5L 2GITA 4M6NH 5GRUL 1DDHA 3C60B 2XZCH 3RNQB 5I19H 4NHCH 4RMSA 4NN6B 4KMQA 1R3LA 5E2JA 3KWWA 5BVJA 5C0JB 2VLRE 4LCIH 5DJ8A 3HKFA 2YD6A 2HJFB 2ZUXA 4KQ3L 1KBGL 4FQQA 5LCVL 4PRAA 4EQ2A 1BF8A 2WP3T 2GJJA 1NFDE 1N26A 5F1IB 1OTUD 1E4XH 3HAEA 1F00I 1UEMA 2J8UE 4JLRA 3W0WD 5GS1A 2CJUH 1UVQA 4GKNB 5IOPA 3V6ZA 5K9QI 4M02A 4F57H 1Q9OB 4LLVB 3QWOA 3TESA 1P7KB 5HHOE 1NCNA 3D3VE 4RNRB 4RGOH 4TNWK 5ABDE 2HJKA 3G6AB 5DD3H 1KTDA 2OSLB 4G6KH <