2OLDA

Bence jones kwr protein- immunoglobulin light chain dimer, p3(2)21 crystal form
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
217
structure length
217
Chain Sequence
ESALPQPASVSGSPGQSITISCTGTSSDVGGYDLVSWYQHHPGGAPKLIIYEVTNRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYASGSTPRIFGGGTRLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bence Jones KWR Protein - Immunoglobulin Light Chain
publication title Bence Jones KWR protein structures determined by X-ray crystallography.
pubmed doi rcsb
molecule tags Immune system
total genus 45
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oldA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oldA02
4X6EB 1SJVA 3IRPX 3IF1B 3HUJE 4NO2B 1F97A 2B0SH 3HI1B 4Y5VA 1PX3A 3RGVB 2VWEE 3AS2A 4GRMB 5J89A 1WWCA 2FGZA 4TOYH 1DBJL 4MA1B 4QO1A 4XNXH 4P5TA 1JZ3A 1A1MA 1II4E 2AK4B 4XPBH 3RU8L 1U95A 2V9TA 2IG2L 3VFTB 4K2UL 2L7JA 1IM9B 5AG8A 5TFSL 3DROA 3EYOB 4PJDB 5T1LD 3RY4A 3IJYA 3TT1L 3P4NA 5EUOA 4XP1L 3OGCA 1ZK9A 4K7PX 3T2QA 1E4KA 1F2XK 4NBZB 1J5OL 5KVGH 3MLSL 3QUKB 5CMAA 3FT3B 4FQXA 1WBZA 3EJYD 2VNCA 4RFNC 1N6QL 4M48H 1QPXA 3O81A 3RA7H 4H1LG 3ARFA 4O58L 4XMLH 3IFNL 4U6XA 4PGBA 2VLJA 3RUGA 4W81A 3R1GH 3ARVA 1U8NA 2VDMH 1XR9B 4RGND 4F3FA 4NQDB 2ESVD 5SWSB 4IIQB 4Z5RA 2HJFA 1RVFH 1NCCH 5DURD 4N5EC 5D71H 1MFCH 2VE6B 3TBTA 2FJHB 5DXWA 3I02B 1T66D 3DARA 4P46D 4DFIA 4BFEA 1V3KA 4PD4J 2J1KA 2VISB 2IF7A 4OZGB 2ZSVB 1T3FB 1ZANL 4OZIE 3HNTH 1J88A 1HHKB 1QFOA 1UWEL 4ZUUA 4YHKL 5D7SL 3RI5F 4WEBH 4G8GD 2UZIL 4G7VL 3RIFF 1A14L 2BFVL 2YPLB 5IMLB 5GS0H 5TE7H 5C0CD 2H2SC 4HAFA 3IXAB 4GBXC 2IGFH 3QPXL 5DK3A 4MDIB 3RVTC 2RR3A 4XXDA 1UGNA 5KW9H 4Z7OF 5IVZA 3VI4F 4Y5XC 5DVOA 1U3HA 4BQBA 1FL6A 4I5BA 4YQXL 4QGTA 3B6SA 3Q5TA 3X11A 4UT9H 3TEUA 3PGDA 1FCGA 5CP7B 4Z7VB 5CJQH 3TT3H 4I3SH 4ZO7A 2ICWA 4PRHA 1NCNA 4FQ2H 1GGBH 4E41B 4ACPA 2EC9U 2XZAH 3GJFH 3ES6A 1RK1B 1AXSA 5FYJL 3QDHA 4PJ8B 3TWCL 4BUGA 4LLVB 3WLWD 3AY4A 4U3XA 2OYPA 5H94B 3H3KA 3X14B 4S1QH 2VN7A 1CE6B 4LNVA 1S7SB 3QIUB 1QRNA 5M7QA 5MEQA 1CFQB 2BRQA 4UIMB 2F5BL 2A83B 3I6LD 5DSCA 1CU4L 5LGJA 2F74B 1R5WB 1NCBH 35C8L 1MNUH 2DQHL 3JVGA 5C07D 4GW5A 5I76B 1R3IH 4ZG1A 5EU6D 4R9HA 5A43C 1FNFA 2V9RA 4WVRA 4XWOD 4OD2B 1H5BA 3B9KC 5GGQL 3ZMRA 4E42B 1T89C 3T0EC 3WSQH 5A2JH 4PP2A 4X7SH 4ZDHB 3VJ6B 3PHSA 3P0YH 5L2KB 2X70A 3RVXD 2KKQA 3QFDB 1DVFC 5E08L 1PKQB 4Y5YA 3RBSA 5ICYB 3FMGL 1TZGL 4ISVB 4W6WB 4NHUB 3SO3B 4NZJA 4QEGA 2VDQH 5JO5B 2P5WD 2CDGB 1FZJA 3QUZC 3ZLQC 3AREA 4PJHE 3K8MA 5AWNH 1HQRA 4WHDA 5FUZH 3JWOH 1QSFA 4OZFH 5GRXG 4Y88A 3MOAL 3ZE0E 4AM0A 1G7JA 4CU8A 4PJ9C 3KLDA 4L4VE 3SHSA 1T7YA 4NFBA 3O3AA 3UBXI 3ZKSD 2OQJA 5JDJA 3BYYA 1PQZB 5L8LB 4K7FB 4TUOB 3RX8A 2DQGL 5J12C 2LAAA 5HD8D 3H0TA 3MODH 4LOUD 1K4DB 1UH4A 5I1HH 5DZOA 3E6FA 3IRZA 5HGAB 2AEQL 4WTZG 1K3IA 4JO4L 1CICA 3U9UB 3QXAB 2OI9C 4ZAKC 4D94A 4DAGH 4O02L 4FXKA 4UQ2B 4G9DB 4H8WL 4X8XA 4FQIL 4MA3A 3AVEA 3QO1B 1AQKL 3R06B 1B2WH 5T1MA 1KPUB 3TBYA 5GRYA 3QUXB 5J3HD 2W65B 1F3RB 4S1DC 4NRYA 2EYSA 1IGTA 4M7JH 3RY6C 3UDWC 5JHLH 5F71A 1AHWA 4QXTA 5A16B 3MGOA 3MRCB 1W72B 3D3VE 2O5ZL 4N0RA 2WP3O 4P57A 4KTEH 2BNRA 1W0VA 1BVLA 2K7PA 1EVTC 4HWBA 4A6YB 4WCYL 4RX4D 4YEFA 1MVUA 1J1OL 1IMHC 3OKKB 4FQJH 2BRRH 2BXYA 2O5YL 4GAGL 3AMLA 2YN3A 5HYEA 2XA8L 1ZT1B 3DVIA 5IR1A 1K8IA 1RJYA 4KY1H 4OSUL 1U8PA 5IBLC 1FO0H 5HYQA 2VL5B 2X4RB 1N5AA 1GHFL 4NP4L 4MQXC 1NC2B 1PG7X 4N90D 2Q86B 2B7DT 3TZVB 2VDLL 3BD5A 3TESA 5D2NC 2OCFD 4CVWA 3ZDXE 3IYLW 4R2GD 1DDHA 1UJTA 2BJMH 1FGVL 3FQRB 2ZCHH 1KBGL 5SWZB 2V5RA 1DLFL 1VB9A 5J11C 3F7RA 4XWGL 3VDBA 1FVCB 3NTCH 4MAYA 1SY6H 4NOBA 3NABH 2LU7A 2CIKB 1HEZA 5D1QB 1GIGH 2PR4L 2IH1B 3MNWA 2EYTA 4P5MA 4WW1B 2MPAH 2E9JA 1S9XB 5JOPD 4HG4J 1S5IL 1L7TL 3FT4A 3IU4L 3TPUA 1BLNA 3BPOC 1T04B 3MJ9H 2LV4A 4Y8AA 1K3ZA 1M1SA 2AJSH 3RJDA 4NC1C 4EBQH 4JY5H 4AIZA 3NVQA 3QIBC 2Y7QA 3QFJD 4QRTA 1WISA 3PGCB 3T04D 3V4PH 4X6CE 3TO4B 2ZOLB 2OTWA 3VXOA 2FX7L 2JJVA 2R0LH 1MCBA 3BAEH 2OP4H 3MLUH 4IRSA 2BOBB 4YXKH 4TSBH 5KN5A 4OCRH 4YNYA 3T4YA 1JF6A 3V79C 1F90L 3EOAA 3RWDB 3SDCB 1CFTA 3EDJA 3VXUE 5F7UA 5I19L 3MLWH 5JPMB 4IHOB 1Q9WB 2VXVH 1NFDE 3V6ZB 4PLOB 1WC7A 4LU5L 4ZUVB 3S3PA 1BOYA 1MH5B 3CFBA 2FCBA 3J7HA 4X9BA 2JJSA 2R4RH 3QQ4B 2A74A 4IM8A 1I7RA 2BSRB 5F9JB 2Z91A 4F37K 3TYGH 3SDXE 4MJ6B 1OTTD 1Z3GL 4L3AA 3V5KB 3QUMB 1RJZA 3ILPB 2ITDA 4XHQA 5IQ7L 3G9AB 3GBLA 4UINH 5H35A 3MUJA 2APVA 1DANU 4K23L 4QRQB 4LAQL 3AAZA 4H8WC 1T0NA 3MRBA 1BJ1J 4PREA 5ID0A 1NBVH 3OHXB 2VLME 4X5XB 1HILB 1S7TA 4HJ0D 5BW7A 5I1GL 3ZYJA 1RULH 3P0VH 2GQHA 4GXUM 3PQYE 1DQJA 2GJJA 2YC1B 3S7GA 2VXSL 4R8WL 3ECBB 3Q6FA 3WFBH 2J12B 1RIVL 3QNXB 5F7HA 4CMHB 4KKAD 5D7IA 1QSEB 3IS1X 4PJXB 4XPHL 4QHNB 15C8H 3O2DA 2DMCA 3OKNA 5T1KA 1C1EH 2X1OA 2DKMA 2J8HA 3Q6GL 2ICEA 3VW3L 2GFBB 4DUWA 2VLKB 2OR7A 3CLFL 4LCWE 4FTVA 5F96L 1E28A 2DBJA 5JDSA 5T33L 1FE8L 2J8UA 4XNYH 3S36X 4XNZC 1P5UA 4HV8B 4LPXA 3FFDA 1T1WA 1NMCC 1E6OH 3GI9H 4NO3A 4YHIB 4XCYA 1JUFA 3HE7D 1YPZE 4ETQB 1ZA3B 2IBGA 4JRYD 1OF2B 4EUPA 3BZEA 4Y4FA 4GG6F 4V1DE 4LKXB 3WKNA 1ITCA 3O6KL 5IB5A 1KULA 1AGDA 3D0VB 4D0DA 3PHOA 3MLXH 3NPSC 4N9GB 3P2TA 1H0DB 5I71B 3BKCL 3C8KB 1K5NA 4NQCD 1IAKA 2VLRB 1QEWA 3DRQA 4KGLA 4I18A 3MV8E 2YD2A 4TVPD 4OB5H 2LU3A 4DEPB 1GC1H 1K6QH 1A6AA 2HJLB 1LDSA 4N8VG 4XGZA 1X4YA 5L2JB 2VMFA 4YBLC 2DQFB 3U36B 1UACL 5F88A 2A77L 1WCQA 4U1GB 2OS7A 2F5AH 1P7KA 3MREB 5FO7B 4YDLB 1AD0A 1Z5LA 3TN0C 3OF6A 1CCZA 1QYGH 2ZWLT 4MNHB 2PYED 4P2RA 1L6XA 4EVNA 2EIEA 1NGWB 4JFHD 4YAQB 1S7UA 1U3ZA 4D9QD 5D5MF 4ERSL 5JQ6L 3T65B 4HLZG 4HKJB 1NAKH 4D9LH 3EYSL 4TQEL 5BMFH 4I4WB 1JZ8A 3PWLA 5EZIH 5CZVH 5IHZA 1YECL 1ETZA 3OZ9L 1XF5A 1MCIA 4PLKC 1HXMA 3GFUA 5DQJA 2WQ8A 1IC7H 5L88H 4S0TD 4UU9B 3RY6A 5E6IB 1WCBB 4HEME 1ND0B 5E4EC 3O3BB 5K9KB 4ZQKB 1U92A 5DUML 3MRHA 3FOLB 1WAAA 1P4LB 3FOMB 2ENYA 3QZWB 1JZ2A 3K4AA 5B38A 3CVHH 5IVXA 1D5IH 2V5YA 1NDMB 5EO0B 4JZOA 1I8KB 2P5ED 2Z35A 4LSRH 3SGEH 4ODVH 3S96A 4NQXB 5GGSA 1J1XH 1AKJA 2UYLA 2N4IA 4OFYD 3DHJA 4K94H 4RGOH 2Y72A 3WNNA 1FBIL 3DWTA 3DURA 4I3GA 3D9AL 2MMXA 1YC7A 3UPRB 2AV1A 2AXFB 3EW3B 3NGBB 4IRJB 3ARBC 5TDPB 3WYRA 1E4JA 2CIIA 5F7MC 2EC8A 4C56E 2YSSA 4C54A 1CR9L 1MIMH 4TTGA 4OI7A 1JWSB 3BD3A 4JRXD 5F7WC 1W8OA 4KRMB 3DVFA 5TE4H 3DLQR 3SJVA 3BKYL 3SKMA 5F7NC 1OAXH 1HQ4B 5K9OA 5J9PB 1F45A 3ETBF 1EA9C 2NY2B 3GB7B 5ADOH 5I1DB 4LQFL 5DD6A 3MRNA 4BUHA 3QWQB 1AFVL 4KU1A 2EDXA 2VLLA 3WFCH 4MNQA 4O9HL 4XVJH 1UJ3B 4RBPH 5HI3D 4ZUWA 2XN9D 1S7VB 7FABL 2J4WL 4DWHA 3T1FA 3B8SA 4I2XE 4R7DA 1DBKL 4IRZL 4XBPB 1QVOA 5CILH 4R4BB 1CD8A 1UA6H 2W9EH 1P2CB 3UTSD 1Y6MR 4BSVB 4EN3C 1R3HA 5I16A 3GSOB 5B8CB 5D1ZC 1MWAA 5JR1L 2COQA 4JY4B 3QSKB 3LEXA 5DF0A 1SBSL 1NCDL 2C3VA 1JYNA 1DQLH 5T1LA 3C87A 3KPTA 3DO3A 3LH2L 2JJTC 2R1YB 4JG0H 3C6SB 3SGEI 5ICXA 5GSVA 3HZYB 4BFIB 4YC2B 4WO4C 3UJJH 4WW2F 5DRWB 1UVQB 4KZEH 1IAIH 1AD9B 4K7PL 3K2MC 5FCUH 4HXAL 4MD4B 4Z7QF 1RZGB 1WWWX 1B6UA 5HGDA 4WV1C 3GSXB 4NN5B 3OWEA 3QISA 1KG0B 1KLFA 3NN8A 4G9FE 4P4KB 2ESVA 2FLBT 3VWKC 4ZUSA 4ZPVA 3FQXA 2DBLH 1JYXA 2ATPB 3DNKA 2RGSA 4GMTL 1D5ZB 2QHRH 1AR1C 5DT1L 3NCJH 4F2MA 1G9EA 4HIHA 3ULVL 4P46A 4OQTH 3U1SH 3QULB 3IDMB 1R5IB 5FGCE 3DJ9A 4Y1AE 5CD3A 5TF1H 5HHOD 1NL0H 2CGRH 2ADJA 1BX2A 2DLIA 3IXTA 4FP8H 4Y16C 3S3JA 3NFNB 2BZDA 2X9XA 3HKFA 4G8GA 4HZLA 4YR6A 3O0RL 4TUKH 4NQEB 1IKNA 4ZYKB 2WQRA 4UOW1 3FZUC 3QO0B 3QBTB 4OLVH 3H42H 4QRRD 5DK2A 5GRWA 5DHYB 1A4JA 1OCWH 5HYJA 1IEBA 4M7LT 4MCYB 1D7FA 4P3WA 5CUSH 2DAVA 3SY0A 1BZ7B 3OB0K 1PVHA 1V7NH 1YY8B 4QY8B 5BVJB 1HINH 4GG6A 1FVDB 5FHAL 5MEPA 2WK2A 3NIFE 3VWJC 1AI1L 3MJ8B 1ZT4A 3AM8A 3DPBA 1IEAA 4YHMH 5EZOH 1TETH 2OL3H 1EJOL 3D39E 3QNYB 4H26A 1I1RA 1IAII 4LDLB 5TDNB 5T5NG 2XWTA 4KQ3H 4XPFH 4FABL 1X5ZA 5KSBE 4OCMC 3VG0H 4LGPB 1KPVA 3PWPE 1XCTB 2PW1A 5HVFB 4KPHL 4KTDL 3ZT7A 5T3ZE 3BPCB 3ZHDA 1U42A 4QCIA 2ZCLL 4XCEB 5T1DH 2W60B 2VKWA 4JFXA 1FFNA 5C07A 4BZ2L 1YMME 1BD2D 3EFFA 3LB6D 4YGAB 3QUYB 2IFGA 3F7YB 5EU6A 2J88H 1MRCL 1DEDA 5LVEA 1N7MH 5EC1B 2AGJH 2AJXL 4RFEB 4HF5L 4P99A 5ABDE 1I9RL 5J56B 1P7QA 1UCTA 3QRGH 5A2IH 4FFYH 5AEAA 5DRNA 4AMKH 4L3CB 4GG8B 1QP1A 3D85A 4MSWB 2C7UB 4J3TA 5F97E 4Y2DC 5JNYA 1LD9B 4M7ZC 4YO0B 2X40A 3KJ6L 2R9HD 2WAHA 3SKNB 1HHIB 3V9FA 1ZA6B 4G43B 3VXRB 2N56A 4M1GL 3X3FH 5D5MA 3DXAE 5D7LD 4Z7WF 3FB5B 2R2EB 3O8XC 5EWIL 5IW1B 2OK0L 1KN4L 2X7LB 1DBAL 4J6RH 3T8XA 3VI4E 1M6OA 4XPGL 4NM8H 3RTQC 3TBWA 3MLPA 1QFWH 4YFLI 3VFSB 2Y5EA 2K9UA 2R1XA 2EDWA 4UBDD 3PHQA 4S11A 1K4CA 1NDGA 4JO2H 2DI8A 2HRPL 2AJ3A 1GGCL 4F8TA 2AJZA 4HUXA 1BPVA 5EIIA 4M7KH 2XFXB 4LP4A 3ARGB 3S37L 1FYTE 3QAZB 2CR3A 2EZ0D 3NA4A 1ZTXL 2C3XA 5C0RL 2ERJB 2AJYH 1W0WB 4LMQI 3TIEB 3G6DH 4TPRL 5EZLB 5JW5A 2A9ML 4TVSa 5L9DL 2APFA 5C0EA 4MDJA 4Y19B 1C5DB 3S88L 5JHDD 1U8JB 2Y07H 3U2SA 1YNLH 3RGVD 2ZNXA 1AH1A 3DYOA 2NR6D 1KJ3H 4WWKD 1RK0A 1Q9KA 4R0LA 3MO1A 3ULVC 3DYPA 1I3GL 4JFYA 2CKBH 4OCXL 3P73A 2OJZH 1CTNA 3RWHA 1BFSA 2AK4D 3Q0HA 4PJCF 2JB5L 2F8OA 4RX4A 5I1JL 5KSAC 3ULVF 1IM3A 1P4IL 1IM9D 3VE0A 2DM4A 3L3IB 1JNNL 1B4RA 2MNUA 4WRLA 5CINL 3WIHL 2V7HB 2DLFL 4LVNB 5T5FH 4XBEL 1JV5B 3VGAB 5A3ID 1C16A 4B7LA 2ZG2A 4KFZC 1A02N 4JFEB 1VFUA 2F8XC 1NBZA 4HIJB 3BGFC 3EYQD 2DQCH 4K3GA 1F42A 3T0EE 1LO0H 4OCYL 4HH9B 3S34L 4LGSB 4DKEL 5L7XH 1D9KB 1PG7L 4HX1B 4ODSL 3DHMA 3T2NL 1EEYA 1WFUA 5DS8B 1A6WH 1BFOB 3R8BB 2MKWA 4AL8H 2JTDA 3HFMH 4MHHG 32C2B 1AY1L 3FL7A 4NQDD 3WMSA 1JL8A 5SWSD 1QFWI 3MTRA 2AI0H 2PO6B 2C4FU 4FZ8L 1IGIH 2VAAB 1ZGLM 2W0KA 3VFPA 4Z0BL 5DYOB 1N0XH 4X9HA 5T3XD 3V7AE 4OTXL 4OGAC 4ODWB 4O5LH 4Y4KC 3T1WA 5IOPA 3HUJB 2N7BA 3WE6A 4L8BB 2NY4C 3OKMA 2XY2A 3H9SB 2YN5A 2ZSWB 1C08A 4XCFL 4DCQB 3THMH 5KVDH 1CGWA 4ODXA 2E9WA 4MCZA 3V6OA 4X6DF 2OZ4H 3WFEH 4WW2A 5KG9B 2MHAA 5E70A 3ZSSA 4AEIL 2OMBA 5DEGA 3CU1A 4M43L 4ZTPL 2B39A 5DHVB 4U1LB 1OAYH 4PFEA 1ERNA 1KFAL 4JZJB 1LE5B 2P8PA 5EA0L 3EYVB 2OTUB 3L9RB 1MCSA 4H1LA 2DJSA 1NEZG 3WUWB 3B9DA 4OLZL 1UB5A 3MA7B 5C6TH 1HHJB 1BAFL 2BVOB 4E41D 5I1LB 3OJDB 2Q8BL 4MVBC 4U33A 5JPNB 3QQ3A 1FZMA 4PJ8D 4JFFE 1SM3L 2RB8A 1MI5E 5EUKA 1S9WA 2Y1VA 5FDYA 3PV6A 1NMAH 5GIRB 5SX4H 5D8JH 3QCVH 3GMRA 4BZ1L 5I1IL 1EO8H 5EORH 3QP3A 5LCVH 1YYLH 4LSTL 3BGMB 1MVFA 5D2NE 4Y16A 1FNLA 3RDTC 3DECA 2O61A 4JDZB 1S7WA 1TVDA 4I0CC 3HC3L 1F3DJ 1KPRA 4JFDE 1OAQL 5C7XL 2IAMD 3MUY1 1RIHH 1TZHA 1CLOL 4L9LA 1G7IB 3HAEH 1LE9B 5EBWA 1G7MB 1ROWA 5L2KD 4L1DA 4DGYL 1I8LA 3SGJC 4LASH 2V5MA 1BQLL 2GI7A 4CN4A 2UVEA 2Z92B 3QEQE 3EO0A 2GY7B 1CXFA 1A22B 3PG2A 4YHZH 4K3JH 1ZWIA 5JW4M 3F7VB 3VXSE 1V7MH 4GRLB 3ARPA 3VWJA 3AS3A 4XP5H 1YDPB 1EDQA 4ZSOA 5FKAA 4OM0H 5BOZG 4KXZH 2H41A 1T1YA 2DQIL 2NW2B 3KPQB 4D3CL 3FONA 4JCLA 4YFEA 4PGEA 1Z9OA 3I50L 4UQ3A 4DK6A 3BEWA 3EOBB 4QXGH 5DLMH 1FHGA 3HE7A 3LIZH 2YEZA 4JRYA 3Q5OA 1A7QL 4M6OH 2BHUA 3I85A 4JPVL 1J8HA 2CLVB 2MSPA 1OTSC 1JNLL 4F7TA 1P6AB 2NY3C 5DRZA 4N0UA 5SX4I 2FX8L 2EYRA 2BNQE 4CMMB 1OTUD 2VN4A 3DTXB 3BWAA 3QUXD 5ICZA 5CHNB 4B50A 3ULSB 5DHXB 4NQCA 1U8OA 4F58L 3CX5K 5CIPA 4PTTB 3K8KA 5B21A 5BV7B 3OKOA 4K55A 5JIIA 5B3JF 4Z7WA 3QZWG 3CMOL 1YEHL 3EGSA 4G5ZL 4MXVF 2LAGB 3WJLC 4PJ5E 5BZWB 4NNYB 3JZ7A 1XGRB 4RQQB 3ALXA 3QR2A 4S0SD 2GTZA 1FPTL 4PJHB 5I8CB 1JGLL 4UT7H 3SOBH 4XC3L 4FFWD 4PV8B 2BHZA 3GUTB 1EV2E 4QWWC 2IADA 4DKDC 2MCPL 4YHLH 1YUHA 4OGYH 2W0FB 5CCKH 2PYEA 4MWFB 5EIVA 5F1SA 4Q9BA 1IFHL 1YMHB 1W72H 5SWZD 4F9PA 5EH1A 1BHGA 3FO9B 2A6KA 1N0LA 4D0CA 5DMJB 1GAFH 5C0AE 4ONFH 5DD1L 1KCRL 2FHBA 1MCWM 1U8HA 2FO4A 1T83C 3G5XA 5DJDB 3O4LB 2QSCL 3UP1A 1ITBB 5DZLA 2Y06L 3C6LB 3ZL4L 4JFOA 3CC5A 1GGUA 5C6WH 3KYKH 1LMKA 2P8LA 3IJSA 3A6CL 2M1KA 2P7TB 3ULUC 5BJTB 4EI6B 3C60B 3KVQA 5IF0B 2P5EA 4NJ9L 3JV6B 1DEEB 3ZKNC 4M62H 3TGXA 5EZJB 2NY7H 5AUMB 4OFYA 1FZKA 1UM6H 1FYHB 4PJBF 3TO4D 2IPKB 3UO1L 2QR0A 3BP5A 1R5VA 4X7TA 5GGUB 3V4VL 1MEXH 5IV2A 4QYOB 3GEWB 2FLRT 3HLAB 5I1AA 3F8UB 3QI9C 3DV4B 3SDCD 4YGVA 3HMXL 3GSRA 5JMOC 2GAZB 5IHLB 2XY1A 3G08A 3P9MB 1AGEB 1R6VA 4ONGH 5ALCH 4CNIA 3MACH 3L3JA 4CW1A 4N1HB 4ZS7H 1YEKH 4JRXA 4L8CB 2FBJH 4OUUB 1KB9K 4U6HB 1XFPA 2QHLA 4UIKH 3DMMA 5IJVA 4HIEB 1UQSB 3E0GA 4XB8A 1RZKH 2X4QA 4XPBL 2A2QT 2HKHL 4X6DA 2EICA 5D9SB 2PW2A 3BXNA 4LARL 1MRFH 3HI5H 3V5DA 1LEKB 2ZG1A 1OAUL 1YYMH 4HPYL 5I2IA 4MJ2A 3BX7C 3EDKA 4A6YL 5KVGL 2ZUXA 3ESVF 2FB4H 1U6AH 2OM5A 3P4MB 1L4IA 1A6VL 1NAMB 1T2QH 3RA7L 3ZKXC 3L6FB 4RMWA 2FEEL 4L5FH 1QSED 4XMLL 5ITFA 3ABZA 5FHBH 2C1OA 5F8QC 1ED3A 1UB6B 1CD1B 1MFAH 5DDHB 2YPVL 3QUMH 4XC1L 2VDML 4HS3B 1UYWH 3LSOB 3P77B 4OUOA 2HKFL 5DMYA 5DC4B 3G9VA 2VLKD 2I25N 1NCCL 3EJJX 1NFDB 3MRMA 3TV3H 5D71L 1OP3K 4Z76A 4OF3A 1U8KB 3VFOA 5J13B 1FZOA 2I60H 1PBYA 3HNTL 5D1XB 4M3KB 4WEBL 3TVMC 5HHPA 4JM2C 2J5LC 4WHTA 3QIWC 3MMEA 1MHCA 4YBQD 4LCUA 5GHWH 1FNGA 4JLRA 1VADA 5INDB 4JM2F 1I9IL 4CN1A 5HHNB 3VA6A 1KTLB 2NQCA 2IH3B 2VZUA 2IANA 2VLRD 4AEHL 4KK6C 4PRIB 4XP4H 3C5ZD 5CP3H 3BZFA 5FA3B 3ZKMC 4UT9L 2UWEE 5MERB 4MX7B 5FGSA 5DR5H 4I3SL 3RVUC 3REVA 4L8SB 4PJIB 1X5AA 3BH8A 1OM3H 3QXWA 4FQ2L 4AG4H 2XZAL 2HH0H 5KS9F 5JA8B 4CGTA 1TQCB 1WUNT 4LF3A 5ENWB 3H9HA 3BPLB 4MHHI 4MD5B 3PDOA 4PRDA 4X99B 5DFWH 5J1AB 5HDOA 1QBMH 1Y0LA 4XCNB 3WIHA 3VI3E 4JN1L 4LCWB 5E8EA 4P5TB 1QFUH 3SPVA 1A1MB 1WFTA 1H3PH 4NKQB 5MP6L 1IILE 1QFHA 1U95B 2B8OT 3SGKC 1FDLH 3LRGA 2ZJSH 4LDOB 5JORB 2F54A 3DROB 2VDNL 2EEBA 3IJYB 5CGTA 3CDYA 4Z7QE 5EUOB 5F7LB 5HHMB 3OGCB 3LQAC 1ZSDA 1MAKA 4NSKB 3C5JA 2X4TB 4X7SL 5CMAB 2Q76A 3P0YL 2WUCL 4XI5D 5E6ID 1BD2A 4RGMC 5F9DC 3ARFB 3WHE1 2RCSH 1LWRA 4Q6IA 4U6XB 4PGBB 2VLJB 3GSQA 4ORZC 3RUGB 1BBJA 1DBMH 4FN0A 4GQPH 1U8NB 1SVZA 4O2FA 4ZFOL 2YRLA 5GRJH 4F3FB 4N8VA 4R97B 2EIDA 5EU5A 3WNPA 2LU4A 4Z5RB 4EI5C 4K71C 2HJFB 1AJ7H 2WBJC 4ZXBC 3TBTB 5CEZE 3EOTH 1F4YH 4HWNA 3MYZA 2NMSA 3IDJA 5TPWH 4CADB 4LLMA 2JJWA 4LCCA 3ILQD 5D7LA 2NY6D 4OLEA 4ZUUB 2AKRB 4RZCA 4TNVF 2B20A 2Y4SA 3CXHJ 4HXBH 2XTJC 5D96C 2EXYD 4C57C 5F44A 4DAGL 1KIPB 1J10A 1QD0A 3EYUH 1NUFA 5SX5H 2DMKA 1WEJH 3FO2A 3KPSA 4XBGA 3O3EA 5FGBC 3I6GB 2YKLH 3GIVA 4MMZC 3PL6D 5IVZB 1HH9A 4OF8A 3OR7A 1U3HB 1N64H 1FL6B 2VKXA 4M7JL 5JHLL 3OJ2C 1CXIA 3E6HA 4JVUA 3B6SB 3W0WE 2WIIA 2NY2D 3ZTJG 4KTEL 4PPTA 5GS1C 3U30C 4OAWA 5JHDA 3EJYC 4UZGA 4FQJL 4OLXH 4G8FA 4HGWA 3RQ3A 4PJBA 5GS0C 1AXSB 1BZQK 3UTTE 4GRMA 5BRZE 3HE6C 4WWKA 4YDIL 3O3UN 1FO0L 3DRTA 3U7YH 2AK4A 3GKZA 5DA4A 4KVCH 1M7DB 4P2CG 3LPGA 1TQBB 1TLKA 1WT5A 3GGWB 1OWRM 1IM9A 4FXGB 3EYOA 2UZYB 5DO2C 5LGJB 2BJML 1T66C 2ZCHL 4PJ7F 5EIQA 2WBKA 4GW5B 1PY4A 5CGMA 1CIUA 3FT3A 4OD1H 4H20L 1H5BB 4AQOA 4C56B 4HWEH 1BZ9A 3NTCL 2DM2A 4KKCC 1VFMA 5CJ5A 3MRKA 3ZYZA 3WUWG 3BP6A 2B1HH 4P3CH 4PLJD 3ZDYF 1QBLL 1GIGL 2X70B 2EDJA 2E27H 4PGZA 4HULB 1XR9A 4Y5YB 1JWUA 3MLYH 2YPKA 3G04A 4NQDA 4P4KD 2KQNA 2HT3C 3G5ZA 5I8KH 4PG9A 3AREB 3MJ9L 4KMTL 4QNPE 1ZHKA 1HQRB 2AJSL 2VE6A 1QSFB 2IBBA 2FJHA 4JY5L 1G7JB 3I02A 4GS7C 1DN0A 5ACZA 2DL2A 2VISA 4WGVB 4MAUH 3CCHA 2ZSVA 3O3AB 1XCQB 1V5JA 2OQJB 3V4PL 1LDPH 3EKCA 1JGDB 2P4AB 4I2XB 2R0LL 4TRPH 1CLYH 2OP4L 3O4OB 4PJAF 4FRWA 1MCHA 1F58H 3H0TB 5LJYH 4NQED 4J4PD 3WNMA 3T2OA 2E9BA 4MDIA 1CICB 1MSPA 3BDXA 3MLWL 2P48B 2D7OA 4C4KT 4B0MM 1S7QA 3JWOC 4MA3B 2R4RL 3O41B 1EERB 3EDEA 3VCLA 4LPVA 4PJCE 1Z9LA 1HI6B 3TBYB 1T5WB 4OCNC 5M94B 2DKSA 1AR2A 3TYGL 2R29H 4GSDH 4OD3H 3ULVE 1IGTB 1Q38A 1AHWB 1TFHA 3MGOB 4OCSH 3MQIA 1FAIL 4P57B 1KJ2L 3A6BH 1YEIH 2P1YA 4FQ1H 2BNRB 2X1WL 4UINL 4JAMB 1BVLB 4PJ8A 4YK4C 3QEHA 1ZGLA 3AMKA 1UXSA 4FG6D 3SE3C 4M61A 3GJEB 3QIWA 1QA9A 4R3SB 3UC0H 4Q0XH 4RNRA 1E0OB 4PG2A 1S7SA 5IR1B 4UOW0 1K8IB 1RJYB 1GVIA 1U8PB 1ZHNA 4JFPA 3P0VL 5DJXB 4RAHA 5C92A 5I66A 3WN5C 1UCBH 3IAPA 1N5AB 5FGCB 4JREB 5LGKA 3L5XL 25C8H 15C8L 2ED8A 3KNBB 4JGUA 4OD2A 2IAMA 5DWUH 5HD8C 3CVIH 3HZMB 1FL5A 4LOUC 4NJAL 4Q9RH 3NACH 1BIHA 4M1CD 4ZDHA 4WY7L 3QNZB 2ARJQ 5L2KA 2QTEA 3WEXB 3QFDA 3MROA 5CS7A 1CGVA 4WGWB 4ZNEA 2M8XA 4XNYL 3PNWA 4NHUA 4XNQB 5IMOA 4JQIH 2VDPL 1L0XA 1LNUA 1E6OL 1MCQA 3MV7E 3GI9L 1HEZB 4HUUB 4QKXB 5DA0B 1IC1A 3VFNA 1DP0A 3MNWB 2EYTB 4M1DH 3U4BH 3DSFH 1CGSL 3TPUB 1M71B 1FVEB 3SGKA 4U2YA 3EDFA 1PQZA 4K7FA 3IETA 4L4TA 1UM4H 3OSKA 4U1SA 3MLXL 1XEDA 4EDWH 4AIZB 2Y7QB 1K4DA 4OIBA 3VXME 3HR6A 2CPCA 3BPNC 2OR8A 3PABA 5HGAA 3GBNH 1YEFH 5EN2A 1I1CA 3VXOB 1A1NA 3QXAA 5F1NA 4EIGB 2HA1A 2CO7B 1TENA 4OB5L 5KN5B 4YNYB 3EOAB 4Y19D 5M95B 1K6QL 1P7HL 1NBQA 4I3RL 3CXDH 1B4JH 1WC7B 5MI0C 2KUTA 2A74B 4CDHA 1N8ZA 1I7RB 1RMFL 3KLAA 1MCOH 1RZJL 3C09C 4A6YA 3RZCA 3GNML 3MV9D 4GQ9L 5CEXB 5I18H 1RJZB 4Q9QH 2ITDB 3BT2H 4OBRA 2FGWL 5H35B 1ZT1A 5CJXC 5HI5D 2PCPB 3DXAB 3Q48A 2X4NA 2X1XR 4YZFF 3TA3C 5J06A 2R0WH 4JFED 2X4RA 3JTSB 5FYKE 4D9LL 1U8LB 1KTDA 3KPRE 5BMFL 2A6IB 2Q86A 2XKNB 3AAZB 2IANE 1QQDB 4PJEF 3BJ91 5FGRA 1T0NB 3JV4A 3MRBB 4ZPTA 4Z18A 5EZIL 5CZVL 1S7TB 1KCSH 5FGBA 4HFWA 2F19H 1D9KD 1DQJB 5CBEA 4Y5XB 3Q6FB 1IC7L 5L88L 5IROC 4KAQH 5I8EA 3GM8A 1HSBA 1VSCA 3PWVA 4JFZL 3OKNB 2PO6D 3TFKD 1FVCA 5BCAA 2APXA 2EEAA 2PN5A 3TCLA 4LSRL 2Y6SD 2ICEB 4LSSH 1JJUA 4WU7A 2LTQB 2PTUA 3AS1A 1OQXA 4FTVB 3G6AA 1E28B 5JDSB 3HE6A 2X89D 4MLIA 5HHQA 4JR9H 2RBLA 3L5WA 3O6LL 4RGOL 2XOTA 3H9SD 1QNZH 1T1WB 3FFDB 3GRWL 4FFVD 1T04A 4XCYB 3WS6C 3CLEH 4PJ7A 5DMGD 1UKTA 2P46B 1E4WL 2P45B 4NKMB 5BOPA 4Y4FB 3BZEB 1DR9A 4N8PA 5KZCD 4KUZL 2MCG1 1A7BA 4HK0B 1X5HA 2MFNA 3CZJA 3MZGB 1KC5H 1RZFH 1L6ZA 3FQNA 5F21B 5IB5B 3BKJH 1AGDB 3TO4A 1HIMH 2ZOLA 4D0DB 3PHOB 1FORH 2EDOA 2FIRT 2I07B 3GJFA 5B3JE 3QDJE 4ETYA 4RMSA 3QDAA 2Z0BA 2YD4A 1YNKH 1A6UH 2EH7H 1K5NB 2BDNH 4GT7A 4W70A 5TE4L 3RWDA 2XZCH 1QEWB 1JHKH 2R1WA 3DRQB 4XVSH 4I18B 1Q9WA 3FCTB 1EH9A 3V6ZA 4EOWH 2VQUA 2VDOL 3HG1A 1QFWM 3ZT6A 3NCFB 2FBOJ 2WMPA 1TJIL 2JKXA 3WFCL 4O4YH 3LCYA 3QQ4A 1MHEA 1IAOB 5F9JA 1BQUA 5JXEC 4XGZB 1H9VA 4XH2A 3PDDA 3F58H 3C8HA 3DETD 2KH2B 2IALA 3G5VA 4MJ6A 4HPOL 5I17A 4KJYA 4PJAA 3V5KA 5CILL 1UA6L 2W9EL 3B9AA 1P7KB 1AD0B 1Z5LB 3FB6B 5IT2H 3STZA 4OJFH 5HSFA 1DQLL 4LEXH 4JGJA 4F7CA 4JG0L 4XRCB 1RURH 2XPGB 3NIGE 1S7UB 2EXWD 1E27B 4K8RH 1GC1C 4ZAKB 3MLRH 5EPMA 4JY6B 4KZEL 4HC1A 1I9JH 3NAAH 1IAIL 3AU1A 4ZFOA 3RWGA 2K7QA 4RIRB 3PWLB 2DIJA 3L1OH 5IHZB 4HUKB 1I7ZA 3WFDH 4QHNA 1XF5B 4KJPC 2DIAA 1NEZA 2D4FA 1R3LA 1RAMA 5DQJB 1XF3B 3V4UL 4A2MA 4GXVH 1JGVH 4GRLD 5FXCH 1VGEH 1U92B 2X5PA 3MRHB 4ZFGH 1A9BA 2GFBA 2VLKA 5ADPL 3ULUE 1CXEA 2Q20A 2VIRB 5B38B 1I1AC 4C55A 4OGXH 4JZOB 4PJFF 2Z35B 4P9HH 3BDBA 3U1SL 3S96B 1JN6B 5F8RC 4YHIA 1TJHL 5ILTL 5JOFA 1AKJB 2UYLB 5GPRA 1OGAE 1NL0L 1ZA3A 2CGRL 3BKMH 4JKMA 5C9KA 4FP8L 4OGZA 2PTTA 4TUKL 2P8MA 2W9DH 2D3VA 3DURB 3BZDA 4FFZL 2JCCE 3NA9L 3D0VA 2PETA 1H8NA 1GXEA 5D2NB 2AV1B 1YEGL 4OLVL 3O6FC 3CDGA 5L8JB 3H42L 5F3HA 1B9ZA 2CIIB 4MQSB 2OJEA 3C8KA 2YSSB 4FQHA 4U2ZA 4PGJA 1OCWL 2VLRA 2D2OA 3LPWA 3BDYL 4JDTH 3TH3T 3C5ZA 3CIQA 4PB9L 5J11B 5CUSL 4P2QE 3I9GH 5C86A 1F6LL 2JF1A 3OAZH 2DM3A 4CUCA 4GUPA 1HINL 4K94C 3PGFL 3SKMB 5MEOA 4QTIH 2G75A 2DQEH 3UTPE 4U1MA 1HZHH 4IBLT 3CSBA 2DS4A 5DD6B 1GGIH 3MRNB 1H3UA 4IOSD 3OG6B 5EZOL 1UZ8A 3T0DA 5D6CB 4IS6A 2VLLB 3WJJC 2NY1C 4MNQB 4X4ME 3U4EA 4KQ3L 3BPOB 1KB5H 1MFEH 4ZUWB 1T03L 1IGFL 3VG0L 2DN7A 1AE6H 1T0MA 2HN7A 4R7DB 1QVOB 7CGTA 5E94B 1R3HB 5T1DL 5I16B 1NPUA 5BV7H 3LEXB 5SV3A 1OW0C 4M7LH 2C3VB 1INQB 1F11A 2VC2L 2J88L 4HKJA 2AGJL 1T20B 5ICXB 2IMMA 1HOCA 4FFYL 3KS0H 4AMKL 1I1FA 3F7PC 4KROC 1UWGL 2BNQB 3MJ9A 5IWLA 4PY7A 2BHYA 4UU9A 3BIKA 3C6LD 1WCBA 2NZ9D 5FYKU 1DFBH 2ZUWA 4ZQKA 5HGDB 1P4LA 3UX9B 1TITA 5E9DE 1FLRH 3CFEB 2Q1EA 3NN8B 2DQDH 1CBVH 1I8KA 2CK2A 4ZUSB 2K1MA 1PEWA 2MOVA 4ZPVB 4J6RL 5DEZA 4DN4L 4NQXA 3SE4A 4UDUA 4NM8L 5IMMA 4TSAH 5CJXA 4JO3H 1QFWL 3GO1H 2UUDH 4F57H 4F2MB 4UOJA 2WWMD 4P46B 5BVPH 3DGGA 1YN6A 4K3DL 1Q94B 3ARZA 4JM4H 5CD3B 1KYOK 5HI3C 5I30H 2ADJB 1SEQL 2AXFA 2WINB 3IXTB 1S8DA 5GJSH 3W39B 5KS9E 4YR6B 4R6UA 1I4FA 2DWEB 2CMRH 2P47B 4Z78A 3B2VH 5CZXC 4KMLB 4FNLH 3IDYC 4K3HA 1KJ2A 2PKDA 1CDHA 3PL6A 4NCC2 5IUSA 3LV3B 4XPTH 1IARB 4HT1H 1ZLUH 1A4JB 5ETUB 5HYJB 2YD9A 1E6JH 1IEBB 2F58H 5ERWA 3LN9A 2CKBL 3RNKA 5D7KE 5I1DA 2OJZL 1LEGB 3SY0B 3MUZ1 3UZVB 4ONHA 5D2LE 5IGXH 4WFGD 4U0RB 4GG6B 4XNZB 3QHFH 5MEPB 5DFTA 1UJ3A 1JTOA 1OOAA 1S7VA 3K2UH 3LKOB 1ZT4B 4OFPA 4MLSA 5T5FL 4IDLA 1EEZA 4H26B 4XBPA 1Y18A 2ZKHH 4PP1C 2XWTB 4BSVA 4J2XA 4CDGC 5B8CA 4U6TA 1KPVB 4G6AD 2PW1B 5L7XL 4E9LA 3KPPA 4JQXA 4QCIB 1YZZA 1ES0B 3QRFM 4G7YL 3UTQA 4PRPE 4JFXB 1FFNB 4DUXA 5DJZB 3EFFB 3G6JE 3HFML 1JRHL 5F89A 1UVQA 3EHBD 1F4HA 2AI0L 4NKDA 1AO7E 3VXUD 4YFLF 1AD9A 4JQVA 1IGIL 1KCUH 2YMXH 1P7QB 1J0HA 5E2TL 4OFVA 5DRNB 4MJIE 2ICES 4OLYL 1PG7W 5JXEA 1N0XL 1IGCH 4DZ8A 3GSXA 3M8OH 4HJJH 3D85B 3L3GA 2SEBA 5JNYB 5LQBL 5IHUH 4WI8A 5CD5C 4GRWH 4P4KA 9CGTA 2YHGA 4APQD 2E6JA 1D6EB 5DMIH 3L95B 3THML 2QEJA 5KVDL 5EOCH 4WHCA 3NH7H 5D5MB 3AXLA 1PY9A 2OZ4L 2XTJE 4IOFD 3T8XB 1M6OB 3QULA 4N0CC 8CGTA 3DBXB 3WXVH 4MA8H 3KYMB 3BQUC 5I15H 2FJGB 4Y8DC 3NFNA 1JHLH 2VLMD 2PXYC 3MRGB 3PHQB 4NQEA 4B41A 4KTYA 3PQYD 2D0FA 1NDGB 4QRPE 4J4PA 2AJ3B 2AJZB 4HUXB 4YHNB 5EIIB 2L4OA 4OZIF 1A1OA 1WITA 2JELL 2A6DA 5JW5B 1XIWD 4ELME 2XG4A 4PGCA 5DHYA 2OBGA 4PJFA 5E4EB 5GZOD 1WJ3A 4MDJB 4JDVA 2FD6L 3QQ9D 2CDEA 1NMAL 1HDMA 3U2SB 3T0AA 4F7PA 5D8JL 3QCVL 3RBGA 1YY8A 4LCWD 1IGYA 1S3KH 2EDKA 4RGNE 1EO8L 5EORL 5E8DL 1RK0B 1Q9KB 4R0LB 5LCVL 4NZTH 4JFYB 4U3HA 1LILA 4P5TD 3P73B 2EE6A 3SE9H 3RWHB 4W4OA 3TH2T 1EGJH 1CXLA 5KJRH 1IM3B 3VE0B 4V1DD 2R9HC 4XAKE 5E8NB 3N1GC 2NLJB 2E7LA 5TQ0H 3ARBB 3ZDYE 1C16B 1FG2B 2IMNA 4CKVX 3KR3H 1ZLVH 5FYLH 5MENE 5C0CE 4CVXA 3ARFD 4KKBD 4NNPL 3F7YA 4NRXA 3HRZA 4YHZL 3UXFA 5EC1A 4K3JL 2VLJD 2RFXB 4R2GB 1EEYB 3HG1E 4MNGA 1V7ML 5HVHC 1EEUA 2EIZB 5H2BA 5IBTL 4LNRB 1TIUA 4X6BA 4GLRH 3GRWA 3SQOH 1D5MA 5K9QI 5ANMA 3QDME 4MSWA 5EBLA 5TH2B 1FNHA 3O45B 2Z4QA 3SKNA 1HHIA 3GHBL 2QSVA 4QHMA 4HIIA 4QXGL 3GKWH 5DLML 3ISWA 4DKFH 5FO8A 5JXAH 1U93A 5IOPB 3DOSA 3FB5A 2R2EA 3WE6B 1NBYA 3OKMB 2X7LA 4JO1L 1I1YB 4EN3B 5FM5O 3RGVC 1C08B 3LY6A 4LSUH 5J8OA 3U46A 4ODXB 3ARDC 4MCZB 3IKKA 3B3IB 3ZE1E 4GMSH 4WW2B 5EULV 4P23C 3O9WC 3WHE0 1NCWH 2MHAB 4X4YB 5L8KB 3ZE0F 1OSZA 4M6MH 5JA9A 1P9MA 4YE4L 2XFXA 4BZYA 4WO4B 4Z7UF 4KJQD 4J3VA 4XMKH 2P8PB 1W0WA 5A3IC 2YA0A 2NW3A 1JGUH 5EZLA 3GIZL 4R26L 1MCPL 1VESA 5GZNC 3RVWC 4ODUB 1U8JA 5JW4R 4C4KO 5F3BA 5INCA 1NSNL 4J8RB 2KPNA 4O51A 4C58B 2A73A 3QQ3B 1FZMB 3VWKB 1S9WB 3SOBL 1TTFA 3PV6B 2P5WE 2R69H 5IVOA 4R4ND 5C0BA 4IIQC 3GMRB 3MBEC 3V6FA 3MV9A 4OGYL 5CCKL 3T77A 1MRDL 3L5JA 3L3IA 1IZJA 4UV7H 1JYVA 3QXVA 1MAMH 3LN5A 2G2RB 4GLRI 1EAPA 1JV5A 2Q3ZA 4Y16B 5D6DA 3TNMB 3WHXA 2DTSA 3SDYH 4IMKA 1QLFA 4JFEA 3VRJB 3TJHC 3ZYOA 4P2OD 5DD5H 2YRPA 5FCSH 1KPRB 3REWB 5K9JH 3S97C 1VA9A 4C56D 1TZHB 4WEMB 3SBWC 5DK0A 2YUXA 4L9LB 5EBWB 1D9KA 2HFGH 4HX1A 2H2PC 1JPTH 1LO3H 4OLUH 4XCCH 1X7QB 5J0BA 4X80H 1QLRA 1LQSR 5LXGL 4H25B 3FFCA 3KYKL 1DBBH 2XKSA 3EO0B 2F53E 2PO6A 3ZDXF 1NUDA 3ARED 4ZD3H 3VFMA 1X6NA 1Q0XH 1TZIA 3VWJB 5DYOA 4JG1H 4ZSOB 4N1CA 2Q8AL 1T1YB 4WU5A 3HUJA 1N3NA 5CEYB 3V7AG 2X89A 3FONB 3SCMD 1JNJA 1RZ8A 3BEWB 2FATH 4JPKH 3R8QA 1QR4A 2ZUYA 2ZSWA 4JE4B 1L7IL 1MEXL 4ZOCA 4PRBA 1MLCA 2VDKL 1N5YH 4JRYB 3VGFA 1S5HA 4FQLL 4PBXA 3MGTA 2G9HB 1NJ9A 4XTRC 3QIUC 1J8HB 1P69B 2WWKT 3EJZD 4ONGL 4F7TB 2CJUL 1EHXA 3UPCA 5DRZB 3MACL 4N0UB 3RX7A 3CX5J 4DQOH 2DDQL 2EYRB 4ZS7L 4ZFZB 2FBJL 4S1RH 3RI5K 2X41A 3BWAB 2OTUA 3L9RA 5ICZB 3RL2B 3RIFK 1U8OB 3WUWA 5CIPB 2ZCKH 4X6CF 5HHVH 4DVBA 2BVOA 1IKFL 3PXHA 2VZSA 3OKOB 4I9WE 5I1LA 3OJDA 5LWYL 5ACLA 4P3DA 4Z7WB 3EGSB 3HR5A 4M7ZB 5B38G 1HYSD 4YLQT 3HI5L 2ICWI 2RJMA 3CH1A 3HHRB 5GIRA 4PJEE 3SO3C 2GTZB 1KIRB 3O8XB 3UYRL 1X3DA 1M7IB 2O5XH 2HFFA 3GMMB 3LQZB 2FB4L 1U6AL 5JOPE 3QJHB 2HP4A 3ZTNH 2IADB 5MHSE 6CGTA 3I3EA 4OZIA 1YUHB 4L5FL 3SDXF 2PYEB 4JDZA 4I0PC 3S6CA 5J1SC 1MFAL 3QFJE 1ZVYA 4N8CL 3MBXH 1FNAA 1LE9A 3WIIL 4HWBH 4BFGA 3N1PC 2A6KB 3ARTA 5HDBE 4D0CB 4LRIA 4BKLA 4MJ4A 5D7JD 1LEIB 3CSYA 1EBAA 1IC4H 1U8HB 4K3EH 2FO4B 3G5XB 1TCMA 4PJCB 4WENB 2I60L 4QOKE 4LRNL 4DW2H 4GRLA 2XNAA 3CC5B 5ACMA 1LO4H 4HFUH 1A3QA 2P8LB 3IJSB 4L29A 2NW2A 3KPQA 3MRJA 1ACYH 1JK8B 2I27N 5DQDL 1CDCA 5BZDA 1TVBB 2R2HA 1FNSL 1FZKB 4H88L 1MPAL 4MA7H 3KPMA 4ZUTB 5IEHA 4JKLA 4XP4L 3JBG7 3PWPD 2QR0B 3BP5B 1R5VB 4X7TB 3VGHA 5T3ZD 6FABH 3HNVH 1R24A 4FFWC 1T1XB 3LEYH 5I1AB 1B0RA 1YPZF 1LP9F 4CMMA 3GSRB 2B4CH 3TZVC 4AG4L 2HH0L 2EECA 3G08B 1JBJA 3BMWA 2NXZC 4CNIB 5F6HI 3L3JB 4CW1B 2Z93B 1PEZA 3IB4A 4WWID 4U1NB 4RISH 4N5ED 1NMBL 2KZ1B 5A40E 4FMKA 5IJVB 3DMMB 3BSZH 1NGQH 3MA9H 1PAMA 5HY9A 3FB8A 4P5KB 4X6DB 4PJHA 2W91A 1LO5A 2PW2B 1FDLL 2NY4B 3BXNB 5D1QC 1KELH 2ZJSL 3DXAD 2BSTA 5KVFH 1KJVB 3BMVA 4HKXA 4PV8A 1DSFL 5FOJA 2GK0A 3GUTA 4XXCA 4OV6F 3ARDA 3INUH 4L4VA 2NXYC 5DVKA 4KK8C 4MB5A 5AYUH 4AQ1B 3O9WA 4HS6A 3TNNA 4MWFA 1VCAA 1CE1L 1B88A 2EH8H 3F62A 1UWXH 2A6JB 5HPOA 1T2XA 4CVZA 4G6JH 1YY9D 3QHZH 2IPTH 2C3WA 1BF2A 2VABB 3ULUH 5E00B 1FYTD 5ITFB 4YX2L 3WL9B 4OIIH 2B5IB 3G5YB 1BEYL 1RZKC 4KZDH 2ATKB 2C1OB 1ED3B 1R3KB 1WIOA 3MRPA 3JTTA 5GRJL 4YDKL 3NBNA 5GS2D 5DJDA 2ZOKA 3ORJA 2YK1L 4OKVA 1AJ7L 2OZ4A 5EC2B 3MRMB 1UH2A 4Z76B 3CGTA 4YWGH 1F4YL 3FN0H 3VFOB 1OARH 5TPWL 3D3VA 4EQ3A 1JFQL 2NY5L 5JZ7C 1T80A 4O2EA 3BP4A 5IF0A 3NCBB 2A9NH 4HXBL 5HHPB 1EAJA 2AW2A 3MMEB 2DWDA 4F80A 3EYUL 5AUMA 2HG5A 1WEJL 4LCUB 5E8OA 1XF4A 1VADB 2YZ8A 5HGBA 5EU7C 2YKLL 4XAWL 1A7OH 1FGNH 4QYOA 2VYRE 3IDGA 3OGOE 4NDMA 4PD4K 3B9KD 1N64L 4GAYA 2IANB 2VERN 1RIUH 2VSDA 3BN9D 1BJMA 1GGYA 1AGEA 3OKLA 3C2AH 3MR9B 4DUVA 3TIDB 2G5BB 3REVB 4OLXL 4J3WA 3ELAT 3KGRA 4EUPH 5D72H 1R0AH 4NWUH 4LF3B 2X4OA 3PDOB 4PRDB 2QJDA 1IEHA 4HIEA 4AH2B 3LD8B 5CSBA 3U7YL 1S78C 3MUGB 5KANI 4HLJA 4KVCL 3RKPA 1G6RL 5D9SA 5E8EB 5C9JB 3OF6D 1LEKA 5FB8B 2W59A 3VXPB 4MB4A 3C9NB 4WHYG 2DQJH 1A3LH 3QCUL 2VTFA 4PBWD 1H3GA 1K9TA 4ZAKD 3GK8L 2F54B 2YUVA 4OD1L 2AERT 1NAMA 3SKUD 3X3GL 3FAXA 3TO2A 2NY3B 1ZSDB 4X6CA 5IW6B 1JYWA 3C5JB 4P3CL 2IG2H 1MCLA 2Q76B 4K2UH 5IEKA 1UB6A 4S1DD 1CD1A 5TFSH 2E27L 5I71C 3LRHA 4BSJA 1T2JA 3MLYL 3LSOA 1BD2B 3P77A 1UM5H 2BERA 1EO5A 3VXUA 3GSQB 2X05A 3V8CA 5FK9B 1NFDA 1BM3H 2KZWA 4O2FB 4N8VB 1AP2B 4G6KH 1MI5D 5DUPL 4MAUL 3W11C 3VGBA 1AKJD 1LDPL 4I0KA 5IBLD 1OHQA 3SDXA 2DYPA 3QWOA 4APQA 4PYHA 5E2JA 2HVKB 3KPOA 5C2UB 4JKPL 3W9EA 2CLZA 5BO1L 4AENA 4MQXD 2YRZA 4LLMB 2XN9E 2CO6B 3F5WA 3KHOA 4RZCB 4UB0H 4YDLC 2OMNA 5HHNA 3UTSE 3EFDH 1DUYB 2IH3A 5FO9B 2D7QA 4WNQA 2FHFA 3KPSB 4XBGB 3O3EB 4YHKH 3PQYA 5D7SH 3GIVB 1CT8B 5D70H 5FYJD 2UZIH 5H37G 3OR7B 2R29L 1RHHA 3J8F7 4G7VH 4OD3L 4PIRF 2DQTL 1I3RB 3GSUA 3FFCE 1VDGA 4YDVA 1FV1A 4OCSL 3DX8A 3E6HB 4FQ1L 3QPXH 1XIWA 4QLRA 1RFDL 4AEFA 5C71A 3VXSD 3LQAH 4OAWB 5JHDB 4MNQD 3TBVB 4XCNA 5E6IC 4G8FB 4HGWB 3UC0L 4LCWA 4NCDA 4PJBB 4ODBD 2DF3A 4OCWL 1N26A 4F33A 4WWKB 2E6PA 4YXLH 2VQTA 3DRTB 3QIBD 4HMCA 1YPZA 4X7FC 5JORA 2QADC 3TWCH 25C8L 4OBSA 4V1DA 1Z9SA 4BH8A 3E1F1 3NIFF 4F9LA 3BZ4A 1DQQA 2ADIA 2DI7A 4AT6A 4NSKA 5HHOE 4Q9RL 3NACL 2X4TA 1KF9B 2BNQD 3FJTA 3NGBC 4IRJC 4LMQE 1MJUL 2EXYC 1CU4H 1BZ9B 5KSBF 3LS5L 2DMBA 2EDLA 4JQIL 1DL7H 1JCKA 3MRKB 3BP6B 4XNUL 4QRRE 5DJ2B 3MV8A 4P2QB 4OF5A 4DOHB 1X5XA 1JWUB 3RWCA 2YPKB 3G04B 3DSFL 4NQSB 5SWQA 1MWAH 4PJ5D 3G5ZB 4X9IA 4PG9B 4UDTB 5KSVB 2BMKA 1ZHKB 1UM4L 3SEPA 3ME0A 3FMGH 1DN0B 5ACZB 1TZGH 4S1SL 4CADA 3CCHB 2AKRA 1LK2A 5E6ZA 1OP5K 3MOAH 4HG4K 1KIPA 1VHPA 4PY8I 1DUZB 1I85C 4ZFFA 2X4SB 1EMTL 1JI1A 3CXDL 3I6GA 1B4JL 4KC3B 2H6PA 5C0AD 3MCLL 3IJHA 1S7QB 3O3DA 5HYJD 2H1PL 4WFHD 3VCLB 2AEQH 2ADGA 3OKYA 4F8QA 1C5CL 2XRAH 1BMGA 3IFLL 5GSRA 1MQKH 2NYYC 3D69A 1SYSA 5I18L 3WD5L 4JVPA 2BVQB 4JEGB 4RAVA 4FQIH 4LBEA 3BT2L 1AQKH 2Y25A 3FT2B 3LKNB 4KUCD 3GZKA 4P2YA 2MKLC 3QEHB 4NN5C 1ZGLB 1UXSB 1GJIA 2OR9L 4M61B 5ISZE 2R0WL 4OZHF 3QIWB 3GMNB 1QA9B 4KWUA 1KN2H 1M7DA 4RNRB 1KXQE 4HCRA 3V95A 1Z6JT 1XGYH 3P40A 3GGWA 2H45A 4FXGA 4YIQA 1ZHNB 3OXSB 4JFPB 5I66B 2F19L 3T09A 1S7XA 3VRLF 3LVEA 4QRSA 4LVEA 4KAQL 3ESUF 1JWMB 2D9QB 3JV0A 1FFQA 1TJGH 3MSPA 4P2OA 4OSUH 5KS9B 1MJ8H 3DX7B 1OWWA 1RZIB 2IAMB 4C56A 1FL5B 1GHFH 1P7QD 4NP4H 2FECL 2VDLH 5IB1A 3PIQA 2IEPA 1JNHB 1ZXQA 3D85D 3MROB 1FFOA 3OAYH 3V0WL 2HFEA 4N1EA 5GRZA 3PNWB 1CDIA 4JHAL 1OD9A 4OZ4A 5IMOB 1A2YA 1KBGH 3MLZH 5IJKC 4Y4HA 1LNUB 1U8QB 3CLEL 3VFNB 3TN0D 1DLFH 3S8WA 4KDTC 1JPGA 4NM4L 3KYOA 4LVHB 1XCQA 4Z7UE 3BKJL 3SCMA 1HIML 3STBA 3K80A 2V2XA 1JGDA 3IETB 4I2XA 4L4TB 4U1SB 2YD3A 1JHTA 4U31A 1TXKA 4PJDE 4FG6C 4U1HA 2Z8SA 1S5IH 3S4SA 3IU4H 1YNKL 1FAKT 2EH7L 4O2CA 2BDNL 3PABB 5EN2B 2VZ3A 1JHKL 1A1NB 1AGBA 2QQNH 5DJ6A 1NFKA 4LPTA 4PLKD 4X6FA 4X98A 5F1NB 4WI4A 2IBZX 1GYAA 1OAKH 5KBNC 3ZYIA 4RGMB 4PRPB 2CLRA 4O4YL 5IM7A 3O41A 1HI6A 1T5WA 3QUYC 3F58L 4MS8C 1T7WA 4FQCL 4UNUA 4KKLD 1F90H 4WUUE 1N8ZB 4K71B 5SWSE 4EI5B 1EHLL 3KLAB 4JAMA 1BREA 5E1AA 4H0IA 5IT2L 2Y23A 3RZCB 3CFJA 2ZZUT 4G9FA 4OJFL 2EDHA 1J0ZA 3GJEA 3MRFA 3ZZ1A 4R3SA 4PS4H 4OZGE 1MHPL 2WBWB 4K8RL 2YUWA 3SDDA 1JMZA 1WFNA 2X4NB 3ARBD 2XTJB 1HNGA 5D96B 4LEOA 5DJXA 1MCJA 1Z3GH 5TGBB 3R0NA 3NIDE 1KTDB 1RUML 5IQ7H 3QEGH 4Y1AA 2YPLE 2E9IA 3QJFA 3JV4B 4ZPTB 2YWYA 4LK4A 2X4PA 4HUMB 4LCIL 3WFDL 4EKXA 5IIEB 4HFWB 5CBEB 5I9QB 3KNBA 2J6EL 4RCAA 3FB7A 3HZMA 2XZQH 4QRPB 2WUBL 3BVNA 1RUKH 5I8EB 1U8IA 2AEWA 2BK8A 3IT8D 3DGCR 1HSBB 3QNZA 3PWVB 3ARGC 5I1GH 3PJSB 4JRWA 3WEXA 4NC2B 2GJ6E 2C5DC 3U30B 5GS1B 3LKPA 3NCCB 4NO0A 5D7JA 2ERJC 1YEDA 4J3SA 3VGEA 2I9LA 4Z7VE 1YNTA 4XNQA 2D03L 3TCLB 5D4QA 3DSNA 4WU7B 4HUUA 2BY0A 1EFQA 2FEDD 3G6AB 4E41E 2JE8A 3HE6B 5HHQB 4NGHL 3L5WB 4EN3D 1ACZA 1M71A 2FL5A 3Q6GH 2W9DL 1FVEA 4IDJL 5D1ZD 4NWTL 1JPSL 4OKDA 1S9KC 4DGVH 4PJ7B 3CLFH 5DZNA 5F96H 4E0RA 3Q5YA 2GY5A 3D39A 1FE8H 4YEEA 5KOMC 3LEVL 4KQ4L 1OVZA 3QQNA 4KHTH 3FQNB 5KSBA 3KS0J 4WO4D 1SJHB 4JDTL 3V5HB 3PWPA 4LVNC 5HI5C 3GJFB 3VGAC 1ZEAH 5F9WC 3I9GL 1VEPA 3KPNA 5FOBA 1TTGA 1YMMA 5EU4A 3BIBX 2R1WB 2WWKO 4C83B 1GGIL 1G6RA 4OLWL 2QL1A 3HG1B 1EZVY 1SMAA 1PKQE 2CSPA 3VWKD 3BKCH 1MHEB 2BVUA 5FUCC 1KB5L 3PWUA 4DTGL 3SE8H 4XH2B 1G0XA 3QDMB 1AR1D 2BY3A 1HKLH 1CK0L 2WANA 2IALB 3G5VB 2BVEA 1NGXB 1ZVSA 4KJYB 5I17B 5CEXA 4PJAB 5CEZD 1MELA 4KK9C 4D9RD 2C3HA 3P30H 2PCPA 3DXAA 2OLDA 4Y16D 3STZB 4M7LL 5HVWA 4X9FA 4H1LH 1UACH 4I8DA 5TQ2L 3JTSA 4F7CB 1U8LA 2A6IA 2XKNA 3FZUD 4OT1H 1QQDA 3NZHL 2HTKC 1WF5A 4GBXA 3CUPA 4FFVC 3GSNL 4NUJA 4PUBL 5EPMB 4Y5XA 1MY7A 2YD8A 3AU1B 3KXFE 4NN6B 4ZFOB 3RIAK 3RWGB 2C1PA 5E2VH 1DFBL 3PWJA 1FYTA 1I7ZB 1DQDL 4ERSH 5I8OL 5JQ6H 1NEZB 1FLRL 3E3QC 1R3LB 3DVNA 4JZJC 4TNWF 3W0WD 4X9GA 3EYSH 1BJ8A 3VGDA 1CBVL 1U8MB 3BI9X 4TQEH 3VA2C 2FO1A 3VWJD 3CFIC 1A9BB 4LDEB 1YECH 3OZ9H 2HLFC 4RWHA 4YK4B 3H3PL 4U6VL 2EDRA 4JO3L 3QG6A 4K8RC 3GO1L 3UTTD 1J7VR 3HC0A 4NZDA 1O7VA 2LABA 5DUMH 3JWDH 5JOFB 4JM4L 1TNNA 5I30L 1LP9E 1B0GA 4NKMA 2PTTB 1ONQA 3EAKA 2P8MB 4HK0A 1NLBH 1J8HD 5IBUB 1X5FA 1X5JA 2CMRL 4KUCF 1NUGA 3MRRA 4NBYB 1JZ7A 4FNLL 1KTRL 1MCFA 3D18A 2I07A 3AROA 3CDGB 1BVKA 1SJXA 5F3HB 4XPTL 3B9KA 2OJEB 4HT1L 2DIBA 1T89A 4FQHB 3T0EA 1E6JL 2F58L 5SWZE 3C5ZB 4P9HC 5FECA 1X4XA 4OCLC 1DVFA 3FCTA 4H5SA 2R0ZL 4NZRH 3JV5A 4Y2DD 5GGRB 4GUPB 1FO0B 3BGAA 5MEOB 3QHFL 1VPOH 2G75B 1IAOA 4U1MB 3BRFA 1CR9H 3QUZA 3K81A 3K2UL 3PP3K 5EOCJ 1M7XA 4BQCA 2F53B 1MJ7H 4YHOL 3O8XD 1UZ8B 1RUAL 3MYJA 4IS6B 2ZKHL 4PJ9A 3VDAA 3BKYH 3U4EB 3O2WL 3RTQD 5IFHL 1JPFA 3FB6A 3MGAA 4LQFH 1T0MB 2HN7B 3H7BA 1A21A 1TDQA 2DL9A 3ARQA 4R96A 5C09E 1AFVH 5DQ9B 4JHZA 4XRCA 1FNEB 4RWYL 5CIPH 2XPGA 3BPNB 2R2BB 1E27A 5GGTL 3EYFA 7FABH 2BSED 4TVPH 2JLLA 1F11B 4ZAKA 4DGIH 4JY6A 5CGYC 2VOTA 4IRZH 4Y0GA 5CEZL 4ODHL 1O0VA 1MJJB 1YEEH 3RP1A 3QXDA 4Z77B 4RDQF 1HOCB 4RIRA 2W0PA 1I1FB 1SBSH 1NCDH 3M8OL 2C26A 1XF3A 3B9EA 2C9AA 4PY7B 4JZNA 5MI0B 3BIKB 5IHUL 1ZLWK 3UDWA 3I2CL 1WBXA 5FIEA 3ULVD 3KJ4B 2X9YA 2R4SH 2BC4A 5DMIL 4ALAH 4MXQD 2VIRA 2BOCA 3TJEH 4M5ZL 3NH7L 5I0ZA 5BV7C 4JFFA 4HXAH 1MI5A 2NNAA 4Q6YA 1JN6A 1P4BL 4UDUB 5IMMB 4PJEB 4ZO9A 1F4AA 5A2KH 5I15L 1I7TA 5EU7E 1PKOA 4P59H 2Z31C 4M93C 5EDXA 2Q7YA 5L0QB 3DGGB 1YN6B 2DLHA 2VAJA 2NY6B 3HI6L 3TLRA 3RGHA 4A2LA 5D2NA 1S8DB 2GKIA 2ARJA 1HE7A 3WNKA 1DE4A 3VD3A 1I4FB 3WDIA 43CAA 3BO8A 4JFDA 3C8DA 4Z78B 2DD8H 5JOEA 4ZOAA 3W5MA 1BGXL 2APBA 1QSEE 4PJXE 1KJ2B 1CLCA 3PL6B 4PJGF 4Z95H 4LL9A 5I6XC 5DC0A 1S3KL 4NQVA 4QT5B 2CUMA 4HH8A 5EFIA 1YQVH 3DMMD 4U49A 4NZTL 5ERWB 2AV7A 3QEQA 3RNKB 4OGAD 2IQAA 2X1PA 3QG7H 3CFDB 4ONHB 3VXSA 1GRWA 1EGJL 2VR9A 5D6CA 2UWEF 2NY4D 5FF6B 3LMJL 5E95B 3ZHLA 1T6WA 3HPJB 2GCYA 4LIQH 4PR5A 4JN2A 3TCXA 1EEZB 4BA8A 2VH5H 1Y18B 3LHPH 5E94A 3QIBA 3WXWH 3C60C 5FHAH 4G8EA 1CL7H 3VI3F 3VXMD 2A38A 4KI5C 5JQHC 1INQA 2H26B 3WFHB 5DI8B 3UZEA 4GW1A 4DN3H 2HT2C 3KPPB 5DD0H 3KDMB 1T20A 2WWMC 1SYVA 2Y5TB 3UTQB 2V6HA 5HJ3B 4KI5F 4JB9H 1OSPH 4KHXH 5F89B 2BNQA 4NKDB 3N1QC 4MVBD 1GH7A 4NFCA 2ZCLH 1C12A 1HN1A 1I75A 4S2SA 4DVRL 3VH8A 4KDWA 4ENEC 3HPLA 4DKFL 4DZ8B 1DANT 5F1IA 4MYWB 1J87A 3CFEA 3L3GB 4PV9B 2SEBB 1WTGT 4HF5H 1I9RH 2HTLC 1IT9H 4PJ5A 3BISA 1IGJA 1Q1JL 4R7NB 5HHXL 3C5SA 3AXLB 4O00A 3RDTD 2AQ1A 1XF1A 2Y36H 1NCWL 2IBZY 5KVEH 4M6ML 1Q94A 1B0WA 2ICWJ 1G9MH 4V2CB 3BHBA 5FYKD 1RD6A 3KPRD 1IBGL 1J11A 2WINA 2IAND 4BM7A 4JHWL 4P9MH 1A0QH 3W39A 4XMKL 5EWIH 3STLB 3QDGE 1ZS8B 5C70A 1KN4H 2DWEA 3I6KB 4MGXA 1NKOA 3FRPG 1QSVA 3UJTL 5C2BH 5I0DA 1A1OB 4UT6H 1A3RH 3QWRD 2A6DB 3LV3A 5DVNA 2D7TH 1A64A 5C0AA 4PGCB 1V3LA 4PJFB 5ETUA 5IHBA 4GRWF 1CL7I 4JDVB 3S37H 2CDEB 2WM0A 1LEGA 1HDMB 2R69L 3MNVA 4F7PB 1YJDC 1I1AB 4KI1A 5C0RH 4ZTOL 3KG5A 4DZBB 5HXMA 1IGYB 3CH8A 1MLBA 1KACB 4Z8FL 4CBPA 2A9MH 5L9DH 3IFPA 4UV7L 1MAML 1W0YT 4MB3A 1XGPA 3LKOA 2XWJA 3IDIB 3WO3B 3W2DH 5J13C 1K8DB 3BW9A 4LLWA 1G7LA 4W6YB 3SDYL 3ALWA 2CD0A 5D1XC 2F54D 2J6EA 1OTSD 4JPIB 5DD5L 3B2UC 1I3GH 2NY3D 3HZKA 4J1UA 4L4JA 4EXPX 1TCRA 5K93A 5I1JH 4AJ0A 1ES0A 1JPTL 1LO3L 1P4IH 4OLUL 3QDJD 4XCCL 1JNNH 5CINH 3WIHH 5DJZA 4CVXB 1J9CT 1LO2H 2NZIA 4NRXB 3HRZB 4RAUB 4MNGB 5HGHA 4LP5A 1WIUA 5IKCA 4AIXA 1Q0XL 5H2BB 3V0VA 1FSKB 4W68A 4OCYH 4X6BB 5IESH 4JG1L 1D5MB 3S34H 3LAFA 1H8OA 5ANMB 5EBLB 4L8SC 1A7PH 4IJ3C 3T2NH 1H15A 2NY1B 1TQCC 2Z4QB 2FATL 4JPKL 1D6EA 2LFGA 3BPLC 4QHMB 3L95A 4HIIB 4HDIA 43C9A 5FO8B 4QWWD 1AY1H 5F6HJ 1U93B 1QRKA 1Z9MA 3H3BC 3TN0A 3GSWB 4FZ8H 1NBYB 4WTXA 4OM1L 4X5LA 4Y5VC 4LLUA 4NHCL 4Z0BH 2OSLB 4ZS6C 3DBXA 3U46B 5CLTA 4WIQA 1HCFX 4P5TC 1GZQA 3ARRA 3KYMA 4QNPF 2FJGA 2BCKA 2NY0B 4LHUD 3KPSD 3MRGA 5E2UL 1OSZB 2N1KA 2A1WH 4TTDD 4YHNA 4KROB 5HHVL 3HB3C 1KB5A 2AABL 5DVLA 2D0GA 2NW3B 5EBGA 4M8VA 5FYKL 2UV3A 3RFZC 1C8PA 4FQXC 2I9TA 4OZHE 4ZTPH 4D2NA 3RPIB 2GHWB 3ARFC 5F3BB 5INCB 1F4XH 5EA0H 4O51B 5A2FA 2A73B 4HS8H 3OXRB 3RHWK 4XHJC 2O5XL 4JPWL 1IL1A 4HIXH 3VRLE 2FZ3B 3ZKND 4HLZH 5F7KC 3OG4B 4R97C 3ZTNL 3UMTA 2D0HA 2ZUQC 2GTWB 3P9LA 5C0BB 2AQ3A 3GSNA 3V6FB 3MV9B 3U0WH 3T77B 2V9QA 2Z31A 1UEMA 3UBXG 3MXWH 4LLDB 3RIAF 3LN5B 4Q9CA 3QPQC 4TSCL 1HCVA 5E8NA 1EAPB 4KRNA 2NLJA 5FDWB 1WQVT 3ARBA 3DV6B 1FG2A 1CGUA 3WHXB 4BZ1H 1QLFB 5I1IH 4LVOB 4KRPC 1P84J 3IDYB 5DK0B 4GKSA 1IC4L 1J0JA 2XA3A 3D1MC 5EO9A 2RFXA 3BFOA 4P2QD 2UWEA 1QLRB 2EIZA 5F7DA 2JB6A 4LNRA 1LO4L 4QRUB 3FFCB 1U3HC 3CPLA 1OL0A 5F7EL 1FH5H 4D8PB 3OB0H 5TH2A 3VFMB 4R90H 4NUGH 3O45A 3RKDC 1FRGL 1TZIB 3N85H 1QTYT 1BQLH 2DLEA 2R8SL 4IEFB 4XVTH 2FRGP 3D6GA 4WU5B 4YH6A 3LKQB 1N3NB 8FABB 5C0IB 3RAJH 1RZ8B 3ROLA 1I1YA 4EN3A 2ZPKL 6FABL 3HNVL 5C0FB 2LQRA 5D1ZA 3AY4C 5I74C 3VD5A 4PRBB 1MLCB 4XMPH 3B3IA 4MQ7A 2DQIH 4N0YH 2NX5E 1S5HB 1B6DA 3OJVC 5KZCB 3MGTB 1TQBC 1I8MA 2JJTA 1NJ9B 2P43B 3QXUA 3I50H 4X4YA 2BVPB 3MC0A 5GISH 2APWA 1CFNA 2UY6A 2IC2A 4WO4A 3NPZB 4QF1A 3O11B 4OZFG 5BS0E 5TDOA 2HLAB 3JVGC 4TNVK 4RISL 2X9WA 4FOMA 1SBBA 5T3XH 3N1FC 1XF2A 3CSGA 3BSZL 4WV1A 4AIOA 4ODUA 1H5BC 4DVBB 2YXMA 1QKZL 2FX8H 1KGCE 4J8RA 4P3DB 3HR5B 3VWKA 1KELL 3VFWA 2V2WA 5EG6C 5KVFL 3HS0B 1QHPA 3TVMD 4JM2D 3CH1B 4F58H 4Y5YC 3QIWD 1EHNA 3INUL 3VXRE 1MAJA 5GGTA 5AYUL 1G84A 2F8VA 4X4XB 3AREC 4OF7A 2HFFB 4G5ZH 1VACA 1MHHB 2EH8L 3H6JA 2G2RA 3ULUL 5IBUG 3KLHC 2MQ3A 3D0LA 4OZIB 4PRAB 1FPTH 1ADQL 4KK6D 3TNMA 3ZKMD 2PXYB 4OIIL 5EOQH 3VRJA 1JGLH 4KZDL 2A0LC 3REWA 1HH6A 1WWBX 5GRUH 3FO0L 3RVUD 3VDCA 3WFZA 1P53A 5DEFA 3K3QA 3O2VL 2HFTA 4BKLB 5FUOL 1X7QA 4LLQB 1Z0MA 1CICC 1I8IA 2D31A 2ADFL 1CXKA 3IDXL 1CLZL 3CSYB 4H25A 4Y19E 3FN0L 1ORQB 3S3SA 1OARL 2CDFA 3W0WA 1UT9A 3CZFB 4YUEL 5GGSY 2XNAB 2G60L 4L29B 1AHWC 3MRJB 5DD3H 5CEYA 3GJFK 2QSCH 3UTTA 5BRZA 4L4TD 1PX4A 1OGTA 4K9EC 1AQDB 1HYSC 5BZDB 4WDIA 1FGNL 3CDCA 3BUYB 3FAWA 2R2HB 4NBXB 3S36L 4RSVA 3L7FB 2I5YL 3KPMB 5IEHB 2G9HA 2YR3A 4UMGA 1R24B 2XI9A 4NJ9H 1UKSA 3U9PH 1B0RB 4PRPD 5K59F 1EIBA 4OFKA 2CKBB 4ZFZA 1HXYA 2CQVA 4X7DC 4NYLA 3L3HA 3OX8A 4NO5A 3UO1H 5HVHB 3RL2A 4NWUL 1EGJA 3TC9A 3MNZA 3V52L 5FUCE 2ITCA 3VG9C 4HBCH 4EI5D 2K3TA 1QACA 4Y2DA 5KSUB 1PGRB 2WBJD 4ZXBD 5FA4B 3RZCD 1Q9OA 1MCRA 4EDXA 5HY9B 4MAYC 3L5IA 2DQJL 3FB8B 4H0HB 1KIRA 3O8XA 2XV6B 1LO5B 1A6PA 1M7IA 1MCDA 2BSTB 3GMMA 2XTJD 3LQZA 4HKXB 2B4CC 3H9SE 3QJHA 2GK0B 3CX2A 3RTQA 2ZP0T 3ARDB 4L4VB 4ESKA 4F15B 3MOBH 1PZ5A 2GSGA 4Z7UB 2IFFL 2DI9A 4P23B 3O9WB 2HKHH 4HS6B 3TNNB 5CSZA 5E8PA 3D2UD 5E5UB 4LARH 3GMLB 4CVZB 4HEPG 1FN4A 1J05A 1OAUH 4HPYH 4L3EE 4QRPD 5FEBA 1UM5L 4RMQA 3E3QE 4A6YH 1IC5H 2H32A 3CFKA 4IRSC 5IK3A 3MRPB 1BM3L 4GAFB 4H0GA 3W9DA 1A6VH 1XR8B 2E5EA 2B1AL 3JTTB 3NIGF 1LEIA 4KK5C 5DFVC 1AXTL 4G6KL 4NQUA 1EBPA 4JANA 4PY8J 2ZOKB 1HK6A 1EXUA 2VSCA 4PJCA 1M05A 4OKVB 4X7CC 5GS0D 4RFOH 3HE6D 4NT6A 2R56L 2YPVH 4XC1H 1F8TH 1FFRA 4R4FH 4WUUB 3D3VB 4HK3J 2JJSC 3DUUA 3LRSA 2ZNWA 2HKFH 3MBEB 4O2EB 5KSAA 1JK8A 3BP4B 3UAJC 4UB0L 5DO2D 3EFDL 1TVBA 4GKOA 2DWDB 4UUJB 4QGYA 3ULUF 2HG5B 4XVUD 4ZUTA 4M6AA 4CU6A 1WIPA 2CK0H 4JFQA 4XAKD 2FNBA 5E8OB 1XF4B 5CJBA 5HGBB 3SDAC 5D70L 2RHEA 3IDGB 1T1XA 4NDMB 2C4FT 1FP5A 4GAYB 4KKCD 5IFAH 5MEND 3CXHK 1CQYA 5BW7C 1WLHA 1I9IH 3OKLB 4XP9L 3HG1D 3LQAL 2UVFA 2JCCF 5DJAA 2HT3D 1YY9C 2V5SA 3U82B 5C0NC 2Z93A 1AIFB 4UAOC 4AEHH 4U1NA 2B0SL 3QDMD 2GJ6B 4U1KB 1G7PA 2X4OB 4TOYL 2H8PA 4QTHA 4YXLL 1CFVH 4LSDA 4XNXL 4QXUH 4Y4KA 1JE6A 1IQWH 2W92A 5D7IF 3MV7A 4P5KA 3FRUB 3SO5A 1L0QA 2LTQC 2GT9A 3HAEB 5B22A 4UI2A 3UJIH 3HZVA 1GZPA 1KJVA 1DLHB 4RMUA 1WZKA 4M8QA 3KAAA 4UTBH 5CKAA 3T3ME 3ZHKA 5E56A 2FEEI 2YS4A 2JK5B 4JN1H 2J8UF 5K33A 2AJVH 1DJSA 2A6JA 5H8DA 5IB3A 1GPOH 4Y4FC 4M48L 2FDBP 3TO2B 2VABA 3VXMA 5E00A 5MP6H 1T22B 4X6CB 1DL7L 3WL9A 3G5YA 2ATKA 1SHMA 4YHYC 5IEKB 2QV2A 3R1GL 5D93B 1R3KA 3NFSH 5KTEH 2VDNH 3WBDA 3RVVD 5FFLA 1MWAL 4Q7DA 3VXUB 1RVFL 1BQHB 5EC2A 4I18C 1X5YA 3BN9C 3HRPA 1MFCL 2WUCH 4WI7A 1G6VK 3VFRB 2YA2A 4HC1H 3SDXB 2DYPB 1TPXB 3QWOB 4APQB 5C6PB 3KPOB 2IWGA 5HDQH 2CLZB 3W9EB 5ID1A 4XPAH 4AENB 1J18A 1ZVHA 5GS0L 5TE7L 3OJMB 3F5WB 3RDTA 4I77H 4I0PB 2IGFL 4PJGE 5KW9L 4PBVC 1LGVA 3S37X 2FJFA 3BESR 3KPRA 4WNQB 3WLBA 1EVUA 1PYWA 3PQYB 3B5TA 3RHWF 3SGJA 2XRAL 2V5TA 3KXFB 1RHHB 3MR9A 1MCEA 3OKDA 5CJQL 1MQKL 2G5BA 3GSUB 2B2XH 5EOTA 3TIDA 1CDGA 3TT3L 5IFJA 4YDVB 1FV1B 2YUZA 2CR6A 3DX8B 1GGBL 3QWRA 1XIWB 5I75C 2F53D 3O4LE 3IAGC 1P1ZA 2BXZA 1J8KA 3DO7B 2MWCA 4AH2A 2HMIC 4X5WB 1KN2L 3MUGA 4S1QL 1OPGH 5EU3B 1ZKAA 1DQTA 1DZBA 4D0BA 5C9JA 12E8H 1XGYL 4F33B 4TUJA 1QZ1A 3V8OA 5FB8A 3VXPA 4FZEH 3C9NA 4LAJH 1R3JB 3BYTA 1NCBL 4KI5E 1WAAF 1MNUL 2HT4C 1DN2A 1YPZB 4PTUA 4YHPA 4QXWA 5D2LF 1MY5A 1LP9B 1NCAH 1R3IL 5IVXF 1TJGL 2E7BA 1RUPH 4LGRB 4YDIH 1MJ8L 4V1DB 4BH8B 4BSWB 3BZ4B 3T2PA 5ESQA 1DQQB 2ADIB 5DMKA 1UKQA 5DJYB 5E2WH 1P5VA 4AT6B 3WSQL 1HKFA 1T7VA 5IW6A 1GOGA 1OY3B 4POZC 5CBAA 5E99H 1UZ6E 3QDJA 1CD9B 5JIKA 1RJCA 2NXZB 5GJTH 2GUOA 2QKIA 5AD0B 3GMOB 2X44D 1NGPH 4B7IA 3MLZL 2VDQL 4JKWA 1DTUA 3MV8B 5FK9A 2FR4A 4I9WD 5AWNL 5FUZL 4H20H 2M2DA 1Z0NA 3JWOL 3WJLA 3RWCB 5SWQB 1AP2A 2W0LA 1U0QA 3G6JF 3T0BA 3B8YA 3MOQA 2VDRH 3F12B 4X0KB 2BMKB 1JVKA 1QBLH 3BEVB 5DGRA 4WFGE 3TA3D 2HVKA 2NXYB 5JW3H 2XQBH 3MODL 4U3CA 1S9YA 5I1HL 3OR6A 4G80A 4KMTH 4LSQH 5MHSD 4E5XA 1LK2B 2QQNL 5DJCB 1YN7A 4F7EA 5C09B 1DUYA 1XGQA 1OAKL 4GRWE 1JF1B 5FO9A 3WDJA 4ZFFB 5I1KH 5CWSB 1B2WL 4LHUA 1RUQH 1CT8A 2E8YA 2H6PB 5C0JA 3IJHB 1I3RA 3L3KA 3O3DB 1T83A 3LZFH 1N59A 2ADGB 3IDUA 5F9OH 5GSRB 4QOKD 1BWWA 1OP3H 3D69B 1SYSB 3TBVA 2BRRL 4RAVB 4LBEB 1NLDH 1U9KA 2EIBA 2AEIT 3PDGA 4PS4L 3S5LB 1ADQA 1BP3B 4ELMF 3QH3A 4KY1L 3FO1A 2DJUA 4RGNC 5LBSH 2EO9A 3AS0A 1FAIH 3QEGL 4NZUH 1KJ2H 1OGAA 4MJ5A 5HVGB 3SDAA 1H3WM 4YIQB 1U91A 1S7XB 1F5WA 1SJEA 3LQMA 4P46C 3QI9A 4HQQH 4QRSB 2JCCA 2XZQL 1RUKL 1CFBA 1NUNB 4HHAA 5I1EH 4PRIE 1FFPB 5IB2A 5E24E 4OF0A 4P2OB 1BIIA 1U2HA 1VKXA 3JSSA 4UTAH 1SY6L 1IKNC 4NOFA 5HPMA 5JXED 3NABL 4PJIE 5IB1B 3PIQB 4KDVA 5DJ2A 3VD7A 4P2QA 1FFOB 3L5XH 1A6ZB 2HFEB 2MPAL 4NQSA 3P4OA 4OZ4B 1A2YB 1ZHBA 1T4KA 4NJAH 5FYLE 4Y4HB 2FSEA 4UDTA 4WY7H 1F3JB 4DGVL 5KSVA 1TTUA 4EBQL 1KXTB 1VGKA 1KEMH 5KOVC 1JPGB 4X4MA 3KYOB 4U0RC 4RBPK 4KHTL 2VDPH 1OT2A 3SCMB 1FJ1A 1KIQA 2V2XB 3BAEL 3MLUL 3AM8C 1JHTB 3U83A 4YXKL 3WLWC 1ZEAL 4TSBL 2HRLA 1CGSH 2BSSA 4GKNA 4OCRL 4U1HB 3S4SB 1DUZA 4O2CB 1CFSA 5EUOE 5HHME 2X4SA 1PW3A 4JHBA 4KJPD 1AGBB 4P4RB 5DJ6B 1A9EB 3P3YA 4X6FB 4X98B 2VXVL 3U0TA 1KCVH 3KHQA 3N06B 4Z7NF 4G42A 1HSAA 2CLRB 5HDLA 5IM7B 4G3YH 4JJHA 3ZE1F 1O5DT 3SE8L 5EBMB 2VLJE 5DRXB 1I1AD 3RUGE 1HKLL 3QEUB 4U7MA 5ECJE 4YBHA 3SKOA 4XWOC 1ZHLA 2BVQA 3B83A 2HVJA 2WV3A 2XXCB 3VXNA 1A7NH 3A6OA 3FT2A 3LKNA 4I3RH 5E9DA 3P30L 3TPKA 1SVCP 5E1AB 1K2DA 3LDBC 3RVXC 3CFJB 1F6AA 4G9FB 3TVMA 5C1M