2OM6A

Hypothetical protein (probable phosphoserine phosph (ph0253) from pyrococcus horikoshii ot3
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
233
structure length
233
Chain Sequence
MREVKLVTFDVWNTLLDLNIMLDEFSHQLAKISGLHIKDVANAVIEVRNEIKKMRAQASEDPRKVLTGSQEALAGKLKVDVELVKRATARAILNVDESLVLEGTKEALQFVKERGLKTAVIGNVMFWPGSYTRLLLERFGLMEFIDKTFFADEVLSYKPRKEMFEKVLNSFEVKPEESLHIGDTYAEDYQGARKVGMWAVWINQEGDKVRKLEERGFEIPSIANLKDVIELIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hypothetical Protein (Probable Phosphoserine Phosph (PH0253) from Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
molecule keywords Probable phosphoserine phosphatase
total genus 83
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature ec 3.1.3.3: Phosphoserine phosphatase.
pdb deposition date 2007-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.400 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2om6A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2om6A01
5AI0A 1Z4OA 5ALHA 2P9JA 4FYPA 4H1WA 5AVXA 2GHQA 5AKKA 1ZS9A 5AM1A 1TJ3A 2W43A 2I6XA 3OPXA 4KNVA 3N07A 4OHFA 2OYCA 3UMGA 4Y2RA 1L7OA 4HGQA 3EF1A 4G9BA 1T5SA 2IA5A 2HF2A 3A1DA 5ALYA 3WK4A 2Q5EA 5AVWA 1FEZA 3MC1A 2YMMA 2NYVA 3U13A 3WKAA 5A3RA 5AW0A 1Z88A 2VKQA 2R8ZA 3M1YA 4EEKA 2P69A 3SLRA 2ZBFA 1Z4QA 3QUQA 3U7HB 2O9JA 5AK4A 3SD7A 3QXGA 4OD0A 4C4TA 4DFDA 4ZEWA 3QU9A 1QH9A 3GYGA 3QUBA 4HYTA 1VFPA 2B30A 2ZBGA 4KN8A 4J2TA 4UAUA 4BX2A 1L7PA 3U7FB 2FUCA 2BDEA 3ED5A 1XPJA 5FP0A 3W5AA 4Y3UA 3WKDA 2HF7A 2R8EA 5AW1A 3UMBA 3ZVMA 4EZEA 2C4NA 1ZD5A 2WF7A 1NNLA 2QYHA 1RQNA 3KD3A 5ALZA 3QU4A 3SF0A 5ALGA 1JUDA 2C8LA 2WF9A 3A1EA 3M9LA 2Q4RA 1J97A 1Z4KA 2HX1A 2B0CA 3DAOA 3DV9A 4BKMA 3L7YA 1U7PA 2P11A 3EWIA 3BWVA 2HO4A 1WVIA 3ZUPA 3AR9A 3ZU6A 3R4CA 3ZX4A 2EATA 3EF0A 4BEWA 4BBJA 3WKBA 3AR2A 4Y2VA 5AKZA 2GMWA 2YBDA 3RF6A 5ALPA 1ZJJA 1U2TA 1VJRA 5IT0A 1Z4JA 1X42A 2RB5A 2HSZA 3TLMA 5ALQA 3SMVA 5ALUA 4YIHA 2W11A 3HYCA 1XVIA 1KYTA 2C8KA 3FM9A 3IB6A 4MUMA 3OCUA 4KX5A 4NV0A 2AH5A 2YJ6A 4MWOA 4EENA 1T9ZA 3N1UA 4I9GA 1NF2A 3HLTA 2AGVA 2HOQA 5AKLA 4JB3A 3P96A 3ZX5A 2FPUA 1U7OA 1T5TA 5A3SA 1S8OA 3QU7A 4FFDA 5AW2A 3AR6A 4BEVA 3W5CA 2JAOA 3EPRA 3VAYA 3ESRA 2X4DA 5AI5A 2I55A 2MU1A 2ZG6A 2R8XA 4B6JA 4CF3A 4ZEXA 1RPZA 3I6BA 3NASA 2WF5A 3AR8A 2I54A 1RMTA 1Z4PX 2HEGA 3L8HA 1L8LA 3L0YA 2PQ0A 1O08A 4UATA 4UAVA 5AICA 2NO5A 2GFHA 5ALRA 5AK6A 3DDHA 4HGNA 2OBBA 4Y2XA 5AKXA 4YCLA 1RC8A 1SWWA 1Z4LA 1O03A 2P27A 3L1VA 1WR8A 3PGVA 3S6JA 4F72A 3NANA 2ZOSA 4CNQA 1CQZA 5ALOA 3L0BA 3FPSA 1AQ6A 2W4MA 1K1EA 3WK9A 4F71A 4ZEVA 2C9MA 3L8FA 5AIAA 3N8GA 4E88A 1QQ5A 3MPOA 2PKEA 3L0CA 3B9BA 2RARA 2B1RA 4HGOA 5ALFA 4HGPA 3L1UA 3WK5A 4QQFA 3W5BA 5AVTA 5ALTA 2YMQA 3AR3A 3OTQA 3CZ4A 1RRCA 5ALXA 2FEAA 2HDOA 3QUCA 5AI9A 2I34A 2FPSA 2YJ5A 4IG4A 5ALEA 5ALMA 4C4RA 4DCCA 2IYEA 5AVZA 5AI4A 3ZTYA 3ZVLA 5AW6A 4PNHA 2EAUA 4NABA 1YJ5A 1XP5A 2O2XA 4Y2PA 5ALLA 2QLTA 5AM4A 5AVVA 2WFAA 1YNSA 1RMYA 2G06A 1RKQA 3IJ5A 1RMQA 3N5KA 2FI1A 3ET5A 2HCFA 2G0AA 5AW8A 2Q4TA 3QX7A 4L6CA 1QQ7A 2YMLA 2ZBDA 1TA0A 4AS2A 2D2VA 3OCYA 5AW3A 4C4SA 2CN1A 1LVHA 3AR5A 1TJ5A 3KDPA 3OCZA 3UMCA 3PCTA 4KNWA 2YMPA 1Z4IA 2PR7A 3ZTWA 1ZOLA 3B8EA 4BNDA 3ZI4A 2EARA 4NFLA 2I33A 2GO7A 4CE6A 3NAMA 4YGYA 2FPRA 4CF4A 2HI0A 1YS9A 3QYPA 2YJ4A 2G08A 3BA6A 2YN4A 2IOFA 2MSNA 3OCVA 1WZCA 4NWIA 2CFSA 5ALSA 4EELA 3U7GA 3FGOA 3WGUA 3D6JA 4EX6A 4CF5A 4DW8A 4XQ0A 5AKYA 5IT4A 3OCXA 4L57A 5AKEA 4I9FA 3SHQA 1SU4A 2B1QA 1EK2A 4KYTA 1Y8AA 3ESQA 4G63A 4DWOA 3R9KA 1IWOA 3QUTA 2CFTA 4IFTA 4XOUA 1RDFA 1ZRNA 3FVVA 3R09A 2OM6A 1Z4NA 4UU0A 1U2SA 5AW4A 1RKUA 3E8MA 4Y2UA 5AM0A 2FPXA 1YV9A 3QGMA 5AKHA 5ALIA 1L8OA 1WPGA 4AS3A 4QJBA 2BY4A 5AHXA 1YDFA 5AW9A 3SKYA 4Y2YA 4UASA 2CFRA 3WK8A 1RKVA 2RBKA 1YMQA 3KOOA 4UW9A 1EK1A 3K1ZA 3KBBA 2WM8A 1Z5GA 4RESA 3L8GA 3WKCA 1NRWA 1L7NA 1S2OA 4BYGA 5ALVA 3ZW7A 1VJ5A 2G07A 2JARA 4OCZA 1ZD4A 1QYIA 3UM9A 1ZD2P 1RLMA 3MMZA 3U19A 2FPWA 3E58A 3AR7A 3L5KA 4Y2TA 1CR6A 1RQLA 2IOHA 2YFYA 4RETA 3ONNA 1TJ4A 3KC2A 2WHEA 4UM7A 1QQ6A 3ZWDA 4OFZA 2B8EA 5AI8A 3N28A 3E81A 4NAVA 1L7MA 1L6RA 1Z5UA 1TE2A 4UARA 5JJBA 5AK5A 5AK3A 3NIWA 3WGVA 1MH9A 5AVRA 1Q91A 1ZD3A 3QLEA 3F9RA 2ODAA 5AW7A 4KX3A 3QNMA 4Y2SA 1Q92A 5AIBA 1RLOA 3L8EA 5AVSA 4EX7A 4YH1A 3WK6A 4XPZA 2R8YA 5AKIA 2G1AA 2NO4A 2I7DA 2AMYA 1N9KA 4Y2QA 2ZXEA 2HHLA 3U7EB 2DQSA 2JAWA 5ALWA 2AUTA 2IOFK 4HGRA 3FPBA 3ZWKA 3QU5A 2JGAA 4UMEA 1LTQA 1N8NA 2YY6A 2JAUA 5AW5A 1J8DA 4JDPA 3A1CA 2C88A 2FDRA 4GXTA 4BNDB 3B9RA 2G80A 3MN1A 2YJ3A 4J03A 2B82A 5AI6A 4UMFA 5AM3A 5AM5A 5A3QA 3QU2A 1SWVA 2B8JA 4YCMA 1F5SA 2ZBEA 4UMVA 3W5DA 2RAVA 3WKEA 1RLTA 3NRJA 3PDWA 4HAIA 2WF8A 4BX0A 4XE5A 5AM2A 3U26A 3E84A 3RFUA 1Z4MA 4YIKA 1ZRMA 3ZVNA 2GHTA 5AVUA 2G09A 3NALA 3WK7A 4UMDA 5AVYA 5T41A 3OCWA 1PW5A 1U02A 3CNHA 3J7TA 3SKXA 3KZXA 4GIBA 5E0OA 3I76A 4AP9A 3FZQA 5ALDA 4UU1A 3NUQA 4FE3A 2BDUA 3AR4A 5ALNA 4BX3A 4O8CA 5AKJA 5ALKA 3PGLA 2WF6A 3IRUA 4YCNA 2FUEA 3A3YA 4L6AA 5IS2A 3DNPA 5AESA 4Y2JA 4UM5A 2OA0A 5AKGA 3I28A 5ALJA 3I1YA 5AVQA 3ET4A
chains in the Genus database with same CATH superfamily
1O96B 2KKVA 3QZ7A 1E1LA 1EP2B 3AF4A 4FYPA 1P6QA 3R75A 1Z15A 5AKKA 1Z82A 4JOSA 2RGYA 4TLBA 1R6VA 2Z5GA 5E4TA 5K3CA 3NYQA 1JHPA 2FZKA 4BVHA 1YONA 4JLPA 4U6PA 4ED3A 4Z6DA 1TEVA 1VKJA 3BRWD 3GT0A 4UD6A 2OAP1 2WE8A 1CRZA 1P1BA 8LDHA 2BRUC 2FFQA 2CT8A 3AN1A 2Q5QA 3DJYA 2ZDQA 3T38A 2AQ0A 3FR8A 3F53A 2ISPA 2HY7A 4F1KA 1RAAA 2NAFA 4QKQA 2F59A 3RBEA 4LGYA 1H4TA 2C4TA 5B3LA 2H5IA 2V8BA 1G21B 3M4ZA 2KHZA 3PE4A 4YUAA 4JV5B 2XVTA 4BLQA 3PFIA 3NC1C 4MW7A 5E8JA 3GA7A 2WIKA 1C8VB 3IPCA 3TLAA 2EJCA 2Z9DA 3KG2A 4QASA 1XRPA 3K3PA 1P91A 4D4KA 1ZIPA 4ITRC 3BOSA 3HCBA 1Z5NA 4UFOA 4NBRA 2W3RA 1RWWA 3FTEA 1V96A 1Z29A 2TECE 5JWRA 4CN8A 4L7QA 3M5PA 4ND1A 5EUCA 3THXB 1C1XB 1C30B 1NU8A 2QX6A 1LKYB 2HIMA 2ZSUA 3GYGA 3O4GA 4Q7JB 4ZDKA 5L3SB 4DV3B 2B30A 4J2TA 1K8RA 3N0TA 4AZTA 3KWMA 1IBCA 4S2EA 5BSTA 3OEHA 1DXQA 1K6JA 4DL7A 4MARA 5D5HA 4P5EA 3MFIA 1J8MF 4DJJA 3PQFA 4WADA 4TYNA 3TI9A 1ECLA 2PYZA 1LV5A 4ZQGA 4V0OA 1BW9B 2HRBA 3CC8A 2H0QA 2W93A 5T57A 2H2GA 4PGXA 2FN4A 1CYDA 2OC9A 3B3AA 5JMTA 2VDKB 2XRZA 1NVEA 4F5RA 3LLSA 4TKZA 4YJGB 5K4HA 1F7UA 2AKEA 2LUOA 2OCDA 3U7QB 3GHYA 1M2HA 3GRYA 3R0VA 4IZIA 4AIIA 4RTLA 2IY9A 2FLNA 1RE0A 2F6RA 5E1BA 4WBNA 2FSHA 3ITEA 4ZAWA 2AU0A 2W9CA 1ZHHA 3AHGA 1HUQA 1NQVA 1RXEA 3MDCA 1TEXA 2R5NA 3IUQA 4KBFA 4MS1A 4HDOB 5EHIA 4D4JA 2B25A 2FG6C 3DV9A 1G5TA 1JRLA 3BK2A 4R5MA 2PD3A 5H8WA 5JNUA 1MO3A 1PTKA 3BQTA 2HLDD 2ORED 2DT5A 2TSYB 4QO7A 1PZNA 1JEJA 2C99A 2I6UA 2CE7A 2XUPA 4IMIB 5F78A 4HVCA 1VPVA 5B1YA 5AUPB 4DM3A 1I7QB 2X13A 1QP4A 3V7KA 3PD1A 2D1QA 2X76A 3G1WA 5G53C 5PNTA 3L7JA 2ZIAA 4DUYB 1NW3A 1Q0RA 1QRUA 1NN5A 2P3LA 1RCUA 1AC5A 3WL8A 3QFFA 2PGJA 1VFNA 1Y7LA 5B57C 1T4MA 2C82A 4YGXB 4Q9DA 1O77A 3LF2A 2OESA 2HSZA 1FQWA 5ALQA 4M83A 3AV0B 4G1EB 3T1OA 4ZI5A 3PEUA 4PHTA 1KC3A 1JHDA 1E9SA 3BC1A 5BOVA 4LDRA 5JHHB 2ST1A 3SJZA 2PDAA 3DP9A 4G5QA 4PAQA 1EBFA 4G41A 1E1KA 1BDIA 3CG4A 2ZUSA 5HKKD 5IVKA 3GR6A 2ZBPA 4B71A 2AH5A 5JROA 4EENA 3C16C 4ENTA 3TDKA 2PANA 1T9ZA 2DUMA 2VH1A 3NW9A 1X9XA 2H3FA 2X8JB 4P7GA 5T3YA 4CKXA 2VHZA 3AOEC 4RXTA 1WZIA 4BQOA 2X3YA 2DHRA 4LNAA 4LQCA 2CJWB 4OHZA 4NLLA 1QNLA 3F6SA 2Y92A 4QNLA 3FCOA 1N62A 2QI9C 3TRDA 4ARZB 2V96A 3U4QB 2H00A 4LRUA 1WUJS 3WZ2A 4Q47A 4FNMA 3W5CA 1GKYA 2NU8B 3BB3A 2IKSA 4D82A 4YRTA 4DRZA 3R5XA 1J8YF 1KK2A 2JNWA 2XRYA 3H4MA 2HUPA 3SF8A 2CB9A 2EX4A 4JLKA 5JFOA 1QBGA 1BMDA 1A0PA 1WJGA 4V0MA 2CXHA 1GARA 221PA 1VBFA 4UB3A 2FP3A 2FKNA 2HA2A 3EMBA 5EJ4A 4PQGA 5JH7B 2HHJA 2PVCA 1G64A 3EVZA 4UHCA 2IIVA 4OMDA 1NLMA 4V3CA 3BTVA 3KPWA 4LJLA 4H3HB 4L02A 2ATVA 2OSVA 3Q8MA 2JV3A 2EW1A 2NXJA 2B7LA 3FHCB 1P0QA 3R5SA 1RBYA 4P93A 1YBFA 3T3NA 3KZNA 1UOEA 2Z6UA 3HMQA 4H17A 5F9NA 4ZOLA 2WUDA 1ES9A 2OL4A 1LDEA 1RZVA 4MV8A 4M1ZA 2W42A 1ZNXA 5CLFA 3USCS 1HTBA 3C4JA 1CB7A 5J9FA 1VLHA 1KYWA 4G81A 3KT6A 3QBTA 3RSSA 4N76A 2R7NA 2IF0A 1VG0B 1A4XA 1X13A 1B0AA 2NZVG 4OV6B 5J4YA 1MEOA 3AUFA 2PWAA 3I04A 1ZWKA 4QE3A 1EBBA 1CJSA 1V3TA 3A1NA 2E21A 1H2WA 2XCOA 2CVFA 3IUYA 4P81A 4R8KA 1Z3CA 4S0ZA 4XYBA 2MR5A 4FNAA 3OPYA 5KSPA 5J0UA 3WA7A 3SKVA 1UOQA 1SZPA 1YUBA 4PAOA 1MX9A 4S1PA 1BU5A 4PTLA 3TD6A 3EAQA 3ZC3A 3H19A 4UHKA 3F3KA 4R8SA 4BV2A 2K4PA 2XD9A 4A26A 4M36A 3R3JA 2B1RA 4V1CA 1QGUB 5JUMA 1A9PA 2X8LA 3ISJA 5DT9A 3Q10A 5B1DA 4B3CA 1MAUA 5CIQA 5CH8A 5M3BA 1AX9A 1FP4A 2GO1A 2GPTA 5DOZA 4RKRA 4QQFA 5GJVC 3JQ9A 8ICOA 4II2A 2PL1A 3OO0A 4RCVA 5H59A 4AL4A 4YREA 1PIWA 4DJFC 3ISDA 4H59A 3CZ4A 3MG9A 1PWXA 4LF9B 2GOYA 4C7OA 3H40A 2Q45A 2FWBA 3CMMA 4KN9S 1JJBA 4PV7A 1WHTB 4BS9A 4EI7A 5JLJA 4V0SA 4UNRA 5AI9A 4KLRA 5KAPA 2BMJA 4AFNA 4B0OA 2FPPB 3LUJA 4KMRA 4R1UA 2OH2A 4F11A 1K3UB 2C54A 3AJ8A 4RIFA 1L5NA 1Z7YA 4ECUA 3R5KA 3RVSA 1HA3A 3UATA 4W5OA 5G5HA 2AA3A 3T12A 4W5WA 1EDEA 3BCSA 3QSYA 4KLTA 9ICGA 4QBKA 3WY9A 4CLRA 2I2BA 1XP5A 4XIYA 3SMQA 1M2FA 5ALLA 4RQTA 2HU7A 4CKEA 2YKGA 3KYDB 2XT0A 2QX4A 1MTZA 4MI9A 1H0HA 1GKKA 2B34A 3AKEA 4K28A 4IDHA 4ZGGA 2JB9A 5FTLA 3KSMA 2CBZA 1OSNA 2JIRA 2J0SA 3N53A 4WXRA 3UB2A 2O23A 4FHDA 4AZVA 3WADA 2FJPA 5JISA 5KVSA 2ONKA 4HZUB 1RMQA 1Y4UA 3RSLA 1ICEA 2PLAA 3NRCA 3PJFA 3PSTA 2FN3A 3DZCA 1MGOA 5AHOA 1ZFNA 3ILVA 5D3MB 1P8AA 4CRWB 4DCVA 3M49A 3RRZA 1QQ7A 4FGUA 5AXDA 3AF6A 4MUAA 1WNTA 1IXYA 3OF5A 5HBRA 2QW0X 2Q62A 3JPYA 4RHTA 1HFWA 4A8EA 1SHZA 4DQQA 2Z95A 3DOHA 3EZ6A 1UC5B 1MU0A 3IAEA 4PX9A 2JIMA 2XB9A 2CN1A 1AV7A 4L5YA 5J4LA 2BFBB 2H54A 1S3SA 4B9TA 8ICMA 2LWIA 2WSSD 3R0QA 3RVNA 3S4YA 4R5HA 5CITA 4M9NA 2VYNA 2W6ID 3RT7A 4TTJA 5E3HA 3LKDA 1L4GA 2XE8A 4COKA 2DWPA 3N39C 3O1IC 5JRZA 4Q45A 3C3PA 3SZLA 1J22A 2QR2A 3T3PB 4Q9NA 2JEIA 1KAGA 4GC7A 1MSWD 2C8VA 4QW9A 3JASB 4EMUA 2QY9A 1E3EA 4S1WA 1XMSA 2AJTA 3IMFA 3GIWA 4W7HA 1LEHA 4TQGA 1G20B 2I8LA 5KNDA 3WICA 4NFLA 4UBBA 2P1DA 3KYCB 4R9RA 2VK8A 3JQ7B 4LK2A 1OPXA 3GCWA 4P33A 3I1FA 3ZNPA 3U4IA 2HZ7A 1JHVA 1QSSA 1ZPDA 2YOGA 3KPYA 3O90A 1A97A 4RZ3A 3QYPA 2JH7A 1N78A 4JGBA 2G08A 1UEJA 2HGZA 4S05A 2IOFA 1MB9A 3MWYW 2CW5A 4DLVA 1EU1A 2XLBA 3RCBA 1YZNA 3ZY5A 3PW7A 2UZ3A 4OSPA 1DZ3A 2WWGA 1GA1A 1KDRA 3DZDA 1J49A 1JFFB 1HMYA 4CF5A 1XCGB 3DWGA 3KXLA 1NMEA 1U2DC 4Y0AA 4TMXA 3OE4A 1QCZA 4NCIA 1RSZA 5KFIA 3FCYA 3IOYA 2OXRA 3BF7A 5JFTA 1JGTA 3PFCA 4OHVA 2OCAA 4V0QA 1VCNA 1EK2A 4MW4A 3WHKA 1JQDA 1NW4A 4LVCA 5JXIA 3F73A 3ANYB 1YIAA 1NK5A 3W9SA 2BDPA 5K8VA 1Q1EA 1Q7EA 3F8SA 3FPJA 1N6NA 3PQEA 4AY4A 3PQ8A 2FRVA 5HR6A 4C5AA 2VP9A 1QLJA 3HI4A 4ZCTA 4Q7KA 1IOWA 4QUKA 1F2VA 2PEZA 3R3HA 5FBRB 1X2IA 2EQBA 1BVHA 3PT9A 3RRBA 4WLUA 1P2SA 2Z1DA 2ZUTA 4EBBA 5KCMA 2X86A 5JNLA 1RU3A 3QGMA 3C2LA 5EJ8A 4RMJA 1WPGA 3I9KA 3OTHA 1GU0A 2ISSD 1P1IA 4LWQA 4BNFA 2GLEA 2EKQA 3B1KA 3OFJA 4B31A 4W8GA 5AW9A 2IPOA 3EEIA 3G5MA 4O2LA 1EM8B 1GL9B 1Q5PA 1SHJA 3DQPA 4OQ4A 4RPKA 2YB4A 2GPYA 3OWOA 1BXZA 4X93A 1E0SA 3O3OB 4Y7DA 2PK3A 3VC3A 4C8OA 1UM9B 4LHVA 2IWRA 4B33A 1T91A 4OYRA 2GF9A 1PZHA 4G2NA 5DBOA 1T4CA 1GG8A 1Z5GA 2WWTA 5MFPA 2H2IA 4M0UA 3FDSA 1Z0AA 2FUG6 1CV2A 2V7PA 4Q3KA 2L0XA 1PS0A 2BONA 2LCFA 5IYZA 1CF4A 4E0DA 4MUYA 1Y5LA 1JXMA 1M1ZA 5DGCA 1T24A 1XJWA 2HA7A 2XY4A 1EVQA 3F5SA 3VSEA 5A3JA 4K9LA 4B3MB 2I3ZA 5K8IA 4KO1S 4MHOA 3FYTA 2YV5A 1ODJA 1VJ5A 3IPRA 4I1PA 4EH1A 2OD7A 3T94A 3TIFA 4QLOA 3BHMA 5DN6A 1X3SA 1QYIA 1PBTA 2B5OA 1JU3A 2FTKE 4M46A 4AMBA 2AXEA 1PFWA 1IQ0A 1ZD2P 2P0EA 1XNGA 2A6PA 4K6HA 3EPKA 1Z6AA 4HUJA 4ZO8A 1FXWF 1TUBA 3TSAA 5CDTA 4IS3A 3HXQA 4E30A 2OZLB 2WNHA 4IS7A 2BEUA 4V0NA 2D5AA 4DSZA 2ZR8A 4LXUA 4V0RA 5HW0A 3M5WA 4J7CA 4PU0A 4ASUA 5BVHA 5IBCA 5LD2C 4UCQA 3V72A 2Y2UA 2CL6X 3RVLA 4RMHA 2Q07A 4ATNA 5AUOB 5GIOE 1HWYA 1V26A 1Z5UA 5B3AA 3T9FA 3GYBA 5LMCA 1LDMA 3OIYA 1G6KA 1T9BA 4LJ6A 4E1AA 4US8A 3NHAA 2VHTA 3IXMA 2OSBA 4O3SA 4DFJA 2RGNC 3K0SA 1F2TB 1FLDA 3VBCA 3RUPA 3OGUA 2XXBA 4MO2A 3LC7O 1Q91A 1PD1A 3JQ8B 1FQOA 4EHAA 2EX0A 3UGQA 3RI3A 2PUDA 4BATA 3SM3A 1N6OA 4B73A 1KEEA 4J3NA 2QTHA 3C7AA 3LKZA 1D2EA 1GAQA 1TMOA 2E48A 2F1KA 3IIIA 3QWAA 4XPZA 2G1AA 2NAPA 3DC2A 3GFPA 3NWBA 1PS8A 3QYFA 4FI3C 5EP4A 2DLDA 3KFXA 4KGZA 2C31A 3UWPA 3ZHYA 2RLTA 2J4DA 1P3DA 4D92A 5CLIA 4FCTA 5LBIA 4KQEA 2ZXHA 1FU7A 1T0HB 4EJ6A 3K6RA 3KTQA 4CF7A 4FWTA 3ND8A 2O2SA 1RP1A 2R2AA 2KFNA 1BVUA 2I6SA 1JEEA 3C1TA 3AUAA 3CRQA 5IJWA 1VLJA 4KMSA 2QRKA 5G4KB 3VHXB 1Y63A 1BQEA 2XUKA 4U63A 3SXJA 2CWWA 2JI9A 1DKNA 3G2OA 1OWLA 4E6PA 2C22A 3HXTA 1JSZA 2CVZA 3N2EA 1UJ6A 3VR5H 5KFZA 4U2GA 1Q0PA 2XMSA 2VZEA 2FX2A 1JHQA 1K6XA 1OX4A 1ZUNA 2ZJFA 3M7DA 3R8FA 1ZQBA 3P9XA 1TZKA 4RNOA 1X0VA 4G26A 4HK4A 3HP4A 4OHCA 4W8HA 3RYFB 2Y99A 3COJA 4G67A 1TU4A 1M2WA 2D59A 4LJSA 1EUDA 2QARB 3HDQA 2D5CA 2BGMA 3LPCA 3FMIA 2P30A 4QPCA 3RBZA 4ZKDA 5CB8A 3QEBZ 1W1IA 1HKHA 3GFTA 1J56A 1K4YA 1ONBA 2ODPA 2B8JA 2XDAA 1I7NA 2YQEA 1R8JA 2ZYHA 3B6EA 1K6EA 4LHEA 5H9VA 9LDBA 3NDIA 4ZPJA 5KC9A 1YO6A 3G02A 3H0CA 1IG0A 8GPBA 3T9BA 3W5DA 1JA1A 1UMDB 4AS1A 2Y93A 2M9NA 3AH8A 3GVCA 5DLDA 5DNVA 1DJOA 5CFPA 1QHFA 2ISQA 3A7EA 3ESAA 2YZNA 3DOCA 4QDKA 4B40A 3ABOB 4OXIA 1VM6A 4K9PA 4R2IA 5FV7A 3K75D 2R8GA 2HHCA 4TTTS 3EGIA 2GZRA 1K5HA 3M4YA 2XXAB 2ECQA 2R6AA 3V4FA 5KSOA 1JIUA 1MPTA 2KN7A 4OP2A 4QX6A 5TR9A 1ZCJA 1F38A 2DWUA 4G86A 1LBSA 1E9EA 3EC2A 1OW3B 4U4AA 4BKOA 2O8DB 3TFRA 4RM2A 1FMCA 1W4BA 3C5VA 3SP1A 3TZQA 2WWVD 2AD5A 3I9MA 4MV3A 1X1CA 4Y6QA 4YBRA 4ZAGA 4B9MA 4KFSA 2W6JD 4IIVA 3RABA 2IYNA 2RDIA 1HH4A 2ACVA 4ECSA 2J5XA 3DNPA 5IS2A 3ZS9A 3W4JA 2WDPA 1F17A 3A4TA 3AJRA 1A95A 1ZMRA 2OA0A 3JPWA 3GRAA 4MLPA 1HNXB 2LKCA 2C2EA 1PLLA 3FY4A 5KG5A 1P4SA 4BQRA 1GTMA 4HRAA 5LQCA 2EZXA 3PSPA 3C41J 1Z47A 3C0KA 2G63A 3NXKA 2CWDA 2IYSA 4M6WB 2CHQA 2EQ5A 4INJA 4Q34A 2FMUA 3E8XA 3GD5A 3ET4A 1OWPA 1Z4OA 3PQDA 4JYCA 1XQWA 3B20A 4RK5A 5DHPA 4YAIA 1TM5E 3IDFA 4MULA 1U0RA 2KZ3A 2GEVA 2XY7A 2Z08A 3PHBE 3HN6A 3QOWA 3OT5A 4PO9A 2O2CA 2GTPA 1ZHFA 1QYXA 3FNGA 1IG3A 5EAIA 1BDHA 2GM4A 4KLLA 2X1MA 4ZJZA 1CEQA 2C5HA 3WQBA 4R7GA 5J0YA 4IJMA 2OGSA 3K1RB 1ZMOA 4NJMB 4TZ0A 3I1IA 4EA8A 3HUTA 2HF2A 5TLSA 2VI5A 3EBPA 5HQTA 4I0WB 5AK0A 4RTJA 3D7LA 1KAOA 2YMMA 2FFAA 3FMFA 3U13A 1NIPA 4WCFB 2UUPA 4DKXA 3GUYA 1QRTA 3BWYA 1UQUA 1SKRA 5LN1A 3V8RA 5IKPA 3ZKAA 4ENQA 2VXOA 2DQKA 3KB6A 4CR8A 1JEQB 2YN2A 3NYRA 4HP8A 3LUHA 4B9VA 3F97A 1JDTA 3WLOA 3OF2A 2FCAA 5JANA 3ONWA 2NUTA 3A6EA 2JFVA 4DFDA 4WFKA 1Z19A 1WZEA 5DI3B 3TAXA 3QU9A 2H17A 2ZI5A 3IERA 2NZXA 2PMEA 1ZQYA 4EQZA 4Q1CA 4HYTA 3BX1A 3IULA 4X8HA 1Z25A 1PBNA 4U7TB 2W6OA 3KQKA 3V7NA 4XSGA 4K9KA 2F9FA 5JARA 1FPQA 3CZRA 1RJ9A 1XPJA 4AN0A 2C0QA 4B44A 4G4JA 1Z5OA 5EKSA 3E22B 1R27A 2HF7A 3GRKA 3NUZA 2OG1A 5KPDA 2YS6A 4QTZA 2WWHA 1WY7A 2OD9A 2ZGVA 3I01A 4MMYB 1EFAA 3KYCA 3S2GA 1NV9A 1SPXA 1ZL0A 3JAKA 1SXDA 1SD1A 2C4NA 4A6XA 4W7IA 4CCYB 1XK6A 2OCLA 4M1MA 3FWPA 1NNLA 1POXA 4ZK2A 3UH1A 2VYVA 2NT4A 4CFYA 1LD3A 2BMEA 3GUCA 2IUSA 3IAFA 5FBHA 1YSCA 3PFFA 4BNYA 3L07A 3LVBA 3UMRA 1ZQUA 4P92A 4C5BA 4PBTA 3DAOA 4DEZA 3EGOA 1K5DA 4JUBA 4ODIA 5J1SB 4DR5B 2WMYA 4HQRA 1YU6A 5JZBA 2JLVA 1CZUA 3BWVA 1Q7TA 1DBRA 4Q18A 4O3NA 1SEVA 1E9DA 1HSOA 1SC6A 3VAAA 1XROA 5LL6P 3OETA 3LA8A 3D3JA 5BOMA 3DO8A 3NHBA 4ENPA 2DZDA 8ICXA 4Y2VA 3AR2A 3UCXA 9ICMA 1FNDA 4MMZB 1I5RA 3PRYA 4A1FA 5FD8A 5M34A 2O6KA 5JBIA 3MWLA 3P0EA 3HBAA 1DX6A 3ZD9A 3GAMA 5I5GA 3SBEA 4Z4EA 2OOKA 3QJ5A 1M1YE 1QHYA 3LQYA 3OECA 1ISHA 1WL8A 4GOJA 3FOCA 4ARIA 1MPXA 3H4TA 1P7CA 1JW9B 5ARDA 1P72A 3DULA 3WIVA 3T5KA 5DCYA 1JEDA 3GC6A 1Q7BA 3HRKA 2P35A 3HU5A 3TGWA 1SQSA 2Q9UA 3O91A 3LC0A 4E94A 4PO1A 4KPFC 2Y9TA 1EX1A 1ZJ4A 2JK0A 3Q3GE 3SBXA 3VU8A 1QWSA 4HT3B 1S3IA 3G23A 1II8A 4X63A 4DLPA 2XXJA 1JF8A 5EIHA 1IBLB 4I9GA 4UUBA 1VHLA 3UKDA 3ILXA 1NBAA 2A84A 4EY4A 4I2NA 5IZCA 5HP4A 1T5TA 1IJFA 2C3YA 5A3SA 8ICPA 2I65A 5IYZB 5BUZA 1SZCA 1F20A 5TDHA 1YA6A 4P8RA 4RQ8A 3B9JA 2Q50A 3JQPA 4ICIA 2R79A 4P38A 4K7JA 2MINA 5FBZA 1D07A 3WBKA 2XZOA 3WL5A 2YDXA 2OWDA 3G0BA 3ROMA 4JV1A 4WAUA 1CF2O 4XB6B 2A3RA 2L18A 1Y34E 3I05A 2Q6OA 1PFVA 4FB5A 2C2HA 3PPIA 2ZG6A 4CEJB 1Z37A 3D02A 1FSPA 2K6GA 3MJHA 2P6RA 1E0DA 3HPRA 4AICA 4MF8A 3EYAA 5DH9A 3NASA 2DUWA 4PSAA 4IKOA 2WSIA 3D4PA 2C7VA 1ZQHA 1VKRA 1C3OA 1OXKB 1JJFA 2NSDA 4MCJA 3UBMA 1L8LA 3NKFA 2PQ0A 1NAIA 2R87A 2Y77A 2V4RA 5BN5A 9ICJA 3L0OA 1TFRA 9LDTA 3ER8A 1KL7A 3OU6A 4AJOA 4Z1OA 1W8IA 2IGBA 1CDZA 2PBFA 4QZIA 2XRFA 3DT6A 4NL9C 2OCKA 3ESZA 1IULA 3GBVA 4JJZA 3ZXIA 5LUAA 3SFZA 1HYGA 1TO2E 1V8OA 2HA6A 3GJ0A 4MVJI 4XD7A 3NJ8A 3BFXA 5GM2A 1J0DA 2IHBA 1MBZA 3JYQA 4FS8A 2CDNA 4CNQA 5F3RA 1OFGA 2D1SA 3EVBA 5GOZA 5KFWA 2QVLA 1AQ6A 3PIIA 4ENWA 1HFJA 5A71A 4P7FA 2BN4A 4GOOD 3R2JA 1BPYA 1NYRA 3MJEA 2Z4SA 4J1QA 4NJEA 1CIJA 2J5QA 5IJ0A 1HDEA 4LRTB 5BYKA 1R18A 5KZMB 2O59A 1S1MA 4LWPA 4X6UA 5J2DA 2X2FA 1N6HA 1AY0A 2M0NA 1EFTA 4DC9A 3C3WA 2NNWB 3ZGVA 1ZUWA 1KO1A 3FGNA 4YN4A 4IXDA 4MAMA 1XRLA 2J4CA 1WMFA 1VBMA 1ZNQO 2PQ6A 1IMOA 4DMCA 5BNZA 3SR4A 4FNGA 4YMUA 4TYMA 3OM9A 4HDCA 1QG4A 1QFJA 3OJFA 1I0ZA 1OD6A 2WFZA 3DKKA 1L5UA 3IMGA 4G4GA 4J1NA 4HJRA 4QFBA 3UN1A 4D7AA 1K7EB 2UZIR 4K2HA 4E32A 3LY9A 4XGRA 4IMRA 3OQIB 3TAHA 1XTJA 3ZVLA 1T43A 3CWCA 5IVHA 5JD5A 4HSGA 2C2BA 4N6GA 4MI6A 1G5RA 3RLFA 2UYCA 2QJFA 5CNMA 4I19A 4EA7A 4JI1B 4CLXA 2W5UA 4JJGA 1GTRA 1DAFA 1NK8A 2W2OA 3W04A 1U04A 4NVRA 4Q4HA 3KJQA 3BHIA 1Y81A 1U8TA 2AR9A 5BW5A 1ULHA 1DG9A 3LPNA 5D86A 1MO5A 5A62A 3RS9A 3VRHA 1VKZA 2BM8A 4BE9A 2G06A 5LC1A 4C4YA 3W3AH 5EMNA 2C84A 3NH9A 5DQIA 4CRXA 3TACB 4DQPA 1EFLA 2ODWA 4GI7A 4ELUA 2A59A 2BFOA 2IYLD 3PC8C 2YQZA 4PO3X 4Y9RA 1KFDA 1JE0A 1YZFA 1Z07A 4EA9A 4GKJB 1AROP 2N1BA 3FB4A 3CTMA 3OIFA 1GLNA 6CHYA 3D8SA 2C1EA 1QO7A 5KWIA 4WKBA 5FL3A 4WN3A 1G5IA 5HCNA 2QTTA 4C14A 4X3PA 5LWQA 1VDZA 3ZJYA 3AR5A 4TLLB 5HEKA 4CUJA 1E3MA 2VDWA 1ZG3A 4JWKA 1O1YA 3LBYA 3V8PA 1RP7A 3AQFA 2REQB 4GOKA 3Q5GA 4MB6A 4UU8A 4C0SA 2GVDC 3T5JA 3FCSB 2A1JB 4QJIA 3NJ4A 2NZYA 3OOHA 4PS1A 2UDPA 4KV7A 1UJ2A 1Z2CA 1V1MA 1KGSA 4PLWA 3NHUA 4BFVA 3LCVB 3AUOA 1WWKA 4ZAZA 2YW2A 1NY5A 1A2OA 2ASJA 1LK0A 4GBMA 3CINA 2ZRAA 4MUIA 2G04A 4GMKA 2W04A 3KR1A 1QXSA 2QTVA 1NYQA 4RAQA 4UTXA 2OXIA 4FVTA 3IAUA 1FZQA 1JXOA 1ADGA 3Q7IA 1IN4A 4LDPA 3WJ7A 3O7MA 2BGIA 2APJA 5K45A 4DILA 2F8MA 2KBEA 4DA0A 4GGOA 3KZCA 4A8JB 1E4EB 1GRRA 2R0QC 1U0SY 3JS5A 4L2IB 3HCFA 4F6LA 1MV8A 1YE3A 4EX6A 2X0IA 3K0HA 4LGCA 3STUA 3RSCA 3HW8A 3S55A 5EKDA 1XWLA 1GUZA 5FWDA 4IYRA 2P2ZA 4KGXA 1KRPA 3TR0A 4RL6A 3DTNA 4YCXA 1GL7A 3C6QA 2Z8XA 3VR0A 3ZN2A 5K5EA 1XNSA 3SG0A 4LY3A 3EIXA 1PAUA 5EKXA 1T1SA 5L7TA 1NKCA 2CFTA 2HJHA 4ALJA 4ARVA 5DP1A 1L4BA 2ZE7A 5I7EA 4YY3B 1NN1A 1UK6A 4JFRA 4E4RA 4RSGA 4HLDA 4JJEA 1Z36A 3DFUA 3OZGA 4MROA 5KL1B 3GN1A 1QMPA 2HCBA 3OE1A 5BWCA 1PT6A 1YJ8A 1YR3A 4GVXA 3FPKA 2Q3CA 3NIGB 1MO2A 5CFZA 4ND2A 2Z2IA 4ND4A 3W8EA 2GRUA 1XD2A 3L9WA 3LU1A 3T5AA 5IRCD 2ZB8A 4B8ZA 3VKGA 2PXAA 1ZUD1 2VF7A 4IX9A 1L8OA 3IIJA 2W2LD 4JYMA 3K4PA 5FFMA 2BY4A 2CDAA 2GXQA 3BJEA 3DDSA 3LX6A 3A4NA 4GRAA 1ZLYA 4FONA 5BWLA 3DLTA 3ITKA 3PL1A 1KTVA 2NU7B 1VXRA 2GD2A 1USGA 4O3QA 4P4LA 3J81k 3EDRA 4YLYA 3B6MA 1IIRA 3SJUA 2WYWA 3GMSA 3HM9A 4LUCA 4DL5A 2DSTA 2AJBA 5DTEA 2GLTA 3UPDA 4G0YA 2I9GA 2YFHA 4KOAA 4ME6A 1RXYA 5K03A 1CUZA 1Z5VA 2J33A 2R1VA 3D8HA 1NOMA 4OOEA 3EIEA 3GRUA 1EHYA 1OTHA 2VLBA 4IH9A 4IINA 4BPRA 1JH9A 2JI8A 1V9LA 1EWVA 3MUEA 4C6TA 3OQJA 1Z7BA 4MFAA 1ZNZA 4II3A 4BQPA 4NR0A 3CEAA 3QKRA 3A6LA 2WI8A 4BU0A 4BLRA 4GI1A 3GD7A 2A5DA 3USZA 4JLNA 4URUR 3OURA 1NUSA 4YJ2F 4E0BA 1NXPA 4PC1A 5HNKA 2WV7A 3O5AA 1MA7A 4FQ7A 2ZSAA 2VJOA 3TQQA 5BUSA 3ENWA 1NI5A 1D2HA 2POCA 1QQ6A 5C51B 1E59A 3PG5A 1GL6A 2HFJA 4E1BA 4EPWA 3L46A 3HVRA 2QLLA 1E3LA 2O07A 3D2AA 4KQFA 4GPEA 4Q1BA 5IHXA 1UMCA 4NHOA 4C3ZA 1X9HA 2R60A 3FMPB 2QL5A 2JIQA 4I6JA 5ANRB 3PTAA 1MV5A 2YFKA 3GEBA 4FXPA 2YY7A 4PHPA 2VWGA 5AVRA 3IQWA 1SBIA 4MPJA 5KAFU 2YL2A 1ZD3A 4LHWA 3W3AD 4KK4A 2VP5A 4EGAA 4F3CA 1N60A 1RZ3A 2HCJB 3ES9A 4Y2SA 2W90A 4C7JA 5JZVA 3QKSA 3AHHA 1AGPA 5IKXA 3CGWA 2W71A 3O95A 4Q1DA 1JHZA 1MNQA 1JDBC 1SVKA 2GXSA 4EI9A 2L69A 5J40A 4QG3A 3KT3A 3MTAA 2NO4A 2MSKA 4PWZA 1YI8A 3L1HA 5T3UA 2HQSA 3UNXA 3UXPA 1QH1A 3DVSX 3OIDA 3QVKA 3U7IA 1Z28A 4R54A 4TYQA 3U7EB 1JHOA 4YXJA 3DZFA 3NX4A 4PR0A 4O5OA 4D9BA 5BR8B 3K2BA 2C97A 1Z7GA 1TMGE 2R47A 2QJTA 2WUVA 3CE6A 2OE2A 3VYVA 1SULA 4IS2A 2B7BA 3FIUA 2J6TA 2AUTA 1NWHA 2H52A 2Y8EA 1PQPA 1T1IA 2Q3FA 1M8PA 3RKUA 3KUUA 1R8YA 1EXMA 1U8FO 1NGSA 1UADA 3CRMA 4RMNA 5LQAA 1LTKA 3AESB 4UBJA 2Q8NA 2HMXA 9ICOA 1KI6B 4JDPA 4Q9IA 3WLRA 1R12A 3B9RA 3I9V1 4CEJA 2QX8A 3E6AA 3GMTA 4KQCA 3HTXA 2AZMA 4BZZA 3H5RA 3F9IA 4AMUA 3PDIB 4N7MA 4YR9A 4B75A 2WJYA 4TZ6A 5IBRA 3CVJA 1YASA 1FDTA 2EIHA 1FX0A 5E1MA 1CDDA 3Q2OA 3KQUA 1H65A 4CQMB 2DOKA 4UOZA 4UMFA 3MABA 2Y0PA 2D4HA 4YD2A 1K63A 4RHUA 2IY7A 4UEWA 3VZDA 5BN5B 4F97A 4B6FA 1GRNA 3DE2X 3WYGA 4FFMA 3CLSC 4JBIA 5DI9A 2XO7A 4P98A 5L7WA 4MWGA 1B6SA 4MYDA 3GLGB 1NATA 4X60A 2B2NA 5E4FA 1R88A 1XEFA 5EJ7A 3W78A 5JE8A 2WWRA 5KFQA 1D2MA 3VPAA 2N47A 3EVGA 3FRIA 4MW2A 3ADOA 5FBWB 1QTIA 5H4GA 4PN7A 4OBWA 3V8EA 1UKBA 4XDZA 3UUWA 3MS4A 1Q0QA 1JIQA 3QVUA 4PZOA 1IHDA 3I53A 2JA1A 5T41A 1B4DA 5CNIA 4MV4A 4TOIA 3TCXB 4B6QA 4HAYA 4D41A 4DRXB 5CHGA 2PAAA 1KO5A 2ZWOA 3EIOA 4C4OA 4CQJA 2WSMA 1UHUA 4J9OA 3RH5A 3AOEA 3H42B 4P54A 5FI5A 5G1NA 5EHXA 5A0FA 2GAJA 1CUUA 3UOAB 4M9JA 2BFFA 3H84A 1CT9A 1EDOA 3KL4A 4P86A 3AR4A 2ASDA 4MGIR 2HEIA 1ABFA 5F2OA 3U31A 2LIPA 5AKJA 1SCDA 3K4GA 1EFRD 3LHKA 1N5RA 2VNIA 4LSMA 3CRXA 1EA5A 3V8VA 3VU0A 4P2GA 3OEED 3FLBA 4YCNA 3GV7B 1R1DA 1X1DA 5FJIA 1XJ5A 5TVGA 1CRXA 4AWBA 5KNCA 3W9YA 4EZ6A 2DCMA 4PYKA 9ICHA 1SBNE 4Y2JA 3NG1A 4JOBA 4QDXA 3JRNA 3TRIA 1XO1A 2NV0A 1YVEI 4PGQA 3G2PA 2NYRA 3EFBA 3OPQA 2QXUA 4OMFG 3DDNA 4PSUA 1M2VB 4WBXC 4P5PA 3PR4A 1R15A 2JJ2A 3F1LA 4EG5A 2YASA 3I1YA 1XOIA 2FMIA 4KN7A 2QU7A 2ZR7A 1Y5RA 3HRHA 4EHNA 4K6FA 1F4VA 4H6XA 2EZ4A 1KO8A 2H3HA 5DTQA 2P9JA 3LO5A 5KTSA 4C0WA 1SL2A 3DLCA 5KOYA 1BNCA 4L9WA 3WGHA 2K4EA 1U8XX 3IA7A 2GNOA 2WA2A 1U48A 3W7VA 4A0RA 2AYZA 2GZ3A 1J9ZA 1KRHA 2W9MA 3OUZA 3E2EA 4PTZA 3AVWA 1K7XB 2ORYA 1DOAA 2FEWB 3NH6A 1XDBA 3B1WA 4ZTZB 1G4AE 1I2AA 1I7PA 1JR4A 5EINA 4ZICA 3T1VA 1SA0A 1G19A 1T6ZA 3W2HA 1NX6A 2QD3A 4KVFA 2J9ZB 3PW4A 3O8LA 1FDVA 3M1YA 1H94A 1YT5A 3B60A 2ZBFA 3EOZA 3SZRA 2CMKA 3AY0A 3RS3A 3HVKA 3SU8A 2Y67A 5BVGA 1D4AA 1E96A 3WYAA 1GRQA 3GNSA 2E8MA 3ZJ5A 1BKSB 3LAWA 1HTTA 4N7RA 4B8YA 4K9QA 4LX0A 5D1NA 2A0FA 2GFQA 2O20A 4R16A 5I7FA 1WXIA 3U1VA 4OQFA 1M72A 2BR3A 4KO4S 3VNVA 2FUCA 3HJFA 4JP8A 3AERA 4IIHA 1EUZA 1F1BA 3LOUA 4HDNA 1UDBA 5EOVA 1ZJ6A 4FD2A 2YTZA 2VTBB 2AR7A 1Q0HA 2EGUA 2JIDA 2RHBA 4RJ2A 3UMBA 1M6VB 3G6YA 1T36A 1GPNA 2NADA 1G21A 3TE6A 3GT3A 5K0CA 2A1AA 5G0TA 1XB2A 3GFKB 1FXUA 2YN0A 2Z5VA 5DOVA 1FFEA 2FYTA 4AJNA 4Z2AA 4I66A 4PPGA 3AHCA 1RZUA 2J9RA 1ZY2A 4BFSA 1PJQA 1U0BB 3GROA 5CLLA 2BM1A 5DNUA 4DQVA 2Y0SF 4O4LB 1GAWA 2A9PA 1VSQA 2PT5A 4IXNA 4REQB 2KSOB 5CX1A 5J5VA 3MJVA 4I9UA 1V9PA 4H2DA 4QA9A 1T29A 3T0IA 5L3SA 4BXOB 1SUSA 2E37A 2H5XA 1OV6A 2OC4A 3WLKX 1TRHA 1W36B 4PAMA 1DFIA 4PG6A 1WE2A 3NETA 4X94A 1LKZA 5FOQA 3F2CA 1UOOA 3NHWA 3PEVA 1P1CA 3ZX4A 1GZVA 1BHO1 5IPFA 2I29A 1L3BA 3AHIA 1XU7A 3CH5A 4UB4A 1P4AA 1ORDA 5KYGA 4JV0A 4MI1A 3MHPA 2RB4A 4YR0A 4GZMA 3W5JA 2HCTA 1SBTA 2RK3A 1C0LA 4JC8A 3VQTA 4HEQA 4ED8A 1CR0A 4QGBA 4MUNA 3RIGA 2ZSFA 4BMNA 1LXCA 2BP7B 1BC5A 1KQPA 3N5CA 1Z0UA 2BKAA 1Y6ZA 3IQXA 2BELA 5IBQA 1XVIA 3PD7A 2W9CB 3SX0A 3D0OA 4WDRA 4CL8A 4DL4A 4EF5A 1Y5NA 2ZFUA 1W49A 3A4IA 2R5WA 1FCJA 1D2CA 3W3AA 4IVNA 2IYXA 4MUMA 3RJMA 1X7ZA 3ZLBA 1KFSA 1JLMA 4YT4A 3VSAA 1XK7A 5EQFA 4JJKA 4NJOA 4UBMA 4GZLA 5CB4F 2EZYA 4MWOA 8ICTA 2I6QA 4AECA 1YB6A 2GZDA 3UY4A 3N2NA 2WW8A 1MIOB 2HOQA 3R24A 5ESXA 4DV4B 4B35A 3DOOA 2WICA 1FP6A 1HTWA 3AVVA 1PI3A 2XZTA 3PIRA 1ZN9A 4HKTA 2WVGA 5C8YB 1MAAA 1S8OA 3WMFA 3BREA 1P7DA 1NFRA 1ZO8A 5EE9A 2NVUA 4AM8A 2XB4A 5F1KA 3NMUF 4JFAA 3M0EA 2PFGA 4OU4A 3FHTA 2JAOA 5FQNA 5TGZA 4A8PA 3X1KA 1DTSA 3FSRA 2RCNA 1JG6A 3UEOA 2VT2A 4TUSA 4RJTA 3GT4A 2I55A 1VIYA 3KHGA 4IKEA 3X44A 4EB8A 3AU8A 3E7PA 5KNDD 5DULA 3LWLA 2FJUA 3UQYS 2KP7A 2C9DA 3BMCB 3MTEA 4YAGA 3CYFA 4TMKA 4UPEA 1IVNA 1VKOA 5ED0A 4BJQA 1SKUA 1NJSA 2NZ8A 2VTEA 4C6SA 2EYUA 3LT1A 3VR6A 1WU7A 4LC0A 2GFHA 3H2BA 1CUHA 4CIXA 3WWEA 3NS7A 3SEAA 3GIDA 1H5QA 1B0XA 3RR8A 5DM2A 1WB5A 4RGYA 4M54A 3ZEAA 5KHLB 1HOTA 2KLBA 1MRNA 2AKYA 3PPWA 4JD5A 1Z4LA 2HC9A 4FOOA 2ZUVA 2BCGY 4FZVA 2LPEA 1VE1A 3V80A 2QN6A 4DNPA 2X23A 4YD1A 3DUFA 4D4IA 2BI4A 1X7HA 1ZU4A 2LR0A 4DCGA 4IZOA 2PUBA 4OJ6A 3T1TA 2XNDD 3UK1A 5KG2A 4L3VA 1YCDA 3LXXA 1DAMA 1KE2A 4A82A 3JVIA 4AG6A 2XCPA 1FJHA 2DFNA 2RAFA 3HY6A 2O3JA 1QIDA 1YCHA 4AVYA 1IHOA 4H6WA 3ONEA 3UF0A 3SAGA 3HR7A 5F35A 4K46A 1COZA 1UIRA 4LDQA 1BD4A 3OZRA 4HGOA 2WAXA 2J0EA 2JEFA 5EUQB 3G6VA 5LIPA 2C0PA 1GOTA 5CD1A 4DZTA 1DBQA 3CXUA 3QEMB 2Q27A 4GD3Q 4O4HA 5D3ZA 5JRJA 2PZBA 1K0UA 1RJDA 2QV7A 1LX7A 5ALXA 2JBWA 4EUNA 5ILQA 2D1YA 2AMFA 4P4NA 4YAFA 1TC2A 2VQ3A 4M49A 2JEZA 4C4RA 3EVEA 3JYHA 4QDUA 4UDNA 3O8CA 4P2HA 1UDRA 1ZCBA 4IIFA 5LP6C 4QLBA 5LMUB 4H77A 2GZHA 1ZIOA 2WIGA 3ZCQA 5KI6A 2C28A 1T0BA 2XZPA 3BF8A 3LLUA 3LYUA 5CJPA 2GCPA 3PLAE 1IOZA 4BX8A 2ZBRA 1WU8A 3V33A 1C7YA 1NRJB 3GHHA 1NG9A 3QW4B 3BYZA 4KDRA 4TV9A 3C3JA 1JX4A 4G07A 1S2LA 3UENA 4DV0B 2OHJA 2QXTA 1NM5A 3IS3A 4IG9A 4PXAA 1OY1A 4OHXA 1NTOA 1L4YA 3SAHA 2H5LA 3ZOZA 1FU4A 1OI7A 1CVRA 2IEZA 2LKDA 1V11B 4H7HA 1T2EA 2RC6A 5D46A 1T9GS 4KLDA 1MT0A 4DA7A 1U2GA 3GWZA 2IHTA 5DE3A 3VZRA 5EHZA 4KE8A 2FI1A 3QHQA 1JFLA 3IHWA 3SC2A 4YRSA 4I6GA 4UE2A 2JANA 3QX7A 3C48A 3IHLA 4N5HX 4LSGA 4QC2A 5BSVA 3TL2A 1SUPA 1A8SA 3DOJA 4UNPA 5HTKA 5BN4B 4ALMA 4AS2A 4BAZA 4YMTA 2I3GA 3QVLA 4X95A 2PGDA 2QRLA 4BO9A 3DE7X 1QTMA 2ECOA 3AM4A 2X2EA 1NXWA 3L77A 4L5CA 5A2GA 1CKEA 4GBED 4F60A 1OB5A 5FR1A 4EBEA 2AFVA 3RBVA 4BO1A 3KYDA 2JLZA 2VXYA 1XVTA 2M6SA 2X0FA 3VVLA 3EGCA 1XIVA 3N75A 4B8WA 4D57A 2BZSA 2X9GA 1GZ6A 2AS0A 2LIVA 4KIJA 5H9WA 5J4KA 1G7TA 3IAS1 5KYWB 1NQWA 3ICEA 3TADC 3T34A 3ZVRA 5BOSA 2WMDA 4WFQA 1ZQGA 4J2HA 4LOKA 1TW2A 5DWVA 1J70A 2PFPA 3E15A 2PZFA 3KWJA 3V1LA 4CMAA 2V9PA 1DRGA 1XEWX 2GO7A 3IT2A 3LXUX 4RK6A 4EVSA 3TAPA 1IM5A 1FO4A 1B3RA 5J0SA 2OEHA 2Y1WA 2P9TA 1N34B 3WIEA 1DEAA 3UQ0A 1KN5A 4M2LA 2W6JA 1WZCA 1VZ2A 5K0NA 4C0BA 2F76X 5ALSA 4JXZA 2HGSA 4ZO6A 1ZH2A 4BLWA 3FNHA 4W8OA 4ZZ0A 5MGBA 2YWJA 1JQAA 2C4MA 1HQKA 2AW3A 3KM0A 2R85A 3Q7QA 1THGA 2K60A 1Y3HA 3BWCA 4FFVA 4LGMA 1RWBA 4DN6A 4PGHA 3P0FA 5C3UA 1FFGA 1FMTA 1PTJC 1G8JA 1JU4A 3TF5A 3FPCA 3IT0A 4UNIA 3SC2B 1HEYA 3GGSA 3U4MA 1XDWA 4HVAA 4MRMB 2JKZA 4GQIA 4EKDA 1Y0BA 5DJ5A 2AZTA 4E5YA 4DWIA 1JP7A 1MKYA 1N33B 3HJTA 3M5DA 1I36A 4WNIA 5G40A 1QYCA 2IELA 1QB7A 3NM4A 5BVGB 3A9SA 1RKUA 2QJRA 3OKPA 5AJYA 5ETJA 2KZZA 1VSUA 1BOOA 2M32A 1E7YA 4R1QA 1EEXB 2XNCA 5HKAA 1A72A 1L7RA 5L51A 2A94A 2XGSA 1QGDA 1JLRA 4IHJB 3GPLA 1YUMA 4BFLA 1T2DA 3C7TA 3TW8A 5CB4B 3DLHA 2V6FA 3G2NA 1SQ5A 3HO8A 3THYA 1ECPA 2OBMA 2JD0A 5EPEA 5ERXA 4D8XA 1YMQA 1L7QA 2E3JA 3MWEA 4ZOAA 3E53A 3ZE7A 3AJDA 1OFVA 4PBSA 3OJOA 5JHGB 3NYIA 1E64A 2HSGA 1E3WB 2C4VA 4X1YB 2PUHA 5I6DA 3WKCA 3ZY2A 3O9ZA 4RHEA 5J2UA 1PLKA 1RD4A 1L7NA 1IZ8A 4KTQA 1YR2A 1EZ1A 1YL5A 4WIAA 3R7FA 1E9VA 4BFWA 2E4YA 2Z1MA 3FNFA 3B1FA 3VDMA 1CY8A 2HVHA 2UYYA 2WIJA 3B1XA 2VDVE 2Z2XA 1H4VB 3F5MA 1U9YA 2FWAA 2EJTA 3P52A 4IP0A 5BUCA 1POWA 1PN3A 5J5AA 5BWMA 1KIFA 1H0SA 3DDWA 4M1TA 1XXHB 5TNXA 2MMCA 3I9LA 4U7FA 1NX9A 1Y1PA 5K09A 3ENNA 1XFDA 3LFHA 4HS9A 1FRFS 4ZOQI 2ISCA 4O2BB 5IABA 1Q0ZA 3HKBB 5D00A 3IKLA 1V41E 2ORVA 4ND6A 1CUWA 2JS7A 2QUHA 5DTMA 1UM9A 3TMKA 4ERNA 4QBHA 3ONNA 2V97A 1KDVA 1TYBE 3TTTA 2WTNA 1CUKA 3JQRA 1N5XA 4WZZA 4F93B 3THVA 1OI2A 1KY3A 1C7JA 2B8NA 3BE4A 4JQSA 4O4LF 4YVZA 1JYSA 4BVLA 3ZD7A 1E7RA 4IILA 3U60B 3DFFA 5FBLB 1BU8A 1IH8A 2O2YA 4KIGA 5EWLA 1PQWA 2HSWA 5LIRA 3N2GB 3WA6A 3AMZA 3MOIA 4Q1AA 1AU9A 4R1SA 4IVPA 1SKBA 1ZL2A 1KVUA 4JYBA 1W48A 3QLEA 4M7OA 4EP1A 4EG6A 1JYEA 4FGJA 2H57A 5FA6A 1YRQA 3PW5A 4KX3A 4YWJA 2X8JA 4U6SA 3SHTA 3FPFA 1KI8A 4D56A 4AYXA 2RP5A 3IUMA 3L8EA 1L9KA 1K7SN 2DSNA 4U2DA 1CNEA 1K66A 2JGNA 4YEDA 5T6BA 1F6DA 5KOIA 2HFKA 3IMCA 3KT8A 5ILOA 3PF9A 2ZXIA 1PUJA 4I1RA 3UV3A 5B3KA 2ZZMA 4HWRA 4A27A 3ZZUA 5JFGA 4YV7A 4RT2A 5DVZA 3F71A 4B84A 1KMQA 4LVNA 3K20A 1TJNA 2ZTDA 4L15A 4XPIB 5I7OA 2XSZD 3CY6A 4R84A 1Z0SA 4GGMX 1VA5A 4MQ6A 3QUSA 2WJJA 5CEFA 4WLEA 5GQSA 5K3SA 3WXMA 1VIDA 2WKRA 3P1JA 5FKJA 3KKMA 4J90A 4D8UA 3LVRE 2QSYA 3C5CA 3OJEA 3WXBA 4DMFA 1U5BB 2D2EA 2IQIA 4EGFA 1GY8A 1YJAA 2PKRA 4M47A 1KMMA 2ZWAA 4EQ6A 3KSZO 3LBAA 3MINB 2VA2A 1TLTA 3ZNQA 2W7PA 1BKYA 1NKVA 5IM5A 2ASEA 1X14A 4QTUB 4RMIA 5CHYA 3RB3A 1Z8DA 3CN7A 4PCLA 4EHJA 1NQ5A 5JEDA 1PWHA 4DCUA 1FFDA 4WLVA 4EY3A 1Q0UA 1T8WA 2GAIA 1O0SA 4QYMA 5FTKA 2ZKIA 4NCJA 4UREA 4ZOLB 4B3SB 1GPUA 2Q3LA 3EZGA 1S2IA 5BQXA 2VYVD 1SK8A 2YWBA 1MC8A 1GPKA 1L5ZA 2WOOA 3AIKA 3D59A 4H6PA 4OP1A 4ZHQB 2QD1A 4UB8U 1KJJA 1BN6A 3IHTA 5FLEX 3RVJA 4G5SA 1L4KA 4LRXA 3UAZA 4N0MA 1A9TA 3P20A 5KDLA 5DISB 2IHZA 2PWPA 1UA0A 1RLTA 3VUEA 2MA1A 1R5JA 2PE5A 1D8YA 3JVUA 4XE5A 3RNLA 4BX0A 3U26A 3C5GA 2DTEA 2G8NA 3M8RA 3E84A 2VQDA 3PBKA 4NBLA 3V9PA 2VNAA 4WNAB 4MVJM 1FU8A 1BOFA 3GN2A 1EH5A 4P53A 3F2VA 2C2RA 1LB1B 3KFUF 5KAIU 3DFIA 3C1ZA 1YQTA 1J7JA 2KE5A 3WK7A 1A8PA 3E1KA 3F5EA 4JENA 5GAJA 3KB8A 2V54A 3TIXB 5JT1A 2KIWA 1UBTS 3CF6R 2QB5A 1ZAKA 3HU2A 4D1YA 3CNHA 1EB8A 4IR9A 1XAJA 3RYHB 3ZDCA 1SIWA 2D3DA 2R8RA 2QYOA 4RTQA 4GIBA 1UBMS 3H2YA 4NYMQ 4G4SO 1QFSA 1NBME 2WVHA 1GYRA 1UWCA 4LTDA 1PDWA 3K16A 4YRAA 2BZFA 3QSGA 3RUHA 2WG0A 4FE3A 1FMLA 2NRTA 2F43A 2QA5A 4IHAA 1CVIA 5H4HA 5K6AC 2YXEA 3W7BA 4J0JA 3ZE0B 5I48A 4DWWA 1L5RA 4PYMA 1N2EA 4F0JA 5KINB 2WF6A 4MIKA 4QLAA 4NENB 3WWDA 4ZDIA 3AVUA 2IZ7A 1D4ZA 1IN5A 2KKPA 2BISA 1MQSA 3DFZA 1GT91 3V7UA 3ECSA 1P39A 1NT4A 1DAGA 3LYLA 5AKGA 1VPLA 4HFRA 1A5TA 4A8HA 3L41A 3OHBA 3N2YA 1TO1E 4PL1A 1X1EA 4CLRB 4XWOA 3D6NB 5DNYB 4H7PA 5DCLA 4LVSA 4BYMA 5IAOA 2ZSJA 3AF3A 1FJ2A 3Q7PA 4QICA 1T15A 1TJPB 5J2TB 2O8DA 4ZV7A 2KJ8A 4RHXA 4OJPA 3MJCA 5HRCA 5LKAA 3KKZA 2Z4RA 4NE7A 2W2MA 2AFHB 4P32A 2W43A 4XWAA 1DARA 2IIQA 4QNNA 1SVLA 4FZNA 3UJBA 4PL2A 3ZPXA 4DARA 1ZMXA 3RKSA 2PXHA 1SFRA 1OXXK 4PAGA 4DIKA 1UK7A 2HHXA 3K4HA 3DBRB 3QQPA 4A23A 1CULC 3MK31 2X19A 1JG7A 1CD5A 2QZPA 1T5SA 1WXWA 1JZQA 2DERA 2JZOA 1YAHA 4NC9A 1L8XA 3ESDA 4OXRA 2R44A 1UINA 3A31A 3T1NA 2ZSEA 3FBTA 3SJ7A 2P6PA 1QIKA 1EGHA 8ICLA 2KPOA 1JIKA 1NVDA 3LFUA 2BCVA 4YAWA 3W6UA 3M89A 3CBQA 4KLNA 1FW8A 2P69A 3HPOA 3SS9X 3QLVA 1WY5A 3GUUA 4LYYA 3GA5A 1CU1A 5DLQC 3SK0A 1P9WA 4ETIA 4B17A 5JW6A 1E1QA 2BDTA 3KR0A 4J0FA 4Q93A 2QXYA 5CVUA 1U7HA 3BXGA 2NT3A 5HK9A 4Z7JA 4JX9A 3BFKA 5TJHA 1KS2A 2ZB3A 2O3RA 3SEIA 3BTOA 3L6BA 2QU8A 2B21A 2JGMA 1B1AA 3OOWA 1YDHA 4W6QA 1U3TA 4C4PA 8ICFA 2OQIA 1DT3A 4Z8YA 2AZ4A 4B32A 3ODPA 2ATLA 4ZV9A 1CJVC 1W73A 2LPMA 4NJMA 2HUNA 3ED5A 3BIXA 3ICOA 3ME5A 4JZYA 1UPXA 1ELOA 1YB5A 4LOLA 4BP9A 4F4CA 1ZDMA 4Q39A 2R8EA 3BBLA 1N0IA 3C97A 1SKSA 3DP7A 2AOVA 4IFIA 2PCJA 4XR9A 4GMXA 4OO1J 2W2TA 1YBHA 5EMJA 5G3YA 1VB5A 1YZUA 1QDLB 4FHZA 2QX7A 5LP6B 1WAMA 3TSOA 1SOWA 4O3PA 1YZQA 3JZIA 4M1KA 2WHPB 4I4IA 2HV9A 3CLTC 4GI3A 2CFOA 3EMVA 3ISVA 1T9KA 1PEYA 1JMYA 1PV1A 1DJMA 1CQIA 3L7LA 4RAOA 1JXAA 2BBOA 4PZYA 4EITA 3JATA 2NUTB 4CV2A 9ICBA 1C7RA 3ROTA 1XVLA 4B4DA 2JMGA 1ZH0A 2ZSHA 3MBOA 3D2BA 4MKRA 5DGIA 2HNAA 2BPOA 5DGAA 1KSGA 1U7UA 3WLTA 3CLRD 3HYLA 1O89A 2EOAA 3CCCA 4W5NA 3P94A 2HO4A 3M7IA 3QYJA 2DBZA 4NMMA 4N4AA 1IY8A 4QWCA 2C2ZA 4RZIA 4MQFB 5K0JA 3K70C 3EISA 4UAZA 1IJBA 2FWRA 1B76A 3DS8A 4A0FA 3KLMX 3H8MA 4PHEA 1FC0A 1EVJA 2PH3A 3K5PA 4LI0A 3JAKB 7YASA 2I1QA 1NLZA 3TTWA 1HNZB 3U1BA 3B2QA 1L3IA 2DY0A 2PPLA 3E7DA 1BEZA 3TUZC 3KHKA 1BCSA 3OJUA 1OVMA 3IEIA 5CVJA 4A5OA 4L8YA 2BFNA 5LP1A 1HV8A 2CD9A 4JQCA 1OYYA 3SMVA 3LY8A 4U5XA 5L53A 3SX2A 3DLAA 2RGGA 2ZRCA 3F47A 3H1TA 4MI3A 4NXMB 4TKUA 4J4BA 1E2KA 1HEUA 3FI0A 1XMIA 1FLVA 4LJAA 2WAMA 4LS3A 4ND5A 5COBA 1YL7A 2IX9A 3VR4A 2IIBA 3VUFA 2W6CX 1EVKA 3SBOA 5EJ2A 1R6DA 5JADA 9ICWA 4C7MA 1ID8A 2YJ6A 8ICWA 3MCVA 3T7AA 1E0AA 3MWEB 3AXSA 1S9DA 1A71A 3HLTA 4IXTA 4OU5A 1UBFA 2AGVA 4WLOA 3KHTA 2BEJA 1E3WA 2OHXA 2R68A 1R4ZA 4JS0A 4X1YA 2GFIA 2GUWA 1P8JA 1XRQA 1P7WA 2V6BA 5A04A 4C0KA 4BMOB 1IXSB 1YULA 3IUSA 4LOIA 4YRCA 3GEPA 4IWXA 1KC1A 2W55A 5T4FA 1NYLA 1UWVA 2Y1JA 1YK0A 3DE4X 1UQVA 3UAXA 4BUCA 1C9JA 3QPVA 2NV6A 2IXDA 3PFKA 4OTZA 4QUEA 2VHWA 1LPNA 3VV2A 2VZ8A 1C20A 3I23A 1ZGHA 2P62A 3OSUA 3EEYA 4PCVA 1SC4A 4CF3A 2DJ5A 2MU1A 3BJYA 4IDCA 5HSGA 2QTZA 3IO5A 4HWPA 4LMPA 2K7FA 5KT7A 3OO1A 4QQRA 4JR2A 1G291 2P65A 2VUUA 3DJFA 4UZEA 1Y37A 4AD8A 4ZI7F 2UU9B 1HR0B 2FQ1A 2QG6A 2JFYA 1MX1A 2QTFA 2FSGA 3L79A 4UVDA 3VZSA 4BCDA 3HM2A 4RENA 4UAVA 2GSWA 2XOKD 3NHSA 2NX2A 3EYWA 1LJUA 2PVSA 2DULA 4MYRA 4FW8A 5KFSA 3DWFA 3EXAA 4I4LA 4INZA 4EFDA 3H9JA 3JXEA 4DIMA 2D4AA 4XIFA 4DL6A 4DZZA 5K4GA 4JBHA 1ODIA 2IP2A 3PGVA 4J8PA 4QQ8A 1DSSG 2ADMA 4XASA 3SOZA 5KQLA 2QF7A 2XUZA 3L0BA 4OATA 1UFOA 3CCFA 5TS3A 2FW0A 2O57A 3EAFA 2G9RA 1SXGA 3N6RA 1EINA 2H1RA 3BGVA 3KWLA 4JBWA 4D80A 4P34A 2O2IA 5HDQA 3D7KA 1NBMD 4F71A 4M8IA 1XTBA 1D8BA 2AQ8A 3Q4GA 3KHHA 4OHRA 5TS2A 1GAXA 2E8PA 1CDOA 1EFPA 3CM0A 3FYUA 2FSVC 4LV8B 4BKUA 4R7ZA 4ZYVA 5K99A 2DL0A 2DGDA 2XX3A 4RA9B 2ZQ5A 4NPHA 3W06A 5B4VA 5B6PA 1PDOA 1P4GA 3O94A 3QJGA 1THTA 2HMYB 1T6BY 4DVGA 2BZ1A 1R0YA 4B3IA 2JHPA 3NDJA 1HDOA 4KOEC 3LBIA 1L3CA 3MS7A 4XPIA 3ZGOA 5FUVA 1N5IA 1SAYA 2AXTU 1O4VA 3T3IA 1IN7A 1AXRA 1U0GA 2YHBA 2CLKB 4I9HA 4RD3A 5DWDA 5AOVA 4MVJP 4Z53A 4PQRA 4C1BA 1YVUA 3HWWA 5KSWB 2GCEA 1BXRB 3DO5A 1RYBA 5CA7A 3HFGA 2FEAA 2K4HA 3MMXA 3QW2A 4F8EA 4EQ6B 3FDXA 4LJ4A 3PXGA 4CTJA 4TQSA 5BN1A 4ZOLF 2QUKA 1J9EA 3JWIA 4BO6A 3HJEA 3DL4A 3QFCA 1PVOA 3RYIA 2QARA 1DMRA 2A5JA 2RKBA 3TBFA 2IYEA 3UTDA 3ZTYA 3IAHA 4KODA 5E0KB 2GERA 5AW6A 4XRGA 2A33A 5I8WA 1QH8B 3KB2A 5G02A 4DS3A 2PA3A 4BX9A 3B1JA 3K2QA 1H42A 4QPZA 3TOZA 3PC8A 3U4CA 5KYKA 1VE6A 3VKVA 3WRVA 5TARA 4R1LA 1Z0JA 1KI3A 3ABQB 3QMWA 4YMVA 5B36A 1N5KA 3U44A 4XJVA 1ZJWA 3T8YA 3UJHA 3ZV3A 2HT1A 1HDCA 3WYCA 2YHUA 2QD5A 5EWGA 2IXBA 2ZJ4A 2ETVA 2VKTA 4WOPA 1JEAA 2ACKA 1J2YA 1DGSA 4JT8A 2IU4A 3TUJC 3ZHQA 2G0AA 1OWOA 3HCEA 2Q4TA 5REQB 3R1IA 2GBLC 3GIJA 1R2QA 3OQOA 4GC9A 4DIBA 1JG3A 4UBIA 1TK8A 4OQLA 3EFEA 4R2JA 5EIAA 4Z4GA 2HWKA 2ZYDA 2KI5A 1TJ5A 2AG1A 3MUFA 2VK2A 2FPKA 3TTVA 4N40A 1E3TA 5DHUA 1PL0A 2YV2A 3M6AA 5IJ9B 2B3TA 3HA2A 1F48A 1QVRA 2PNJA 4GPBA 1V4VA 5CXXA 1L8QA 3ICPA 3L8YA 2XUFA 1IXKA 2V6IA 2VSQA 2I78A 3FUWA 5KL8B 3EW7A 1M5UA 3NFYA 4MRPA 1BE6A 4ECYA 1CZKA 3H18A 4PM4A 4RV4A 3IDSA 4NYJQ 4HMPA 2NSHA 3TQIA 1C81A 4BQNA 2QP4A 2KHQA 1FDIA 1QUEA 3FZNA 1BSVA 4OM7A 2BFWA 4QYSA 3KUDA 3HUFA 1IIPA 4JWMA 4PONA 5FHRA 2CHUA 3IXQA 5JPIA 1C0IA 1JB1A 3CRNA 4NQRA 4L4ZA 4ZU1X 5IIMA 1XJ0A 1JJIA 3CNNA 2O8BB 5DT2A 5J2TA 1D09A 3LI2A 4XGNA 5MHTA 3M9OB 4JBGA 5J2TF 3B3JA 3D6TB 4QUHA 4C08A 1HK7A 4OI2A 4Z3KA 2C58A 2I22A 4KR2A 2B61A 4OB8A 3VTZA 3WQSB 1L4NA 2CUZA 5EJ6A 4BU1A 2XWPA 2FMFA 3SHQA 4UVHA 4X1KA 4RZHA 1I4DD 4DV2B 3CR3C 3UPUA 4R1TA 3UFBA 4JCOA 2Z9BA 3R9KA 1JEQA 1RQXA 4JP2A 4BFZA 1PNQA 1Y8QB 2JAQA 5LQNA 1LJ8A 4A3SA 4FMCB 2JLSA 2CZQA 4M21A 5BNFA 4CCHA 1ODFA 2BTEA 1F12A 3UFXB 4CR7A 1WETA 1W1UA 5DN6D 5MN6A 4GXQA 1D3AA 1U8YA 2ZCVA 4JKIA 1Z8NA 3JYOA 4MW6A 3KTAA 5FT9A 3TKLA 3TRFA 2IBSA 3S27A 4KPGA 4N5IX 2JJQA 3ZQUA 1DMSA 4LZGA 4DSLA 2FPXA 4GM1A 3WGJA 4TMWA 5ALIA 4LYAA 4GBGA 4V0ME 1Z3IX 3L6RA 2W70A 1GDTA 3C7KA 4DOAA 3N6XA 4MA4A 4S12A 4RPJA 5J5CA 3OKAA 2AOWA 1YDFA 1KFBB 2E4XA 3LYSA 1I32A 3HB7A 4D6YA 3R0JA 3AFOA 3OESA 3PNCA 3QY0A 3RVMA 5BRAA 3KR9A 5JXJA 3NHZA 1A0OA 1U4BA 1XAIA 1ZA1A 2E0IA 2ZVQX 4W6ZA 2WJZB 4CODB 3BZUA 4HDSA 3ZWNA 3PC6A 1M74A 1D7AA 1ZVMA 5BSKA 5KT3A 1M2GA 2O6LA 2WJGA 3RH4A 3BGOS 3ZY6A 1AZLA 2WAQF 3CUSA 3D2NA 3RSHA 3UT5B 1RYNA 3OX3A 2YXBA 5A0LA 2GZAA 4PX5A 3ZI0A 1U65A 4LV6A 3H9UA 3LYAA 4G3XA 4MQ4A 4HH4A 5A6SA 2AW5A 3TZBA 2GB4A 2JARA 1RYSA 2FV8A 4ZCMA 5IG2A 1PCXA 4GM0A 1XZNA 3PRKE 4TXNA 1C7QA 1HFKA 2BFCA 4JSYA 4XYGA 4CM9D 1N2XA 3I2HA 5LXTA 3GV8B 1ENZA 3E82A 1QKIA 2BEKA 2ID4A 3MMZA 1IHUA 1AG9A 2BJHA 3UQZA 1FYWA 3OQ1A 4IRDA 3UJ6A 4A2CA 3SFTA 2NSYA 4B4VA 3MCZA 3CH4B 4NH4A 2PSDA 2ZUUA 5HM8A 1QOQB 2E4VA 3H1BA 4TUQA 2X58A 3UA4A 1JDSA 1TJ4A 4ZTBA 1UBEA 2XZDA 4CLDA 4ETMA 3CYMA 2QL7A 2OPHA 3BH0A 4ED9A 2Q7XA 3K09A 2LKYA 2F8LA 2QD2A 3A28A 3PPXA 4KKVA 1IQUA 2NPFA 1KAHA 1VPEA 2XV1A 4TYYA 2XQJA 5CNJA 3X1YA 5AK5A 4F8YA 4J1TC 4EHIA 4K3UA 4ASUD 3S2ZA 3AEKB 1X70A 3M2PA 4BWGA 3H11A 3ZK7A 2EDCA 2AJDA 3EVCA 3R5HA 4J0CA 3LSTA 1DUIA 2XKAA 1HYEA 2RGWA 3DAFA 1O8CA 5HF8A 1TD1A 2UYOA 5TPZA 1YKSA 1HC7A 1CEZA 5IASA 1LQ2A 2F8KA 5A02A 5AVSA 4CMGA 4OY3A 4DADA 3AL0B 2QLFA 3T5BA 3O7WA 3TNJA 3RK0A 2R8YA 3DBLA 2CJXA 2BHNA 3O4FA 1BJKA 2ZANA 1ZBDA 3U61B 3PNKA 4O5EA 4M9LA 1CRLA 1GV1A 2JCSA 5KYUB 1SXQA 4IAOA 2DFPA 4BASA 5L1LA 5AJHA 1SXJD 3WV4A 4ARCA 3SS8A 4CDNA 3R5TA 1TADA 4RGQA 1OREA 3PC4A 4FKBA 1Q0SA 1YZHA 1E2QA 3EGXA 2G7MC 4B81A 4QHSA 3AKDA 4G09A 1ORHA 4N0EA 1GQ2A 1CNMA 2VWPA 2G25A 2JGAA 4ZZ1A 1X74A 3SICE 3WLMA 1BNOA 4G8CA 4XM2A 4Z86A 2ZTSA 5DW3A 2OXTA 3RU2A 3SXUB 4RQ4A 1B15A 1J8DA 5AH0A 1K7YA 1RJFA 2H7CA 2ZE8A 4HDKB 1JLLA 1TUEA 3OM1A 4RNNA 3QE0A 3I8OA 4MWDA 5EP3A 1XMOB 4RF5A 1QFXA 5DEIA 1H6CA 1EG7A 3LECA 1RS0A 4IQ8A 3U17A 4MJ7A 3IE1A 5AI6A 1HL3A 2V9CA 5F21A 4QBFA 4NLCA 1XN4A 2IXEA 3F6CA 1PR1A 3UUEA 1U6JA 4GX5A 1ONSA 2I2WA 2Q49A 4WWHA 3FI9A 2GN4A 3QTTA 5E4YA 4OHUA 4UMVA 2ZXUA 4L08A 7MHTA 2BI7A 1U2EA 4FGWA 1NLUA 3PKIA 1RAGA 1EQAA 2UVWA 1PJLA 2DECA 3PDWA 1G6OA 4IDPA 4P7BA 5LZ5A 3T3DA 5TQ0B 2HPAA 2E5LB 3QA3E 1V8BA 4EB6A 2BBWA 2VTVA 4OLAA 3PJDA 1Y33E 4Y6GB 3G8AA 3H7AA 4G84A 4EG3A 4LF6B 3CB4A 1ONPA 3KNZA 1VGQA 4DEVA 1TO6A 1L5LA 3SNHA 2BI8A 2HVIA 4OUKX 4B09A 4QOEA 3AU6A 3GJQA 3H05A 4KE7A 2GESA 3HLKA 2YVUA 4OSOA 4PRZA 2O8NA 1U9IA 2G9NA 4AROA 4CEIB 2RMKA 3RASA 2XVMA 4NDZA 1CJBA 2AB0A 3UO8B 4D5EA 3EWNA 1UA1A 3KZXA 1L4FA 3FYUB 3R3WA 5BR7A 1Q0TA 2ZAIA 3TSWA 1SOMA 1AK2A 1EKXA 4MP3A 3I76A 3WDLA 3AFIA 3QMVA 5CTAA 2GT1A 3STWA 1C1DB 1L5YA 4LK3A 4Z6CA 1XT6A 3OFNA 4WKCA 4YUVA 1NC3A 2E1EA 3BD6A 3NTOA 4I1OA 3T3OA 4C0XA 4CMKA 2VAMA 2MUTB 4RTOA 3GLGA 2VSXA 4DJDC 1RT9A 3MXOA 1W6UA 2MSEB 5C52B 8ICJA 4GZ5A 3ETJA 1JHMA 4F2HA 2P4UA 3NGDA 1XGKA 4JVLA 2Q6IA 3WHLA 1DL5A 1N7HA 4ARUA 4KXNA 4XJXA 5IDYA 5M7EA 2W8ZA 3LDFA 1NVFA 3I28A 1E5DA 1GAEO 1N25A 1I5OA 2DC1A 2WIBA 3EGEA 1U11A 3I5UA 3PCXA 2IH5A 4EYEA 4FC6A 1T26A 4K9OA 4RMGA 3GEHA 4IX1A 4QQNA 3I6ZA 5B1EA 5JBNA 5KOJB 2JJYA 4CM4A 4UAGA 4F3NA 1FP2A 1IWBB 1AB6A 1YJQA 3TZ6A 1J2UA 1II9A 2EJVA 2R84A 3KAPA 4Z1MA 4F4IA 4G0VA 1I0IA 3GARA 1DTWA 5DTIA 3GUZA 5L3ZA 2WTMA 1VCHA 1NONA 2INGX 4OHFA 2WWIA 2B36A 4AKTA 2YC4C 3A27A 4DY6A 5FDFA 3JD4A 3DKVA 3AL2A 4Y8VA 4HGQA 1UBGA 3MFHA 3EF1A 4HSEA 2AJCA 1OX6A 3X1ZA 3FNIA 5ADWA 2HPZA 5GJBA 3BL8A 2VRNA 3EXHA 5A7FA 1Y42X 1Y4AE 2XIQA 2NYVA 1DC3A 3DYBA 421PA 3JU3A 1D2RA 4PZNA 5A5DA 1Z88A 3HCWA 1HF3A 3FA2A 1R00A 4YFVA 4DMRA 3NGXA 1ZD8A 3KJNA 1UT8A 3V4VB 3OLZA 3SS7X 1TUIA 5AK4A 3GMDA 2HPVA 1TAHA 4EI2A 2B98A 4C4TA 1C3XA 2P9CA 2FQQA 3LDUA 2WIDA 1QH9A 4X97A 2VDJA 3U5ZB 1GUBA 4G9GA 2WYOA 4LYEA 5JZ9A 4C2TA 2YWRA 3R3VA 5KFMA 3GDHA 4HAOA 1VYHA 4C8MA 1IBMB 5FUBA 5EWJB 2OQRA 3W5AA 1UEIA 3EBLA 5AO9A 3EVNA 1FMJA 2OCYC 2XIDA 2ZT5A 5JJLA 2XTMA 3I64A 5ESRA 3VX4A 1DC5A 1CLEA 4GXJA 1OIWA 1ZGZA 2A86A 4OJKA 4R2LA 2H3IA 1PQUA 1O6CA 1V3QE 2HKIA 2IOYA 4M1QA 1N9ZA 1NC1A 4OJYA 2YOFA 3OIGA 3SSOA 3KKAC 1RBMA 1T8TA 1WF6A 2IUYA 1Z75A 2CVPA 1J8VA 2Q5CA 1AS0A 3KLNA 4L2IA 2AV6A 4LQLA 3K5WA 5LQDA 2BSQA 2KJQA 2FW7A 4YJ3A 5IC4A 4J9VA 1GPWB 1W85B 1TYAE 4TUYA 4ZC8A 4GX2A 3SF0A 4KMOB 1S0MA 2P0AA 3AG5A 3KOYA 3PUZA 4JB0A 4R9UC 2ZAGA 4GKAA 1AKMA 4S0XA 1QJ4A 2KD1A 1Z5WA 2FHPA 1Z4KA 2Q4RA 3ENKA 1GDHA 1W0KA 4CM1A 2R5FA 4EATA 2XGPA 2FN7A 5DQGA 1FA9A 5U1PA 3G2LA 3K73O 4ZCRA 2JW5A 4JL8A 3IP7A 4P6VF 1W44A 5ICCA 1HG0A 1EQUA 4AKEA 2ZRLA 3C2KA 3GVPA 3IAM6 4HDNB 1RPJA 4YJGA 4DMKA 2JGDA 3FTFA 3AZPA 4B3JA 5HMLA 1H4QA 4UQLA 1DADA 1TM3E 3ILSA 1TNDA 2EFCB 1CHNA 2DQ4A 3KAJA 3SJCA 3TZLA 2HJRA 3KXPA 3ZWBA 2BGWA 5JYDA 3ED1A 4IQTA 3LF1A 2XWBF 4QNRA 3SHFA 4ZT4A 1DAPA 1IZYA 1ORIA 3LTNC 3THRA 3BN3A 4Q9HA 3MJ4A 3OZIA 3QA9A 3V2HA 3OKFA 2QPLA 4LDJA 4XGIA 1K3TA 2P4QA 3PQ5A 4IO1A 5H3HA 3B70A 1A04A 2EZ9A 4EVQA 1E4VA 1WXXA 3Q85A 3DLPX 1YS1X 3HV0A 4TS9A 4C8NA 2PU5A 3I45A 4OEHA 5DB6A 8ICQA 2VO1A 3JAWB 3RU3A 8MHTA 1YQUA 1M2NA 2FZEA 4D3XA 3A1TA 4TRMA 3IH5A 3R40A 3U7JA 3FSGA 3UXYA 1SN7A 2CBXA 5LLDA 2Q2WA 2NG1A 2QN8A 1K5GA 3CLRC 3DAHA 3NP9A 3Q98A 3WFZA 3JWHA 1K8ZB 2J9FA 3B2EA 1TEHA 4FR0A 2D1FA 1GTZA 1KGDA 5BWBA 2Q2VA 3DL0A 2DUYA 2VZ9A 3NVAA 1NP3A 5GZ1A 4M7RA 2ODTX 1H2HA 2OAEA 4MUBA 2OCGA 4IZHA 5HILA 5A6SB 1OKKA 7ICGA 2HT6A 1ZQQA 1QNFA 2ROQA 4FX5A 4Q16A 1T6XA 3QUAA 2H2DA 4RTKA 4IQGA 4CQNA 2YW9A 7ICIA 1W5FA 4F92B 1YRLA 3OTGA 3KKAA 2QGFA 2GXUA 4U1RA 4MAAA 5C46F 2RHDA 1N6LA 2GILA 1M2OB 1YJBA 4W7SA 1RPZA 4ZA2A 3A8TA 3HKDB 3L40A 3I6BA 3OHAA 1FNNA 5U4QA 1XZMA 5C7IO 2E9SA 3WB9A 3EW9A 1ZM2A 1I2MA 3HJRA 4GR4A 4M1WA 3R7LA 1I1HA 1V7PC 1JROA 5JXHA 3LP8A 5JSHA 1V3UA 4BRUA 5I7HA 5AICA 2WTXA 2G5CA 3IYLW 1AUPA 2RBEA 2AC7A 3LS2A 4KFUA 2I5HA 3UTCA 3GU3A 4B6SA 5LNK1 4EPVA 1NZPA 3JV7A 1E32A 5FA5A 4E5NA 1YMVA 2M2IA 4RPHA 2LCIA 4TT3A 2IBKA 4OQZA 1RCTE 3AEKA 5CXSA 3LPAA 5DP2A 5ENVA 1AO3A 1K5OA 1E94E 1V16A 2C9CA 5JCJD 2WQ7A 3FPGA 2CVHA 3ACBA 1IONA 3BXZA 2W6ZA 1CQZA 3I72A 3NTQA 4L51A 4BNVA 2E3TA 4GE0A 3GK3A 3AK4A 4B6OA 2PFKA 2QAGC 4L27A 4KR7A 4J1TA 4JNKA 1XMVA 1WUDA 2QRQA 1H2RS 4RLQA 4FHGA 4DWJA 1XR3A 4FO6A 1QV9A 2X1VA 4RA6B 2BAGA 2CKDA 2ILVA 3ABRB 2QQGA