2OM6A

Hypothetical protein (probable phosphoserine phosph (ph0253) from pyrococcus horikoshii ot3
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
233
structure length
233
Chain Sequence
MREVKLVTFDVWNTLLDLNIMLDEFSHQLAKISGLHIKDVANAVIEVRNEIKKMRAQASEDPRKVLTGSQEALAGKLKVDVELVKRATARAILNVDESLVLEGTKEALQFVKERGLKTAVIGNVMFWPGSYTRLLLERFGLMEFIDKTFFADEVLSYKPRKEMFEKVLNSFEVKPEESLHIGDTYAEDYQGARKVGMWAVWINQEGDKVRKLEERGFEIPSIANLKDVIELIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable phosphoserine phosphatase
publication title Hypothetical Protein (Probable Phosphoserine Phosph (PH0253) from Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 83
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature ec 3.1.3.3: Phosphoserine phosphatase.
pdb deposition date 2007-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.400 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2om6A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2om6A01
3FGOA 1RDFA 5AW7A 1YV9A 4HGOA 1RMQA 4UMDA 1Z4NA 5AW5A 1JUDA 2P69A 2B1QA 2HDOA 3ZTWA 2YBDA 5AIAA 4KNVA 4UMEA 4UARA 2HI0A 2AGVA 3U7GA 5ALZA 2CFSA 4AS3A 1J97A 1Z4OA 5IT4A 5AKZA 4IG4A 5AM1A 3A1DA 3F9RA 3L8GA 5AI0A 4Y2JA 2JGAA 2P9JA 5AW4A 2Q5EA 4RETA 2EAUA 5AKKA 3WK9A 5IT0A 3N1UA 5AVRA 2ZXEA 3P96A 5T41A 1N8NA 5AM2A 5ALTA 2YMLA 4YCNA 3QU4A 1ZD3A 3S6JA 2DQSA 4DFDA 1Z5GA 5AI4A 3HLTA 1YS9A 4NWIA 2I7DA 2G1AA 4XE5A 3ESQA 4C4SA 4ZEXA 3CNHA 4MUMA 2FEAA 5JJBA 1PW5A 3ZWKA 2RBKA 3WK5A 1Z4MA 4Y2XA 4UATA 1VJRA 4FYPA 4KYTA 3SKYA 1RC8A 4YH1A 4KX5A 5AVVA 5AKHA 3QU7A 5ALWA 1L6RA 5AI9A 1XP5A 3I6BA 1ZRNA 5IS2A 3FZQA 5AKIA 2ZBEA 5AW2A 2BY4A 4CNQA 2CFRA 2BDUA 2FPSA 1CR6A 1U2SA 3QUCA 3SF0A 5AVWA 1RLMA 5A3RA 2C8KA 3TLMA 1SWVA 1ZRMA 3L5KA 4Y2PA 4UM7A 1RMYA 2R8EA 2HO4A 4JB3A 2VKQA 2IOFK 4HAIA 2OBBA 2ZBGA 4UU0A 2O9JA 2EATA 2BDEA 4BX0A 5ALJA 3PGLA 4HGNA 1U02A 3EF0A 3AR3A 2B30A 2RAVA 3KDPA 3W5CA 2HCFA 3NAMA 5ALRA 3KC2A 4G9BA 3E81A 5AKGA 3DDHA 3NRJA 4L57A 3I28A 3OCXA 3OPXA 2FPWA 2RB5A 3IJ5A 5AHXA 2WF9A 2ZBDA 5AK5A 1U7PA 2CN1A 4EEKA 4CF3A 3WK7A 1WR8A 4AP9A 3R09A 2HHLA 3ZX5A 4UAVA 5AVTA 2JAWA 3R9KA 1QQ7A 3D6JA 4NABA 4RESA 5ALGA 3OTQA 1Z4KA 4CF5A 2PR7A 4NFLA 1EK2A 2YJ5A 4G63A 1XPJA 2YN4A 2ZOSA 3L1VA 3K1ZA 1RPZA 2R8ZA 3ET5A 2ZBFA 3ZX4A 1VJ5A 3ONNA 4ZEVA 2YY6A 4HGRA 3KZXA 3ZI4A 3UMBA 2WHEA 2ZG6A 3ET4A 3DV9A 2NYVA 2G08A 2Q4TA 2G06A 3QGMA 3QYPA 2GHTA 3MC1A 1YJ5A 3AR7A 5ALPA 3OCUA 2NO5A 4YGYA 4NAVA 2GFHA 1YMQA 4BBJA 1ZS9A 2X4DA 3NASA 3WKAA 1O08A 4OD0A 3WKBA 3RF6A 2YMPA 3U26A 2W11A 1NNLA 2G80A 1EK1A 2FUCA 4GXTA 2AMYA 2QYHA 5ALXA 2GO7A 3ESRA 1RQNA 3VAYA 2B0CA 3UMGA 2NO4A 4UASA 1Q91A 3MMZA 1RKUA 4BNDA 3ZW7A 3EWIA 2WM8A 1RKQA 1WVIA 2IYEA 3UMCA 5AKXA 4UMFA 5AI5A 1TA0A 3KOOA 3EPRA 3W5BA 3AR4A 2JARA 4KN8A 1NRWA 3OCYA 5ALSA 1X42A 3BA6A 3NUQA 3B9RA 3PCTA 3ZVMA 1QQ5A 1ZD5A 4L6CA 3IB6A 5AW9A 2C4NA 4BYGA 5A3QA 2GMWA 2R8YA 4FE3A 1RKVA 3U13A 1QYIA 1FEZA 4EX6A 4UU1A 1TJ4A 2B82A 3N5KA 2IA5A 4E88A 2PKEA 3WK8A 3GYGA 3QU9A 1Z4JA 4DCCA 5ALDA 3WGVA 4UMVA 5AK6A 1RMTA 1KYTA 3OCVA 4QQFA 3ZTYA 5ALUA 4J03A 4F71A 3WKEA 2YMQA 5A3SA 4HGQA 2GHQA 4OCZA 5AIBA 3W5DA 3J7TA 2AH5A 4F72A 3ZWDA 5ALOA 4PNHA 3AR5A 3M1YA 3KD3A 3MN1A 5ALYA 5AW1A 3M9LA 4I9FA 4XOUA 5AVSA 3L0CA 3WKCA 5ALVA 2B8EA 4MWOA 4Y2QA 2G0AA 1F5SA 4HGPA 4HYTA 3MPOA 2C8LA 2O2XA 2OM6A 2EARA 2HOQA 3AR2A 3ZUPA 3B9BA 5AVZA 4QJBA 5ALQA 4EX7A 3N07A 4XQ0A 3ZVLA 5AI8A 5ALLA 3E8MA 3ZVNA 1L7OA 4Y2TA 2I6XA 3FM9A 4Y2VA 2WF8A 2JAOA 2OA0A 1O03A 1TE2A 5AKYA 3SKXA 1Z4IA 1WPGA 1Z88A 3NALA 1L8OA 4BKMA 3SMVA 3QUQA 3A1EA 4JDPA 1AQ6A 3U7HB 2FPRA 3AR6A 2FUEA 3L8FA 2C88A 2G09A 3L0BA 3QU5A 4IFTA 5ALHA 4EZEA 4L6AA 3FPSA 4OFZA 5ALKA 2YJ4A 1MH9A 2B8JA 2I34A 1LTQA 1YNSA 3PDWA 4B6JA 2ODAA 1NF2A 4O8CA 2OYCA 4Y2RA 3QXGA 3NIWA 3L8EA 4FFDA 1Z4PX 4BX2A 4AS2A 1ZD4A 2I55A 4KX3A 5E0OA 3DNPA 2AUTA 4C4RA 1RLTA 4YIHA 1ZD2P 1L7PA 3U19A 1YDFA 3N28A 5AI6A 4ZEWA 1VFPA 3I76A 4YCLA 4Y2SA 2I54A 3E58A 1RRCA 1Y8AA 3EF1A 2Q4RA 3IRUA 3RFUA 4EELA 4EENA 2W43A 1WZCA 5AK4A 3A1CA 3A3YA 4BNDB 3AR9A 1QH9A 5AM3A 2FI1A 2WFAA 2P11A 1S2OA 3L1UA 1J8DA 2D2VA 1ZJJA 4CF4A 4I9GA 4UAUA 4Y2YA 4CE6A 4Y3UA 1CQZA 3SHQA 2G07A 1XVIA 3W5AA 3I1YA 5AKJA 1U7OA 3L7YA 5AVQA 5ALNA 2HF7A 4KNWA 5AICA 2R8XA 3FPBA 2CFTA 3QU2A 4BEWA 5AM4A 4C4TA 5AW0A 3QUTA 2MSNA 5AKEA 3ZU6A 3L8HA 3WGUA 4YCMA 3CZ4A 1IWOA 4DW8A 2QLTA 4DWOA 3E84A 4UM5A 3AR8A 3QX7A 2HSZA 3NANA 1RLOA 4GIBA 5AW3A 4BEVA 3KBBA 1SU4A 4Y2UA 2C9MA 5ALMA 5AM5A 2WF7A 1T5SA 1Z4LA 5AW8A 5AVXA 3WK4A 2IOHA 3N8GA 2JAUA 2P27A 1TJ3A 1QQ6A 2PQ0A 3DAOA 5AVUA 1Q92A 4YIKA 1RQLA 5AW6A 1Z4QA 1T9ZA 1L8LA 3QLEA 1ZOLA 4NV0A 4J2TA 3WK6A 3ED5A 2FDRA 2WF6A 4H1WA 5AM0A 3FVVA 5AK3A 3UM9A 3QUBA 3U7FB 1L7NA 2MU1A 2B1RA 1U2TA 3L0YA 3R4CA 3WKDA 2HF2A 2I33A 2RARA 3SD7A 2YJ6A 2HX1A 2W4MA 4XPZA 5FP0A 3QNMA 1S8OA 2YFYA 3OCWA 1L7MA 5AVYA 3HYCA 1TJ5A 1Z5UA 3SLRA 3OCZA 2WF5A 1K1EA 2HEGA 2YJ3A 2YMMA 3B8EA 1N9KA 4OHFA 5ALEA 5ALIA 3U7EB 4UW9A 1SWWA 2FPXA 5AKLA 1LVHA 2IOFA 5ALFA 3PGVA 5AESA 1T5TA 2FPUA 3BWVA 4BX3A
chains in the Genus database with same CATH superfamily
1O5OA 2PQMA 1ZC3A 4EHAA 5J29A 5CH8A 9ICXA 2MIIA 2ID7A 4RY8A 2P9YA 4D5EA 2CE2X 1YFZA 4EH1A 2NU6A 2C1ZA 1NW6A 3IT1A 4IRMA 2J7PD 1HV8A 4ZOQI 2A57A 4D25A 1SOAA 4DR6B 1SUCA 4XSVA 5CCEA 1QF7A 2HHTA 2G1AA 3PYXA 3ZIDA 1SC4A 2FN8A 3KKOA 1I4WA 1UT8A 4M9UA 2AGPA 3U7QA 4B3JA 5C37A 3FFBA 5A3RA 3OZCA 5KWIA 4RELA 3R0VA 1ECLA 3BXPA 1XPUA 3GLQA 5KT3A 2UVPB 4RJKA 4DQKA 1Y8CA 3NW9A 4ZDKA 4WK2B 2OLJA 4Y0VA 1Z74A 3I28A 1LNSA 3A3PA 1I51A 3RRXA 3D2AA 2Q21A 5C1BA 3S55A 4CCHA 4R7ZA 4RA6B 5AUNB 1GL7A 5ALGA 2Z6AA 4KTTE 3WWPA 5TS3A 2R1VA 1SY7A 4HVAA 5DG7A 5AXCA 1ZKMA 1Y7LA 6PFKA 4CETA 4AG5A 1H9BA 3GEEA 4Q7MB 3I2FA 1EVEA 4HLQB 2XUFA 3BSSA 1A69A 2Z9BA 4C7OA 1CY1A 4EPWA 2R47A 3CT4A 4NBWA 1DAMA 1SKSA 1ZU5A 3UWOA 3O5AA 3STYA 1EK1A 3CVYA 2VDJA 2XQJA 2V9CA 3HY3A 1B3RA 2XGOA 1RKQA 1AJEA 2F1RA 5I5GA 2I2AA 1L0BA 1XRQA 1GADO 1L3SA 4KE7A 4RE5A 2WJIA 3E5NA 1SXDA 4OB7A 4J90A 4E88A 1BYIA 4LRWA 1IZZA 3OJEA 5CDGA 3K16A 3T3DA 2EWWA 3TRFA 1R15A 2KVSA 1XO1A 1WCV1 3IPYA 1ZXIA 3AF0A 1P7PA 4E5YA 1UXIA 5K0JA 2VT6A 3AEUB 1WSDA 4LNUA 4I9FA 3WJAA 2IX3A 2PZFA 3U5TA 4JGBA 3ID6C 2FAXA 1XMPA 9ICUA 1W1WA 3A28A 1YS4A 1B16A 3HJEA 3EZXA 5B2ZA 2KFNA 1OVMA 2G3YA 3V4PB 4KGZA 3TR5A 3GVCA 3W34A 1QP8A 3G7UA 2ZTVA 1OI4A 1JQAA 2QP3A 2C7BA 3IILA 3NRWA 4X92A 4HT3B 2CNKA 3ZCVA 2JA2A 2GBCA 3DZKA 1PV4A 3GO4A 1NJFA 3E22B 4FEAA 2WABA 3M6FA 1JG6A 1K7SN 1YZ3A 4KLHA 2VJMA 4B0OA 3TK1A 1OZFA 4MW4A 4QRIA 4XVUA 3C3DA 1N5IA 1MFZA 1I80A 1YULA 2EDCA 4RMIA 1FW8A 4MPDA 1KI2A 1U8FO 1ZQYA 4KQWA 1M1NA 4YD2A 2X0DA 3SX2A 4LV5B 3K6KA 2IYZA 2MYTA 4ED1A 4ISCA 5AW0A 3D4IA 4YJ3F 2PANA 4JLAA 4O08A 5I01A 3T3OA 1SCQA 5GJCA 4BEVA 4HEJA 1OJLA 2VJBA 3VYWA 3THYB 2CNWA 1Z45A 1YFJA 5EQTA 1I6KA 3AETA 3LECA 1V85A 2QTLA 1ZD9A 1A50B 5IANA 5HR7A 5IUKC 1GFZA 3Q41A 1WUKS 3NDPA 3WYEA 3HYCA 2KZZA 3AVQA 4MMXB 1HE5A 1W0JD 3BJIC 1L4BA 2A1TR 3QG5A 3IESA 5JJ5A 5CHGA 3JYQA 3DEYX 2XNCA 5ADVA 2DLCX 4MEBA 3PXAA 1TQ8A 5H83A 2ZTHA 3JVVA 5G02A 4XFDA 1AV6A 1T2NA 5CDHA 1NN5A 4OF4A 5AJYA 1TLFA 1T3SA 2OD9A 3AOEC 4B4WA 1ZONA 1HDCA 1WDKA 5KX5A 3IT2A 1L7XA 5D7BA 3BC1A 3I6YA 1L7BA 3S8YA 1HTWA 1Z36A 3MAAC 4UATA 3E35A 4RHXA 1GTL1 4W5OA 4IJVA 3RUHA 4PYOA 5AOBA 3I3SR 2V7EA 5CB4F 5ERYA 5IARA 1ORHA 1GOTA 1SPBS 1U0EA 4NY1A 2HXYA 1F0PA 4N5HX 4OKSA 5KTOA 4E5VA 5K8CA 9ICMA 3GGSA 3VZSA 2BBWA 2BFCA 2HMXA 5ARBA 3RSCA 3KT6A 4YX9A 1U3WA 4XVRA 4PZ9A 4HTFB 1XTSA 1M2KA 1E7QA 1GO2A 2RDMA 2AQ0A 1RAHA 4MUNA 5EUMA 2QRVA 3JZAA 3OIFA 5F77A 1Z5VA 3LQYA 1MABB 4KCGA 2SBTA 4IQ0A 4FUTA 1KO7A 5D5QA 2MSKA 5KYUB 2YHAA 5M29A 1WB4A 3A2KA 4IH4A 4BO7A 2G63A 3RRHA 3ZVKA 4AY6A 3NASA 4ZIRA 1H6AA 1IQRA 5JD3A 2VDQB 5I7HA 3S7TA 3PUKA 2H57A 3WDMA 4DLGA 5LYJB 4YJHB 3WMXA 5J4KA 1PFQA 3INNA 1UDWA 1TU3A 1KN5A 4MYSA 4UTNA 3RYIA 4HNTA 1KVTA 5LBUA 4BUJA 2Q62A 1NT2A 1NASA 3WDKA 2Q9AA 3W3AD 4MF8A 3U0BA 4PLZA 1YZLA 1BN6A 3TNDA 3DAPA 2H2GA 2P78A 2QDKA 1UBNA 2V9WA 1Z2DA 2V54A 4F4YA 2P62A 2XYRA 1AUOA 3KD3A 1BWPA 2Q6IA 3TAHA 1RYEA 2XXJA 1NK6A 3VR5D 4RADA 5TQ2A 5I4BA 5IKOA 4KLGA 4S0ZA 3IDZA 3UK2A 2I1QA 4UAJA 2EQ5A 2GS9A 2NP6A 5CT6A 4V2UA 5KTQA 4M7OA 2XMDA 2HA0A 3FCCA 1GVHA 2XNHA 1K5PA 3PZBA 1R10A 3S2UA 3ACBA 3F5QA 2JAPA 1QCDA 1XP8A 1A7KA 2IYWA 2A0YA 4Z8YA 3ZJ4A 1CRXA 1SUIA 1HEKA 2ID8A 4PQYA 1NL3A 1T3GA 4EBCA 2I54A 4B73A 3WVNA 4REOA 2O57A 2IEIA 3D31A 3EXAA 2CC2A 4EI2A 2ZKIA 1R4MB 3PK0A 1UBGA 5KEIA 4TYYA 3A6DA 2ZSHA 4PLWA 1KJYA 2QD2A 4DPMA 5J43A 3W5AA 4TMVA 4IVPA 2Z7JA 2XT9A 2BFWA 2HA2A 3WP1B 1CERA 5JQWA 4JLWA 1Q20A 1DS6A 3S1AA 2C2OA 5J2FA 4QT4A 2KVCA 5AVXA 3UYLA 3PVCA 3VU9A 4JXJA 1WMAA 4ND5A 4LC9A 1WXGA 4H1WA 1KSFX 2QE6A 1TZ2A 2W9XA 1QG6A 3KEGA 1X39A 3AWIA 1MAVA 3E1SA 4TXMA 2NZVG 5CVCA 5JUWA 3QTBA 2WF5A 4BWMA 1GITA 4JUBA 4E94A 1QRUA 3KXDA 3LNTA 5FH9A 2P4SA 3CTMA 3AJ8A 1T9GS 4M3NA 3ZDZB 4ZFNA 3NIGB 5E6RA 5AUOB 1RDFA 2O1WA 2PRJA 3HGTA 4X65B 3B89A 5FFFA 4BRSA 2KBEA 2J6TA 4KXWA 5BV1A 2VA8A 3ROFA 3A1DA 1T4DA 3RT7A 1JFFA 4F21A 4G2NA 5GONA 4JL6A 3NYIA 3QU4A 2JK0A 1J24A 2I99A 3QJYA 4KBFA 1RI2A 2ODEA 1N5RA 3QU7A 1XF9A 5EIWA 2PX8A 3JAKB 4CKBB 2CVPA 5HA5A 1EPUA 2DM6A 3DPIA 4QU9A 3FYTA 3V1KA 1BVHA 2VKQA 1NRXA 2OKCA 4LS3A 4BE7B 3JQ6A 2B30A 4Y9SA 4EGSA 4S0XA 2KMLA 1M74A 2BFFB 4HAYA 1RKBA 3OHBA 4D45A 1BTOA 4I2BA 3RB8A 5A3VA 2J3DA 4OYLA 1AX9A 4C8KA 4G9EA 2HQSA 2NVBA 3P9ZA 3ZDEA 1EE9A 4L3VA 4QUAA 1SIUA 4Y9TA 4NH4A 4UCXA 1F6BA 3WSWA 3AL2A 1KBZA 3D0KA 2ISCA 2CL7X 2ISQA 4CLOA 1Q46A 1EDDA 2GESA 1NK9A 1TCVA 4ICAA 2VNHA 4IILA 1PL0A 3IP5A 4RPGA 2JBWA 3QVKA 2H5JA 3DL0A 3AM3A 2C4TA 2P9FA 4P83A 2P0EA 3LRXA 4E0DA 4E11A 3NEPX 4E1BA 1MB3A 3UAGA 3DG9A 3OQ6A 4XEUA 2QQGA 2O2EA 1Z0KA 4S1NA 3AHDA 1I0IA 3UC9A 3C48A 2RBEA 5KFIA 5HNKA 4J7XA 5B3JC 5H16A 4I29A 3KUXA 1KJZA 5FUBA 4U6PA 4LJ4A 3VJLA 1VIVA 3RAPR 3KSBC 4DLWA 2XVTA 2NRZA 4QA9A 4JZKA 2V03A 4IIYA 1RQRA 4OBWA 3DC2A 2NU8A 4UE2A 4I3HA 3BORA 4R54A 3K70D 2WOOA 4I2CA 2HYIC 3N86A 1C2TA 2I87A 3HFJA 5LYJF 2PA0A 3QVTA 1CZRA 1FP1D 2A33A 3SV4A 2QG4A 2LWIA 2WNSA 5CJ7A 1Q0LA 4JSTA 2ZYVX 4PZCA 1PK8A 4F12A 2QP4A 3AR6A 2W22A 3LQRA 3IBGA 3I6QA 1C3XA 2LYBA 4BTLA 3WO1A 4R41A 1XRSB 4C4YA 5IAOA 5CNMA 4GEGA 2XAAA 4D81A 3Q8LA 5KJFA 3U37A 3H86A 5E0OA 4LJRA 4Z3DA 4C6TA 3M5PA 2AQKA 2ZR7A 4KODA 2YYSA 1IE3A 5FUXA 5LUBA 1BJRE 2ZI3A 2IH4A 4GGOA 4KAXA 5AK4A 2R3SA 5JSYA 3QPWA 3RTVA 5DHPA 4JU9A 4N5DA 3O31A 1KIFA 3JQGA 5KYXB 5AICA 4B1FA 4KPUB 3K9LA 1UR5A 1L7EA 4CUKA 3R7FA 5K3DA 4KG7A 4LYDA 1GPUA 5LZ5A 2QB1A 2V0NA 1W2HA 1V8OA 1QO9A 2W5UA 3NHFA 3AESA 3BMXA 1YA8A 3QXSA 3GZJA 1UFOA 1DSSG 5FLXA 4OK5A 3SF8B 4DMGA 2F4VB 3GVXA 5KNBA 5KT5A 4AX4A 4MAAA 1LTHR 2ORED 2P1DA 1CJCA 4M9ZA 1F2UB 2Q5LA 2CV0A 3QNMA 3PC8C 3MWDA 3T34A 1MPXA 2CPRA 1VPVA 1JBEA 1E58A 5DTRA 1ONNA 3RYCA 4ARCA 2EJTA 4YJGB 1XDZA 5HTOA 1B8PA 2DWOA 1AQJA 1Y1LA 4DUGD 1YF3A 1SWWA 2YZMA 2NNLD 7ICVA 1RYUA 4D9NA 4BX3A 1L4MA 2H5XA 1P80A 3HWRA 7ICLA 1ONPA 1N2XA 5ESRA 5JROA 1ZQGA 3EVEA 3M3DA 1MORA 1TF7A 4AW9A 3V72A 3M7IA 5HFNA 1ZGZA 3A6FA 4TYWA 3S99A 8ICFA 1RM3A 2C3YA 3PDJA 2FNAA 2VAXA 4OI0A 3S2ZA 1TGYA 4B9EA 1GPWB 2CKDA 4D8UA 3WP0A 3N0WA 1C5KA 8ICGA 2F62A 3OMWA 4P8RA 4YWHA 5AI9A 3LUAA 2O52A 1QVWA 1CR6A 1K9SA 1RMYA 2QIOA 5BR4A 3PGLA 2AOTB 4MVJM 1HZZA 3UUGA 3IDOA 4BNHA 5E7QA 1WU8A 2QTNA 2Y1KA 2HQOA 2VQ3A 1GGKA 4P3KA 2H52A 3H5AA 1M6NA 4KXLA 3S7ZA 4IOLA 4AP9A 5DM1A 5D8DA 5KWSA 2ACKA 3ENZA 5CAEA 4TWBA 3O9ZA 4BNGA 1W88B 4Z0TA 1R6XA 4RO0A 1NLZA 4B85A 1MIHA 5DDIP 1P8JA 2FZVA 1Y33E 1NBMA 4WESA 5DBIA 3A1VA 5G1OA 2QOEA 4KB5A 3QEMB 4BO3A 2ZVPX 2PKYX 3OCUA 1PEKE 4BTEA 3IBSA 1VBFA 1U90A 2HA6A 2RQ5A 4JYBA 4YRGA 1ZXBA 1KAQA 2R79A 1RQNA 5D51S 3DE5X 2FUKA 4BCBA 2A5LA 2YV4A 3LGAA 1XK6A 3WLPA 1MVOA 3BGVA 4ODIA 3C5FA 2AN5A 3GBVA 1NDUA 2GVDC 2QX4A 4QNRA 1K8ZB 5F3WB 1WB9A 4ZJPA 4R8UB 4W7IA 2QMYA 2R8YA 3P71T 4F4HA 4CCWA 3MCUA 1XT6A 5CNKA 1QNLA 2H1HA 2H9AA 1S0OA 2Y9UA 2HU5A 1CUYA 4H3VA 2C3PA 2VNJA 4OQ4A 2WVJA 3U6BA 4J03A 3AI1A 1JEYB 3N8DA 1RXVA 2WJ3A 3BE5A 2P68A 2ERCA 2D0OB 2Z6QA 5ILGA 4MWDA 2KEYA 2DX7A 3UIEA 4UUPA 1RP7A 3AXSA 2W98A 3RRYA 2OGSA 5CFLA 4UB8U 3OOJA 3OLZA 4Q45A 2IHBA 1GFWA 3R4VA 4OV6B 3GFVA 4ME6A 1CDDA 2BD0A 1HUOA 2R7MA 5F9MA 4RKRA 1G8SA 1XNGA 4RHCA 3U4IA 4ZOHC 2PFOA 4R1LA 3S8EA 3BH6A 4CBVA 3DMNA 1JDBB 1QCCA 2O2YA 1L8AA 2XA9A 2JJYA 3RVMA 3BT7A 3OH8A 2IYLD 4QG7A 3BH7A 2G8NA 2FEKA 2DT8A 4X66B 2WV9A 1D8LA 1RM4A 3AW8A 2VIXA 2MYPA 1Y88A 1OKKD 1E89A 5IABA 1QFSA 4M54A 4O4IA 4EA6A 5SICE 2GBGA 2VEDA 4C14A 3TBFA 3SOPA 3UG6A 2XT6A 1XGKA 1C7YA 1ZDMA 2GNPA 2W2KA 2Q07A 2E4ZA 1V5GA 2MCFA 1EDZA 1SQ5A 4KZKA 1EU1A 2OHXA 3T5HA 1Y82A 2CNNA 3PV8A 5HZKA 4IS3A 4C3UA 1CF9A 2FPIB 5AKJA 2X77A 4JA2A 2BKUA 4EBFA 2P91A 3OLYA 4ZVOA 1A8IA 4C0JA 4M0LA 2E1EA 1KO8A 1RQ7A 3O84A 1NMQA 2VJDA 4CU2A 1A82A 5FFNA 1JVBA 1RLOA 5CVEA 5G0UA 1SCIA 2GJAA 5ALMA 1NVAA 3P2EA 5C32A 4B83A 4C1BA 3HDGA 4MPTA 2OKGA 2M9MA 2M6LA 4JLPA 2DY1A 4DLSA 2G9VA 4X24A 3PXXA 3KQNA 4I46A 4PU0A 2G83A 2WYWA 5DOVA 1FFDA 5L6MB 1U80A 2NYAA 1RWKA 2R8KA 3FBWA 4JELA 1GG2A 1GU7A 5FBHA 4URHA 4Q02A 3BMCB 1YB2A 1WZEA 4TT3D 2K87A 3PDCA 4BLQA 3D54D 1F8GA 1W0KA 4Q4HA 4WZZA 1YJQA 4P4TA 2EWMA 1VLVA 1JDBC 4DA0A 3A11A 1UM9B 5FJIA 4O0LA 4J43A 3T7RA 2IBMA 4E2WA 2QROA 4RFSA 5GAJA 5A7GA 3SYNA 5ALTA 1B1CA 3D8NA 2VC2B 1QYDA 2RAFA 2HLPA 1BMTA 2BGLA 3X1YA 2ZB2A 1KZYC 3HUDA 1SC1A 4KX5A 2MTBA 1P0PA 4EHDA 5KG6A 3QNWA 3LVFO 2AGOA 3TLGA 2HNBA 3GLFA 1KKMA 1EQUA 2QRZA 3AKDA 2PGAA 5C1IA 1FFXA 4QM6A 3RR8A 4YAEA 5KOHA 1GDDA 1B2LA 3F46A 1R6VA 3VTAA 3QW4B 4Z9AA 1PWYE 4XSGA 2X0IA 1U7PA 1DCMA 2ZSAA 1U3GA 4G4SP 4I2VA 1I7PA 2EGHA 4KL8S 2WFMA 3ZQJA 5FTMA 4PXSA 3DE1X 4ARVA 3OSZA 4NM1A 1HMPA 4BL5A 2AN1A 2JXJA 2WQZA 2EJWA 4IC9A 1VI6A 2OZEA 3M6LA 4PCLA 4M0DA 4NJ8A 3PDIA 2WZDA 5F7ZA 3IG8A 2Y4OA 3EPKA 2QD1A 3ICCA 3CVJA 4OD0A 2WTAA 4EK9A 5DMHA 2ZIFA 4FO6A 1GGJA 5CDFA 4RS3A 1AGXA 2DQYA 1UBKS 4EEZA 4MH0R 8ICMA 3Q8XB 1PGNA 1L4UA 1NTOA 2ENWA 3AF5A 1VYVA 3DOOA 4C4ZA 3CUYA 2HK9A 2JIBA 1GA4A 1BE6A 2RKOA 5EVJA 4A91A 2ECOA 3GEBA 3ORRA 4IVNA 1K2VN 3FWZA 2P6OA 1EHCA 2J3EA 3AF2A 5DZSA 1KNQA 5HRUA 3L01A 4JGGA 2YMQA 1YI8A 3QBTA 2GYUA 2P4HX 2Q3LA 4CM4B 4PG5A 4QEZA 1V1RB 2HLHA 5EHXA 4C6RA 1AK9A 4JBHA 3RVRA 1Q7BA 3P27A 1G3MA 2WWIA 5BWNA 1GL6A 2NUPA 1E8NA 4QQ8A 2XEDA 5DNCA 3R3JA 1FQKA 1BNOA 2JFGA 4ER6A 1DDOA 4ED7A 3AMVA 1CEYA 3LL7A 2H2DA 3V55A 3HYRA 3WJ2A 1H42A 1XDUA 3GA7A 5JSUA 5IF3A 2V4MA 1I3CA 2LV8A 1L8OA 5DGAA 1XXHB 1HNXB 2E4VA 3V34A 2FPRA 1AHPA 2I6FA 4P6VF 1Z5OA 1B0PA 3KKEA 2AG1A 5H82A 1LGYA 4MQFA 2AVNA 4MWCA 1PJLA 3Q85A 4MQLA 3PBKA 2WTEA 1JLLA 1RXIA 4C0KA 1U1DA 2Q6VA 3SPXA 5IC4A 1YJXA 1B8VA 4UM8B 4M0MA 4AKEA 3H83A 5JAZA 3WRVA 5F7XA 4QREA 4I1RA 1OBHA 2DF8A 4KLUA 4BLTA 3WYNA 2I3DA 5TDHA 1ZESA 3ROMA 1XOIA 1T2FA 3PSTA 2C2ZA 2P30A 2BN4A 2J4DA 3ESXA 3BJZA 4N0EA 2MR6A 3FY4A 2QNRA 4ZAGA 3H4MA 2O3JA 3GOQA 3OX4A 1NXPA 4RXMA 4FOPA 3ZZ1A 3R24A 2VWGA 3HKEA 2OLKA 1O57A 5HZMA 2QZZA 4BVEA 1HBJA 2PWZA 3DA8A 5KFRA 3SFTA 2RHMA 5KOJA 3H11B 1XZGA 1Q1EA 4M7PA 3C43A 3DPUA 1SQSA 5FYQA 5K3EA 4DMRA 2I7XA 1FJ2A 2G1UA 3G0CA 5F3XB 5A6VA 4AXXA 1FP7A 2DUJA 5L3SA 2XB9A 2NOAA 4ECYA 1J23A 2ZWIA 2WAYA 2I33A 4FFBB 5F4ZA 3QKTA 5KC8A 1VM6A 3BD8A 3GFTA 4DHWA 3R7AA 2CVFA 1DAEA 4FDLA 1DJLA 3Q98A 3AL0B 1GRQA 2FSPA 4L1KA 3PA6A 2GLXA 2VRCD 5CJ2A 3OF5A 1W7AA 1S7CA 3CLRC 3LHIA 3SEAA 4GICA 4RUCA 2JZOA 4M37A 1N34B 3ZJVA 1V8BA 4JKYA 4OBBA 3WGNA 2GX6A 1G8KA 1DAGA 2XO7A 4LQLA 3N7TA 3O1HB 1P61B 3WBKA 4UVHA 1B4FA 2VDNB 3RARA 3E3NA 1KKXA 3RH5A 1J2RA 3L0PA 2VSNA 5BR8B 4RUKA 5JLAA 3KUDA 1MGOA 1B0AA 3ZGNA 5F3RA 2YQZA 2IIQA 5FXMA 5LMUB 1ADFA 2XDYA 1EB8A 3IR6A 2X7JA 1B42A 1WXWA 1W36B 2CCKA 1ZICA 1VL6A 4MOWA 3ECCA 3ZLTA 3OZBA 2FVYA 3AHCA 3OQVA 5CITA 4V3BA 4RPLA 3LSTA 4QODA 2B6NA 3ET5A 3BA1A 4XJTA 2J7KA 1KI9A 3OICA 1XDSA 4X20A 4Q1CA 2D6FC 2H29A 1M34E 1UK6A 3ICQB 3THOA 4FX5A 5LOVB 1BCRA 1YVDA 1XN4A 1JKJA 4I08A 2CK3D 4ZZ1A 2O20A 2MMGA 4OAPA 3CE9A 3AL0C 4FCVA 2GEDA 1MRZA 3VOBA 4HWGA 3ER9A 4Y9RA 1RNLA 3LHFA 9LDTA 3TE7A 2JGRA 1IG6A 1GO3F 1YL5A 2BWJA 5FHRA 1C0EA 1A7UA 4XIIA 3QFRA 2FQYA 1PSDA 4MF2A 2CDCA 4RW0A 1YR9A 3LS2A 4G8BA 2JEOA 4CMGA 1NR5A 1OLXA 4H15A 1IXYA 4PM4A 4A0GA 1Z18A 1NQVA 4OL0A 1XHEA 3L79A 4JFAA 3E1GA 3M9LA 1VJ0A 2ILTA 1UHUA 1UWKA 2WMNB 1E3SA 1RPLA 5KFCA 3RASA 5DULA 1DBWA 2GF9A 4B4VA 4CDNA 4BLWA 3GK3A 3L43A 4BRZA 1O03A 3TGWA 1XI2A 5KZMB 1AGYA 3KALA 2PXCA 3EVBA 3MMNA 1W36C 2AFIB 4CMCA 5FTNA 1BDMA 5CVJA 4PRLA 3PFGA 2FSIA 3RIXA 1W1IA 1UWCA 2G09A 1LI7A 7ADHA 3BGIA 3QWBA 3ADDA 4EPRA 1XQVA 1DKPA 3KKAA 1A77A 5E38A 3Q3JB 4AS2A 1W87A 1V3UA 2FP4A 3EVNA 4MJ7A 1THMA 4YXWA 3IPXA 2IEYA 3ZOKA 5IMSA 3JRNA 5L51A 1SKWA 3KAKA 4EENA 4BC1A 2VJ5A 1NJ1A 2V0CA 4II7A 4I1PA 5SV2A 3UAVA 4H1UA 3O91A 3DMTA 3ZCPA 1J00A 2I7CA 5E2AA 2CL5A 3UQ2A 1KK2A 2CLIB 4ER7A 2R8PA 1JLHA 1W76A 3V97A 4CKXA 4MB0A 1MRSA 4QHSA 5LQSA 4H7IA 5KCMA 2P0AA 4PZEA 3RVDA 2MSCB 5AM5A 2QD3A 3ECAA 4QDUA 4ZCPA 5TVGA 1A0OA 2JAUA 1L8LA 4Z4CA 3WZ2A 3ZHTA 1T2CA 5ENZA 4F9FA 1ECGA 4FS1A 5HYVA 3TQRA 4B3MB 2F8KA 3AT1A 2X5KO 1M2VA 1D0SA 4RKFA 4M4SA 5CM2Z 4WCFB 4JJFA 3EEYA 3RUPA 1QVRA 3HP7A 1FX0B 5A4AA 1DPGA 3N0RA 4Y6PA 4CG3A 2OHIA 4C7VA 2P2YA 2QR5A 3PW2A 2IYYA 4M1EA 5EJ6A 4W9RA 2C1EA 2Y77A 5DBFA 5I4CA 1SZDA 3TOZA 1JR3A 1SG6A 1PK3A 4UBOA 3V48A 5AH0A 2B1JA 2UYGA 5KNIA 3OC0A 1CB7A 4BGIA 4YCNA 1BW9B 1G7CA 5B64A 5BYAA 4LC1A 2VO1A 1PJBA 5LP6C 3WL3A 4TRNA 4OU5A 3VISA 1KZ4A 1Z1BA 5JAPA 3ELWA 3EXFA 5DLFA 2CFRA 2BDUA 1ZAYA 1YR7A 3SQIA 2I9KA 3G13A 1UODA 1MTZA 4OHZA 3MIIA 4E5KA 4EA9A 3EJWA 5E1MA 3HB4X 3ISVA 5K01A 1PZHA 3H5NA 1QVVA 3GGOA 3A9SA 5JXIA 2QRGA 4NFHA 5AHXA 2NO0A 4B40A 4GSYA 3EFOA 5ECWA 3ZCRA 4MX8A 2C7RA 4AO7A 4EQ6B 4ID9A 2R751 3NYWA 1KEPA 2LM1A 2XYGA 5K0GA 2F3RA 4CQMA 3IAAA 5EJAA 1XU4A 2CY0A 3DVAB 4OOFA 5BSMA 3AM4A 2WHEA 4ZO4A 2IC5A 2VNIA 2ZBRA 3E5HA 3ZV4A 4D82A 4QDXA 2LR0A 1USKA 5FTWA 4WCFC 4IRDA 1VB3A 3FNRA 2I4LA 3W04A 3UMGA 4LRQA 1NBIA 1A9OA 2BHSA 1UDXA 3QBEA 3RJIA 4EJSA 3PC3A 1HQDA 1DBIA 4K1XA 1X40A 2BZGA 3AU2A 4HDMB 3GNLA 5CBPB 4G0UA 4KK3A 4LBWA 1AKEA 4TKZA 2CHFA 1K5DA 1WB5A 4XJVA 3OZFA 1N78A 4JI8B 4I5EA 3WLKX 1WKCA 5ALDA 2Q7DA 1L5WA 3D5EA 1WUIS 5EXEA 5GJBA 4GVLA 3PWTA 1ADBA 1W25A 1L5KA 5LOVF 3CVVA 3M6AA 4ACBA 5DEIA 4II2A 2HA3A 3VJKA 1T9BA 4BOYA 4YR2A 1A9SA 3NB0A 5DN9A 3V4VB 3C4QA 3I9V1 5DGXA 2XTZA 4LWOA 5FWXB 3GL9A 1DLIA 2NIPA 3OLXA 1I1HA 3AUTA 4LGMA 1I30A 5CHEA 1EJ2A 3FI0A 1BJTA 4FFSA 3DWGA 1NVEA 2RC5A 3G0HA 3E3OA 4KHPB 4M6WA 4US0R 2KN7A 1K8QA 3L0BA 4JI1B 1L1EA 3SBDA 3LXXA 3IMKA 1A5BB 3D6TB 5I7OA 4XLLA 4YJFB 1EX6A 3WGTA 4KPEC 2FRDC 1SUPA 4MWEA 1G0OA 4HI0E 1E2UA 4O5OA 4XM2A 2CVOA 3QKSA 5K3OA 2G5HB 2OV6A 5A02A 2YCLA 4IIVA 1NQAO 2E5FA 5DGDA 4GXJA 4F60A 4RPIA 1XSEA 3TIIA 4NS1A 3Q2OA 3O26A 1ZQDA 5FLEX 3CHYA 4CIVA 4R2JA 5HDBB 1KI1A 5HEKA 4ZOBA 4CKZA 1JBKA 1I10A 4GOXA 5FOSA 1UEXC 5TQJA 3QVOA 3KR2A 2PO7A 1M1XB 2KHQA 3UK0A 3WAKA 3VR4A 1HEYA 2XR1A 2KZ3A 1XN1A 4A2WA 2PRZA 2V7UA 5HQTA 1RZRD 4O5AA 1NZBA 1IPEA 3UFXB 2BJVA 2ATIA 3WL7A 4NRDA 4DARA 1NC3A 4PW0A 4XYMA 4HDSB 3PNYA 3KDSE 3WGYA 2WFZA 2OESA 1ST2A 3O3MB 4UNNA 3L9XA 1USUA 3L0SA 2QY9A 4LWPA 4DCGA 2J6BA 5DXJA 2IYXA 1P5JA 3NHPA 4D0LB 4PYRA 2HDOA 1CQWA 1U0GA 1JLSA 4ZOAA 1ZC4A 2CXYA 1LI4A 5AI0A 1JG2A 3TANA 4BLVA 5L1JA 2FSHA 2ZUEA 3N1UA 1FU7A 5CCXA 4PZOA 1ZHOA 1ACMA 1SKRA 3UA3A 2VEOA 1C3LA 2WKPA 1C8VB 1ENOA 1ZQNA 2NTYC 3I4CA 2E1FA 1T7PA 4ID3A 3RUIA 4KTQA 2G1KA 2HJWA 2W8BA 1T3QA 3H6GA 2B4QA 3A0BU 4JASB 4LHEA 2IOFK 4A3SA 5ICSA 3ETJA 4OQDA 2EATA 2GETA 2X42A 4FGJA 5EJIA 4TVBA 2C22A 1HI9A 1OT5A 4E5DA 1NRIA 1VL5A 3VUFA 3NBFA 5DBAA 3H4BA 3LGXA 2W9AA 1T5HX 4MEAA 5JSFA 3K0FB 3K1ZA 2IV2X 5CUQA 1OH7A 2B3DA 3ZI4A 4GGPA 4O1MA 2IY7A 1AQIA 1TZCA 2JKYA 4RVCA 1SV0A 5H70A 4B79A 3PZPA 3BFKA 1JQBA 3SAGA 2OO3A 1QSGA 2D74A 1WXIA 3SCZA 1X15A 4JT2A 1ZN7A 5I9TA 3CNLA 1EGHA 2NO4A 2QMUA 4RSHA 3BFXA 4URXR 1J5PA 4B09A 2COUA 1WUDA 1PTJC 3PFFA 2A9QA 1KVQA 1ZD5A 5KFPA 5A3QA 4EFDA 2BZFA 4ZO9A 1UBTS 4JR1A 2QP9X 4A0FA 1FLAA 1Z0AA 4IDQA 4WLOA 1F17A 4KFUA 1Q0HA 4IUBS 3FPCA 3I09A 1FFEA 4H0NA 1RLJA 2ZJZA 4LHSA 3N2IA 4I2JA 2QN8A 4XDYA 3BZUA 1AN9A 4TRMA 2ILVA 3M1YA 1JHPA 5I47A 2JZBB 2I4IA 5BY2A 3FYSA 2BMFA 1VLLA 1FYDA 2C2DA 1QANA 1TU0A 2J3HA 5IIKA 5BO5A 4O0MA 5K4LA 4B8ZA 1PJCA 5KYYB 2VUUA 4GC9A 5B12A 4M8NE 1N3IA 3N8HA 4YV1A 2GM5A 5C53B 3CNOA 1PJ8A 3VU3A 1J2MA 4DOCA 4TKUB 4US2R 1L4GA 3RS0A 2IP2A 5KOYA 3P4XA 4BO2A 3G9ZA 1BKYA 3CN7A 4BFLA 3PGJA 4FFDA 1U4SA 1Z4PX 3GDWA 4RDXA 3OIYA 4BDTA 4FEEA 4JFRA 5DI9A 1IRXA 2ZSUA 1N6NA 2DWPA 5E6UB 3PNVA 1U99A 2W43A 1JSLA 1ZXXA 4CG2A 1EWKA 2VYND 1QHXA 1ML4A 2X1LA 2Z57A 2ZSIA 3MTEA 1SVIA 1AGNA 1ZAKA 3LNCA 4O8ZA 3H3JA 3WRXC 2ZEJA 3MR3A 4F1KA 2PUBA 3NU1A 1EWYA 1QB7A 5TS2A 1GTG1 1AUVA 5ECGC 1R66A 2WHPA 2IQIA 1SXJD 1Y3BE 4Y2UA 2BUAA 1HLPA 1LBHA 4PQEA 5DT9A 4AD8A 3KJIA 4B6EA 3NC0C 5KQMA 3WNZA 2HU2A 5EPOA 3DTTA 3OURA 2CE7A 2WWTA 3A10A 2J3LA 2GKOA 4OA8A 3GYBA 4JUCA 4TS1A 1OIVA 3AFOA 3V1TC 2A14A 1F48A 3MWFA 2BJHA 4GQIA 5LQUA 4N3BA 3CYMA 4B3GA 4Q4JB 3QFHA 1D04A 16PKA 4AROA 5H9WA 4QD3A 2A9VA 1AIPA 4HMOA 3LPCA 2M0NA 2PX5A 1OI7A 2DGDA 3RC1A 4UM9B 3LKBA 3OHMA 9ICAA 4JN6B 3HS3A 2WT4A 4RCYA 3ANNA 1SBIA 7REQA 3NYRA 4FQ7A 1SK8A 5KTMA 5B30A 2QIPA 4PHFA 2BKAA 1QZ3A 4N9WA 2CXSA 2VHZA 1AKTA 4H1TA 2Q5EA 2VYVA 4B7AA 3OLVA 1VLJA 4QSHA 5AKKA 4KWHA 5BV0A 5HG0A 2QYOA 5JVDB 3R8FA 4ABYA 2OXFA 2YN0A 4IGEA 1YO6A 2CNBA 4JX9A 1RAEA 4BMNA 3PF8A 5FWYA 1IH8A 2ZIXA 4KYTA 3MT7A 1P3JA 2FN7A 4HXGA 3CNBA 2VJQA 2ATXA 4AUMA 2Q6OA 4JBYA 1BCSB 1D6JA 3SF0A 3LF1A 5KI6A 3P0HA 2IU6A 1GNVA 2X3FA 3KXLA 5FPHA 2KSOA 1M8GA 3PIIA 4ASUD 2AE2A 2ZBPA 4V3CA 1QK3A 2FSVC 3KYDB 4J9OA 2RB5A 2OY0A 1KGDA 1U1IA 4EY7A 4A36A 3DEIA 3DCJA 1Y34E 1OFTA 3MT0A 3G17A 4FPXA 1R4AA 1AQNA 5A3JA 3C3KA 1IZ0A 3GVHA 3SZ3A 5JG7A 3SV3A 2EW2A 4IR1A 2Q6KA 2C7QA 4ZYWA 1P1IA 3IV9A 2H1CA 4ENUA 2E37A 2GPBA 6ABPA 1KWKA 4E4RA 1Z0SA 2YWCA 5FA5A 3LSYA 1ECFA 3HJTA 3L0ZA 1J8QA 2Q2WA 3KQKA 3RF6A 1YS2X 3VU0A 3M6IA 2X0FA 4LJXA 4QDTA 4RY9A 3PQCA 1TTHA 4IZHA 1I3OA 4JLKA 1AXGA 4MRSA 5CGQB 2OAP1 2FR8C 5BSVA 2D06A 2Y1CA 4UMFA 5FUVA 2VR1A 2X8AA 3KVVA 4AYTA 2X4GA 1C81A 3U3KA 1E9EA 3OX1A 4EGFA 3LPAA 1S2NA 4IL5A 3AUUA 3SE7A 1JLMA 4KVZA 1DK3A 3SENA 3CLUC 1YMVA 3C5HA 1JTFA 1FUKA 4TT8A 2LGJA 4PLFA 3RB0A 1RT9A 2YQ5A 5BN5B 1HM5A 1S89A 2VHJA 3S5UA 2PT9A 3J7TA 1XMXA 3ESAA 1MC5A 1R6UA 1UJCA 3ZIAD 4BJHB 1N2ZA 2EG5A 5DN6A 2CJWB 4HN4B 1XAHA 3LBAA 5JASA 2WAQC 2X8LA 2J48A 1Z6PA 3KSRA 4GZ6A 3RK0A 5JS8A 2RLTA 5F35A 2D7DA 1RXUA 1KO5A 3P26A 5KVCA 2QQEA 2X4LA 3IHKA 3SKXA 2W2PA 3GJ4A 1VCNA 2A88A 4RF5A 4V0KA 1M2JA 4ZCSA 3GG2A 4NEHB 1RIFA 1PEAA 1Z6TA 1G0NA 2PKQP 4C0SA 2WICA 4UEJA 3I5UA 4EYOA 1M2WA 3PVSA 5J2CA 1LJLA 1Y4ZA 1L7PA 4Q7JB 4EYSA 5A03A 5CA0B 4QU5A 1SO8A 2FF7A 2XE6A 3DEKA 4ZVPA 3JX9A 3KXPA 5CLHA 1X1RA 2MUTB 4NR0A 1XDBA 3A31A 4XJXA 5CM8B 3HACA 4Z7QB 4AS1A 2G72A 3DFFA 2GPJA 2GK4A 4YCMA 3DOFA 1WE2A 3HLYA 2NT4A 5KFAA 1IMOA 2J30A 2ZBVA 2I7VA 2VP4A 1C1XB 3NANA 4E7PA 3G2LA 4ZP1A 3C1OA 1CEEA 4AC9A 3C8ZA 3EPGA 4GECA 7ICUA 1DQZA 2PXHA 1KOFA 5KHOC 3SXUB 2VZLA 1RU3A 2HA4A 3L02A 2JIRA 3PUYA 3L0YA 3OEED 1W4BA 3HBFA 3N0VA 2XLCA 4EJ0A 2QUZA 4JKIA 2X1MA 2VYQA 4S1VA 1G1AA 2CEAA 1FSZA 2Z08A 2YJ3A 4RWEA 5ALIA 3JQQA 3JWIA 1P0FA 5A9SB 1U4NA 3ZHCA 4BO4A 3DKVA 3TBKA 4X1OA 3QSGA 1KFCB 1E3MA 4URYR 2RIPA 4LI3X 4OGKA 4UUMA 1IEWA 4O3OA 3TTUA 4H3HB 3DLIA 5CP8A 4LHXA 2IPMA 1SHLA 1Q83A 5U1PA 4BS9A 1W8DA 1M54A 2IV7A 2YTZA 1NVXQ 2H0QA 4JC8A 4X7BA 2ZXEA 2YZ7A 2XB4A 2Y93A 1FDRA 4H16A 4EG1A 1ZY2A 4D9HA 3H9QA 2OECA 3THWA 1T8TA 4XWGA 2QW0X 4CCAA 3JASB 4EVQA 4EYKA 5HCNA 4FBMA 1F2VA 2QRMA 1RRMA 3HCBA 3EGXA 1B0XA 3FZQA 3O38A 5HJ5A 1YR1A 4E7OA 5G3YA 3ITNA 2HO4A 4F6CA 1EM8B 1BWRA 3RJTA 3BXGA 2JRLA 1XQ6A 4MKXA 3RLIA 4NOLA 3OBBA 2YNMC 5COQA 1JIJA 1SBYA 1KFDA 1QGUB 2HHLA 1C7QA 5JVDF 2BR3A 1ZIXA 4LZGA 3P9NA 2HSEA 3VGPA 1VIDA 1DX6A 5IRCD 2AXTU 3WIOA 1KP3A 5T6MA 1E3EA 3WNCA 4Q7EA 2WAQF 5ER9A 3R74A 1YJ5A 3GLGA 3B5EA 1C20A 1LKZA 1GPMA 1OHHA 3WQHA 2ZUSA 1BG6A 1ZGJA 1AB5A 1DIOB 4L74A 4B2LA 1XYGA 1XQ1A 2YZ2A 4RZ3A 3K75D 2EFDB 2KJQA 1Z7YA 4R9UC 4R01A 5A0VA 1MCZA 3Q7QA 1HKUA 3T7CA 1M0SA 2JLBA 5DNDA 2XY6A 3ZY5A 3L06A 3U1VA 2B2NA 4HYYA 2DFVA 1YDGA 1ZBQA 4OUKX 3SC3A 1X38A 2Y4NA 3DE7X 1ISFA 4F7DA 4ZQBA 1AGRA 5BUQA 2RHFA 1KZ6A 3CSUA 1FFCA 1L4YA 2ZETA 1DFHA 5GADl 4HRVA 5I7UA 1M1YB 4Y2QA 3ZDFA 5PGMA 1KEWA 3EMDA 1ZIYA 2CSXA 1CRPA 5CD1A 1TE2A 1K27A 3RTGA 1JDZA 1W4ZA 1X80B 1XO0A 2IPNA 4OMCA 3H1BA 4OSPA 4PZLA 1T0JB 1E6WA 1DIBA 4I1IA 4U9HS 2CF6A 3DO5A 1U0SY 2QN6A 4EHHA 4ELVA 5DSZA 3WRWA 1JWAB 3H0EA 3KSDO 2FQWA 3C6MA 1WEKA 1A8UA 5CT8A 1JQKA 1H0RA 3S68A 1FRNA 2ZDGA 3C98A 1MR3F 3BIOA 1HUZA 1H4TA 5HKOA 4PX5A 3A1CA 3GG9A 1Z07A 4P0PA 2X6QA 3DFZA 2A5JA 3JXEA 1FA9A 4Q4AA 4U9UA 1ULBA 4F4ZA 2ZB8A 2XT0A 4V2IA 1XRJA 2XY5A 1U9CA 4HBGA 1NUTA 5EFZA 2PLAA 3V8PA 2DCMA 1O94C 3PFKA 4Y0AA 3RE1A 5CTAA 1ELOA 3RSFA 3DAOA 4QVIA 2Z3VA 4DQXA 4OM7A 2R7AA 4UXHA 3QLEA 2DERA 4YB8A 5CA0F 1OV4A 3B1KA 3I9OA 1Y4SA 2C5EA 1PJRA 4KREA 1RYYA 2JVIA 4LZDA 2X7XA 3E9RA 4YR3A 1P1HA 1SKYB 4BWJA 4D0SA 4F0JA 2ZVJA 1LF5A 1PR5A 3P9KA 1YU6A 3RU7A 1NVGA 3UO8B 5JCOC 1BDIA 5LN1A 4FLFA 2EYQA 4J9UE 2NAFA 2G6BA 5CG1A 3IQHX 2Q1SA 4P82A 5MGBA 2BEVB 2W83A 3KL4A 3LY9A 4M9RA 2W03A 3K6RA 3HPOA 3VX4A 4C8NA 1IIPA 5EIBD 5CT9A 1IXSB 2L82A 3KKLA 1HLDA 2PI4A 2F9FA 2DJIA 3S0JA 1FVOA 2Q5CA 1XV5A 3RANA 3BWEA 2PFGA 1ECWA 2Q5OA 4RQNA 1S02A 1HG1A 1CUHA 1XP5A 3GUUA 3GEGA 2F43B 3DO8A 4D4GA 1DRWA 5TB5A 3STXA 2QS9A 5E7JA 3VSDA 4FVTA 1PJ4A 4OMFG 4NNJA 1T36A 4XGQA 2PMEA 3UOAB 1J0XO 3K31A 4WA7A 2PMCA 3VC2A 3PG5A 3J81j 1PK1A 3N74A 3IEKA 4B3CA 3RU3A 3OOSA 3E3LA 3HXLA 3KZMA 2YN4A 3UW3A 4ZCMA 5T67A 2Q4EA 1X7ZB 2C9DA 1GILA 1Q5PA 4KFCA 1SXPA 1QFJA 3OTHA 4GRDA 1EG2A 3OTIA 3QVJA 1M2HA 3M2TA 1E60A 3KETA 1E0AA 1VCMA 1ID8A 2CGEA 3ME5A 1V95A 2EAOA 3A6JA 4DZTA 5B1DA 3F98A 4B6OA 4YCCA 2Y99A 5EKSA 3X3HA 3FNBA 1YZYA 3V2IA 4KI7A 2QZSA 3HYNA 3ORYA 1XVLA 4ESVA 1A9RA 2FQQA 1DX4A 1U7UA 5D1HA 4V0ME 4GC6A 2PT6A 2IXGA 4R83A 3NATA 2Q27A 2PS3A 1FMTA 2W2QA 4JIMA 2WPNA 5CLQA 1CZOA 5IJ9B 3AVPA 4YR9A 3F2BA 4NDAA 1D4OA 1FX1A 2J9GA 1U9ZA 2WRZA 2XRYA 2UZAA 2F3SA 3R5KA 1QAMA 1RYBA 2K7ZA 3LQ2A 3HWTA 4KJXA 3DVQX 2CLDX 3AILA 3LUHA 4YONB 2HMYB 4G26A 2QTBA 3PFBA 1C9JA 2W7TA 2XDQB 3K8ZA 3LT5A 4JS0A 2R6GA 3IAM6 3RF7A 4PFJA 2AR0A 1ISIA 4U2EA 2C9CA 3JQBC 5T3UA 3BWYA 3SY8A 5IKEA 2QM0A 4C2TA 1B6TA 1JU9A 3RUCA 3DHVA 1G3IA 5BV7A 1PD0A 3IVGA 3GUZA 1XZIA 3HBJA 2B61A 3MCAA 3EGOA 3EIEA 1S10A 2FN9A 2Y27A 2NU7B 4Z99A 4EB0A 3CZMA 3M6VA 4LJ8A 4FFPA 2FJ6A 1Z35A 5FRDA 2QD5A 3WSTA 4TV8A 5K09A 5TEVA 4CKWB 1WUJS 2GD0A 3G85A 3MJVA 4OJQA 3IHLA 4N12A 3ILSA 2LKYA 2YHBA 2FP3A 5BUSA 2R2GA 4LXTA 3TTYA 2XADA 3AU8A 5ITWA 3LM8A 3T5BA 5IYZB 3ZCQA 3CF6R 2P4EA 1CF4A 4HEA6 3JSXA 1L5YA 4E14A 4AUEA 5CP2A 3IA2A 2C4WA 4AWAA 4URVR 1U2TA 4Q0MA 1GM5A 1GARA 4GGMX 3IM1A 1NMSA 5HK8A 4NYJQ 1X9GA 3VDXA 1HIWA 3D4PA 4WZBA 3EGEA 5F5NA 1I94B 4YUVA 4G5QA 3BS7A 4DIOA 1S5PA 4BFCA 1C1YA 1OGYA 3EUB2 4ZT2A 4PSAA 1ORVA 4J9QA 4DV5B 1MVLA 5ED4A 4R1QA 4EPVA 5IIOA 4HLNA 1SL0A 4HG2A 2C54A 1HH4A 1CG6A 1YRBA 3DXFA 3A1TA 1H1LA 2GI4A 1QIEA 2FMUA 5AVKA 1P2TA 5DTQA 1JMSA 2VJKA 3WLFA 4B32A 4PG8A 3DZBA 3NKVA 4IPTA 4RHUA 3DJFA 3E9CA 3C70A 1TK2A 4LXHA 1VJRA 3VZBA 3MFHA 1YAJA 2HRRA 1CNEA 2BBOA 1XJCA 5BQXA 4G4GA 1E3WB 2WFLB 5BN4A 4P0QA 4GP6A 2VSYA 3C5WP 2QM8A 4TKVB 2VF5X 1IVSA 1KC1A 5FUWA 3UV6A 1RLMA 3FHJA 5EHIA 2WPDD 2OK7A 3N0XA 2AKAB 2WSSA 4HJRA 1LNZA 4HOYA 5KSYA 3LZDA 2I2CA 3G6YA 3KDPA 5ALRA 3NAMA 4G89A 2H5EA 1IN6A 2AF3C 4ND2A 5L45A 5COBA 4DQVA 1YU9A 9ICSA 1JA1A 1FFSA 4IIBA 1PIWA 4ZK6A 2NRWA 4YT8A 5KTNA 3GILA 1ADCA 1MZPA 1XPJA 5SY6A 5D49A 9ICPA 1CY4A 3ZJ5A 4GI5A 2NO6A 1RABA 3EEQA 5KQSA 3OM8A 3ASVA 1D2HA 4I4CA 4IQWA 1E0DA 5IP5A 4HFJA 2YVLA 1TRKA 2QTTA 4C0ZA 4UOZA 4CIAA 4JODA 4JB2A 3P7MA 1UDBA 1YR2A 2WM8A 1HTBA 1EXVA 4X7RA 4J4TA 1US8A 1Z13A 1PU2A 1EXNA 3ZWQA 1NW4A 3IMCA 4O2LA 2GN6A 1P31A 5CVTA 1U28A 3T61A 4P4SB 4N8DA 4OBEA 1ZHFA 3WOHA 4ZGGA 1L5MA 2WWXA 2HVHA 3BL8A 4IQ4A 3C2LA 4MQ5A 3MK31 1Q7RA 2BF4A 1IXRA 1DFGA 9MHTA 3MLEA 3TXXA 4TLMB 3C6KA 2IODA 3ASYA 5KG3A 4WUVA 1M75A 2EFYA 1P6XA 1TAHA 2JGLA 2WU1A 2V8OA 4LG1A 2HTFA 1DUIA 2NPFA 3TR6A 1II8B 3PL5A 4IQVA 4HQKA 3CG0A 4MWOA 1O96B 1F5SA 4FHCA 1X7DA 2WUWE 3DEAA 3A36A 5KFOA 3ELYA 3COYA 3CX4A 5D84A 1YD7A 3QEBZ 3ZVRA 2R8OA 3G9XA 1B8NA 2PMDA 4G0ZA 3DMRA 3EASA 3M70A 2DFNA 4BRWA 1ZUWA 1MOQA 2FUNB 4QYWA 1X8JA 4N47A 4MA5A 1C3OA 2TMDA 2A1JB 4L4YA 1A96A 1U04A 4RUAA 1IBRA 5K3SA 3CXUA 4W5NA 4XVCA 2OEPA 2BLLA 3H75A 3HJFA 1AU9A 4PYKA 2Y1FA 7AT1A 2J3MA 5CB0A 4E09A 1Z08A 3NTVA 2C2XA 2OXOA 4PGXA 3C3EA 2GA9A 4MR8B 4O4JA 2R65A 2JCGA 1QTQA 3W7AA 2PUEA 3K9NA 2HHSA 5TPZD 2JIPA 4B6QA 5KNCD 3Q3VA 5TZVA 2NW6A 4L9RA 5GZ3A 1FNSA 3FSGA 3S2SA 3W9SA 5FYDA 3OFND 1TOAA 2PUWA 4CQJA 2HSZA 3E9QA 2C04A 2Q7OE 4I28A 3HDJA 4JC4A 4P9NA 1H1DA 2YHSA 2GWSA 3TDKA 4IM7A 3ZDBA 1O0CA 1FYVA 2DAPA 2OH2A 3A1SA 2IXDA 1FSFA 1QCKA 3KL2A 1TUBA 4W6QA 1T8RA 1M2OB 4Q6BA 3WB0A 3OUUA 4EUEA 1G42A 3I9JA 4KPYA 2YASA 4D46A 1V4VA 1RZVA 4A0RA 2WTFA 3KEQA 2O1EA 4BLSA 3WV5A 4DM3A 4N1AA 3C1UA 1SCBA 3NONA 3Q3HA 1H38A 2BDTA 2CXHA 3EIFA 2A5YB 5DLPA 5IYZF 1KEJA 1XHFA 3TFSA 3SS7X 2NMVA 3H1PA 1EVZA 1MTOA 1Y7PA 3E6AA 1H3EA 3BQNB 4AJJA 5JD6A 5C1PA 3B1ZA 5CPBA 4DG9A 4WI1A 3H4IA 4I6JA 4GMGA 4QUHA 3Q87B 1BC5A 1NPYA 5BV8A 4YG2A 4Q12A 5J40A 1PFWA 4BV2A 4YS6A 1Y1RA 4YRDA 5JXHA 2V58A 1YRLA 4NCKA 3EZFA 1Q2XA 1S2MA 4ROSA 4JXXA 4YPFA 1C30B 3BCHA 2O0KA 3EN0A 1Y6RA 2ORIA 4S04A 5MN5A 1SKQA 2JFVA 4JVSB 1GUFA 2EBFX 5DB8A 1CUVA 3TQOA 3IODA 3N05A 2YRXA 2A3RA 3EUAA 4XPIA 4UTZA 1GPNA 2O2SA 3OWOA 2DPJA 1OAOA 1QH1A 4ZHQA 3AHGA 1VCIA 5FEUA 2JH3A 4KVAA 3ADKA 4P35A 5BV2P 3RR7A 4J8PA 2WTXA 1O08A 4Z1MA 4X94A 2PKCA 2WZBA 2D3WA 5B5SA 2HHXA 1E4YA 5KFNA 5J23A 3BAZA 1CT9A 1VP9A 5LP6B 4DDKA 2PH5A 3ZGZA 4AJPA 1R1DA 3CVOA 1YCDA 3D2BA 1S7GA 4MRMB 2PLRA 2Y67A 2AZTA 5KJEA 3WGMA 1A9XB 3IDAA 3M4YA 4YQEA 3PUWA 1U9LA 2ATEA 4CF6A 3PFHA 1VIAA 2HEIA 1ZK2A 3ANMA 3SEFA 1MHPA 1NVUQ 4TLEA 2XRMA 1PLKA 4B82A 2CXQA 5CVDA 2H0RA 1HC7A 3VPXA 2QJTA 2R6FA 3NI2A 2CYCA 4PSCA 1U7WA 1E79A 1VG0B 2OWDA 2AQ8A 2QTVA 1OFVA 2H07A 3IE2A 1T5BA 1SC6A 3T7IA 3PNQA 1NMZA 3IT3A 2PWBA 2FW6A 2JJ1A 3A6EA 5IG2A 4CR8A 4RD4A 3KYJB 1GL9B 1TKCA 1PFKA 1IQPA 3HHPA 5BVHB 3ENKA 1L5SA 3JSAA 2O23A 5IBPA 4YAKA 4N7RA 2KZMA 4BJ5A 3HNRA 1LK7A 3IAS1 2OCAA 5DB7A 3TIXB 4RZSA 4X62B 3G2QA 1GR1A 2F2AB 4QGSA 3R7DA 3HWX1 1OXSC 4TYPA 4BQFA 4MIEA 1HA3A 3JU3A 3L1UA 1U8AA 5DNEA 3W5VA 2D2VA 5C4IA 4CE6A 2RMKA 3MXTA 1V16A 4PHEA 4IIHA 1YH3A 3U3OA 1NMYA 5B7QA 4DVJA 3NBKA 3IUMA 5FTLA 4O4HA 4C7KA 4KO8A 1H2WA 2QLTA 3A9TA 4OJLA 1S0VA 5HGJA 1E5QA 1TEZA 2ASVA 1D1SA 2IOHA 4GBJA 4BQSA 1ND6A 2C4MA 3BZWA 4IJWA 4M0AA 3TRIA 3FTFA 4J2TA 2CKMA 2AMJA 2NSDA 1JMVA 3V42A 1PUIA 1WDWB 3RS2A 1EFRA 4M1KA 1Y5IA 5EUQB 4I4IA 1OXKB 2QN2A 3RYTC 3QPAA 2WUEA 2E4XA 1FSGA 2V59A 1V1MB 2VCYA 4X6UA 5JI2E 2XDWA 4FFRA 1MOZA 2PLFA 2WJHA 4IIXA 1UBJS 4KMSA 2WMOB 4W6ZA 1QBKC 3V7UA 5GV7A 4X00A 1DAHA 3FGOA 4K0RA 4OJOA 2HJVA 2P6MA 4PO9A 2CHQA 1EWTA 2AFHB 4QEKA 3SSOA 1ZQLA 3Q6NA 1GNLA 3TB4A 4UXIA 5C7LO 4GFDA 5FWNA 3AJDA 3HI6A 4G1EB 1YB4A 5CIYA 2HDHA 1W44A 4LVCA 4PZ0A 2I7DA 3DBRA 4DJDC 1CY6A 4XGRA 5JJLA 4DLZA 2C42A 1E3TA 1PR6A 2IUSA 3ISDA 1E2IA 2HF8A 1MF7A 1XWWA 1ZRNA 1TUGA 1YBAA 3BMQA 5CNIA 2VYCA 4PONA 1DPFA 2Z2XA 3CWZA 3HB7A 2YH2A 3V9PA 4RSRA 4NZZA 4X3CA 4MI9A 3X2SA 2F1KA 2VF7A 2C9BA 2OAEA 1U8ZA 2AGQA 4DDVA 1D1PA 1BMDA 5FX2A 3QTTA 5HQJA 2Q45A 4TZ0A 2WF9A 4MS3A 4EEKA 5KTTA 1NJZA 1EFHA 5DM4A 2OZVA 4FIDA 3HU3A 2ZTCA 5KWEA 3E7FA 3ZS9A 2FSUA 2Q3FA 2QRUA 3LCCA 1LDBA 3O21A 8ABPA 5BNWA 4DVGA 3NXKA 5BRAA 4W4TA 2V4UA 5KFUA 4YCJA 6LDHA 3Q8SB 2C95A 2OXIA 1YMQA 1KS9A 3DMYA 1B0UA 3FYUA 2C92A 2ID4A 2HJ9A 5CR0A 2F6RA 1H22A 1Y7IA 5EP4A 2QX8A 3RKSA 1CETA 4D4HA 2IS1A 2J07A 1MQ3A 3RD5A 2VK1A 1Y9JA 4FMBB 3PEEA 2IIVA 2WAOA 4M0PA 4R66A 1BMQA 3AM5A 1V9PA 2H18A 1DC6A 3K20A 5L7YA 1C4XA 5IJ0A 3RFAA 5GMOA 4QOJA 1UDCA 2XB2A 2N47A 3MB8A 4DLUA 7ICIA 4WWHA 4D7AA 2IWRA 2DKFA 4IQFA 4QZAA 1YIOA 1K8YB 4PC7A 3EQ2A 1JAYA 4NCAA 1KRHA 4E12A 2XWSA 2EDAA 3OQ1A 1IMJA 1VFNA 4K5QA 2P7IA 3WXBA 4KVFA 1IHOA 5ADWA 2O2XA 2Q6TA 2BFBB 4DFMA 5LP6F 2CLSA 1SMKA 1EZ1A 3ZNOA 3L3FX 4UBCA 1LK0A 5LMZA 5DCLA 3QHAA 1RE1A 1GN8A 2DTXA 3EWNA 3N8NA 2YZKA 2H48A 3FGNA 1E2KA 2PSFA 5DE3A 2C3UA 1HE1C 4I2IA 2LIPA 3UPUA 1P4SA 3CJTA 3ZBUA 2PUVA 5JADA 1QHEA 4ZGBA 1ZJ5A 2GT1A 4TGLA 2V5UA 4JMLA 5NLLA 2IPLA 4C22A 3IV6A 1GUBA 3GCWA 3TW8A 1TFUA 3GAAA 1Z8DA 1KBQA 5C52B 3CLSD 4LGYA 3G88A 1JXOA 1W5TA 4Y0NA 4AK9A 3MTAA 2RK4A 1EXWA 3ZE1B 3EW9A 4JC5A 1ECCA 3GFQA 4MMYB 1QRSA 3QXXA 3DHWC 1R8YA 3MF4A 4MB6A 1KQFA 1ZJMA 2O19A 2OCGA 3TVYA 2A9PA 1U3FA 1XE3A 2HOFA 1UPXA 1C9MA 4HWTA 2LIVA 4B45A 2G5TA 4COOA 4UNSA 1VMKA 1E5XA 2ZJFA 2QARA 4UJ3A 5HR6A 2FMPA 1WQ4A 3NGDA 1NP7A 4ED6A 3NCHA 1OI2A 1XTJA 1YI1A 2BPOA 5BPHA 2FFHA 3A14A 2PQ0A 5DFAA 1G21B 2JKVA 1ECPA 1RQLA 1CFJA 1OE0A 1KSPA 3AV3A 1N2HA 2G0NA 2PDAA 1XJ5A 3K4HA 2ZAOA 1I1OA 5TEWA 1X7XA 1PWZA 3GT7A 4IGAA 5CDSA 4FZJA 3REGA 4RTNA 1C0PA 4IINA 1PJTA 4LE0A 3T7DA 1OH5A 2XQKA 4NH0A 3AF4A 3VHXA 4JR0A 1ST3A 2Q2QA 3TI0A 1HOTA 4RZIA 5IC5A 4X64B 2Z5LA 4L5AA 3Q9LA 4F2GA 4HWOA 1QRTA 3MWEA 4N6NA 3BMOA 4P3XA 1SAYA 1X2EA 5LSAA 3U40A 3LP8A 3VR2A 1KVRA 4I8IA 4ETIA 2RK3A 2OFWA 4YI5A 2QV7A 1B73A 2HXGA 2GVNA 1M0EA 4WZAB 4KN5A 2YMLA 3RFCA 1VSUA 4BGVA 1COWA 3DB1A 4QU0A 2DUYA 1L5VA 4W9NC 3W79A 1LPMA 3ZCTA 2SHKA 4MS4B 3UB2A 4PC6A 4R8SA 5BN1A 3PTZA 4OHCA 2YXPX 3JPSA 2UV8A 5HS6A 4X5VA 5JZVA 2J0QA 2YDXA 1QPGA 2Q5QA 1CVRA 1VCOA 2BHRA 3KQPA 1WD5A 3I9FA 3NYQA 3P4UA 4YJ2A 2C3OA 2AN3A 2QENA 4FYYA 5JTIA 3AUKA 2R1TB 5GINE 4IFIA 4ND8A 2JLUA 2RAVA 3VR6H 4PGQA 1IHYA 9ICKA 2FZGA 1H2YA 4MB2A 1QTIA 1NYTA 3V1LA 3M8RA 1FFUA 4DLAA 4QTXA 4JJIA 4LHWA 1LBEA 1IXKA 1F12A 3PENA 4NPAA 1L5HA 1EVJA 4ZOEA 4BEJA 3FNIA 3L7OA 3WGGA 1P45A 3TUJC 2GZMA 3LC2O 1ZJZA 2Z5FA 3H1FA 4TMZA 3K72B 3WO0A 1UQVA 1U6KA 4RVUA 3LY7A 4ZOLA 3FR8A 1GAXA 1WCIA 2R87A 3OKAA 3Q7PA 1KERA 4W7HA 2JFUA 1E4OA 3STWA 1B8OA 2GRJA 1HRKA 5I9BA 3AEVA 5ARCA 5BSRA 4M21A 2VJMB 2MMCA 2QXYA 3N8KA 2DB3A 4LGCA 3L6CA 4F5YA 2EL9A 2A67A 1N9GA 4QNMA 1M5RA 4L0DA 2YYYA 1Q3HA 2X41A 4N3AA 1M1NB 2GTPA 1RZ3A 1BWSA 5U4QA 3LFUA 4M87A 3BZCA 2IUEA 3SI8A 3ZWPA 3TTTA 4Y1FA 1RBYA 1WUYA 1KDHA 1DGQA 1QE0A 3QKRB 4D98A 2ZXFA 1NK8A 3AR5A 1GG5A 3FMIA 4RAOA 3ZU5A 3KOZA 3ZR4B 1WKVA 2EBUA 1Q3VA 5JCXA 3AETB 5J1SB 2OCKA 1NW5A 4LOLA 1E66A 1MBZA 5KDLA 3C8HA 1ZQVA 4OQLA 2P65A 2OC9A 2QL5A 3RWMB 1EVIA 2FLVA 8GPBA 2Q1XA 1TC2A 4ZV4A 1PT9A 4I7EA 1MV5A 2PMFA 3WGKA 3AU6A 4JKOA 3SZLA 2Q50A 2PZKA 1TF2A 2AU0A 4R1OA 2LZ0A 1IM2A 1YHZA 5CJPA 3M89A 2XVXA 2R25B 4K9KA 5KT2A 3T5AA 4XRHA 1M66A 2JLXA 1DOAA 1ZD2P 2ESEA 4US9A 3A37A 3PFIA 3EBOA 1XXHE 4GKVA 4R16A 1UM8A 4KQEA 1X77A 1P1RA 4LSZA 4M9XA 3DYBA 3K94A 3KAQA 4R05A 4QWAA 4ZTBA 2L69A 4LHYA 3RBAA 4F93B 1BXZA 3ZUGA 3SZMA 4ERXA 5EZQA 4F97A 2MSNA 3SOZA 3KXIA 3HL4A 1POWA 2XUHA 4ZT5A 1ZYQA 4U2DA 2C9MA 5BN3A 4YUAA 1RHRA 1O4WA 3KLNA 1BS1A 1Z00A 5J4LA 5F52A 4XCXA 3W6ZA 2XOEA 4LJ5A 4ISBA 1M67A 5ARDA 4DYVA 3NBUA 2BPCA 4GRIA 1MXHA 3QH4A 2VTEA 1P33A 1GCIA 3PPVA 4Y6LA 1DCFA 4OGWA 4XFKA 2VJOA 3D2CA 3FLMA 1UXKA 1FQOA 4HNVA 1NI3A 1JB1A 4S12A 4ZI2A 2IE0A 5EHNA 5JFTA 4U3JA 1JIXA 3L5OA 4QC2A 4HGOA 2GD1O 1UKZA 1KY4A 1KAHA 3EYZA 2ECQA 2AK2A 1BE0A 1UAAA 4M0CA 1GCGA 4H7DA 2SECE 1ZQRA 1ORIA 4NBLA 2GWHA 4WERA 2WK1A 5BQPA 1Y4UA 2MA1A 5DM0A 1UT6A 1PR0A 1DB3A 3QELA 3UXPA 3DV0A 1XS9D 3HLKA 4FNGA 4I1OA 3EPJA 4TUQA 1U2PA 2HLDA 3VOTA 2ID9A 3CRNA 2E6KA 1NKCA 1OIWA 3HW8A 4ND4A 2PSHA 1TD1A 4CL2A 1TFRA 3RNOA 2RDJA 4PWYA 2ZVQX 5J5AA 1D3AA 3ZCUA 4IIGA 4YRNA 1NPDA 1R9MA 4A2QA 1SQGA 3L4JA 4Y2PA 1IL0A 5EOVA 5EJ9A 1BEZA 5KINB 1COKA 5DASA 2FB9A 3UPDA 2GSDA 4CEJA 2FWIA 2ONCA 3PDUA 3B3AA 4Q9JA 2P41A 4HDKB 2EHJA 1UXGA 3SDBA 2IS6A 1USGA 2J9FA 1ZSVA 1JROA 3Q15C 2XZTA 1XZCA 3REOA 3AZOA 3O94A 1F2TB 1QE5A 5CLLA 4ZANA 4MUXA 5EJ5A 3BZBA 3UICA 2ZUBA 1FMCA 1PEDA 1NJWA 3OA2A 1Z75A 4ON9A 1TEHA 3CH6A 5EKDA 3W8RA 4EO9A 4B7XA 3VH1A 1XEWX 4L76A 2PUCA 5DK4A 3R20A 2FR0A 4Z7JA 3BVPA 1ZW6A 2XB8A 1TKDA 1NNLA 3FCXA 3RH6A 3ZWXA 3OE1A 3SI7A 1GNTA 2UVRA 3ZIUA 1JFSA 1T8YA 2XE7A 2OO5C 3U3ZA 5C5EA 2OGUA 4PLCA 1AKRA 1OT3A 1RKUA 3ZW7A 5HUQA 4E15A 1FDVA 1RLIA 4DWJA 4B3TB 4CM3A 4AX8A 1QNFA 1U65A 5DHRA 4MTCA 3W6UA 4DQPA 2DH6A 4PLPA 1OUMA 2PBZA 4D0NA 5EWJA 4OO1J 4NBSA 4FE3A 4M53A 2QMHA 3P20A 3RT1A 5DXAA 3QYFA 2D2EA 4IJKA 4GBED 3BYZA 4KLRA 3NJ8A 1RXEA 3MMXA 3OSNA 1IAQA 3RBDA 3QX8A 2E87A 1YA4A 4U7WA 1UPBA 3KYBA 1DADA 2O1XA 5FF9A 3VVLA 3FZNA 5KCZA 3ORHA 3I53A 1GZHB 1NYQA 5T4HA 1QQBA 2EJCA 5AFSA 3JQEA 4MVJA 1T2EA 1T15A 3OWHA 5LQMA 1NJ6A 1ODLA 3VU9B 3AQFA 2A1UA 2XUZA 2DUUA 2QAIA 2YB1A 4E2XA 3E9EA 1KVSA 4EYGA 2BEWA 3I34X 1U8EA 1B15A 4CLDA 3D9QX 4HDAA 4ALKA 1YZKA 3Q12A 1ZGBA 2DWUA 5KFLA 1AH2A 2KJ9A 2OO7A 1RHJA 2GO1A 2AJDA 2HNAA 5FULA 2C2MA 1CW2B 3MFIA 2GEFA 4NF2A 3R76A 1YE8A 3SQNA 3VC8A 4D99A 2Z30A 3FKSD 3L4BC 3NHZA 2I62A 3K9CA 4FYMA 3ONDA 5B1YA 4BWFB 3VNAA 1OX6A 3PMNA 4BMXA 1UMDB 3GZNA 1RW4A 4EEYA 1D2NA 2AFIE 2XNDD 1Z39A 3VR3A 1JFFB 2A30A 3WYGA 1JLRA 3QLVA 1C7JA 4UNPA 3V6KA 2OFPA 5E2IA 4JY7A 4O33A 4WUTA 1VE6A 3AEQB 4MO2A 1ODFA 3IH5A 2EKBA 4J07A 2I2BA 4PBTA 1P3Y1 1A5AB 3CISA 4FT2A 5ICEA 1PKXA 3SR3A 1AMOA 1CIVA 1KEKA 4URFA 1KPHA 4MYCA 3B0XA 4LOHA 2JEFA 3JYOA 1JI7A 4NZNA 3N8GA 1TJ3A 3IUPA 5H2FU 1V41E 5B66U 3V8QA 2JBHA 3E48A 1E3IA 5FQNA 1P39A 4FN4A 5HOQA 1CBUA 2YWEA 1FPMA 4HRXA 2YWFA 3HBMA 1YDHA 1Q3KA 1AKMA 1J8VA 2WP0A 2QUJA 3ZLVA 2BEUA 1QYRA 3BMNB 5ILQA 1VDMA 4RZQA 1NXWA 3PGXA 4RABA 3EBPA 2KIWA 1H3NA 2FPUA 2X0RA 5AMXA 1S77D 4LWQA 4LDNA 4R81A 4CNBA 2SNIE 2QG6A 1HFJA 4QASA 5LP1A 4NOMA 2K8AA 1BIFA 4JK1A 2VANA 1N2OA 4M9LA 4J3NA 1IB0A 2J8ZA 1CUEA 1PS0A 2C2YA 2PYDA 3ZGXA 1KK0A 3IO5A 4A8TA 1EDBA 5EJMA 3L77A 8ICRA 2ZDQA 1MJFA 3KZVA 3LUFA 2MAXA 3QNUA 4WRRA 2C78A 2W6NA 3B6ZA 3BRCA 1V97A 2K8BB 4OHKA 3VQTA 5HRAA 3UJ3X 1X2IA 1O97D 2PHZA 2RHWA 4YRQA 1N0WA 2VXOA 2E4UA 4JCOA 2JEJA 2BDEA 1B6RA 4QOEA 3TIGA 2ZS9A 1AUQA 2XC9A 3K0BA 4I2EA 4EATA 5FA6A 3FNEA 2LBPA 2AIRA 2CN1A 1WR8A 3TBHA 1MO2A 4NU5A 1YQDA 3RVOA 1QQ7A 1XVUA 3KYIB 4DLPA 8AT1A 1ZYUA 3CW2A 3DUFA 4OATA 2ZREA 5DH9A 2C9OA 5L4NA 4KGVA 3MZ0A 3GNTA 2AJCA 1TTTA 2ZG6A 4LISA 3DTVD 3JAWB 4RLQA 3EZ5A 3DT9A 3QMWA 2OSVA 4WY8A 3LF2A 4QPDA 4RV4A 4CL3A 2PUDA 1QVZA 3PHJA 4RJIA 5A7HA 3D43A 4ZARA 1R4ZA 3AUAA 4KN8A 3STTA 3R7SA 2W4IA 2V6GA 3WLRA 1OBVA 3NT5A 4XWAA 1WG8A 2NYUA 2AFHE 4YLYA 1E4VA 1TA4A 1UMBA 4HDRA 4L9AA 1LRKA 4CTMA 1YR3A 4F11A 1G3UA 1ZQEA 5KYNA 4I6GA 1HWYA 3JQGB 4H3KB 2P0YA 3R5TA 1JEQB 2QRPA 1RYNA 1YGPA 3BIWA 3OA0A 2GHQA 4D3ZA 4EF4A 2ZTMA 3LA8A 4M1MA 5DYWA 1FXWA 1S4QA 4INJA 4UBKA 1ENZA 3OJUA 3JRXA 5TRTA 1Y6FA 3RQSA 1CX9B 2IZ7A 2V55B 2IBTA 3HMQA 1KQNA 1Y5NA 3AR2A 1OWOA 3HG7A 4MIYA 5TJ9A 2BR0A 3NHBA 5EVCA 5CK5A 4MCJA 2FE9A 3WFIA 5KMGB 1ABFA 3SIRA 4LXIA 1U11A 3PQFA 3K35A 3V2HA 3INTA 1Y5MA 3MJDA 5L53A 2HL6A 4AZ0A 1EQ2A 2UYQA 9ATCA 4G8JA 4Z51A 2ZUVA 3JATB 3MDCA 3CUEF 1JILA 4OEHA 3FFAA 1RTKA 1UFQA 4Y8VA 3KB8A 4PHGA 2B21A 4C89A 2A94A 1CJUC 1TM1E 1LEHA 1KYZA 4G01B 1KBUA 3N4MB 4KN7A 4UAUA 3VU1A 1CQZA 1KYIA 3AY3A 4AMYA 1VZ2A 1DDIA 4PHTA 1MIOB 5FTJA 4YN3A 5AM4A 1X7HA 4FJ1A 3M0EA 3MWKA 2GCIA 4WE3A 4PRKA 3L8HA 3OQNA 3A25A 2A0UA 2UXBB 2VOEA 1SU4A 2QM7A 1T24A 4FGUA 2ODGA 4Z7OB 4LOIA 2P27A 3NNDA 4AJHA 2DKOA 4PAOA 2HRCA 4LXUA 1VE1A 3RAFC 1JYFA 4FQ5A 1L4HA 3WICA 4UXJA 3KCQA 1NK4A 2RB4A 2QORA 2YIVX 3R0XA 4KLLA 2QB0B 3N39C 4F2SA 1M0TA 4L85A 2W4MA 4W5RA 5C8DA 5DLYA 2RBGA 2X13A 1UJ4A 3MMSA 4WKCA 3EEOA 3GXOA 3MM4A 2I6GA 3O0TA 4OJNA 4X71A 2P40A 3T4EA 3DOIA 4OGGA 4PYQA 1WMDA 2OGZA 2O0MA 4GNRA 3SZOA 1T5TA 3E9NA 4KNVA 1GDTA 1RJFA 2BQUA 5EESA 1JXEA 1E1LA 3UVEA 3WRYC 3IOMA 4Y9DA 1T8WA 1THTA 2QZ4A 3ZE7A 1ZISA 3RSGA 3EZ7A 4F8RA 3WBBA 1QO0A 1TK5A 3CE6A 4GVXA 2IMWP 1PR2A 1DTWA 4U0KA 2ECFA 4ZCQA 4OY3A 2CXRA 3GLHB 4EGCB 1DRUA 1EVYA 3LXRA 5B2FA 1Q16A 3GNSA 2MR5A 1JJFA 3FPJA 4Q37A 2JIOA 4GM1A 2Q3JA 2ZE5A 3IKJA 2FVXA 4EYQA 4RSMA 3QZUA 2G1JA 3B3FA 3AVTA 5CFZA 2YKGA 7ICMA 3STVA 4QHYA 1JG3A 1WRBA 3DOEA 2OXEA 3QX3A 3LVQE 2JGEA 3E81A 1ZR2A 1N5JA 3RVLA 2XDAA 3K9BA 5CEHA 4OHPA 4QUGA 4HR7A 4V03A 4R1NA 2G17A 4FOTA 2YDYA 1LK5A 1NATA 2IF2A 1Z4KA 4DSFA 4X84A 4TYQA 4EMTA 3PW0A 3PQEA 4WACA 2F3QA 2YW9A 2WM9B 3DAYA 3PMLA 1G21E 3ZV6A 4F5PA 1SZPA 5KNDA 2R6JA 4ZTUB 3DZHA 4TQGA 5KFGA 1XTPA 2QF7A 5JCJA 4C1NA 2C4VA 2VTBB 1H2XA 4P4MA 5T5QA 4PYLA 2FZLA 4L15A 1PSZA 3HY6A 2ZR8A 4A7PA 2XD9A 4RAQA 1JECA 2ZSBA 5FQOA 3VV3A 4NCIA 2QG9A 3CH4B 4ZYLA 3GIMA 1W85B 2HHUA 4DILA 1VL2A 1XYVA 5B37A 4RQMA 2AEMA 4ACOA 5AW9A 4I55B 1BX1A 4QM7A 1PKEA 3HUEA 2YWJA 1CNMA 3DNFA 3CINA 2XVZA 2ZRIA 4XXHA 4MGEA 4H7HA 3JQAA 1QP4A 2F8TA 2ASDA 2QD4A 3GRFA 3NVKI 1TO6A 4X9XA 3PNLA 1NBAA 1ZBDA 1E6LA 2XYQA 3VR0A 4HWKA 4JJ7A 3PRKE 4D74A 1FDOA 4XUEA 5IZCA 4TVSA 2XIJA 3RSOA 3WLJA 2WU4A 3DLPX 2YQEA 1N56A 3THRA 1K6EA 5LCXA 1Q0TA 2ZWOA 4HZIA 1Z26A 3ZWBA 4ZVSA 5FR2A 2EIHA 2ZITA 4KUGA 2P9CA 2ZJ5A 1EA7A 3BRWD 3HVRA 1J0DA 5TQ0B 3ESYA 3NIWA 3N7PD 3T7SA 1VECA 4C2UA 1NXSA 4FFMA 4EGQA 5KSZA 2Q28A 3CVUA 4YCLA 4Y2SA 4IQTA 1TNDA 2OB1A 4UZEA 4RXTA 3WHPA 3G1TA 4AKIA 1UOQA 1W96A 3SHQA 3IEUA 2D5LA 4IICA 4K3VA 3MT9A 1YBFA 2PTHA 4ND1A 4WXMA 3QUTA 1RCUA 1SUDA 2B1IA 3GLTA 4DIDA 3QMMA 1NN3A 3OT1A 4BFUA 4JVLA 1QR6A 3O75A 5HSGA 2GEUA 4WOJA 2CVHA 4X97A 4EW3A 3FGPA 3Q8WA 5CEEA 2JJQA 3C1AA 2P5UA 1P8AA 3CZ9A 5BR1A 1U2GA 4IF6A 5ITVA