2OM6A

Hypothetical protein (probable phosphoserine phosph (ph0253) from pyrococcus horikoshii ot3
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
233
structure length
233
Chain Sequence
b'MREVKLVTFDVWNTLLDLNIMLDEFSHQLAKISGLHIKDVANAVIEVRNEIKKMRAQASEDPRKVLTGSQEALAGKLKVDVELVKRATARAILNVDESLVLEGTKEALQFVKERGLKTAVIGNVMFWPGSYTRLLLERFGLMEFIDKTFFADEVLSYKPRKEMFEKVLNSFEVKPEESLHIGDTYAEDYQGARKVGMWAVWINQEGDKVRKLEERGFEIPSIANLKDVIELIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable phosphoserine phosphatase
publication title Hypothetical Protein (Probable Phosphoserine Phosph (PH0253) from Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 83
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature ec 3.1.3.3: Phosphoserine phosphatase.
pdb deposition date 2007-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.400 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2om6A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2om6A01
4ZEWA 3U19A 1QQ6A 1F5SA 2O9JA 3L5KA 2JAWA 3QUBA 1Z4JA 3E84A 5ALUA 5ALGA 4HGPA 3B8EA 1RKQA 2HF7A 2HI0A 5ALJA 4KNVA 4CF4A 3QYPA 4F71A 2ZBGA 2P9JA 1TA0A 2HHLA 3QX7A 1T5TA 5AVZA 5AKLA 2B1RA 3NANA 4XE5A 2YJ6A 4EEKA 2R8ZA 3I76A 3AR7A 3L8FA 1U7OA 3U7EB 1RQNA 2HDOA 2C8KA 3MC1A 3QGMA 2IOFK 3IB6A 4J03A 1KYTA 2ODAA 2WF7A 3OCXA 4JB3A 2G09A 2YBDA 1X42A 2ZBFA 3ESRA 5AVWA 2GHQA 4H1WA 5AI6A 4YCMA 4NAVA 2I55A 2FPWA 4NWIA 2G06A 2VKQA 3QUQA 1ZD5A 2B8JA 4GXTA 4EX7A 1JUDA 1Z4LA 3QU9A 2B30A 2I54A 3DNPA 5ALNA 4E88A 1VJ5A 2JAUA 3E8MA 3OCZA 1Z4KA 3WKDA 5AI4A 4GIBA 1Y8AA 4UMEA 3DV9A 3PGVA 5AKKA 3U7HB 2FPSA 5AVUA 2FEAA 5AK4A 3EPRA 1LTQA 4YH1A 2R8EA 4IG4A 3FVVA 1NF2A 1RPZA 3FZQA 3M9LA 2W11A 3QU2A 5AICA 1Z4PX 5AM5A 3L7YA 4L57A 4UMFA 4BNDB 3NRJA 4ZEVA 3FPBA 2IYEA 4UARA 2I33A 3KDPA 1L7NA 3E58A 5AK6A 4UASA 5ALKA 3PDWA 5ALRA 3KD3A 3N5KA 3W5CA 3OTQA 2W43A 4OFZA 4AP9A 2PQ0A 5FP0A 3QU5A 3WK4A 2OA0A 1QQ7A 1T9ZA 3WK8A 2YMQA 3NUQA 4C4TA 4FE3A 2GO7A 3N07A 3ZUPA 3N1UA 1ZRNA 1RMTA 4YGYA 3QUCA 5AI5A 2FPXA 3KC2A 2RAVA 4BEVA 1SWVA 3CNHA 5AW6A 1RC8A 4Y2PA 1YJ5A 2AH5A 4YIHA 5AW9A 3K1ZA 3QU7A 5AW4A 2G07A 5AW2A 2GFHA 3AR5A 3ZWKA 2HO4A 1XP5A 3BA6A 3P96A 5AKXA 1ZRMA 5AVTA 1NRWA 3EF1A 4DCCA 1J8DA 5AI8A 4CNQA 3W5BA 3WK9A 4G63A 1ZD4A 2RARA 4YIKA 4F72A 3NALA 2YJ4A 4UM5A 4HGQA 4ZEXA 5ALOA 3UMGA 3A3YA 1RKUA 2EAUA 3ED5A 3KZXA 3D6JA 2OM6A 1QH9A 1FEZA 1TJ3A 2HOQA 2HSZA 2C4NA 5AKGA 4DW8A 1WZCA 3L0YA 5ALHA 3DAOA 1ZD2P 3KBBA 3WK7A 2FI1A 4OCZA 1MH9A 4UW9A 3ESQA 3AR6A 5AKZA 2C8LA 1N9KA 3E81A 5ALMA 1CQZA 2Q5EA 3EF0A 1Z4QA 4FYPA 3DDHA 4KN8A 3R9KA 5ALVA 3L1UA 3WKEA 5ALXA 4QQFA 1VJRA 3WKCA 2ZG6A 3WGUA 2YJ5A 1ZOLA 3HYCA 2P11A 4JDPA 2EATA 2EARA 4CE6A 1L8LA 2FUCA 4Y2SA 4DWOA 2B82A 3I1YA 3RFUA 2CFRA 5AVSA 3NASA 2WFAA 3KOOA 1RRCA 4HAIA 3ET5A 4BBJA 3ZWDA 3ZTYA 3FPSA 3A1CA 4Y2TA 5AM2A 2HX1A 3OCUA 3OCYA 2JAOA 1WPGA 4Y2VA 3IJ5A 1YMQA 3WK6A 5IT4A 5ALPA 5AI9A 5ALFA 1YS9A 2PKEA 1U2SA 1L7PA 5T41A 1ZJJA 1U02A 2C9MA 1CR6A 2ZXEA 1RQLA 4L6AA 2WF9A 1NNLA 3MMZA 5ALEA 2B8EA 3ZTWA 1XVIA 4EENA 4UMDA 3S6JA 3N28A 3AR4A 4EX6A 3L0BA 3RF6A 4Y2XA 4UU1A 3OPXA 3OCWA 3TLMA 4AS3A 4BKMA 3W5DA 3ZI4A 1EK1A 4RETA 1PW5A 2WHEA 4O8CA 1Q91A 4NFLA 2YN4A 5A3QA 2AGVA 2P27A 3A1EA 1N8NA 2CFSA 1RMQA 5A3SA 4HYTA 5AI0A 5ALWA 5AIBA 2BDUA 3AR3A 1Z4MA 4G9BA 1L7MA 4MUMA 2ZBDA 5AVQA 3CZ4A 1WR8A 2W4MA 3ZU6A 1YNSA 4YCLA 5AKEA 3U7FB 2NO4A 3PGLA 5AESA 5IS2A 5AKHA 3F9RA 1O08A 1YV9A 4UU0A 3I6BA 3SKXA 1U7PA 3L8GA 2IA5A 2Q4RA 4I9GA 4UATA 3QXGA 1T5SA 4RESA 5ALLA 2QLTA 1K1EA 4UAVA 4OD0A 5ALDA 3SLRA 2PR7A 5ALTA 3AR8A 5ALYA 3ZX5A 3L8HA 1S8OA 4XQ0A 3UM9A 4YCNA 3SMVA 2X4DA 4KX3A 2FPUA 5AVRA 3QUTA 4B6JA 4Y2RA 1IWOA 3WKBA 2I6XA 3ZX4A 3L1VA 1Z5UA 1EK2A 5A3RA 2R8XA 4CF5A 1J97A 4KNWA 4HGNA 2OBBA 5ALQA 5AM0A 4Y2JA 3VAYA 2ZOSA 3B9RA 2HCFA 4C4SA 2YJ3A 2I34A 3ZVMA 4AS2A 2GMWA 2YFYA 4FFDA 3QU4A 2CFTA 4Y2UA 1XPJA 5AKJA 4UMVA 5AKIA 2G08A 5AVVA 2HF2A 5IT0A 4HGOA 1Z4NA 3FGOA 1L8OA 5AW3A 1U2TA 2FDRA 2FPRA 1RLMA 3BWVA 5AHXA 5AM1A 1AQ6A 2YMLA 3NAMA 4MWOA 4PNHA 3AR2A 1QQ5A 3QNMA 4Y2QA 3SHQA 4CF3A 1S2OA 2Q4TA 4J2TA 1ZS9A 4UAUA 5ALIA 2OYCA 2WF6A 3B9BA 4L6CA 1RDFA 3NIWA 3U13A 3ONNA 3PCTA 1TE2A 2MSNA 4XPZA 3U7GA 1TJ4A 2FUEA 1L6RA 4BEWA 2B1QA 5AW8A 1SU4A 1Z5GA 1RLOA 2RB5A 2WM8A 4KX5A 2BDEA 2CN1A 2G1AA 1YDFA 4BYGA 4QJBA 4EZEA 5E0OA 3ZVNA 2I7DA 2IOFA 1RLTA 2YMPA 5AIAA 4OHFA 5AM3A 2G0AA 1VFPA 2NO5A 2DQSA 3QLEA 2AMYA 2JARA 5AK3A 3U26A 2G80A 2WF5A 1Z4IA 3M1YA 3UMBA 2RBKA 2YMMA 3R4CA 4NV0A 4BNDA 3ZVLA 3EWIA 1RKVA 3W5AA 5AK5A 2D2VA 1Q92A 3N8GA 2R8YA 2HEGA 5AKYA 2NYVA 2B0CA 3R09A 3IRUA 3ZW7A 2MU1A 2ZBEA 3WK5A 3MN1A 3WGVA 4KYTA 3J7TA 2GHTA 3AR9A 1Z4OA 3FM9A 5AVXA 3HLTA 5AW5A 2O2XA 4NABA 3SKYA 5ALSA 4HGRA 2AUTA 1TJ5A 4BX2A 5AM4A 2JGAA 1Z88A 4XOUA 1ZD3A 1QYIA 5AVYA 4C4RA 3WKAA 1LVHA 2BY4A 4BX0A 2WF8A 1L7OA 3GYGA 3MPOA 2QYHA 1SWWA 3I28A 2IOHA 4Y2YA 4Y3UA 2C88A 5ALZA 3ET4A 1WVIA 3SF0A 3L8EA 4I9FA 2YY6A 5AW7A 4IFTA 5AW0A 1RMYA 4BX3A 1O03A 2P69A 4EELA 3OCVA 4UM7A 3UMCA 4DFDA 5AW1A 3SD7A 5JJBA 3L0CA 3A1DA
chains in the Genus database with same CATH superfamily
3U37A 8ICPA 3U0VA 6YASA 5GTIU 3RUEA 2FG6C 5J2TF 2FWAA 3AGQA 1DO2A 2W8BA 2HLDD 4PYRA 3QWHA 3Q3EA 2YZKA 5IAAA 2FPKA 2R96A 4EO9A 1KYTA 3KRTA 2ZJ3A 1KQQA 4B9AA 1FVOA 1R15A 5HX7A 1EGVB 4KXNA 3P0EA 4GL2A 1P61B 1QSYA 2XNHA 3PNLA 4CYMA 5MFZA 3H0RB 1GKUB 1XEFA 3PDJA 2IEYA 1F6WA 2V65A 5J8YC 1X92A 2ZXHA 4ACOA 1T9BA 1VDVA 1FLVA 2C98A 5AVKA 2QTZA 5CA1B 2BM1A 3UANA 5L1JA 3QG1A 4W4TA 2R5NA 5B3LA 3KOXA 2CZQA 3S2IA 3I9FA 2E1EA 2KW5A 1BRTA 2I66A 5EIXA 3UJCA 1VG8A 2RGBA 3KL2A 1YQ9A 3RAEC 1P77A 3NWEA 3ANTA 4PG4A 3S70A 4J3NA 2W03A 4C0QC 1SVIA 2PFKA 2PJDA 1ZM2A 5JLAA 3QU7A 5AW4A 1U1IA 2V7QD 3P45A 5H16A 4R8VA 4TKVA 4MRAA 4XWOA 3PD7A 4MVJI 3GP3A 5I7OA 3FFTA 4DANA 4L07A 4MJ7A 2UYYA 3GR6A 5IZ4A 6NULA 1JDVA 3QLTA 4CI9A 5AR1A 3NRZA 1CQZA 2HHVA 3WKEA 2N0SA 2W8KA 1GPH1 2G70A 1PJQA 3OLCX 1U8AA 1J49A 4P4NA 3P32A 3I1YA 5AVSA 2JC3A 3BMCA 4HVCA 2SBTA 1NOIA 1AXGA 4JV0A 3AESB 1JXEA 3Q9UA 4GPD1 1Z5VA 1WS6A 2CFOA 2PWAA 9ICNA 4FOLA 3C6BA 2ZIGA 3RUPA 1DRJA 2IPAB 4Z2AA 2GEVA 2BEVB 1T8YA 2X7JA 1SKYE 2RD2A 4J0FA 4JENA 4QOSA 5ELLA 4CIYA 1I1HA 3QPDA 1LPAB 2O06A 3FNIA 4X1IB 1K97A 5FL3A 1HEKA 2BRUC 4D9IA 1H2FA 1DCKA 4NLCA 2JGLA 1QDUA 5KTMA 1PR6A 1U8YA 4EHBA 5AKHA 1NQ5A 5DDIP 1CZLA 4Q9IA 5JVDA 1HKHA 1MRNA 3DZBA 2PA3A 4UKDA 2P4UA 4HUQA 2C5LA 3BFVA 2JEJA 4TWRA 4BC1A 2J59A 2KZ3A 2EDUA 1W5AA 5J2AA 3LBAA 5HKKA 1S96A 1V1MA 4OHMA 1K1QA 3GW8A 5A7GA 1KMNA 1W36C 5JXJA 5F3WB 3DBHA 3SMQA 4OIFA 2ZUBA 2Y99A 2WE8A 4UBNA 3K0BA 1RYDA 1ULAA 1JW9B 3PWZA 5CUQA 4FYKA 1Q20A 2ACEA 1REQA 1VZ2A 2XXBA 4K6HA 3HPRA 2XCLA 2H59A 3ADDA 4R1MA 3PCTA 5B5SA 2JKVA 3T4EA 2HWKA 3DHYA 5LD2B 2HWYA 2XI4A 1QG2A 2RI6A 1FP6A 3AVYA 3GJZA 4B33A 2XZLA 3LY5A 3HB5X 4BXOA 4BLUA 4GVXA 3IAM1 1MTZA 3G9XA 1PGOA 4OQPA 3DFKA 1L5OA 3E4CA 1J0CA 3TRIA 2PZKA 3K9GA 2HHTA 4X1YA 2BFDA 3RSGA 3TW6A 5GJVC 2QAGC 5K0JA 4OHRA 4U7CA 1NVGA 2PLFA 4AJKA 3UWMA 1AN0A 1O9BA 2AGPA 4HDSA 2GPNA 3VJRA 5AM4A 2Q45A 1A71A 3D6AA 2V7VA 1EK6A 4Q3DA 5H3LA 3RASA 2W2MA 3RUAA 2YIMA 4M9QA 4DADA 1ZJ6A 1ZKDA 3AP3A 1OGJA 1IJEA 3NDPA 1XSLA 1YIDA 2FEKA 2AKYA 1QP0A 4P82A 2NU9A 2WFZA 2Z2XA 2WW8A 1KR2A 3OHBA 5B4TA 1JPVA 2I4TA 4CIBA 5CCXA 3SEFA 3Q98A 3N8HA 2C5AA 1BH6A 3HR4A 4HZUB 5IVKA 2PGJA 4QZGA 1QM5A 4HWKA 4XR4A 4K0KB 1CYEA 4YLEA 2IGBA 1KDPA 1RWKA 3KPUA 5F3DA 3N2IA 3DMPA 1B73A 1OAAA 4YXFA 1R8YA 2WJAA 4IVRA 4UZFA 3O2QB 1Q3HA 4ZA2A 2ST1A 5IZCC 4JNCA 1UMCB 5F9HA 3R3JA 4UHCA 5LQKA 1U0NA 4EUFA 3JPQA 3WRWA 2A6PA 1J21A 4PR3A 2VTKA 1R5BA 1GKLA 4ZI7F 1RIIA 4JUBA 1N9GB 3TOVA 4DIFA 2Q6KA 2NRTA 3M3PA 4JXXA 1EVEA 3O1JC 2VUTA 4BASA 2VANA 2QRJA 1PLLA 3EXHA 1IOLA 4L28A 1NVVQ 3P19A 3ROGA 1L5HB 3E7XA 4YRZA 1X0VA 1CEYA 3IHQB 4PLFA 4ZO6A 4HLCA 5DIZA 2WLSA 2B83A 1ZRMA 4KPUA 4TSKA 1MEEA 1VP3A 2C1ZA 3GV5B 4V1CB 4USAA 1QBGA 2UZ4A 3LNTA 3TARA 4YP9A 5BRNA 4YIKA 3UO8B 1J8QA 4NMLA 4LJAA 2G4VA 2JEGA 4X8LA 4Q8FA 5L3RA 4EWLA 1XROA 3ETHA 4L8VA 2PS9A 1WY7A 3IVMA 1UODA 2J0EA 1PJCA 1KVRA 4WVFA 1IB6A 4GFJA 1T8UA 1XD8A 5A9RA 1QVVA 3WGUA 3N76A 1AHIA 3GUVA 4RKFA 2FUCA 4ZCTA 4GMKA 1ZQMA 1C7EA 1N6OA 4EKEA 4HNUA 1VIVA 1Z2DA 5ELXA 1IG6A 3IPXA 2BZSA 1WWUA 2XCTB 3BQ9A 4R9NA 4ILEA 5FOSA 3CR8A 2HOFA 4JR1A 1D6MA 1QHSA 1KP3A 1EWKA 3RG8A 3SOZA 2VUIB 3CEPB 3AR4A 1FJXA 3SQNA 4RDXA 1R10A 2PS3A 3A4YA 4D3DA 3N3BC 3WJ2A 2W8ZA 3E22B 4JHLA 4GXIA 1KZ7B 4F96A 2HMXA 4RACA 2C2BA 4AVYA 2ZSKA 1I8TA 2G83A 2ZBDA 2QSJA 2C2XA 5JPDA 3PQ7A 4JX9A 2QN2A 1UKAA 2AFHB 5EWJB 1L5NA 1K1EA 1KGSA 1L5YA 2MMCA 1W9MA 2YRXA 4BX9C 2L2QA 2NAFA 2WQ7A 2PUFA 2VQFB 4WWHA 3NYIA 1EK2A 1WZ2A 2P8JA 1M8PA 5CDGA 1KHTA 5HFNA 4ZO4A 4QGHA 5HE8A 3O93A 3JAKA 2A4MA 2HY7A 2ZSFA 4YP0A 2NRWA 2QD4A 4FOOA 4JCCA 3CRVA 3PC8C 1F8UA 3SXJA 4KMOA 4ZCQA 4XUGB 2Z8XA 3VRHA 2GS9A 3T9BA 3PSIA 2QIOA 2IVZA 3TBHA 3A6ZA 3UQ0A 4L2IA 1K7FB 4L6CA 1XZPA 4BNKA 4LV6A 2GM3A 2JLCA 2IBKA 2MOKA 2ISSD 2UZ0A 1NZFA 1Z00B 4GZ3A 1OX4B 2DWPA 2ID9A 2NQ8A 1KEEA 3BXEA 1GPAA 4G25A 4QWWA 2C4HA 3ZOKA 5BMVA 3KXIA 2GNOA 4MRMA 2WINI 1K6MA 1OYOA 2JA2A 1M3SA 2G1PA 2J30A 3PGA1 3ROQA 1FC0A 3R8XA 3RS2A 2X6RA 3DOHA 2HMSA 3F2IA 5KYXA 3OOWA 1CR1A 4N48A 1ZL2A 1UMDB 2R4TA 1DTWA 3WTBA 1EUYA 5C2JB 3EOAI 5DLEA 4HVAA 1JIXA 3U7EB 1FJ2A 1ZQIA 1F5SA 3VC8A 1HZJA 2A3NA 2B7CA 1OAOC 3AVTA 4CIDA 4FFBA 1CE8B 1XZLA 2QPAA 1GT6A 1TZBA 2ORYA 3H8VA 2OAP1 4W8GA 1Q6YA 4TL7A 2Z2JA 1T9KA 2EJCA 2WZCA 1ID8A 4AY3A 4RDHA 5H2FU 1JKJA 1G3IA 4B09A 1IOZA 4IEFB 5DDYA 4XGKA 3PXDA 4O2AA 1AGPA 2JHGA 2FSVC 3QW2A 4KOAA 3K05A 5ITSA 3SPXA 3E7WA 1ZD1A 1OJLA 1A0PA 3P9QA 3D1JA 3GGCA 3K5WA 4Q4HA 3L92A 2W11A 5F9MA 4RK1A 3DVAA 1HDRA 4CEHA 4RD3A 1EWTA 2Q21A 3IDZA 4IGAA 3GT4A 4ESVA 1UBCA 4COOA 3AFNA 3G0GA 3B7WA 3WLAA 5TSDA 1CKEA 4MS1A 2YZMA 2UXBB 4RE5A 2CY0A 1JI7A 4Z4CA 5FOXA 4DV2B 3IOBA 2X6QA 3EGOA 5JSHA 3OTOB 3UKDA 2FPXA 3RS7A 1Z7GA 4RTPA 4PWZA 4RWZA 4EZIA 1CRZA 1CPYA 4KN4A 4GE0A 5T4FA 4W6ZA 2VJNA 1CW2B 2Z09A 4ELTA 2BFFB 1JQ3A 3TE7A 2HU5A 1U99A 4W5HA 4H16A 2EXXA 4IIFA 3NBUA 1LC3A 3CMCO 2JF0A 3PE3A 1YK0A 1JDPA 1FEZA 1U0OC 3RC1A 4TQSA 3SR0A 1C9EA 3NYWA 4N49A 4NLLA 4BFSA 1FP4B 4RZSA 1JDZA 1EBFA 5BP7A 2C4KA 1JKIA 4AMYA 3I34X 1H05A 3S1SA 1YHZA 4MIOA 4Q43A 5C34B 2C92A 4WKGA 4Y2SA 1TO6A 5JPCA 2JAXA 3P26A 2MIIA 1TQHA 1EX7A 3HKCA 3T7RA 5TRTA 2GARA 3QBEA 4DJ5X 3C87A 1XRLA 5IT4A 2X23A 2E8NA 5A9SA 2J4FA 2VRBA 2DUWA 3TO5A 4LYJA 1A2BA 1CR6A 2YHUA 4BMNA 1B6RA 4XXHA 1MMFB 5JR3A 2JLVA 3VO9A 3N87A 1N2HA 2HCBA 2XQVA 2CV0A 3EAGA 5JJKA 5EVJA 2A5DA 4RY8A 3PTAA 1L3VA 2GAIA 1PGQA 3B8HA 2N47A 4KVFA 1F60A 4V2IA 3TLXA 3QA9A 1O8BA 2OHVA 1XAHA 3TW8B 2OG2A 3PQEA 3GEMA 1U9JA 4HN4B 4EI2A 1H65A 3JR7A 3MSXA 1Y8CA 4RZ3A 4BE4A 1M6NA 2P78A 1L5RA 1ODTC 1HFWA 2X2FA 4MW6A 5E2BA 1GTJ1 4JYZA 1YMVA 3LPDA 5A5VA 1DBIA 2AFVA 1UH5A 3TIXB 4L7VA 4RQ8A 3ER8A 2BE7A 1XL0A 3MTBA 2CW5A 3BHIA 4UHHA 1HK7A 4RGQA 2VBFA 2Z4RA 4X63A 4LTMA 1O95C 5ARBA 2IBTA 4JLSA 4FYWA 5DG7A 7ICGA 3G2NA 3TBFA 2ZTEA 5JH7B 2QVCA 1LBSA 3ASZA 1Q8KA 1VJTA 1MX9A 1YB2A 1R4NB 3DE1X 1KZYC 4YS6A 4YAWA 1E2UA 4M89A 1G17A 2SCUA 3QE9Y 5LU8A 2XMDA 1OGIA 2R6R1 2A33A 3SDBA 4GRDA 1GPYA 3OCJA 1E4EB 4PBRA 5DSXA 5KNIA 1LQ2A 3EEBA 1SVNA 1G6HA 2G1UA 3Q8RB 1YJBA 4EEZA 4TVOA 4KLOA 3TCNA 2PX0A 2XE6A 4MUFA 1JLHA 4HYKA 4YI5A 5J23A 2X2EA 4BCBA 3TXXA 3C3CA 4TT8A 3AUTA 1P5HA 3CCBA 2PM8A 5FBVB 3OMXA 1L7OA 1KL7A 2JZOA 4MR8B 5IJZA 3HNPA 2ZVDA 3LNCA 3WNZA 1PL0A 4HFMA 1XLTA 4WK2B 3PZRA 1JR6A 4UM7A 2O07A 3F2DA 3SD7A 2QZPA 3E8SA 2Y77A 3VI4B 4JEIA 2V03A 2YXLA 3WLSA 4M1MA 4TQRA 4KQEA 2ODEA 1O94C 5DW0A 2D2XA 4NEQA 5D6NA 1JIQA 2B1RA 2DX7A 1U04A 1RT9A 3F4KA 4UB5A 1BPYA 2VJDA 1ILWA 3PGXA 3GRFA 2UXCB 4X24A 4LDJA 1I9CA 2PJZA 4E1BA 5EQTA 5L3SA 4PZUA 3L1IA 4Q9AA 3RU3A 2WHPB 3JQBA 4JK1A 3ER6A 3MFHA 5CNIA 4CKYA 5BRAA 3G9TA 4BNNA 1ML4A 1SVSA 4CIWA 4G24A 1NHWA 4RU9A 2Q99A 3KSUA 5JCZA 1TW3A 1I4TD 1OZ0A 1PJTA 4BYMA 4R1OA 3T1QA 3S2ZA 3SC4A 1NT2A 2RAFA 1KK2A 1ZK1A 1JHPA 1XPUA 3A05A 1PUXA 1RU3A 1AQNA 3KUKA 1ZQWA 4FE3A 4OX9Y 2OMEA 4DUGA 3LW8A 1RMTA 3IOEA 2QRVB 3VC2A 5EWMA 3RGGA 4A73A 4AULA 1C3VA 1DADA 3RYCB 2DBQA 4CZ2A 3BXPA 2IYNA 4N47A 1A69A 3VPGA 4C8LA 3JPNA 1W87A 1TVKA 3ZY6A 3X43A 3HN6A 5CDUA 3QEBZ 3EXG1 5JI3E 4L8FA 5ALOA 2KI5A 1M2NA 3AIOA 4Y9SA 5AUOB 3IM1A 5KDDA 3THWB 4QNMA 2CNWD 2OHFA 4Q4AB 3TSZA 1G0OA 4QZHA 4RTRA 4GWLA 5ALMA 1CVRA 4E14A 5C8VA 1M2GA 1XC7A 5EE0A 1P3JA 5CVEA 4AKIA 2B98A 3CT6A 5H59A 3K0FA 3HI4A 2PX3A 4O5EA 1O96A 3ECAA 1Z7EA 5ED4A 5IASA 5BV7A 4GQIA 1JI3A 3E18A 4EI8A 3WK6A 5TQ0B 4UU8A 2ZXIA 5AXAA 3WE7A 2H1FA 1XTSA 5L3VA 3LUAA 3ZN2A 4PIVA 1XOIA 2B8EA 3HHEA 3U56A 1IBCA 3R7WB 2ZUDA 3OCWA 2XA9A 1NW9B 3NCTA 3UWDA 5CMLA 3G1UA 3SXUB 2D06A 2XT9A 2ZBVA 4I2FA 2GTPA 3QVKA 4GC5A 3PEWA 1QHIA 3AEKA 2PFGA 2XQFA 3WLQA 4BRZA 1W48A 1MQ2A 4O4LF 3G0OA 1NIJA 3VDRA 1E2LA 4V0RA 4LC1A 1BXZA 1G4HA 5ALYA 1KORA 3D3EA 1E5VA 4HDOB 4KPEC 3RJTA 2QL9A 5I9BA 1VDMA 3O82A 2I1LA 2H9AA 3JTMA 4UZSA 1FRQA 4EAAA 3D43A 4ECYA 3SHOA 3IKLA 1K92A 4ZGWA 3OU6A 5KOHA 1IRIA 3VPFA 3UGKA 2RK3A 4B9SA 2VPPA 3VH4A 3K20A 4ETIA 3QOXA 1JDTA 4KEAA 1LDNA 3LPCA 3MJVA 3T3NA 4GPIB 4QD3A 3Q9SA 1NFQA 4BMSA 1P7YA 1IY8A 4MICA 4US2R 2FEXA 3LLUA 3JYOA 1VI6A 3PP8A 1UKVY 3K5PA 4D3YA 4ENSA 3S1AA 3NS1A 4BYGA 3ZVNA 5KYUB 2EQBA 2H3EA 4CCWA 1E59A 1EE9A 1NN0A 2DOKA 3VKFA 3VO2A 1A2OA 2AOUA 1Q92A 1SKWA 1NJGA 1MJGA 1XWIA 1AU9A 3DM9B 2WE7A 3NGLA 4JT4A 1D6NA 3SQXA 4BL5A 3AVVA 3LG2A 2ABWA 3ALRA 1PR2A 4KN9S 2EEPA 5FNVA 3IDWA 3MTQA 1Q3TA 3RW9A 4OB7A 1QUEA 4R9SA 2H3QA 4CHTA 1TL7C 1ZSNA 2FQXA 3KQWA 1ITZA 3EVEA 5AW0A 4XJTA 1UM9B 1O6GA 4FCCA 3GBSA 3KYCA 3D0RA 1V11B 5KKCA 3U09A 4AG3A 4B4VA 2O9JA 2ZR0A 2QIPA 1VPVA 4YUXA 4IXNA 1DJOA 4XFKA 1TA0A 3WNBA 4CMIA 3TIIA 4FMCF 2X3YA 1OFTA 5I7VA 1FU8A 4UTRA 4JYPA 3BICA 2X6TA 4PU0A 3ETEA 1D07A 1VLVA 1N34B 2EGGA 3H4MA 4RXUA 4HLDA 5AVWA 1E9SA 1I7QB 3RF9A 2Q4DA 1WWVA 3JQ9C 4N03A 2GZAA 4NOMA 1UIMA 2ASLA 3KXLA 3T34A 3MPUA 5C8ZA 1LRJA 4UMEA 2C3MA 2YXEA 2H1RA 2JEIA 1R1DA 1MXFA 2BOVA 3HVHA 2QKYA 2WFMA 4L4UA 3I6ZA 3QI7A 2EQAA 4GXNA 3IE0A 5EWLB 4L57A 4AIRA 2PMEA 5BOSB 1U1FA 1DEKA 3UHOA 4MUNA 2VAMA 3IJEB 1QOQB 4F5NA 3EUEA 3LX4A 5LWHA 1G5RA 4AC9A 2W9BB 3O73A 2X0EA 3IS3A 1DZ3A 5KG7A 1QFZA 4P3NA 3UT5B 2R3SA 4HS4A 2BL4A 1NUUA 2E0IA 3P96A 3GIWA 1RXEA 4CU2A 2QV7A 4TKUB 2I6GA 3OEYA 3M1LA 4UM5A 2Z1DA 4ETNA 1JWLA 3CUUA 1PWEA 4Q1FA 5A4DA 2RHTA 1DWUA 4RK4A 1HE4A 3HBMA 1RM6C 4A82A 3K5HA 4EHKA 4F6LA 4L50A 4JXKA 2FUKA 2QYTA 2FJUA 2LWIA 1W1WA 1IATA 3BFPA 1UAAA 4DLZA 3CLUD 2VRNA 4N18A 3NC0C 1LXCA 4L4XA 1SIWA 4BBJA 1ZXXA 4C0SA 2J3EA 4C0JA 1A4XA 3FF4A 3KU4A 4PSAA 1D1QA 2QZZA 3UXPA 3TAQA 2EERA 2YH2A 1VMKA 2WKRA 1I24A 2OGUA 2Y0PA 4C3VA 2HQRA 2WAAA 3OQVA 4RQ1A 2D1QA 5HQ3B 1JEYA 1RJEA 2E5SA 1GL3A 1F8GA 3KV1A 1NAIA 2H31A 1U11A 1PL8A 3W2FA 1KRPA 4G9BA 4PGYA 2CXRA 4F8EA 1Z74A 3JD3A 4HSEA 4P92A 5DNAA 4IRKA 2K4EA 1ZONA 2QRQA 2IA6A 5CLGA 2P4HX 4KK4A 1RYHA 1NPTO 4ZGBA 4Z7NB 3FKJA 1W4BA 1Y80A 4OU5A 3VC1A 4MF8A 2QXYA 4FEGA 4YP7A 2EAOA 1JLLA 1XJWA 5KMGB 1LUAA 1W4CA 1WLYA 4B2LA 5I3ZA 4MGHA 2QNBA 5IJAA 3DEAA 2J48A 4EDHA 4M2LA 3NM4A 1NQUA 1A6SA 1KNQA 3K4HA 4I2DA 3CX4A 3GFGA 2GETA 3TRDA 3HP4A 1E62A 3P5SA 1K06A 4R2WA 3AETB 3LF1A 3IMKA 1GNTA 3ZE0B 1C4OA 3GT0A 1QFMA 3W6ZA 5KU1A 3MJRA 4FZMA 1QF7A 4ERNA 2C9YA 5BSVA 2RBKA 4E7PA 4K3VA 3AJ9A 4RIIA 3G9QA 4UHKA 1W9HA 1IZ0A 4JI3B 2DMRA 3DSRA 3QVGB 2XGQA 1U9LA 4DNPA 1ZHHA 3WZ2A 2PK3A 1SUSA 2E4ZA 3C6ZA 4H7HA 4GMDA 3P9ZA 2OCBA 4FR2A 2D62A 3SHVA 4G81A 2OAQ1 1IEQA 2RC6A 2JW5A 1LBTA 3BHJA 1JEEA 4AD8A 4Q9JA 3EVAA 4KWHA 5J4HA 5K0GA 5K4GA 1T3QA 1YA6A 3PZBA 2RGNA 1YB5A 1GNPA 4GYYA 4JJFA 2HQ1A 1Z08A 2GPBA 2H4XA 3ETLA 4GEGA 3T9AA 3GGOA 3NANA 4IS7A 1T0PA 4PLHA 1GU0A 4KV9A 3H40A 3EG9A 3KFXA 2HLHA 4KXWA 2QL5A 4JBLA 4PHDA 3MDCA 1OUQA 4HXFB 2ZBFA 1J9ZA 3E8XA 3BMQA 4EW3A 1M2VA 3AV3A 5DHUA 2VO1A 3INTA 2YVLA 3LM8A 1KI6A 3C1YA 3C5GA 1NQWA 4Z1OA 3RC3A 2G9RA 3WYEA 3MRSA 4ZT4A 1GRRA 3LDFA 1E1QA 2JGNA 2R00A 2Z2KA 5MN6A 5HMMA 2XY4A 4IJMA 3M6WA 2XY7A 2GLEA 4OMCA 1OC2A 1AIPA 1SXDA 3LXUX 4LBZA 4I2VA 4LJLA 5ALKA 1XTZA 1JDNA 2PKCA 3TFSA 3SR4A 1SHLA 1GCOA 4H7KA 1N1GA 4OGWA 2Q2VA 1G8AA 3Q6MA 1WBDA 4ESHA 4IAOA 2X76A 2H3HA 3HXOA 5JBNA 4YMMA 4BLOA 3ZGLA 2WWWA 1EUDB 1YL5A 3DFIA 4CV0A 2D74A 1B8OA 1IRXA 1D2NA 3E23A 3FCYA 1URJA 3ZHZA 2EZXA 4BDPA 2Y1FA 3H8WA 3ZXYA 2JD1A 3GLVA 3R7SA 1BDIA 1MG5A 4ARSA 4E0BA 5JASA 4M9GA 1EMDA 4OQYA 4BB9A 1CDEA 5IK2A 1JIKA 2XUHA 1YCFA 1ZOLA 3FTDA 2XNJA 1JHDA 1L8LA 1PK8A 2APJA 2XYPA 1ZK0A 5CEHA 4X8OA 4QARA 4IIJB 3LKDA 4K05A 3RTDA 1CIJA 3P2OA 4L9SA 2QB0B 1BOOA 5C5IA 2BQ3A 3VQTA 3IJRA 2WV9A 2FXVA 5E8RA 3EHEA 4MQEA 4PZPA 1P7VA 4XVUA 3WMWA 4CN8A 3SXPA 2QR5A 4AKTA 1B8NA 2PSSA 1P5ZB 1HTTA 1XZGA 3AMZA 2ZDHA 3HP7A 1PSZA 2O2SA 1ADYA 2CHVA 4BQOA 4ZICA 4PFSA 3DQZA 3ZTTA 2LBOA 3DEHA 1BHJA 3VM6A 5G41A 4EBDA 5BYKA 1UMBB 5HJ7A 4OK5A 4R64A 4US1R 1OSNA 1VYVA 3SJCA 2QL7A 1P44A 2O3SA 3QY9A 1LBQA 3W1VA 5AUPB 2X0FA 4TTAA 4H6PA 1EYZA 4EKYA 1QIKA 3Q40A 3ONWA 4LDPA 2JKYA 3MW8A 3PC2A 4QPNA 4TL8A 2D2EA 4OHKA 2JLZA 3DBRA 4C01A 2IODA 3LU1A 4YRLA 5C9ZA 1B22A 1UK7A 1TK2A 3B3QA 4II3A 1N2CB 1XZKA 2Z5FA 3PS9A 4Z0TA 5KJ1A 5AJVB 2C5SA 4EB6B 4KQFA 1GNQA 3BXZA 5EKDA 4G6ZA 1X9SA 3FAZA 3R6TA 5E7IA 1MN8A 4RJKA 5GONA 3CEMA 3S0JA 1T5BA 1XIVA 1I4DD 4RLQA 3EEQA 2EZ9A 1NX6A 2P91A 2UZ3A 5HF8A 2H8KA 4X8HA 3O8LA 1XVUA 4NULA 2OV1A 1RYMA 2V1XA 4J3FA 3LGSA 1DS6A 2V5VA 1RACA 2ASJA 1S2LA 2AVNA 4BTLA 4PF1A 1ADCA 3O9ZA 3VUFA 5DJ5A 4D8TA 2IWRA 4P1ZA 3WIVA 4JP2A 4GLXA 3C3KA 3G5TA 1X3LA 4G5RA 2QYHA 3TBKA 3KK0A 5GADl 5BR4A 2GZHA 4DOCA 4NX2A 4CCAA 2F67A 1SXPA 3C2LA 2FW6A 3GV7B 3IC5A 3NVKI 3BQNB 1NKVA 3GILA 1UZAA 3T4UA 1BH2A 3REOA 2GSWA 4B3CA 4KIGA 3WZMA 1H8ED 1NUTA 2KMLA 3ELYA 3O75A 5FEMA 4YMVA 4ARIA 2O14A 2CFCA 4M0UA 4WXYB 3KWLA 4FZJA 3SP1A 3FKSD 3ZVRA 2O2ZA 4M0KA 3BCUA 5FT9A 4J0GA 4KO8A 4OM7A 2ZTUA 3M83A 4I2HA 5JDIC 2BYTA 3BIJA 1DRGA 1WRBA 3B9JA 2CCGA 3ENNA 3QTLA 3TD2A 1V16A 1PCXA 1EFPA 4D26A 2P68A 3RANA 4E2FA 3JALA 4JLWA 3GFSA 3LBYA 1WU7A 5K8IA 1ZJ4A 2D5LA 4CIAA 4L0CA 3VTKA 4DSZA 3ZNQA 3W2GA 5HR6A 5ERXA 3LHSA 5F3XB 2PD3A 1DAFA 1XBTA 1GY8A 4TSFD 1OU4A 2MSWA 2Z9BA 3TLKA 3TL2A 2F8MA 1WO8A 1T3SA 1Z18A 4GM4A 4CT0A 3PW2A 4YRDA 4PS0A 5TIIA 1GXSB 3H9EO 4QXRA 3FE2A 1TJ3A 4DSJA 1V35A 3RC7A 2HNKA 3C7AA 5G0VA 4U7DA 4XA5A 2WT8A 3CS3A 3SYKA 5G5HA 3R9KA 1UC9A 3C39A 2J7PA 2BCQA 1T0JB 4ZO8A 5GV7A 3H5NA 4RVFA 4W8OA 5E79U 1IBSA 3AM5A 4P34A 2VHTA 4V0OA 2OYYA 1VJ1A 2A9PA 3RCBA 4R6XA 4CUKA 3NVVA 3G49A 3QHQA 3VOAA 3L4KA 5FWYB 5L1KA 3FXAA 4GKKB 1F2TA 4NBNA 1TQ6A 2XB8A 1L7XA 3QPBA 2UVVA 3HCNA 3H99A 3L93A 1A82A 3PQDA 1KERA 4KLNA 3W5DA 1H0RA 5FYDA 5TT0A 1UQUA 2FRVA 4F5PA 5BNIA 2D0OB 2BSXA 2I9PA 1A2QA 1DHTA 1YNSA 2R86A 3PGLA 5EIAA 4IYJA 2QLFA 4BVEA 1W581 1T5SA 3T9EA 5B7GA 3LQ4A 3GFTA 2V4RA 3FFXA 1E5TA 4HAYA 2HAEA 2VYFA 2C1XA 2O8CA 1L5WA 3DE4X 1QAMA 2GJ4A 2OSBA 3WSWA 2Y1CA 2OEPA 3FPKA 1A7KA 1QXSA 3WHKA 3LUCA 4LYDA 3WWCA 2P9TA 1AO3A 3GEPA 1KRWA 1A9TA 3G8BA 2PMZF 3V7KA 3AM1A 1G2QA 4TWZA 4TXHA 2PYZA 4C0KA 4RANA 1DJLA 4D8YA 4A23A 1MOQA 3QBTA 3NIGB 3OFKA 4A8PA 2OBLA 4OOFA 1P9LA 2OAGA 1TU0A 1RJGA 3ZVKA 3DNFA 4MS4A 5EMJA 3AFMA 4UB2A 3GJ4A 4Y1RA 4ZDWA 3KQLA 1WCV1 4MPRA 1FNMA 2HBRA 4ZD6A 3KVYA 4GSYA 2VF5X 1TJNA 3GG9A 3Q4GA 4HN2A 1NJ2A 2OORC 4FSXA 3E7PA 3FSGA 4QPPA 5IJWA 1V9PA 1JFSA 1X7GA 2YMMA 2WPDD 2R6GA 6PFKA 1CUEA 4CCHA 3GLSA 4Z0HO 1PSDA 4Z0PA 2QRKA 3L4SO 1Q0QA 4YMOA 1XF1A 4XLTA 2ZS8A 3U9LA 3KQKA 2V6MA 3INNA 3AKEA 1Z2AA 4IFTA 1SOMA 3EPPA 4YRPA 4ZMBA 3V6MA 1E2KA 5I4IA 3A1NA 4HXGA 1N7IA 4G0NA 5KFCA 5JYCA 2ZT5A 3QZ8A 2HU8A 2ODNA 2ZBGA 2E5FA 1T43A 5CT9A 2WWTA 1RPJA 4GH5A 2Z1NA 2E18A 2R7MA 3KPJA 1I14A 1UJ2A 4A0FA 2C2DA 1I32A 3BWYA 1IC6A 5CXXA 3GLQA 1T5LA 4EX7A 4E5VA 1WCNA 1KN5A 4OQNA 5K3DA 3SQOA 2Y92A 1V41E 4UE2A 2BKVA 2CMKA 2FPSA 2DY1A 4GHWA 3RD5A 4FW8A 1RPZA 2NXWA 5CWRA 1F0NA 4ZEVA 2WTFA 2BR5A 2K4IA 4X91A 1C7FA 1YE3A 4I6GA 1QIDA 3H75A 4XGNA 1QIHA 3BEDA 1MH1A 4C7ZA 1T9ZA 4DAOA 4LZJA 3N07A 4BRSA 3EZGA 3WX0A 3SDSA 1H94A 5AW6A 3OIUA 1G18A 5FOTA 3U31A 2I80A 5CIQA 3PX0A 2GD2A 3PIDA 1MA7A 1T2UA 2Y8EA 3K0AB 1JLKA 2G5IB 4M1YA 1ES9A 4LYFA 1OH6A 3ZDRA 1YQQA 3WYGA 1KFEB 1APBA 1KYIA 4AN0A 4HBZA 2VHVA 7ICLA 5AKZA 2VNIA 1XZNA 3L0IB 4W9MC 5BMOA 4KO1S 3RT9A 3G13A 1QH1A 4YD2A 5L95A 5LM3A 1DKRA 3KZMA 3N7SC 7ICPA 2GJ8A 3F7OA 4EBCA 4L5AA 5ESWA 4MMYB 4F4YA 3MMSA 4B8YA 1QH0A 1X9WA 5EEHA 2NMVA 1PK1B 5DHSA 5LQCA 1ZRHA 4IDQA 2OZLA 3P0HA 5D3KA 2B3DA 1AROP 4UUAA 5LP6B 4K40A 3PF8A 1UJNA 3F90A 3BQTA 3GGGA 3C74A 1EGQA 1SVUA 4XM1A 4P3OA 4Q8EA 2JBHA 4D9JA 4UDOA 5KX5B 1J2YA 5KQLA 4UUQA 1DX6A 1DARA 4HNRA 4ZJZA 4X5OA 3BD7A 4D0NA 1OUMA 3MJSA 2CDNA 4P0QA 3JZAA 1BNCA 3MMPA 1X87A 2O2HA 1UADA 3TMKA 1E1MA 5KDLA 2C29D 3ZDFA 2AFIA 4AI6A 1EG2A 4KZKA 2F8KA 1A9OA 1O97D 3F1LA 2WU0A 2O59A 3N70A 3JYQA 4HX5A 1J8YF 4ZO9A 3QUTA 3H0KA 2QLNA 5ELMA 5B58C 3ER9A 4R6WA 2QTNA 1RM0A 3T1TA 4Y8VA 5FPYA 1CUXA 3ZIAD 1L4BA 1XA0A 5BQOA 3S68A 2PVPA 1E3LA 2NXCA 3IERA 3D5TA 3UW1A 4ML3A 2P30A 3TLJA 4JUIA 4PIMA 4TOIA 4F06A 4GZMA 2VZLA 3W8NA 2WM9B 3HDQA 3VA7A 5IPFA 1DXSA 1AO0A 1IHPA 4H59A 2QX6A 1TUBB 2Y6UA 1ZYQA 4YFKA 2RHFA 4NSNA 2QN8A 3D3KA 1Q1BA 4RD1A 3ZXIA 7ABPA 4M6WB 1ZQOA 1EWRA 1MV5A 1Z2PX 1SCUB 4H4DA 1ZOIA 5FUVA 5KAFU 4RZRA 2K2WA 5IHXA 5J2UB 1SB3C 2YY7A 2Y66A 3V8MA 3HP6A 1H6CA 5JH7F 1UZMA 2IL1A 4I5FA 2AWOA 3KYIB 1SKYB 4AURA 4XDZA 1IBMB 2FWRA 2IH2A 1YZFA 5J47A 1MO5A 3VKUA 5C0YA 3CVOA 4KLJA 1MX1A 2F3NA 4V0QA 2Z1MA 2VDLB 4UUMA 4XD7D 3LIIA 3DDZX 3QF4B 4F2DA 3IURA 7ICTA 4KYIB 2R2AA 2P9JA 3M89A 1SKQA 4DDMA 1FQKA 1I1OA 5I7EA 4WACA 2D7DA 1LRLA 1H69A 1BMQA 1K5OA 4XEHA 4M54A 5IC4A 2PBRA 5JMPA 3I42A 4H1WA 3PFHA 1GR1A 2HOIA 1YRLA 3RJEA 1WXGA 2J9FA 3T79A 1P6XA 2QTWB 5GGXA 4O9MA 4I46A 1F4LA 2XVMA 4MHTA 2XMCA 3T6KA 4DR6B 4M76B 5ES3A 1P6QA 2WB2A 2A1UA 3LA8A 1TM3E 3QKSA 5C51B 3RBAA 2BZ0A 1ENOA 1HEIA 4HDRA 1BFUA 5HF9A 4XWTA 5IUKC 5H68A 1QYXA 3GJQA 4OXXA 1UPFA 4YAOA 1CG6A 4U3JA 1BJKA 5DGHA 2OXRA 2QZ9A 4RNMA 4YD1A 4EA7A 4GOLD 1V5IA 2G0TA 1DDGA 2OO5C 5AH0A 5T3YA 4ECXA 1FXUA 1WNTA 2VAWA 4MW4A 1JEQA 4XM0A 4YPOA 1G2IA 5IDYA 2NUAB 2F1RA 1F1BA 2AOXA 2V8BA 5GZ3A 4N4AA 3UCXA 1FFDA 2YNMC 4B6SA 5CDHA 4MHVA 2BTOA 3E35A 2DYKA 3C5HA 1QC5B 5L7WA 5BXYA 3L5OA 4DFMA 4JBGA 2VSOA 4XKJA 3BSSA 1HV8A 4CCYB 3LDHA 2XECA 1JE0A 1YTUA 5A5DA 1EXVA 3B6JA 1H2EA 2HHQA 4RTOA 3ETJA 3FRIA 5EUMA 2KHVA 2FVXA 4IUYA 1U3TA 2CMDA 3AJDA 3GXOA 4CODB 4ONEA 1QR2A 1RABA 5EYPB 3CUYA 2ZYRA 5FADA 2H5EA 3IP5A 1T5OA 3A9TA 5G53C 1ZSVA 4IL6U 3HC7A 4FJ2A 5AJUA 5K3AA 3PFFA 4N7BA 2LKYA 2GK6A 2VZEA 1NX9A 3AEYA 4AJ2A 4D79A 4RQMA 3MTDA 4WEOA 1M7BA 4DIDA 3ZDAA 3N2LA 3HJEA 2IIPA 1YZYA 3SNKA 4OLJA 3KAKA 4BNIA 3OZAA 2H2AA 3T5BA 1I1QB 5GTHU 2NO4A 2HA5A 3F6BX 3I9V1 2A1TS 5EL0A 1E1CB 4C6TB 3FDZA 4DSLA 2DBZA 5KTQA 2PR7A 3NB0A 3EQ2A 4YR3A 3WWPA 4UJ5A 4GM0A 2EKBA 3ZWNA 1V45E 3HYNA 1M5UA 3CZPA 2OYSA 3M0EA 5A3RA 5KL1B 1R66A 4H0CA 1QGAA 4U00A 4O4HA 3ITEA 1GDHA 4HQLA 3ZXUB 2NT4A 2XR1A 2JGDA 2P0EA 4G8DA 5AXCA 2YHBA 1PQUA 2X77A 3L7OA 4FFNA 1FJGB 1AQ6A 4CF3A 3FI0A 1ZS9A 2P6MA 1ORHA 1RE0A 4KRXA 4H6WA 3V7JA 1Z62A 4K6OA 3QSGA 2FP4A 5C7YA 1XTRA 2E1RA 4BEWA 1GTL1 3SS9X 4MYRA 3S5UA 2PMBA 3FPCA 2GTHA 4S0ZA 3I1JA 2GXQA 3HB9A 4G8JA 2H11A 3LY9A 1M67A 4RPYA 1UCFA 1TCBA 2DY0A 1FP2A 2WTAA 2Y93A 5TPWA 1XNSA 1WCWA 4B6OA 1SMKA 3FRHA 2OWDA 2FK7A 2HVIA 3NEAA 3RTAA 1RAEA 1UK9A 1S3FA 5KBYA 1SXJA 4RK5A 5JNVA 3SKYA 5JU5A 3D3NA 5IAJA 3W8EA 4WNAB 3CVYA 5JZMA 3V33A 1R0XA 3BMOA 3RQSA 3QOWA 3GEGA 2QENA 2B34A 3SF0A 3OSUA 3HZZA 1EFRD 4B40A 5ILOA 2YJZA 4HQFA 2IMWP 1IQUA 3I52A 1UBEA 4NYJQ 5H4HA 3PUYA 3RH0A 4WK0B 4LHSA 2WA2A 3EVTA 4FYVA 4R2XA 4LHZA 1HYBA 2OC9A 4F86A 2RH4A 3ONEA 1M7HA 4P4PA 3EWNA 2DSTA 2HHLA 4J7XA 3HK2A 3QEOA 3GL9A 4ZOHC 3RRGA 5ESXA 2FG7C 2ZRMA 5D46A 3RU2A 1UQTA 2BFMA 1CS4C 1V1RA 3DDOA 1UJBA 3SEQA 4EGSA 2HLNA 1Y3FE 2O6HA 1U0FA 3N6VA 1TEHA 3ZDDA 5J4LA 3RAGA 2KBEA 2QBYA 3B9QA 1PBNA 2ZBQA 5BT9A 5DBBA 4MZXA 3AOEC 4DWWA 1S76D 2ACKA 3LKVA 5I8WA 3KYJB 2R8EA 2AQKA 4RS4A 1RHQA 5B3AA 5AM5A 1WMBA 3FPBA 4CM1A 2CB9A 1Q84A 4FDAA 4PSVA 3TDKA 4O4IB 4BQSA 2QQ5A 2V0CA 3N0VA 3KE8A 3KTAA 5K3BA 4K1XA 3RC9A 1RHKA 1ZQ1A 2OPHA 2JAHA 4LXHA 5KL8B 3STYA 3VSBA 4JUZA 2W5UA 3IEPA 4YIHA 4CM9A 2K87A 4KWTA 1RC0A 2GEBA 3B6KA 3MD9A 3RYHB 2OXCA 3I61A 4FUQA 2AR9A 2V4UA 3TZEA 1CJMA 2QKQA 3NWBA 1QSGA 2HFKA 1F4VA 1X13A 2DWQA 4X84A 2AXNA 2QPLA 3BFJA 4K6CA 4DWJA 4NXMB 4FDTA 2VJYA 3WA7A 3HSSA 2KIVA 3FFBA 2LYAA 3PR1A 3KVRA 4G9EA 3RWBA 3EF0A 1RYRA 1P3DA 3NATA 4ZIRA 3HZOA 2HK7A 4K1LA 3NHUA 3WL5A 2Q8PA 4O6VA 2XOXA 4QG7A 1KJYA 3C3MA 2IS6A 1DWOA 1M2OB 4P93A 4KREA 1PDOA 1D8LA 5AHWA 1NY6A 3NGDA 4C5AA 2UUAB 4ECEA 1HSZA 3H0MB 1X7ZA 2RHWA 3UKJA 2H54A 3W2TA 3R0IA 4NECA 2NTYC 4EATA 3VMMA 2J87A 1LNZA 1VHQA 1ZMBA 3RIEA 3MTJA 4DMGA 2AC7A 4C0BA 2Y1XA 4YMTA 3STXA 1US8B 4QEDA 1EVIA 3GGDA 3GLGA 4W5RA 1KOGA 4YN4A 3TZ6A 3ZIUA 2GCIA 1P17A 3KPYA 3AV0B 5BSHA 4ZVQA 2IYVA 1HLDA 4ZYYA 3EMVA 2AJBA 3IQHX 4TMYA 2A7XA 4KKXB 1H9CA 2NXJA 4LGVA 5BW4A 4F3RA 2GERA 5ALQA 5SYMA 3VAYA 3PO5A 4GPTA 3DV0A 3AP1A 2H2HA 1E77A 1TAHA 3RT1A 4AY4A 2R9VA 4CL8A 5BXQC 2XGGA 2RKWA 1PK9A 1QHFA 5DGAA 4D9GA 1WY5A 5JS2A 4XQCA 1RG6A 5HM6A 4DEXA 2J0UA 5AHXA 2EU8A 2B7LA 2PVSA 3OOYA 1OXXK 1GGFA 4O3OA 2OYCA 3IQIX 3SZUA 4L4SA 3H7IA 3QELB 2QSYA 3T7TA 3P0JA 5DLYA 1KQGA 2A4KA 1UBOS 1CJUC 2OCAA 4N65A 1YOVB 2BDEA 2OBYA 5TMPA 5JNLA 3TINA 4WY8A 1RVDA 1YA8A 3VHXB 4EDFA 1KS2A 4E12A 5FPKA 1KC3A 4QGBA 4S2EA 1JHAA 3R4CA 2BGMA 1RZVA 1IHYA 2H1WA 1AGNA 3VYSB 1OZGA 2EX1A 4Y2GA 5EN4A 5AKYA 1BMFD 2XLCA 4OBXA 1UOPA 3PKJA 3R6DA 4J0IA 3CNEA 5IBRA 4D41A 1YRHA 3KHKA 4HWPA 4BNMA 3KB2A 4BX0A 1SCDA 3LPLA 1IZYA 2C88A 2WOOA 4IR9A 1W2HA 3Q0IA 3ACDA 2AJDA 3S2EA 4KG7A 3SAJA 5C52B 3L7NA 1J56A 3K1TA 4QODA 4QU8A 2Z8ZA 1TT5B 2X9GA 3PX7A 3IO5A 4C3OB 2ZIEA 1Y4AE 4F5RA 3OMLA 3NKLA 3VPDA 1DFHA 5KVQA 4QTTB 3U4IA 3MB5A 5DHPA 5U4QA 1Z9BA 2JGIA 1LU9A 4BLSA 5JW6A 3E1KA 4C0AC 1ACLA 1PIWA 2ODAA 3LD9A 2XZPA 4ZVPA 2BR0A 1M8GA 1KNXA 3FMFA 1XLVA 2QM0A 2J6UA 2X9VA 1KBQA 5EJAA 4P86A 5E6UA 1PJLA 3H11A 2HJ9A 3NOQA 4IJ6A 1E4OA 1HTBA 1BCRB 1O54A 1LPPA 3FI9A 3CB2A 3EGVA 1GUAA 1JB9A 3F5EA 1S5PA 1E2GA 3EPRA 4MVJP 5F9LA 5LDDC 3MWFA 3ZKAA 3UHAA 1FX0A 1LX7A 2FR1A 2WTNA 4LYEA 5HNKA 4UASA 1XDZA 2O7SA 2V9CA 2GAAA 4A1OA 1A77A 3OO1A 2PRJA 3S5JA 4XRGA 1JS1X 5ECWA 2C20A 3ZG6A 3VJLA 4LRSB 4BNFA 1BHQ1 2J46A 1ZN7A 3AEZA 1KARA 3KC2A 4J0DA 3IPRA 4FP9A 4Y2PA 5AW9A 1SUWA 5KNLA 4K9RA 3LT5A 3WY9A 3GWGA 1VLZA 2ZRFA 1DKMA 4H7FA 4P22A 1GP2A 1R6DA 4QUGA 1ZJWA 4RY9A 5IM4A 5EQDA 2GB4A 2M9NA 2F4VB 4LHVA 4QYTA 2H4HA 5TEWA 2JIOA 3KVOA 5H82A 4OQXA 2XIQA 4L6IA 5B6IA 1BS9A 2YHIB 1AB6A 3A3PA 1ZQBA 1NK4A 1VG9B 3FBGA 2O1EA 3ESYA 5FD8A 1P45A 5EPOA 4DYVA 3N8NA 2COUA 1JLMA 5EJ4A 4HAIA 4L02A 3LCCA 4LYYA 4LAFA 3SBOA 4K8OA 3OUTA 4Q9NA 2I29A 5U1PA 2QWXA 2X1MA 3IMEA 4DSAA 2AF4C 2WSLA 2CNOA 5DN6A 1PUIA 1RFLA 2QMUA 3O4JA 3SLGA 1PF7E 3K72B 2I1QA 1W47A 1Z2EA 4CG3A 3N0TA 4RH0A 1NY5A 2CFSA 3B1ZA 3UHFA 3VU1A 5LXTA 3RJ5A 3AJ8A 5L51A 3WS7A 2AHOA 3ZJYA 4OF4A 2P75A 1LLQA 3C21A 3B9PA 5CLJA 1PNVA 2NPIA 4UVIA 3I3OA 1EWQA 1TIBA 4OD0A 5FV4A 3ZHRA 3JXEA 2L19A 3BILA 1E20A 5CLHA 3DPIA 4TT3D 4X20A 3RVSA 3BZWA 4KOEC 1JBKA 3V1MA 4A6DA 3GZ4A 1KZ6A 4OYHA 3ZDEA 5MGBA 3CUKA 3U17A 4NE2A 3H4DA 4Q16A 4AZSA 5DASA 3GRAA 4U2EA 5DCWA 1J1ZA 3ND9A 4R01A 2ATXA 4BNXA 1N6PA 1V8DA 1V6AA 1J24A 3H5RA 1NMZA 2K8AA 8ICKA 1OFVA 4HLUA 2C4VA 4O3MA 1CU1A 1NQXA 1HUZA 1GG9A 3I5AA 1VHDA 4EJSC 5LLTA 1U4OA 4AP5A 1N2XA 3H6GA 2PPVA 4L5JA 4DQXA 5J1SB 4D7AA 5BPHA 1U7HA 2O54A 4F3NA 3UMMA 1Q7EA 4OHFA 4LF6B 2VF8A 2YCLA 4BFZA 1JAXA 1NVTA 2ZPAA 3KHLA 5E3IA 1TC1A 3O38A 2LXNA 1I2CA 4MEXA 3DJYA 3GQVA 3J7TA 4Q9HA 1B8UA 2RDIA 4WBNB 5AVOA 4B81A 2CF5A 1GCAA 1ZOPA 4K9MA 5B1YA 3UFBA 4REQB 2O3TA 2JS7A 5CXUA 1WZIA 2H51A 2ZCUA 2GEFA 1WXXA 1HJPA 1N5OX 1VCOA 3O0FA 1PTJA 2LPMA 4BVJA 4YWJA 3GUZA 1NBIA 1KFTA 2W2KB 2ECFA 4HP8A 3U16A 2X4GA 3OBIA 3B3GA 1WU8A 2H9YA 9ICOA 2P66A 3F9IA 1XZDA 2JR5A 5E1DA 4CJXA 2JI9A 1PO7A 4GLOA 1T1SA 1D7OA 1WB9A 4P9NA 2OP0A 4L22A 1K7SN 3IB6A 2R5WA 1PGNA 1P2DA 3UG7A 2I8LA 3EN0A 5EZQA 5A1TA 3V46A 4NAVA 2EZTA 4D0RA 3RRJA 3GEEA 3VKWA 4IGEA 1IUNA 4DJFC 1PJ8A 4G5QA 4UEQA 3MAAC 2J41A 1X38A 3MK31 3PDCA 3U4CA 4EVSA 4WN9A 5FOVA 4WKCA 4GR4A 4ME6A 4G1UC 4P7BA 3A10A 2JI7A 3DWIA 1SQGA 5FEUA 2VJAA 3TADC 2COKA 3VXKA 1Q7TA 4FJ1A 3T7KA 1V25A 1CERA 5DULA 3MHTA 3OJWA 3T3EA 2FJPA 2WJWA 1FXSA 3S2YA 3E6AA 4FDMA 3A6JA 2V6JA 3FNRA 1A5SB 3UMVA 3B1JA 5B1EA 2Z6AA 1FFYA 4CMBA 4AG5A 1K88A 4H6VA 1N6HA 4WXMA 2XYHA 2W8BB 4CV2A 4LJ6A 3VR6H 3ZWQA 2QQEA 4DY4A 2QE7D 4BV3A 5EKUA 1YF3A 3IR5A 1II8A 2H2WA 1DIOB 3I2IA 4DJDC 2B4QA 3NV9A 1T5IA 5J0XA 2BBWA 5D49A 3UBTA 4TYNA 4EUEA 2IS2A 3DZGA 4Z7QB 1NQAO 4XUSA 3LFHA 4FHEA 9ICQA 3NNNA 3KJQA 3ZJ4A 2M6RA 1IBLB 5J0QA 3LYSA 5GVSA 1THGA 3OY7A 2B4AA 5EHGA 1GNRA 4D8XA 1P33A 1AQYA 4H7JA 5H83A 2ZXFA 3VX4A 2AFIE 3GAFA 1OWNA 4YVZA 4MV5A 4ZT7A 4YCBA 5INTA 2QX9A 1T8WA 3PEVA 1NXSA 3P4XA 2WJZB 2EW2A 4XCQA 5F1PA 1YVRA 2I2AA 4E3ZA 3V55A 4MW0A 1GQQA 4J9OA 3EA0A 3SLRA 1NYQA 4QNNA 4GNRA 4TKVB 5J2FA 1WSAA 1Z26A 5IAOA 3L7DA 2ODBA 3I8SA 1HL3A 1Y6QA 2FN4A 2Z4SA 1A97A 3AF2A 3C5WP 3SVTA 1KEVA 1JU3A 3Q8XB 3AVUA 2X5OA 2BF7A 1W35A 1Y6RA 2EBUA 1UJ4A 1M8KA 2GAOA 4BZXA 2BEUA 4QDKA 2ERYA 4R31A 2PX4A 1AQIA 4N7MA 4C7VA 3BMCB 4XQGA 2HHXA 3EH2A 3H6KA 1WHSA 4I8IA 4NCIA 2NSDA 2CJWA 1YRAA 3FWPA 5JMOA 2FXIA 4D4IA 2X58A 5LSAA 3TGLA 2DQYA 2WWHA 3VZBA 2Y68A 4R1NA 4Z1MA 2I4LA 3GGSA 5AD1A 4NV0A 3GDFA 4BNDA 1XHEA 3ZPXA 3H2SA 3PIIA 4MGEA 1NU8A 3T52A 4W9RA 1WXEA 4ENPA 1G291 3GCXA 3QFCA 4BWVA 3W2EA 1CUWA 1L5VA 5JVDB 3CT4A 2V45A 4HUQB 5IVDA 3V2GA 3BPSA 1XR3A 4PZNA 3FZYA 4XX1A 2PXAA 1QMPA 4LDRA 3ZBPA 1MRZA 1I80A 4B9TA 5AW1A 5CA1F 1IAQA 4U4AA 2GJAA 3I9NA 3KDAA 1Z33A 2FZCA 5JSFA 3E84A 3LP6A 3IPYA 2ORWA 3I9KA 3QYPA 3DBHB 1PWHA 1DEXA 4IRDA 3S99A 1KJQA 3VR4D 4JBXA 3IVAA 2E49A 4G0ZA 3MGHA 1DBPA 4N3AA 1REQB 3G5AA 4DBVO 2QUJA 5C8YB 4RXMA 3U4HA 1Z2CA 2ZRNA 4NU0A 4RMHA 2C5FA 3S3TA 2XH8A 2N46A 1SV0C 3V1LA 3A2KA 4JN6B 1BE8A 4IS2A 5KCZA 1QYVA 3CE9A 2VK2A 3NJ4A 3LWLA 3TX2A 1HC7A 3BSWA 4BX8A 1RLIA 1KZ1A 2ZTCA 3URMA 3BCHA 1FUKA 3QXSA 4HTAA 4X1YB 2HO5A 2BFDB 1CLEA 3UB2A 1NVAA 4WOPA 2GCGA 4MCAA 3RARA 5FDFA 4WAUA 4J1TA 1D0IA 3VH2A 2J3LA 1TKBA 3OHSX 2W4QA 3CO0S 3LUBA 5FJJA 1DO0A 1FUYB 4BPBA 4ENVA 3ZQKA 3MTGA 4MV7A 4YJ3A 4YP6A 2OXOA 3IBSA 4DIMA 2BAGA 4A2PA 1GQFA 3PC3A 2GBCA 4J16A 4QUBA 1VL0A 3OOEA 1E9AA 1YOBA 9ICEA 3CMMA 1PT7A 4DBLC 1I0LA 2NU9B 4FB4A 4DLLA 4GEKA 4LVUA 3IUSA 3AKDA 1YKSA 2DQ4A 4DQRA 3Q11A 5E6RA 3PZPA 3AWDA 3UYLA 1XD9A 3ABZA 4AS1A 4J6EA 2A88A 2R1TA 3L07A 4HNAA 4KHZA 4M38A 2B3TA 1T1JA 3ZHYA 2V0GA 1OYWA 3CYFA 3M6ZA 3F6RA 2V55B 1MC1A 4HX9A 3GH1A 3TIFA 3C6XA 3EDOA 4RD2A 2C9CA 3OMWA 3CRXA 3WB1A 2FMUA 1TZJA 3PE6A 2ADMA 3HVJA 1NXXA 4J9KA 4Z6FA 2ZXEA 1OWOA 3BGOS 2YYZA 4INOA 3UXMA 5IU6A 4MIKA 3VNUA 1GNVA 1M8JA 1RWQA 3C4QA 3OPXA 4KLZA 4AJPA 4H3KB 1YA4A 4UB6U 1JQEA 1UK8A 1ZQJA 1Z4MA 4MUMA 2KSQA 1SD1A 1JL3A 3TN7A 1WR8A 2OV4A 2R7AA 2ODPA 1C3EA 2WWXA 3L8GA 4X6YA 4RDCA 4DV1B 3RSSA 1DPGA 2O20A 5LP6F 2ADFA 4U7GA 2UYGA 3CW2A 4LXTA 4KPUB 4JI2B 3QPCA 2ZI3A 2SKEA 5IN5A 4R2KA 1CUCA 4TPKA 5KX5F 3E70C 1LA2A 3OO0A 3L1VA 2DHQA 3LL7A 3ISJA 3KJIA 1Y34E 4IUBS 4UVHA 2Q29A 4NXZA 4MKZA 1QZUA 4G0OA 3V4VB 1KQOA 3GIDA 3PHLA 2A1TR 3FMGA 2Z43A 4MEBA 1U5CA 2R6ZA 5JEEA 3ANNA 1XZ8A 4TRJA 2LM4A 4JKYA 3HGTA 1SXJE 4IQTA 3BWEA 7ICUA 5EZYB 1E3QA 2PZMA 4B9EA 2EJWA 4IDNA 3UMBA 2CMHA 2O1XA 1KZ9A 4FS8A 4OQLA 1EK5A 4RUAA 1POWA 4JU8A 1I2DA 4Q45A 3MLBA 3W3AH 5GOZA 1QIGA 2Q3LA 1DELA 4Y1FA 5JYDA 4OJKA 2IEZA 2LI6A 3PFNA 3DC2A 1IUPA 2CWWA 3DF9A 5HS4A 1V96A 1AK1A 1RCUA 2RAUA 4RQ0A 3PY8A 2QW8A 2Y9PB 1QIMA 3E3NA 2VXOA 4HEQA 5F12A 3JQGA 3R5JA 3MWGA 1QU3A 3LDGA 1SZPA 4A6PA 3EGXA 5J2UF 5D87A 2FHPA 5HKKD 5KI6A 4OGFA 3X1WA 3N2ZB 4C3ZA 4C7BA 1IN1A 3ZY4A 4ZVKA 1UP6A 2W6ZA 3H9CA 3H9QA 1NVWQ 2OTCA 3IQWA 4LWPA 1MQSA 2H1OA 4KMOB 4M9XA 4E08A 3HJBA 3SM9A 3HBLA 4JI7B 4L2IB 3BXXA 5JFTA 3ZNNA 1DOQA 5C8XA 1NJ1A 1NVDA 1SUFA 1E1LA 5LR6A 5K3EA 5HCIA 4JELA 2IS1A 1YRQA 4Z6KA 4DSIA 4OV6B 4GKJB 5BYBA 2FZ4A 2Q5IA 1KEEB 4R1LA 1LF5A 3UK6A 3QYJA 4E5YA 3EHDA 2GO1A 3PWSA 3UA3A 4MYCA 2ZWOA 5JMTA 3E27A 5BMVB 4QU9A 1WNFA 3E9CA 2W3SA 1R8XA 4MRMB 4YUAA 2I8CA 3BIOA 1QRTA 5KTSA 2BKEA 5F21A 4IIEA 5CA7A 1YL6A 3ELWA 5KYXB 2RGEA 4UHFA 4BBZA 4C80A 5CEJA 4C4ZA 1NW8A 1MW8X 3VYTB 1DTWB 3JD0A 1NZPA 1NF8A 3AVQA 1Y7IA 2I5HA 4AZ3A 1KHHA 4RTSA 5EWEA 1FLNA 1VECA 4IKOA 1OFGA 4HGQA 1KBOA 1HQKA 1HI9A 3WO0A 2YWDA 4IRCA 2XKAA 2H4WA 1ZD2P 3WGQA 2WFLA 3RB4A 1MH9A 4Z49A 1UQRA 4S12A 4IEEA 2IHTA 2DBVO 3VC3A 1JKJB 2CRXA 2XVYA 3HCBA 1SBIA 4DV6B 2VK8A 3KOMA 3KOOA 4O2AB 2LM1A 1N5IA 5A0FA 4EY3A 3NNSA 4UD6A 1BVRA 4UQGA 2Z3ZA 4CF6A 3H1AA 2OCPA 3HDYA 4XIYA 2VYNA 3A28A 3IDQA 3BS7A 1ARZA 3FNGA 3W7BA 3VISA 3PFIA 1X1AA 3GLGE 1RZUA 4Q4HB 1ZH0A 1VBNA 3VZSA 3DVAB 4E03A 4CEHB 1GDTA 4AS3A 1CTQA 3AXSA 4HEJA 4C1NA 3COJA 1KK0A 2HV8A 221PA 1N75A 1ZK3A 4MS1B 1VE6A 3R7NA 2PE5A 2HBLA 3G0BA 5HGXA 2IU0A 4DO9A 4FFRA 1UDXA 2AYYA 1VXOA 3TI9A 1K4KA 3AIIA 1RW4A 4CKBA 3O1HB 1F8FA 3WHIA 3RYFB 3QWFA 3ZEIA 3SX0A 4FGLA 3S2UA 3U60B 2A94A 5AVRA 8ICMA 2K4PA 4UUBA 1VE9A 1NVKA 4FMPA 5L1IA 5KWIA 4P3YA 2ZJ4A 1NJSA 2X3FA 1C7YA 1DAIA 1JGTA 2CVPA 5KSWB 3JQRA 1FCJA 3OOJA 4IVPA 3CO5A 1ED1A 3AKZA 4UMVA 1UBRS 2VT3A 5JO0A 3B0YA 1XV5A 4QWBA 1N7HA 5ESDA 3N2EA 2D1YA 3RJZA 4R1PA 1X0XA 4O29A 2C61A 5A9SB 1NNI1 5J5AA 5CVCA 2P7IA 1BFKA 5BQFA 4G5HA 3NWOA 3KZNA 4X54A 3HCWA 3BD6A 4P38A 1H4VB 4HVLA 3F5DA 2BM8A 4EKNB 4EPXA 1M2KA 2VF4X 3NYQA 1R4AA 6ABPA 4A36A 9ICPA 4D02A 1C29B 1Q6ZA 2I9GA 1C4WA 3ZLVA 3WMEA 3AG6A 4RJTA 2QUKA 3NHPA 5K6AC 4BGUA 1TAQA 2FRDA 4KMSA 4TTRA 4RSRA 4BECA 1UKCA 2QGZA 1DRWA 2HXYA 3KQPA 1EFAA 7YASA 3HYLA 1A4IA 3R7AA 4B7XA 1JU4A 3VCBA 1M54A 2NGRA 2CE2X 4OLBA 2NYAA 1ONSA 4FS3A 4FBTA 4UB1A 3USCS 1TK9A 3TZQA 2PTGA 4FOPA 4ITVA 4BDSA 4EG8A 4MMZB 3E0FA 1CUYA 2Q4OA 4ND4A 1I2AA 2LRHA 4R81A 4U9HS 3T3HA 1S77D 1RBZA 2E8PA 4DDWA 2C5GA 5JAZA 1QHNA 3RWOA 3TZCA 5CU7A 3AERA 2C4TA 2J6CA 2BCGY 3SU8A 2Q6VA 5HF6A 3VHLB 4H1VA 4BJ3A 2JFFA 3SS8A 2P1ZA 4FBMA 2YV1A 2KHZA 1J33A 3BBLA 5FX2A 2C0CA 3FYUA 4IL5A 1X7YA 1E1RA 8ICNA 2KP7A 1M0EA 5FPHA 1JHRA 1L1EA 1VJ5A 2F17A 3LKZA 2CSXA 1E7QA 4BJQA 1J22A 2F3QA 5JSUA 2OE2A 4A6XA 2EV9A 3ZY3A 2OOSA 2CB0A 4OX9B 3M3DA 1U5BA 1DIRA 3OPYA 1RBYA 2WUVA 3W1WA 3H1FA 4GUAA 4RVGA 3PI6A 4ASUA 4EJ0A 1A72A 4IFIA 4PO1A 2HQSA 4J1NA 4N3GA 3FJYA 2GYUA 3SJAA 1B8PA 1E69A 3TFRA 3O21A 2PZ8A 3SM3A 3CH7A 3LT2A 4F5ZA 4D43A 2QARA 3SLKA 4O3PA 3V5NA 5IINA 2AF3C 3C97A 1EGAA 3BRQA 1F3LA 5KQGA 1S02A 1A8IA 3WK9A 3DMHA 1J0BA 5LNK6 3K3PA 4O4IF 3UMGA 4A0HA 5LLSA 4IIBA 1ISIA 5TPZA 3GLKA 3L7BA 3DDHA 1HE5A 2MYNA 3OFSA 4E21A 2CSUA 1K1SA 3N8KA 4B7AA 4BLPA 5L3SB 2Y0SF 4LZLA 1BC5A 2W54A 4KPYA 4XM2A 3O9MA 2YL2A 4R4JA 2SKCA 4MR7A 5HRUA 4DC9A 5LD2C 1DKUA 2DPIA 4FQ8A 2B36A 5HGJA 1JG3A 1LDMA 1ULHA 3I2KA 3TPZA 3EPKA 4L5YA 3C3DA 4JZYA 1VE5A 3LOUA 4ZDIA 3COSA 3WGNA 4MZDA 2Q7DA 3ZCUA 2DCUA 1C0KA 3M6AA 5FA5A 3SBDA 1KYQA 5JCPA 2FLNA 5FTWA 3W3AA 3O0TA 1Y9ZA 4PGAA 3VC7A 2R5FA 3AMVA 2NZUG 3PC6A 1T4MA 3CWQA 4IIGA 3C3YA 4MKFA 3DD5A 1T0BA 5ALTA 2I7XA 1TVKB 3IPCA 1AKWA 5CEFA 1Z29A 2QRPA 3SHFA 1KQ3A 4AMUA 2NRVA 3QRWA 3NDIA 3CX6A 3BFXA 4DLNA 2ZYWX 1J97A 3F5MA 2RG1A 3G17A 5AM0A 5F2KA 1H2AS 1V0JA 2HCFA 5KFKA 3JYPA 2XB4A 3WOVA 1WIWA 3C6MA 3OPNA 5IG2A 2A0FA 2RGAA 4DCVA 2VA9A 3RJGA 1O96B 1RXCA 5A9TA 4CGYA 1IJKA 4LPKA 1A95A 1WVMA 4MWOA 2SICE 3PRJA 1W85A 4YK7A 4NJMB 4ND5A 621PA 4AYBF 1T7PA 2Q62A 3NP7A 4HF7A 4R3NA 3AHHA 4Q19A 5CFRA 2PMDA 3MZ0A 4B2PA 4JJ8A 4WEQA 3AEKB 7ICHA 5KQPA 1CS0A 1G8KA 3ORQA 1RHRA 1E5LA 1LZKA 4WCFA 2Z83A 1XZFA 2P65A 3GUHA 2XVZA 1WETA 5AJWA 2X8WA 1V7ZA 2O8VA 1T36B 5JUWA 1SWWA 4EJFA 3G2KA 5E7MA 3G0IA 1DWPA 4Q18A 1KJIA 4WK6A 4UTOA 2DPGA 4PPYA 4YPVA 2VYCA 4Z9BA 1GJRA 3Q0TA 4FZRA 1ZICA 3L5KA 1QO7A 2VXYA 5KOHB 1IG0A 5DE3A 4XOIA 4O5OA 3K2BA 3AR7A 3DAPA 4N9QA 4L95C 3PV0A 4U0KA 1I4WA 2I1WA 5HTOA 5FUBA 1W88A 4CM6A 4Q4CA 1RADA 2ZIUA 4LSZA 2I3AA 1MOZA 4IGIA 5A3JA 1KRHA 2NXEA 3TOSA 4PINA 3UGQA 3TKYA 4JP8A 4A8TA 3WZLA 1ZQYA 3K6RA 3GELA 3I2FA 1JR3A 3FPGA 2Z95A 1P5JA 2AOUB 3QVJA 3QNWA 2Z30A 1BX3A 3QE2A 3T5GA 5JY6A 4WZBA 2QUAA 3B89A 3G5UA 1Y7LA 2PMZC 3O4RA 2WJPA 4NU6A 4UFPA 1E6CA 1MR3F 5LMUB 1CR0A 5DQHA 5FNVB 3ZUPA 5KC9A 1ZM4A 3DZ8A 5K8TA 1P1FA 3CVJA 2NZJA 2GASA 3JPSA 5SZKB 1KA9H 1WTCA 4TS1A 4E2WA 2JCBA 3K9WA 1T2VA 5GM1A 3KYCB 4G63A 1PX2A 3AY0A 4OM8A 1J0EA 4BN4A 3ED5A 3BXGA 4G1CA 1EP2B 5FNZA 5KFFA 2AU0A 2D5CA 3LMKA 4Q7JB 4W1QA 4PZ9A 5I4BA 3UCFA 2YJ5A 3O90A 5CHGA 4B4DA 2Q5OA 4DQ0A 4Y6LA 3CSDA 3LX6A 3AN1A 1N5WA 3GMTA 1C4XA 8AT1A 3ILVA 1YI1A 1FE8A 1EVYA 3ZGYA 1EGHA 4OO3A 4KL8S 3LZCA 2X5KO 2NZVG 2PKEA 2EKLA 3R24A 3DEJA 1P9NA 1S0UA 2NSHA 4FOTA 3HCDA 1N1DA 2FOXA 2QZ4A 3ZWYA 3GN2A 3LY7A 4JC8A 1WUHS 3USZA 1XWLA 3PEFA 4X71A 2FV8A 4IZHA 2QRGA 5CG1A 4D6XA 3BMNA 2O8FA 1Z2NX 5IDQA 2W70A 1T6BY 4CMKA 3R6LA 2DPMA 2WB1F 2WK1A 2IT1A 3RFXA 4DUGD 2OECA 4JA0A 3CONA 3IG5A 4HGZA 4KFCA 4PRYA 4DIEA 1DGJA 2DKZA 2RONA 4LJ9A 2MA1A 3D2NA 1LY1A 1Z83A 4JOBA 1YJ8A 4AF7A 4XGQA 1WABA 4DIKA 3CF0A 2E3JA 4PH5A 3SSOA 2FW7A 3JY6A 2IY8A 1ZDMA 2ORIA 2G5TA 1L4YA 3WL7A 1PWZA 2BCSA 3B13B 4Q9DA 2ZJ1A 1XKQA 2COEA 2WAQF 3NWJA 1K68A 1YTLA 4FD3A 4UULA 2FPRA 1RLMA 4CPDA 3IAS6 4B3JA 2FFHA 1E5DA 1XCBA 1RYYA 2O4UX 5EFOA 3RG2A 2GHIA 4OXKA 2X1LA 2FFJA 5JS1A 3CBGA 5E1OA 4F9TA 4CM7A 1JEYB 2PLAA 3WNQA 4J7UA 4UEOA 4RQ7A 1E5XA 4EFKA 5AQEA 3W5AA 3HCFA 4BFLA 3GV8B 4CUJA 4M04A 5SY9A 4ZV4A 2NYUA 2XVTA 4TLAA 3Q7QA 3EISA 3PLAE 2RGYA 3NOVA 3I58A 4CRXA 4IDGA 1WEHA 2GK3A 1HMYA 1MPTA 2FUG6 4AT1A 4H7IA 4BO8A 1UPHA 3HL4A 4RHCA 1RYNA 2IZ0A 4I6JA 2ISQA 1YD7A 1GUBA 4IXWA 3PPYA 1GFSA 2A1JA 3KHTA 5C32A 1JLLB 4PW0A 3HJUA 3A1DA 3W34A 3OQ1A 1T4CA 1O6BA 4TTTS 4RQTA 2AS0A 1N77A 4DCSA 1JEAA 4BZPA 2AR7A 3OVMA 3HU3A 4ECVA 4YRJA 3ANYB 2B4YA 1AQLA 4EHDA 4PN3A 4NEHB 5K8JB 2GPWA 1O6CA 2O7RA 1IEXA 4AECA 3W8DA 2FPWA 3V6LA 1Z7BA 3SC3A 4WLOA 3A0HU 2M6LA 4NBVA 1ISFA 1E3TA 4OH7A 4R63A 5DGCA 1ZIXA 5T64A 1LFAA 1NZDA 5T6MA 3F73A 4Y1EA 1WDLA 2JH1A 3S1LA 1N33B 4NL9A 2VSYA 4F9FA 1MQAA 4G84A 1CF2O 4KU4A 3IEIA 4CIVA 2QD1A 5EC8A 3Q10A 5EJ8A 4TZ6A 3C43A 1H5QA 4C0LA 5DGTA 3PXBA 1U7XA 3L8ZA 4F3TA 1CY1A 4DZTA 5BYAA 4EJ2A 2P62A 4MB2A 5DLPA 4HAZA 2PZGA 1C8VB 4EKDA 1SVMA 1QFXA 5LBIA 3I09A 1OVMA 3X44A 4KR3A 1QKIA 2W6PA 1ONNA 1YDHA 1ZI8A 2QMQA 3CN9A 5AVTA 1KI8A 2FAXA 3IQGX 4KBFA 3HKEA 3DOEA 3I1IA 4V39A 1AA9A 1RBQA 1BXKA 3F4BA 1U9IA 1DU4A 3RRYA 3QBDA 3KX2A 4NICA 1DK3A 5HWSA 1JDUA 3RS4A 1MKYA 2MRLA 1BEEA 2Z8YA 3FMOB 1YUBA 1P74A 3EG9B 4DILA 4GAEA 2Q46A 1NXQA 2AYZA 1OLUA 4OOEA 2FZ5A 5KVVA 4IICA 3UAZA 2IX9A 4IQ0A 3BMQB 2FN7A 1GLGA 1M2VB 1LF0A 4DVJA 4YLYA 3PX4A 5CX1B 5JXWA 1KI6B 5E6SA 2O0KA 2CLIB 3WV4A 1S01A 3QLUC 4J91A 4J07A 4S1VA 5AJTA 1ECFA 1U49A 2PWBA 3TS1A 2AMLA 3MUFA 5J2KA 1E3IA 3ZV4A 3B85A 1DDOA 1JB1A 5K3OA 1LTHR 2FSSA 3W9BA 1EJBA 2JFNA 3JD2A 1X80B 3F3SA 2HMTA 2YXNA 3RUDA 2DPYA 4W7SA 2NNWB 5I4KA 3VSEA 1S2MA 4B4UA 2AGQA 3OP4A 4DSOA 3GUYA 1DOZA 1GPNA 5JJ5A 1R6XA 3FD8A 2QLLA 2HM7A 2CLMB 4IDPA 3I6IA 3BHMA 4RPGA 4NH0A 4CMEC 3WBJA 1EIZA 4WY5A 2FSPA 3MRVA 1PEKE 3K9HA 4D46A 3TG8A 2KSOA 3GRCA 3MUEA 1MSWD 1G7TA 4N82A 1QFYA 4D4GA 1AKUA 3GCDA 2GYYA 5KNCH 4M87A 3UV6A 5E2IA 1ISGA 3R5SA 1DIGA 1NKCA 5CK4A 2DFVA 1BWPA 2P2SA 3AFIA 1NN5A 2FE4A 1GQSA 3CN7A 1T6XA 1CQXA 1L6RA 2B4RO 4HYQA 4EMBA 2WMYA 3GA5A 1DQRA 1DP4A 2HWXA 2FN3A 1UA0A 2JIQA 4MQEB 5AIAA 1U2DC 4DWIA 2YDXA 3UUEA 4DJJA 4TL6A 4WFIA 3RUCA 4ND6A 3GYBA 4WESA 3CUWA 1C30A 1WB6A 4OQ4A 1LPSA 1XTKA 4IR7A 5EZ5A 3PYXA 3TB4A 4RSHA 3UJ8A 5HEKA 3PEYA 2Z3WA 3I01M 3QITA 4MEAA 4EB8A 3ZCQA 2KHQA 5G1PA 4CFYA 5L8VA 3BIWA 4LXIA 4F85A 1ZNZA 3LUFA 4GBMA 4R2LA 4NVRA 3LLMA 1F48A 3D4OA 3ZYZA 5CM9C 3P9CA 1E3WA 3I3SR 5F7ZA 3VSCA 3O47A 4B44A 4EELA 3OCVA 4KYUA 3W9YA 1XPOA 1WULS 3S28A 2CC2A 3SC2B 1S5LU 2O1SA 3HLKA 4C05A 1NZJA 3OTWA 1P0IA 1RI1A 1UOOA 3DBRB 3W4KA 1T3TA 1AB5A 4ZEOA 4W7IA 3FN4A 4KQ2A 2R6CA 3EZXA 5CDFA 3RREA 3TJMA 2CXNA 4PLPA 4DLYA 3G2PA 3L9XA 3R5XA 1A96A 5GONB 2VSXA 2AZ4A 3O8QB 4DQVA 3QKRA 1WPXA 3LBNA 5CFLA 4IG4A 1DG3A 3CH5A 3NRJA 2Q3MA 1F2UB 4MVXA 3MCUA 4UBIA 2D5AA 3P94A 1BOFA 5C8YF 2FY8A 4FHDA 3B5EA 5C3MA 2CF6A 4M60A 4GRAA 4IIJF 4K28A 3TKLA 4LCJA 7ICJA 2REOA 2IXEA 4LNUA 2XUJA 4IS3A 3PXAA 2F00A 3QUAA 1WB5A 4MIYA 3QK7A 4QO8A 1WBBA 3OE5A 3RS9A 4RM2A 3VH1A 1QWOA 5E9AA 1CEXA 3WL4A 4IILA 4MV9A 3FKQA 1M74A 4JC4A 2UVWA 4EBFA 3EZNA 1E7YA 4NARA 5KFMA 5JHHB 4RW0A 4KAFA 4QFMA 1JIUA 3K75D 3MFIA 5H8WA 4A26A 1WE2A 3H05A 2KK0A 3FPJA 3BK2A 1MEOA 4RTKA 1Z82A 3WQQA 1VI5A 3WLNA 4JC5A 3ZE9A 1ZYUA 5I8ZA 4M8SA 3PG5A 4BU0A 4JT8A 1I2BA 3FZNA 3DMGA 5DTMA 1MGPA 2ODGA 1V16B 1TJPB 2PZAA 2GXAA 1EFPB 5HHIA 1P72A 2ZB7A 4LXXA 3PMNA 2HMYB 3K96A 1KL9A 3JALB 4LE0A 4LE1A 1E1QD 4CM3A 2VKTA 1ORDA 1ORWA 1FA9A 3ZUGA 3OD1A 2Q0XA 4QRHA 3QV2A 4PLZA 5DQGA 4QUJA 2I76A 4BVGA 2PJRA 5J63A 3BD9A 2R79A 2NO1A 5JY1A 1O08A 4C6SA 2FKNA 4JR2A 5SZJA 1RWXA 3UJ9A 4MI9A 2W55A 5LZ7A 3TTWA 3IVGA 3HA5A 3Q88A 2QN9A 3N75A 3RC8A 1Y1PA 3W5SA 1FMFA 1K8QA 1ZIPA 2IK8A 4I08A 1MB9A 4C4SA 3IIMA 4URUR 4E4YA 5BUZA 4FFDA 3T94A 3PWKA 4NJOA 1JR2A 1HX7A 1THTA 1V2GA 1DAEA 5IK2D 4ND1A 2Q3FA 1XQ6A 1KI2A 3KHHA 1CJBA 1BQEA 2FEPA 3ZD9A 1PNTA 1F2TB 3U7GA 5DYGA 1A9SA 4BTVA 4HH3C 3UATA 3K71B 2JJ2A 1X94A 5WRFA 2R44A 1OE0A 3Q8SB 3GIKA 4R98A 3DHVA 2JCYA 3TH5A 3O0DA 4DKXA 4HEHA 3TNJA 1VXRA 8ICLA 4QIHA 1DIAA 4MWCA 1TK5A 2ATLA 2P0YA 3KKOA 4HWGA 1U2PA