2OM6A

Hypothetical protein (probable phosphoserine phosph (ph0253) from pyrococcus horikoshii ot3
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
233
structure length
233
Chain Sequence
MREVKLVTFDVWNTLLDLNIMLDEFSHQLAKISGLHIKDVANAVIEVRNEIKKMRAQASEDPRKVLTGSQEALAGKLKVDVELVKRATARAILNVDESLVLEGTKEALQFVKERGLKTAVIGNVMFWPGSYTRLLLERFGLMEFIDKTFFADEVLSYKPRKEMFEKVLNSFEVKPEESLHIGDTYAEDYQGARKVGMWAVWINQEGDKVRKLEERGFEIPSIANLKDVIELIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hypothetical Protein (Probable Phosphoserine Phosph (PH0253) from Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
molecule keywords Probable phosphoserine phosphatase
total genus 83
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature ec 3.1.3.3: Phosphoserine phosphatase.
pdb deposition date 2007-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.400 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2om6A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2om6A01
3L8EA 4Y2RA 4YCNA 2WF6A 3NUQA 4AS2A 1QH9A 4JB3A 2Q5EA 3SHQA 1RPZA 2G80A 1L8LA 3U26A 3FPSA 2RB5A 1RMYA 2C4NA 2CFTA 1VJRA 3EF1A 4I9FA 4J03A 3NASA 1TJ3A 1YV9A 2FDRA 3I28A 5AKXA 3W5CA 1VJ5A 4Y2XA 4KX3A 5AIBA 2AMYA 2RBKA 4BX3A 5AESA 1WPGA 4FFDA 3WK7A 1U02A 5AW5A 2P69A 2YMPA 2C8KA 4NAVA 3KC2A 3OTQA 5ALKA 1RMQA 2PQ0A 1PW5A 3NIWA 2ZXEA 3TLMA 1YS9A 4CF4A 2G08A 1JUDA 2C88A 3KDPA 2W43A 5AKZA 2YJ3A 3NAMA 2EARA 2WF9A 1XPJA 2PR7A 2YN4A 3A1DA 4GIBA 3ZVNA 3MN1A 3PGLA 5A3SA 3AR4A 1RKQA 3FPBA 1RQLA 2BDEA 4CE6A 1FEZA 1NRWA 1EK2A 3PCTA 5AKEA 4F71A 3ZTYA 4EELA 3B9BA 2I33A 3M9LA 5AVYA 5ALZA 1Z4JA 2P27A 3UMCA 4Y2JA 5AI8A 4KX5A 5AW2A 1TJ5A 4BEVA 4DWOA 4CF3A 4YH1A 2G0AA 1ZRNA 2OA0A 2OM6A 3U19A 4PNHA 2FPUA 4BX2A 5AVSA 1O08A 3N5KA 1RRCA 1QYIA 3E58A 3R9KA 1VFPA 5T41A 4XE5A 4MWOA 3I1YA 2ODAA 1MH9A 5IT4A 2HHLA 1L7MA 2Q4TA 5ALXA 1RC8A 3EWIA 4QJBA 4Y2YA 2EATA 2YMMA 1T5SA 3EPRA 4OCZA 2HF2A 2IOFA 2JAWA 1Z4IA 1S8OA 1WZCA 2P9JA 4BKMA 4F72A 5AVTA 3NANA 4UM5A 2CFSA 4MUMA 4HGRA 5JJBA 2B8JA 1O03A 2HOQA 1ZD4A 4XQ0A 4DW8A 3MMZA 5AW7A 3QUBA 3ESRA 5FP0A 2WFAA 3ZVLA 1Z4MA 3L8GA 2AH5A 2R8EA 3L0YA 5AI9A 4H1WA 5ALDA 2FPSA 2OBBA 3QUCA 2BDUA 2YMQA 5AK5A 3ZWDA 5ALOA 3FVVA 3E84A 2YJ6A 5AVUA 1RQNA 4Y2QA 3KBBA 1YJ5A 3S6JA 3L5KA 3AR2A 4ZEVA 1ZJJA 2W4MA 3QU5A 3AR3A 3AR6A 3RFUA 4XOUA 1QQ5A 3B9RA 5ALIA 3ZX4A 3QXGA 1U2SA 2QYHA 4IG4A 1Z4QA 2O2XA 2FEAA 4UARA 3ESQA 4UMEA 2WHEA 1YDFA 3L0CA 2FUEA 4OD0A 2ZBFA 4XPZA 1N8NA 2ZBEA 1Z4KA 2HCFA 2WF8A 4NABA 3QU4A 2HX1A 2B0CA 5AKGA 3UMBA 3E81A 4RETA 1SWVA 1F5SA 2JGAA 5AICA 3SKYA 2FPWA 3PDWA 3D6JA 2JAUA 1U7OA 5AIAA 4UM7A 3NRJA 4KYTA 5AKLA 4HGNA 4UAVA 4C4TA 1LTQA 5ALLA 5AW0A 2C8LA 3W5DA 3ZVMA 5ALRA 5ALMA 3WGUA 2YJ4A 4AS3A 3NALA 1YNSA 4L6CA 1Z88A 2PKEA 5AVZA 2MSNA 2CFRA 3WKAA 5AM1A 5A3QA 2YY6A 3ONNA 2RARA 5IT0A 3DNPA 5AW1A 1TE2A 5AKIA 4GXTA 5AM0A 4OHFA 1ZD5A 4Y3UA 4Y2TA 3UM9A 3M1YA 4BYGA 2P11A 1Z5UA 2YJ5A 4ZEWA 3N28A 2W11A 4CF5A 3OCXA 4I9GA 2ZOSA 4YCLA 3W5BA 3P96A 1KYTA 1L7NA 2G09A 3IRUA 1ZRMA 3PGVA 1RKVA 5AI0A 2JARA 2GFHA 5AK6A 2I54A 2AUTA 3MC1A 2IA5A 3OCUA 3OCZA 4IFTA 3U7FB 4HGOA 4NV0A 3ET5A 1Z4LA 4C4SA 3WK8A 4UU0A 2FI1A 4QQFA 2X4DA 2B1QA 4HGQA 2B8EA 4JDPA 3QX7A 2HI0A 1RLOA 5AHXA 2DQSA 4NFLA 4C4RA 3U7HB 3W5AA 1CR6A 3FM9A 3MPOA 2NYVA 2D2VA 5ALEA 5IS2A 1TJ4A 5AW4A 3I6BA 3OCVA 3WKDA 2YBDA 5ALTA 2OYCA 3N1UA 5AM3A 2GHTA 1NNLA 2IYEA 5ALGA 4UMDA 4G9BA 3IB6A 3N8GA 3SMVA 3DDHA 2VKQA 2BY4A 1RMTA 4KN8A 4BBJA 3I76A 4Y2PA 3L8HA 1LVHA 3HLTA 5ALFA 3CNHA 5AKKA 1Q91A 1ZD3A 1Z4NA 1ZOLA 5ALHA 1XVIA 2EAUA 1Y8AA 2QLTA 5AVXA 5AK3A 2HF7A 2HDOA 3U13A 4HYTA 4UMFA 5AVWA 5A3RA 1Q92A 1TA0A 4L6AA 5AW8A 4ZEXA 3F9RA 4L57A 4YGYA 3ZTWA 2ZBDA 5AKJA 3N07A 4EENA 3ET4A 1SWWA 3FGOA 4KNVA 4UMVA 2I55A 3IJ5A 5AVRA 3J7TA 3SLRA 3QLEA 4NWIA 3L0BA 5AVQA 2HSZA 3WKBA 2HEGA 5AW3A 2YFYA 2GHQA 4BX0A 5ALSA 3SKXA 3QU7A 1L7OA 2HO4A 3U7GA 1T9ZA 2NO4A 4FE3A 5AKHA 1S2OA 4OFZA 3WKEA 3WK6A 5AI6A 4EZEA 1N9KA 4AP9A 4RESA 3OCWA 3AR7A 3QNMA 4BEWA 2R8YA 3BWVA 5ALYA 4CNQA 1AQ6A 2R8XA 1SU4A 2YMLA 3CZ4A 3L8FA 3QUTA 5AM5A 3R4CA 1YMQA 3SD7A 3ZUPA 2G1AA 3QUQA 4J2TA 2B82A 3QYPA 2CN1A 3AR8A 2I7DA 5ALPA 2G07A 1RLMA 5AI5A 3A1CA 1QQ7A 2GO7A 1K1EA 5ALQA 3E8MA 3QU2A 2IOHA 2JAOA 3WGVA 3WK5A 1RKUA 3ZX5A 2FUCA 2C9MA 3L1VA 3HYCA 1J8DA 4DCCA 1EK1A 5ALNA 1Z4OA 5AW9A 5AW6A 1RDFA 5AM2A 4FYPA 2NO5A 3ED5A 3B8EA 3ZW7A 3ZU6A 3WK4A 2B30A 3K1ZA 1T5TA 4YIHA 4BNDB 2FPXA 1J97A 1QQ6A 4YCMA 1IWOA 3GYGA 5AM4A 5ALUA 4EX7A 2RAVA 1Z5GA 3BA6A 3KZXA 3ZI4A 1L6RA 2ZG6A 3KOOA 1U7PA 1WR8A 5AK4A 4E88A 3DAOA 4HAIA 5AI4A 2WM8A 1U2TA 3U7EB 4Y2VA 4YIKA 3A3YA 3AR5A 3L1UA 2B1RA 2GMWA 3KD3A 2IOFK 1NF2A 1X42A 2R8ZA 3OPXA 3ZWKA 4UU1A 1WVIA 1Z4PX 1XP5A 4UAUA 4UATA 4BNDA 4DFDA 4EX6A 3R09A 2ZBGA 3L7YA 1L7PA 1CQZA 2O9JA 2FPRA 4EEKA 3WKCA 1ZD2P 3OCYA 2I6XA 3WK9A 3RF6A 4UASA 2WF5A 3AR9A 3UMGA 4Y2UA 4B6JA 3A1EA 4KNWA 1L8OA 3VAYA 5ALVA 4Y2SA 3DV9A 2MU1A 3EF0A 2G06A 3QGMA 5ALJA 3QU9A 2AGVA 4HGPA 2I34A 4G63A 3FZQA 4UW9A 1ZS9A 5ALWA 5E0OA 3SF0A 1RLTA 5AKYA 4O8CA 2WF7A 5AVVA 2Q4RA
chains in the Genus database with same CATH superfamily
4O3FA 3DFMA 1HLFA 4IVQA 3HPQA 3AEXA 3KJEA 3KQOA 4DJFC 4UUNA 3URKA 2FX2A 4B17A 4BVKA 3RRNA 1B76A 1QORA 4US2R 2JFQA 3BAZA 2R1TB 3M6LA 4QPDA 4DLKA 1BPBA 5C8ZA 3GFGA 4FZVA 1OB5A 2YV1A 1PCXA 1C0IA 2R84A 3PA6A 1U9IC 3G5AA 3U26A 3FPSA 1Y88A 1UBOS 1CY4A 3LPLA 2IUUA 2GXSA 2NQ8A 4H59A 5CJPA 1ULAA 4TQGA 3K2EA 1WXGA 4WSOA 3WIVA 1RKBA 1E2UA 4ZAGA 2W6NA 4CUZA 1J49A 4F85A 1T8PA 1B6SA 1Z1BA 1PD1A 2MINB 2D0IA 2OGWA 4MV1A 3OKCA 2C7GA 1H05A 4CLOB 4KX3A 4ELTA 1WCLA 4G2NA 5KNCH 3LYLA 3BFXA 3FLMA 3SIRA 3ST7A 2P9QA 3IAM6 4NBNA 1UWVA 1USWA 1HKHA 1NFFA 2EVWX 5EP3A 5IYZF 3ZDRA 4YRMA 1NDHA 5EVCA 4EQ6B 5D7BA 3FUVA 2F7SA 3GNTA 1X14A 5FO0A 4E7OA 4O2BB 4ARAA 5KWIA 4L3OA 1KO4A 1TCVA 3QPVA 1M6EX 3W9YA 1KBUA 1XTQA 4C21A 3BIWA 4D8UA 4D0SA 1OT3A 3RR8A 1V25A 4UREA 3RKSA 3TSYA 5HHTA 2BM0A 3FFBA 4CF4A 1XFDA 3KNZA 3LWDA 2G08A 3B1ZA 3O7WA 2PUDA 2R7AA 2V4ZA 3PDIB 3CH7A 4D5GA 3P2IA 3MTBA 4CKWA 1L4HA 4CM8A 5F9LA 5KJCA 2EARA 4PSVA 2PGOA 3H2YA 5JD3A 2E5SA 4TWRA 5A04A 4TLAA 5K3BA 4ND5A 1EFUA 3E5NA 4X61A 4GW3A 1QVRA 1AN9A 1Y1TA 2A7XA 2DTEA 1QLHA 3QKWA 1UZAA 4RM2A 4NV1A 1COZA 2OO3A 1I4OA 1XMSA 2C4WA 4HH4A 1T9AA 4B1FA 3AWIA 5C18A 1XU9A 3OIGA 1SCJA 4MVJF 1UAYA 1BHSA 2P4HX 4Q1CA 1H8HD 1N9GA 2I33A 3GN1A 2MWMA 4PFSA 4R1OA 4GQAA 4EA8A 3C74A 1M67A 3LUFA 1K5PA 4P0QA 1K3FA 1WVMA 3AIKA 2A35A 3IA2A 4Q3NA 3ADBA 1PJ2A 3X1WA 5JY1A 1RRMA 2R4UA 3N2NA 3M7DA 1OYVA 4R3NA 4RZIA 3WNCA 4CM9A 4DJJA 1DAOA 4HCJA 4AQDA 1OIWA 4RA6A 2R6AA 4F3KA 2QLFA 3MUNA 4OHUA 3CF4A 3EG9A 1YQDA 4BBAA 4FDVA 2X0FA 2DVMA 1V3TA 5FNZA 4DC1A 2AFIE 2ODTX 3IMCA 3RU7A 4E07A 3EXG2 4CM4B 4MQLA 2ZDHA 5GM1A 1UXIA 4OQNA 1JILA 1JYSA 4QXRA 3S5JA 4FZNA 4PNHA 1XZFA 3KPUA 2I7XA 4BJQA 1FTQA 2KHVA 5CDYA 3FDSA 3LC7O 4PZAA 1D07A 3GG2A 3HWX1 3JSXA 4FI3C 5J47A 2EW8A 1NZPA 4ZCPA 5TEVA 1J8MF 2IX9A 3C5HA 4RQ6A 1ZAKA 1Y34E 4L8VA 1CUJA 3B6JA 1GFSA 4MWTA 5FOTA 4RK1A 1HE3A 1RHUA 3BMXA 5CVUA 3AG5A 5GM2A 4BGIA 1HT2E 1RC8A 3JASA 4TYNA 2OM2A 1OX6A 4PQYA 2OCLA 1KQPA 4ALLA 2AC7A 2NO7A 1MN8A 2ZYSA 3HKCA 2AF4C 2EAMA 4R9RA 1O6FA 1U6IA 3P2EA 4GBJA 2F3QA 4G5QA 3WLKX 3V8PA 2BTEA 5LLSA 3TK1A 3FROA 5LU9A 3AKCA 4F91B 3OU6A 3RB3A 3U1BA 4EL0A 2H1OA 2E4XA 1I6WA 2VT7A 2QJOA 4URYR 3UWOA 4O2LA 3THSA 3CKLA 1U8TA 2OD7A 4GLFA 4C1BA 5B1EA 5JJBA 1O03A 4HQRA 5FADA 4BV8A 2XDYA 4K6HA 2I4MA 2RHHA 1KYQA 4IXWA 4NU6A 4Z0HO 4DW8A 4M9XA 4HVAA 5ESRA 5JBIA 4NOMA 1NXOA 4GGMX 4E5NA 1HM5A 3FE2A 1DLIA 2HHJA 2I62A 5B1IA 5F51A 4YP3A 3LPCA 3QVXA 1QG4A 2EANA 4ZT4A 3T4UA 3NO4A 3WZMA 5ERYA 5IJWA 1Q3VA 4YUVA 1E6LA 1JTVA 2XKAA 5CDFA 3V7KA 4RPGA 3NMUF 1W35A 4BRSA 3QMWA 4IS2A 4G81A 2ZWIA 2X5XA 1DAIA 1T5BA 2ZB7A 1UBJS 4XJXA 1I13A 2DOKA 1L8QA 1SC4A 3C6BA 1DQRA 2GK3A 2H3EA 2BGLA 2ZAOA 4IP0A 4WESA 5EC8A 3WYDA 2ZIWB 1H65A 3EIEA 4HDRB 1X1DA 1NOMA 2O2DA 2ZUVA 1U7WA 4X1KB 3VR6A 5B3KA 5TEWA 4DG9A 3EPHA 1WXEA 4O25A 3FTQA 1SN7A 2C5FA 2J6HA 2P30A 4RTLA 5JROA 2I22A 4HDSB 1ZJZA 1BYUA 2BEJA 5DMHA 2QQ0A 2NU6B 4I1UA 4JEHA 3FWKA 1N62A 4BLWA 4B4DA 1QGYA 1C4XA 3Q8KA 3C23A 4HX5A 2F43B 2XMRA 1L0BA 3PX0A 3L1JA 3T9CA 2HB6A 1LSJA 3Q8PB 3FSGD 4JASB 3B8HA 2VKTA 3ZDEA 1LNSA 3JAMA 1TADA 4GYJA 1Z06A 3ZHCA 1KP2A 1YDGA 4AURA 4FT2A 2HHXA 4QJIA 4XJTA 3EIQA 5DV9A 4MIEA 5FYQA 4KO4S 2XDAA 2REOA 3BJEA 1TKCA 3LECA 4XKJA 3VV3A 1PK9A 2W6QA 4KZKA 1SXJE 4DQIA 1TQHA 2N0SA 4Q1VA 5HKOA 1WB9A 1Y3FE 4HQ0A 4WEQA 1CIPA 4DDKA 4DJDC 3KU4A 4TYYA 2KQUA 4F5RA 3EYWA 3UAXA 4CZ2A 4DV5B 3UJAA 2QORA 4AJ4A 1BKYA 3KT0A 5EMHA 2PQMA 3TEFA 3JCZA 3K73O 3S44A 3L4JA 1WCYA 1J23A 3AUXA 5JH7A 3VI3B 1ZXBA 1JGTA 1PWEA 1TECE 3D2BA 4HWKA 3S2EA 1LSUA 3DMYA 4YP9A 4Z3OA 1D2MA 4YREA 4DLLA 4FDMA 1LTQA 1NVVR 2GBLC 2JPDA 1TX4B 3HY3A 3ZJ4A 5EZYF 2X2FA 2VF4X 4FMDF 4DPKA 3KXPA 3KB1A 1PKEA 3TL6A 4QX6A 2Y27A 4IDOA 5IDYA 3I62A 5BWBA 4YRZA 3QVGB 1QFZA 4J49A 5KVQA 1NN3A 3QITA 4KQFA 3KETA 4GQIA 1DQYA 2FZCA 4IIJF 2DC1A 3EE6A 5BN4B 1XZNA 2JVJA 5BSFA 1J1UA 3N74A 3IXMA 1PRYA 5FD8A 1VECA 4P4OA 1VLMA 1K06A 1XKQA 2IYNA 3AW9A 4FZLA 3DNPA 5U1PA 2QMQA 5IMSA 1NVFA 3BWYA 5CRXA 5AM0A 3VDMA 4A6EA 1TK5A 1L7EA 1ZD5A 4ETIA 1DXOA 1RWOA 3AKYA 1Q0PA 5KYYB 3JQPA 4R1MA 5F33A 1DMSA 5C1PA 4C7YA 4B4VA 4GMKA 4ZU1X 3KTOA 5A6VA 1HUQA 4RFVA 5B4VA 1DDOA 2VJYA 2XCQA 1HT3A 1NXPA 2JLAA 3HQ4O 4BNNA 1MG0A 4UCWA 4TV8F 4CQMD 2O3SA 3FF1A 5CA0F 3CPEA 4TRMA 4YCLA 5K4AA 2WZCA 4MF8A 4C2AA 4KLDA 1FTSA 4HTAA 1GZ6A 1SBTA 2PIDA 4R8MA 1WKBA 3THRA 2BEVB 4I2BA 3TB4A 1KW4A 3ZPXA 2JANA 3J81j 4J9NA 3EZXA 4KMMA 4O8ZA 3JZDA 1VPDA 4IFTA 1YGYA 2C7VA 2LYHA 1TZBA 4NV0A 3KLOA 5MN5A 1COOA 3EA4A 3ADKA 5CNJA 5K1ZA 3WJ7A 1K6EA 1Z4LA 2PWZA 5DI9A 4ZKEA 3N8KA 2XF8A 4RSGA 5LWQA 1K0UA 3OLXA 4DSLA 2FI1A 2ZRIA 1VE1A 3W6UA 3R7BA 1LPMA 2MYPA 3T52A 2V98A 3D3JA 1YKFA 2QQ5A 4Y6SA 3WLMA 1JKFA 5E7QA 2HT1A 1DTWA 3M4JA 2B5VA 4MDFA 1LDMA 2X40A 5F9MA 1U90A 5FEMA 2FWPA 1P6UA 4ZK6A 4E2FA 4YAEA 2BCJQ 1NQOA 4TQSA 3V72A 3OTIA 4MKFA 2OC4A 4LXQA 3Q9UA 2JVKA 3WZ2A 4AWAA 1SKSA 3HFRA 4RHYA 3KO8A 3TZ6A 3LQRA 2BGWA 2AEFA 5I4BA 1A0PA 1QJ4A 5T4HA 4G0NA 2VQSA 4BN0A 1BQ3A 2IL1A 4OJPA 3EZ7A 3TTYA 3QF4A 3OM1A 3ZIDA 3GRKA 3SEAA 3I5YA 4NULA 1AJEA 3DHWC 1MLDA 4M1KA 3LVFO 1XEXA 2ATCA 3BILA 4M9LA 4UQPA 2BI4A 3IB6A 4ECZA 3V2HA 5GVSA 4NCAA 1SXHA 4Q37A 4GWKA 2FMKA 2VKQA 3NC1C 3TPFA 3IMFA 3UPQA 1EE1A 3JPYA 8ICQA 3KR1A 4Z2AA 4L51A 1MAAA 3EFBA 3SZMA 1N8SA 4HXGA 2PG3A 4ERNA 1GCOA 3BXFA 5F2NA 4CQLB 4JKYA 1Z4NA 2IHZA 2DG2A 2XVXA 2K87A 1QCYA 3PFBA 4L9WA 1SBYA 4NJEA 4C1NA 4ZYVA 2QLTA 1B23P 1RZUA 1L5FA 2ZBVA 4IQVA 5BOSA 2EP5A 2WJVA 3V34A 4GPEA 1XPRA 4M7OA 2NV6A 5AT1A 4CR6A 4ENQA 4LCJA 3KQHA 1NXSA 3HUTA 3T3DA 1L5UA 3MXOA 1BDMA 1E3JA 3CZMA 4TL9A 4XEHA 1AQJA 3T5TA 5IEBA 4ENPA 3N2LA 3BB3A 4QNMA 5H02A 3QLEA 3SLRA 4BPRA 1SCKA 4PIVA 5KFDA 2XSZA 2PA3A 1F8UA 4B3TB 3DHVA 4X71A 5TY0A 1OF1A 4MLDA 4I1IA 3IVAA 2RCYA 2VATA 2E82A 2ZRHA 2VP4A 1L7OA 2XUPA 3PC8A 4F8RA 4UC0A 2FFAA 5DTRA 4A03A 5KTOA 4G0OA 1I51A 5A5EA 4X7PA 4D9IA 5IAOA 3NHSA 5HDBB 1XQWA 2ZJ0A 4Q7JB 3R6GA 1OA1A 3RHZA 4PGMA 5EZSA 5CHEA 4YUAA 2POCA 4BLOA 1GRVA 1U1IA 3OCWA 5D86A 2MSDB 4ITUA 4BAGA 1B2LA 2DEUA 1YJQA 1LQ2A 4GC7A 2IXFA 4DWVA 1GPMA 4BBZA 2JLQA 3PQ2A 5J43A 9MHTA 3AM1A 2WUVA 1AGNA 2AKAB 4MRNA 1WIWA 1X9IA 2ES4A 2HMVA 4GYYA 3A1UA 2IT1A 2YFHA 3IESA 3MQ4A 5E1MA 1ZK0A 5H83A 2ZAGA 3CF2A 4A16A 1YT5A 4CNQA 1T8TA 2JFFA 2P9HA 2Q1WA 4EVQA 4WOBA 5IJZA 1W49A 3FOBA 4BTEA 4ND3A 2JKYA 7ICEA 3QYPA 3TMAA 2PRYA 3FJYA 4BP9A 4EZIA 5BUSA 1EDBA 3BJYA 3WADA 2I9GA 4EW3A 1X13A 4PX2A 5F1OA 2V54A 2NP6A 5AI5A 4WOCA 1E5DA 5KSPA 3QRWA 3VSAA 4MS1A 5SZHB 5IBCA 1Y3IA 5ALQA 2KTQA 3EIXA 3BQ0A 1SXJB 2BH9A 3EK2A 1X7WA 2FZEA 1PZEA 4JUIA 4R5HA 1JPVA 2KHQA 2VT3A 3PEVA 3WWEA 1OXJA 1GAEO 5KWSA 2I2XB 1ZCZA 1TA4A 4DSNA 1KMMA 2BJWA 5JQGA 2BBSA 2HDWA 4EEXA 2VOJA 4PHCA 5CK4A 1Z29A 3G2LA 1OTXA 1UA0A 2Y77A 4J3NA 1VB5A 4E51A 3BCUA 1MIHA 3M1AA 4BNKA 3L7IA 1U6JA 5KT7A 2E1RA 1BEUB 2DH6A 1C3EA 3K1ZA 1EP3B 1T5TA 1VDMA 1V7PC 1ZMBA 3WJAA 5ELXA 3L84A 2I0FA 1RQ2A 1C81A 2PZKA 1SUAA 1ZISA 2VPXA 4MPJA 1G21B 1SY7A 2OGUA 3LY8A 3Q8WA 3AHFA 3V3KA 2ZG6A 1GPAA 1A8QA 1LPNA 2VRCA 4QM7A 3NVAA 2E4VA 1G63A 4B7UA 3SIWA 3LFUA 4ZVTA 2EBUA 4ZPJA 4FFNA 4EG0A 1V5GA 4ZZ0A 2DBRA 2RD2A 1LC0A 2QX6A 4GBED 4EHLA 3AHCA 1X3LA 4RZQA 3VHQA 2K4PA 3GQCA 2GKGA 4YIKA 3SR0A 2CLDX 4JB8A 1GTZA 4AKEA 2HM7A 1RAFA 3UT6A 3IVXA 2VJ5A 2ASEA 4D92A 4L7QA 3GWZA 2IOFK 1Z82A 2P0EA 1G5PA 1KVUA 2PKCA 4LWZA 2PL5A 3EAQA 3R3ZA 4UU1A 1Y6GA 4Q4LA 3SR4A 3IUEA 4MUBA 4B8WA 4A4DA 3N0RA 3DMPA 3P4XA 2W2OA 1CUIA 1ECGA 1OZFA 1ZC3A 2J3EA 3F98A 3FCYA 3JRWA 1IM8A 1HUZA 2ASVA 2QTVB 4PY2A 4RVHA 1M34A 3TFSA 5CT4A 5ICEA 1KZYC 2RCNA 1CUZA 1FB5A 4HPWA 3LYSA 3GP3A 3DKVA 2B6GA 3EUWA 1V95A 1JHQA 4XVHA 1Q22A 2V4MA 4F12A 3DOJA 3DQZA 3HMQA 3WMRA 1VSTA 3J81A 1XNRB 4J0GA 1Y7IA 4MTLA 1U0JA 2FLWA 4ZCTA 1YNOA 3IUNA 1YQWA 1TV9A 2H9YA 5DB6A 2R6CA 2VWPA 3OEHA 5HBRA 4BMCA 5JSYA 2I8AA 1L9XA 4BLQA 1PVQA 2YB1A 1L7AA 4ESOA 3TMYA 5JCOC 5DSTA 4ESVA 4I55B 3UQZA 1ORWA 4FKMA 2HK7A 2QUJA 2NQ2C 1UKEA 2Y0EA 3NFRA 4HYKA 4MI6A 5DLEA 5KCMA 1JAIA 1XKXA 16PKA 3VAYA 1T2UA 1AU9A 2X42A 2CCGA 3MWFA 2G5IB 1UPUA 1L5OA 3N75A 4KPGA 2G9UA 1V8DA 3UT5B 5IVPA 2XWJI 2MUTA 1N5MA 1NWCA 4DIFA 1ZCJA 4WERA 3NHWA 2IPMA 4II2A 2I34A 2Y1CA 1F8FA 4NG5A 1FBNA 5BOVA 4EFKA 4Z1MA 5HIAA 1E69A 3DA8A 5K6RA 2XBLA 1ZSVA 2GM4A 3A1FA 3S8EA 1XXHA 3IBYA 3PVXA 2CCKA 5KFMA 1JXOA 2YYZA 1O77A 4KZPA 4MGYR 4BLTA 4QXOA 4MR8B 3I39X 3M1IA 5JCXA 1KKUA 4BO9A 4LI0A 3RAPR 4I1SA 1XN4A 4XCXA 3RH0A 4DNXA 2SCUA 3DBVO 3LT2A 1UPAA 4RT2A 3LU1A 3MERA 3VPBA 4R9VA 3T9DA 3C48A 3WGIA 4XGNA 4B3SB 3C7TA 3DF9A 3I6QA 1NULA 5JS1A 3I9V1 2PXIA 3U39A 5IP5A 1ZAYA 2CFTA 3C98A 3MABA 4MB2A 4JLVA 4R65A 5BW6B 1NVMB 4D0LB 1L5QA 3SQWA 1S2GA 2FW8A 4N0QA 1GGEA 3KUCA 5GV8A 3W2HA 5G5GA 1V97A 2A94A 2ODGA 5IVIA 3RVSA 1Z12A 3LXXA 6YASA 2KIWA 3ADOA 1MNAA 5JWHA 3EUAA 721PA 3G9XA 3UJ7A 1KH2A 1RHRA 2KZMA 1J0AA 2MIIA 2Q1TA 2VP2A 2O2IA 4ABYA 2O54A 2B9EA 4KQ9A 2BGRA 2GARA 3AL3A 3U4MA 1DC8A 1JE1A 3QUSA 4MWSA 3TZLA 1UMCB 3FCAA 2D5CA 2BMFA 5IJ0A 3BIOA 1X66A 5BSHA 4EHAA 4KE9A 2H3ZA 5KG4A 2CWWA 2XGMA 3SXPA 4C05A 2O59A 2RGXA 1RZ3A 3X1ZA 4AB1A 3BBLA 2FK8A 3KVVA 3QA3E 3MW8A 2OSBA 3MEQA 9ICSA 1CQIA 4Q6WA 4MUHA 2GZHA 1O5TA 2HCBA 3QEBZ 1ZN7A 1BHQ1 4RVCA 3VKFA 4DQXA 1DXQA 1WMDA 1XLWA 2Q5JA 4DLSA 2LIPA 1CBUA 4XYGA 4LGCA 3K7EA 3HPOA 2UUOA 4DCOA 4KGXA 4LHSA 4YLYA 3MPUA 4QRIA 3D6TB 1FNDA 2JGEA 2J5RA 1Z0IA 2D7CA 2H8GA 4K05A 1RXSA 2PS1A 2QM8A 3E9YA 4P2HA 3JVVA 2PH3A 7ICUA 1TYDE 2OO5A 3KOXA 1ABFA 2FPPA 3GPDG 3SZLA 1RQPA 4I2FA 1T0PA 4QOEA 4A9AA 1E0AA 2WINI 1JHUA 1VSUA 1WOYA 2FSVC 5TF4A 4YP7A 5AHOA 4KBGA 1I1OA 4EGCB 2R8KA 5IWAB 8ICEA 2B35A 4RCVA 2P79A 1YJAA 3FX2A 3ONFA 3NNSA 4H3VA 4JENA 5FFFA 1U80A 4YH1A 5J1TB 3F5EA 4AJ2A 4DYHA 3VNUA 1PV1A 3RUEA 2GT1A 3PNYA 4JGIA 4ZGBA 3GIWA 5I9IA 2FPUA 2H9AA 4V3BA 2HCTA 4BX2A 4OJTA 1MC5A 2GWRA 3KYCA 3FNBA 1EX6A 3ZGOA 3PKZA 3DWEX 4WOJA 3RS3A 1P9LA 3DOOA 1TGVA 2C0QA 4XAQA 4ZAXA 5HQTA 4YCXA 4OJYA 7ICFA 1IHYA 3N8NA 3KLBA 1XLTA 2BGUA 3JZAA 1EDZA 1H5QA 3UCFA 4DJAA 1QPBA 2OXCA 3KD2A 4BGVA 3MSCA 2FW9A 3AN1A 3SQDA 4DMRA 4ZQCB 4ZTUB 5TVGA 4ZTZB 2N1BA 1ZQZA 4HAVA 3H4TA 5JATA 2AMLA 4WECA 4EZ9A 3RREA 3VHLB 3CZRA 1CULC 2G70A 2DPMA 1KI6A 3EVCA 3PJDA 3W7AA 1NVBA 4E5PA 3DFKA 1PL0A 2FEOA 2QNIA 4YGXB 2ZW9A 3BD9A 1WZCA 2RHOA 4DABA 4ZIRB 2WU8A 3G9TA 2EZ4A 2PMBA 1LRLA 1IOVA 1LBSA 3E1SA 3GRVA 4PG8A 3TNYA 1Y5RA 2DFKB 2OHJA 1USIA 1PBNA 4ILEA 4CN9A 3V1YA 1C0LA 1Z7EA 1J2NA 2ZIAA 4MRSA 4Q9JA 3WBFA 4C78A 5JMPA 1UUFA 3HJNA 4KUGA 2C5AA 3ZGYA 4K9MA 2NO1A 2BQUA 4REQB 1NX9A 1Z6TA 1KEZA 4ZZIA 4JWKA 3ITNA 2OB1A 4Q4AA 4EDFA 3B3JA 5FI3A 3AVVA 1D4FA 1G4UR 4QNRA 4M8IA 2NPFA 2R8EA 4D81A 4Z1OA 1QGZA 3L0YA 2QBYA 2KJ5A 4EB6B 5ADHA 4PLTA 2R8IA 4IOLA 5FUMA 5K0SA 1HOTA 3OT5A 4F38A 4J0DA 3W4KA 1ZNYA 4PCLA 1UQRA 4H7EA 3F2BA 3AVOA 3HA5A 3DDNA 3KYIB 3N2KB 3NHJA 4KAAA 2YVLA 1OX4A 2A84A 2F1KA 2JFVA 2QTAA 3HCEA 4U5XA 2XB9A 4WWHA 3F3YA 4RQTA 1U98A 3LBAA 2ZE7A 1DFIA 4BECA 1N6PA 3KBBA 3HU3A 3KSZO 4C5AA 1J06A 4V0RA 4BFTA 3I04A 3M49A 3MHTA 1EHIA 4FGJA 1QF7A 4J3JA 4BNGA 2WJAA 4LDNA 5D2CA 3ES9A 7ICHA 4ED7A 4Q7QA 2PT5A 1XRMA 5CLLA 4B71A 4DDWA 2VRCD 3Q7SA 4JDUA 3EUB2 6AT1A 5I6DA 1VTKA 2YOGA 3QSYA 1QHHA 3GGOA 4R2IA 4XPZA 1D4AA 1Z3CA 1AM4D 2WF8A 1DKNA 1UMDB 1U5BB 4HX2A 2HGSA 1IOZA 2B0CA 3CRXA 3R3YA 3SJCA 3W1EA 4EFNA 1Z28A 3RJTA 4LZPA 1ZQHA 8ICHA 4XW2A 3MFHA 1G1AA 1AK1A 4B9VA 2BTQB 4GPTA 4PHGA 3GT0A 3HU1A 3HI4A 3L8DA 4TWIA 4FEEA 2F3NA 3BS5A 2C7BA 1EFKA 2JAUA 2RMKA 3ABOB 3AERA 4Q3DA 4J9LA 3W2IA 4JEUA 4CQJA 3KVNA 2ZRFA 4GZ5A 2A9FA 1XPOA 3UWSA 2ASJA 4RL6A 3TVDA 1TQ8A 3CUYA 3EVBA 2HLDA 3IEKA 3DEEA 9ICHA 5BN4A 5C3MA 1NHGA 4GH5A 3IJPA 1T2VA 4NV3A 3PTLA 5KYWA 1QP7A 3LJKA 3T54A 1C2TA 2V7BA 1Y7PA 1W0KD 3HMKA 2F8TA 4FYIA 2MSNA 3GUHA 4CLHA 3WKAA 1JDNA 2R18A 2XWPA 3DZDA 1DEOA 3EGVA 1E8DA 3GLUA 2CVOA 3VZPA 2A9VA 1R5JA 4CKYA 3J7AC 1JSXA 2OR3A 3CA8A 5FLYA 5J4YA 4D98A 4MZDA 3WMEA 1T6NA 2O7SA 2R8RA 3KUXA 4QUKA 2F8KA 5DXJA 4C0WA 4BE9A 4ED8A 1SHTX 2JI9A 4ZGGA 5IK2D 1RM5A 5LXTF 3NONA 3PUVA 4JEMA 4TM7A 1VCIA 4Y3UA 1ZUD1 3ZCVA 3G2JA 1YQGA 1I10A 4LHZA 5HKKD 4M9UA 3MM4A 2PBFA 4X6YA 5LXTA 1RWNA 1Q0HA 4N03A 3I8OA 4BYGA 1YHZA 2Q2OA 4JSRA 2OSVA 2YWCA 5D00A 2M2IA 1TVAA 3B0XA 4IRDA 4XRHA 3E9MA 4CMEC 5LZ9A 3IKLA 3PYMA 2PIAA 3OCXA 4J6EA 2AXPA 1QBGA 3LCUA 3UOGA 1RYRA 1CQPA 1G3MA 2Z9CA 3M70A 1WDKA 1YHNA 2R751 2XD4A 4U6QA 4XSGA 3ZV4A 3W2GA 3IAFA 8ICRA 5GONA 2I6UA 4QJ3A 3NBAA 3NC0C 1DBQA 5KHLB 2ATVA 4QLBA 4ARVA 2ZJ7A 2GCPA 5JD4A 3TCKA 2WEKA 2PX3A 3W77A 3ITDA 1FOEB 3OFJA 4TQUS 4XD7A 4CF6A 5EXTA 5IZCA 4QODA 4HS9A 1SCAA 4QQFA 3UA3A 4I2JA 7ICNA 4M8KA 5F9HA 3HWWA 5EP4A 5DIZA 4JUBA 4JN6B 1NE7A 2HPHA 4B3BA 4JJ8A 5E4FA 5C8VA 4WT7A 2RGYA 4WN9A 2B1JA 4OHVA 3V1UA 1VBNA 3FDXA 2AFHE 1QTRA 3RUIA 4YQFA 1MOSA 1T6XA 1MRZA 3TPZA 2ZM6B 1GZ3A 3ZEAA 1A04A 2JAHA 4IOJA 2OCAA 1H5NA 3D4LA 5A9SA 2XT9A 2GVNA 1O95A 4J76A 5BSEA 1X74A 3EGXB 3GFFA 4PTLA 1A9TA 3LF1A 4QICA 5AXCA 4AC9A 4C04A 2G5HB 2YHIA 3FB4A 3N1UA 5E1BA 1SIUA 3IVGA 1LPSA 2XOKD 2F1OA 4RWEA 4Y9RA 2F00A 2I8CA 4D45A 3BRQA 1L1QA 4GHWA 4KVGA 2VPTA 4ME6A 4LZAA 1NN1A 2HMWA 4WK2B 5K6TA 4ANFA 2ACVA 2QU7A 1FFDA 1WMSA 3E9DA 1XWFA 1LVHA 2OMKA 2FMPA 1V3VA 1YUNA 3EEIA 3EH2A 1WRBA 3JATB 4FILA 1KYVA 3EXEB 3GJ8A 4J7XA 4XRRA 4AJPA 1CF4A 1YBHA 3HB1A 2F1RA 4IVNA 4YJDA 4EKIA 4NLGA 1OFUA 4GUDA 4R3UC 4ZVKA 1J5EB 2QVXX 3F4LA 4HK4A 2BCRA 3SPXA 2ORIA 3GJTA 2X0DA 4UHKA 5CYFA 5G4KB 1ZQMA 1A9SA 1Q83A 1C4KA 1FA9A 2B6HA 2H1CA 3C8HA 3LPAA 4KXVA 2JMGA 3AFGA 2Q0ZX 1K5GA 3FH0A 2AFRA 5EIEA 5HZGA 5AKJA 2Q27A 3DEHA 3BWCA 3OFKA 3UENA 5JARA 1VJDA 1NJ2A 1P9OA 3T5JA 1J8FA 2OBMA 2ZUWA 1Y3HA 5HZKA 3LX6A 4CLOA 1RM4A 3S2UA 4F9EA 3X2SA 3HFGA 4OGFA 1OA0A 5C37A 2AX4A 1E9VA 3EG5A 3I09A 1N7JA 2COEA 3CRW1 4HL6A 2CLKB 2QU8A 4XA8A 3QU7A 1DOAA 1PGQA 3A4YA 3B1WA 3GAZA 4GO1A 4RLSA 5FV7A 3VR6D 3KTAA 4TUPA 2IF0A 4XUDA 3WV5A 2VO1A 4O2BA 1AGYA 3BEOA 4LHYA 3KHKA 2HF9A 5K8TA 4M83A 4N8DA 1FNCA 3S2ZA 1M2OA 3A9SA 4KN4A 3WKEA 1T5HX 1ZIPA 4X0EA 5CMLA 3H84A 1HIWA 3OP4A 2ZZMA 3PWKA 3IRVA 3PQ7A 3T9FA 2DPGA 4EZ6A 3HDHA 1LVUA 1N5XA 5J2GA 3JARA 1C3JA 2W6CX 3ETLA 4BEWA 2JLWA 1E7YA 4CG1A 4TTRA 2AUNA 3ZQKA 1TUBA 5B30A 3ER9A 2KEYA 3F5DA 4L8FA 1WEHA 3C3KA 3NNNA 4FBMA 4C01A 5IEJA 1D6SA 2PKRA 1A7AA 2V6GA 4RT3A 3GUUA 4RPCA 2XNCA 2V4RA 3EN0A 4UB1A 3L8FA 2BHRA 3EQ8A 2IYRA 1JFSA 4C29A 3ICQB 4DREA 2Q49A 3GIJA 4FEAA 5TGZA 3OZWA 3N2IA 2B82A 1P18A 3P4UA 1KZHA 1FXSA 1PZNA 1X7HA 3HN2A 3S40A 3FLBA 4CEJA 1BC5A 4PG4A 5JPDA 1WD7A 2WSLA 1RPNA 5LVAA 4Z4QA 1PQWA 1AXRA 1T2CA 2FE1A 1RXEA 1QK4A 2EBWA 1ISGA 2K5UA 3D4BA 3RPEA 1XEAA 1HUOA 3CRVA 1KQNA 3FYDA 4YQEA 3WK5A 1HO3A 2ZRBA 3CNNA 3H0MB 3HL4A 1EDEA 4CG0A 1JKIA 3HVUA 1LSOA 2I4TA 2DHDA 4DCCA 1PG5A 4C2TA 1CEYA 3RE1A 2VPZA 5LLDA 5F7ZA 3IQDB 4LZJA 2AXTU 8ICGA 4MQEB 1AS2A 1ZESA 2ZSFA 2CLCX 2DMRA 1BW9B 3Q3JB 4FYPA 4QA9A 1A7UA 3TVYA 5BT9A 3V8EA 5IC6A 1MNQA 3GEDA 2HREA 3EPKA 2PGDA 2VQFB 1VIMA 2OBFA 2ZJ8A 4B9MA 1AT1A 1Z8FA 4HSEA 1NDQA 3E8XA 4K9SA 9ICBA 2GESA 4MQ4A 2WIGA 2NSYA 4U2BA 2D2IA 1OVMA 1E2LA 1LH0A 1V37A 4DM7A 1ZJMA 5L1IA 3KHUA 3ZI4A 1ZIXA 3VGPA 4RL4A 4BB0A 1P91A 5A5DA 1NW3A 2IW3A 2OCBA 1XK7A 1P1HA 2F4NA 4AP5A 5MHTA 4PPGA 5I4CA 2GAAA 3DAOA 3NEYA 1JQEA 3REGA 4AFNA 1GA4A 3PDCA 1O57A 4UAZA 2AQIA 4UBIA 5CDUA 5HYVA 4X63A 3RHTA 1MB4A 3I2GA 4RV4A 2WICA 1GO2A 3DULA 4WA8A 4UAJA 2KE7A 1V9PA 1G9XA 4L9SA 2PGJA 3SF8B 3FDZB 1P81A 4JKIA 1S7GA 3IPLA 2IBTA 3TJZA 5D7NA 4C2UA 3W79A 1JEOA 1B0PA 2QT0A 4XLTA 2BFBA 1T9KA 2CXNA 2O2SA 4U1RA 1UZNA 2OZLB 2V45A 4GVLA 4MUFA 2OHIA 3DOCA 1LUAA 1Q19A 1XDBA 3T3IA 2CLFB 4PGAA 1ZGCA 3L7YA 2AWOA 3OGUA 4H1VA 2EQBA 4WA7A 3NRCA 3LIIA 1JQLB 1W0KA 2NTEA 1VZ3A 1UM9A 3K0FA 3L0OA 1LBTA 1VPWA 1PVOA 3LWNA 2G28A 2ZATA 1QRUA 1D7OA 3CBQA 3ZWBA 2J8ZA 1F8GA 5JS7A 4X1IB 2W9CA 3MGIA 1Z35A 4PAMA 3B51X 4WESB 2PFOA 3RTDA 4C8KA 5B6JA 1OXXK 3GLRA 4DYDA 5DWQA 5LP6A 3A6JA 1NOKA 2IZ6A 1WU7A 2XYPA 1KBQA 3C7CB 3FJ1A 2PVSA 4FBGA 4FHFA 4B6FA 3H7AA 2G76A 3V6MA 4DHWA 4MYDA 5BV7A 1UBHS 3GGGA 2ORVA 3NH6A 3OO0A 4OGGA 2K8AA 4X84A 3BERA 1CUCA 2GPNA 1UKCA 2Q5CA 4JBYA 9ICAA 1SR8A 1XF9A 1XXHB 4H7IA 5H3HA 3QTBA 1NONA 2R3SA 3QU9A 1YJ8A 1F3OA 2FNAA 4HGPA 1FBTA 4Z7QB 1ESCA 5C4MA 5CYPA 1I9CA 2CXHA 4WJLA 4AK9A 2E85A 5TQ2A 1K88A 1UOQA 3ZD8A 3PMLA 4PYQA 3EW7A 4W99A 2FSGA 4QU0A 3ZNQA 3OPMA 3RWOA 1O0CA 2FMFA 2FP4B 1B4DA 2PV7A 1R3UA 3BIJA 4G36A 4URWR 3ZVRA 6REQA 4FJ0A 1OI3A 1S4QA 2WIDA 3GJQA 5A9TA 5FWAA 3TH5A 4DJTA 4JB3A 5CCBA 5E7MA 4BE4A 1C29B 4EJ6A 1ZYQA 2ONCA 2LCIA 4NBWA 4P7KA 3MDAA 4QBTA 1U9JA 3H9EO 2DX7A 3ORRA 4L9AA 3U62A 3FFAA 2VYVD 4G4IA 1O94A 4YP0A 4GX5A 2W6JA 1JIUA 3I9FA 5BPCA 1KZ6A 3MMSA 2FOIA 3GPLA 2CCJA 2KD1A 2ZR0A 4MJ3A 4V1CI 1ZQDA 2QN7A 3DH0A 4BLPA 1HDCA 1YQTA 2ZTDA 1R0ZA 4TXLA 2KS6A 3HJAA 4W7IA 5FOVA 3UJ9A 1UK7A 3QVVA 1T4DA 3HADA 3TRHA 4BX3A 1P5HA 2NUPA 1RBMA 1Z0UA 4UXJA 2OOSA 3LTNC 1N2ZA 3BRWD 1VCNA 2W9BB 3O4JA 1V38A 2P69A 4OHRA 4RFLA 5K0LA 1ZQEA 3COSA 2JCBA 4EK9A 5JAOA 3D0KA 3K6JA 1YRWA 3U7RA 1J6UA 1ZN8A 1NG9A 1BA3A 1TAMA 1Q20A 2AYXA 1B42A 3KFVA 2D4AA 3QVMA 1YS7A 4A23A 5L6MB 3WLQA 5TNXA 5BR8B 3PSTA 2BKVA 2VHVA 3MJHA 4QWAA 1CZNA 1MMFB 4ER6A 2A0WA 4I7EA 5HJ5A 1ATZA 4ZH4A 3JQAB 1THZA 4OYRA 3Q0TA 3R0VA 2WF9A 1QK5A 3UJ6A 1B26A 3FR7A 2H3FA 1B00A 4RGBA 3ZVNA 3HDJA 2CFOA 2PFSA 3V4ZA 1HEYA 2O1WA 1AV6A 5AJHA 4LBYA 2OFWA 1RKQA 4DSIA 1RQLA 4J0CA 4JJFA 4YUZA 4RPKA 1LK7A 2A7QA 3CLRD 2P4SA 1HTWA 5LPNA 5FTMA 2O52A 2GTIA 1KJNA 4KMSA 4AICA 1IHUA 1BH2A 3HP6A 1I3KA 3L6OO 3OI7A 1ECBA 5B53A 4FMDB 2I2CA 5ICMA 7MHTA 4JMLA 1F06A 3RCBA 3PUKA 8ICXA 3SS8A 2EJTA 1N48A 1KU6A 4ZCQA 1GJRA 2BLLA 2VJDA 5ENVA 3I73A 3OUZA 2C2WA 5DM60 4ZI3A 1AV7A 2O14A 4ALIA 1XOIA 2F2TA 1D6MA 1SVUA 3K2BA 4FFVA 1V16A 5AI8A 2V7TA 1K6MA 2VSNA 1GR1A 1WLYA 2WYIA 2JLZA 5C34B 1Y4AE 2H1LA 4FYWA 5LJIA 1GYRA 3PY8A 1YZNA 4MS3A 2PGXA 3ILXA 1K8RA 4QHSA 3RR2A 4MRPA 3A27A 2HVHA 5E7IA 4DWOA 2Z8ZA 4ZO7A 5A5GA 3HCOA 2VHUA 1ZQSA 1W30A 1X7YB 2HJGA 2GD1O 2X9NA 4KOAA 4U2DA 1CUVA 1XNJA 4A0HA 2W42A 3OFVA 4M55A 5C2JB 1J0EA 1ZCFA 3AESA 4NXMB 1NQXA 2GD2A 1GZHB 4R1SA 1H2ZA 1YCGA 2NYAA 3KYCB 1FDTA 3E7WA 4UBMA 3ZHVA 2F17A 3RAQA 2H2GA 3DBLB 4NOKA 3KXLA 5FAKA 1PFWA 3LCCA 3KKEA 1P7DA 4U2GA 4GWGA 1RACA 4OH7A 3CRQA 3OZ7A 1DDIA 2IZOA 1MABB 5IT4A 1EGQA 4QAJA 2JD2A 3TFOA 3D0OA 4F6CA 1SZJG 2X3FA 1T3HA 1LTHR 3I45A 3VJKA 1BCSB 3CUWA 2C57A 2YIMA 3D8RA 3DEFA 5CVDA 4KSCA 3W0LB 3FDFA 1DAFA 2N47A 1C1XB 4ZT2A 1S8NA 1PW7A 5HR7A 3ZBPA 2JAWA 3NGDA 1ARZA 4Z3DA 4LX8A 4H7FA 3LLSA 3OY7A 1X7DA 3UK6A 3USCS 5BY2A 3DPSA 1Z2CA 2DERA 2FSIA 4K1LA 1GP2A 1NMSA 2PX6A 3T12A 2Y6VA 4MH0R 5EWMA 2EKDA 2DTDA 4ZWNA 3IEPA 4EEZA 3WWDA 5JMTA 1FFWA 3R5XA 2FFHA 5LQSA 2HSGA 3ZR4B 4U39A 5IM5A 3TW8B 1A69A 1ECPA 2M6SA 2CYAA 2EU8A 2QE7D 3K8YA 3ROMA 2PUBA 1P1RA 3PHIA 4TV8B 2OYRA 4EB6A 4DSZA 4JZKA 4R0VA 2IU0A 1TU4A 1L7QA 4B2LA 3ANSA 5BUQA 1P1IA 2A9KA 1LW6E 2V97A 4ZVLA 2UVUA 2ZCJA 2TYSB 3GZTB 4FN5A 4JLMA 4HDMA 1GV0A 4HADA 2OWEA 4NDNE 4NK4A 1NXWA 2VXCA 4R2WA 1N0WA 4P7FA 1PZGA 2VDOB 3JW8A 4N3GA 2JRCA 5IINA 3FYUC 4L5JA 2ACEA 3N3BC 3V1KA 5JFTA 3D6FA 4QUEA 1GPNA 1V9LA 3R5HA 3OF5A 4RLFA 1IM2A 3PGMA 2B61A 1VBMA 4JBHA 2P3LA 4EECA 3LRPA 3WGLA 2CVZA 3AVWA 1X0VA 4JT2A 1RXCA 5KEIA 4FDTA 5JMWA 4KN7A 3GV5B 3ETDA 4IW3B 2P6UA 1I3LA 2GUGA 3COVA 5IU6A 3F8TA 4R8VA 1KR2A 1UMDA 4IJWA 2GNPA 4M1YA 4X91A 1UQVA 3A26A 4CKEB 3CVUA 4GUAA 3H9GA 3E3OA 3NVWA 4B34A 1C8LA 1BJKA 1JZQA 3BMOA 4D9MA 5IULC 1K68A 3QPDA 4OD0A 3L0CA 1Y3AA 1N8NA 2PLNA 2II6A 2QA5A 2G40A 4CFZA 2QRHA 5L9AA 3T99A 5DRTA 2C9ZA 2QTFA 5KB3A 2DPIA 4IJQA 5HJEA 5FOWA 2A0FA 3V7YA 3H7IA 1R4ZA 2XHEA 1CQJA 1Q7GA 2BGMA 5ICFA 4UDOA 2DFNA 1PGOA 1K7EB 4ZZ1A 5B58C 2GX6A 2H8KA 3AM5A 3BIFA 1QNLA 2MMCA 5C1OA 3LT0A 3KQVA 3BH6A 5JALA 5CT6A 3A9VA 3OVMA 2ZREA 4B4WA 1W0CA 4K4HA 3LT1A 3MJRA 5J23A 1C20A 1PZXA 1XEFA 2YHIB 4OXNA 3FMOB 4NS1A 5AOBA 5A4IS 1SRQA 2VSQA 2DUYA 1OOEA 3MYRA 2ODEA 3O93A 1BX1A 3H8JA 4HRXA 5JD5A 4O0IA 2KJ8A 2QP3A 3AEYA 3TAPA 1JX4A 2EQ5A 2EW1A 1DGSA 4EJSC 2C9BA 1USUA 2IF2A 1I5OA 3RTGA 1QFYA 2VDNB 4W1SA 3EWSA 1U2RA 2GSDA 2P66A 5BWLA 1TTQB 4DR1B 3BREA 1FMTA 2O1EA 3LWZA 1M6NA 2ERCA 3W1WA 4AI6A 4IEEA 1ZOIA 3NWEA 1BNPA 4FGLA 3PHGA 3F2CA 3IEUA 4Y2TA 1PDOA 2Z2KA 5F1YA 2HSEA 1AROP 2Q1UA 3OWOA 4UNPA 2CW5A 5I7HA 5BVGA 2FQXA 2X23A 1Z5OA 3EXG1 4G1UC 4Q4HA 1EFDN 3FVTA 2GF2A 2PZGA 3OHAA 1M6VA 1RG6A 3GIKA 1DCKA 4FLEA 4ECWA 4OA5A 2XMGA 4WQMA 3SC2B 2CE2X 1G6OA 4TWJA 3TDKA 3F6SA 3JQGB 2G09A 1L5YA 3IRUA 1GKUB 1NP6A 2XLCA 3G3EA 4FFBB 3HL0A 4KE8A 2QMEA 4ZYTA 3O83A 1D6NA 3HCDA 1K9VF 2QENA 1VYHA 4D9CA 2MYTA 3JR3A 3WRVA 5KC8A 2B4KA 1SIJA 2BHTA 5F12A 3T79A 3LC0A 5CVVA 1Z2DA 4M8SA 5EWGA 3UG6A 3ET5A 1G5QA 3PZBA 2AOUA 3NJ8A 4CL8A 5B7PA 1SC1A 5CK5A 1EEHA 1JJ7A 3GDWA 4TVKA 1AZWA 1CF2O 1IQPA 2B8EA 3OZCA 2VDKB 2WTBA 3UJDA 4XWTA 4C8NA 3ASUA 2GZAA 1OV6A 1T0BA 1U7UA 3CURA 1Z5ZA 4NFLA 3KZCA 2VCYA 3Q4GA 3QLUC 1Y1RA 4IRXA 4IWYA 4TLMB 3THYB 1U3CA 2XCTB 4UAYA 1VM6A 3KFLA 4H4EA 1AF7A 1EESA 1G3UA 4ILKA 3VR2A 2ZYDA 3FPGA 2W2NA 2HQRA 3OCVA 4X54A 4YP5A 3V2IA 1RYFA 4F3CA 1J2UA 4D0GA 1TU0A 5CG2A 4GOKA 8ICJA 4IF6A 1KLNA 1GNRA 1OFVA 3GFTA 3R3UA 3TIXB 3WGGA 4JVLA 4BFYA 4M0MA 1YU9A 4J1TA 2R9VA 1UBLS 1SOAA 1PSDA 4EPXA 5FHRA 1NATA 6ADHA 3I5AA 3TLBA 4G1CA 5HRCA 2PX4A 4P81A 1MORA 5AVKA 2Q0XA 2Z9DA 4B47A 5JU5A 1OASA 4LECA 3OOEA 4MIKA 2WR8A 2CEKA 2DFDA 3HJHA 4QTZA 3SQMA 4ABTA 4TURA 4LF6B 3F5FA 1R8JA 1A2KC 1HT0A 2WHPB 4WK4B 2Z5VA 1R37A 4H7PA 2HDOA 3AG6A 5J59A 4Q34A 4G9GA 3QZ7A 5A3RA 3MBOA 5JDIC 2DKNA 5BNIA 4QVIA 3EBPA 4OXKA 3F46A 4NH0A 1P77A 5JI3E 3L6RA 4QLAA 4ECVA 1PBTA 1I2ZA 1PEAA 3DHNA 1BPEA 3ET4A 1SIOA 3GOQA 4XH9B 2BGNA 1XZ8A 2AG6A 4LC9A 1M7HA 5HA5A 4HB4A 1H2YA 3J7TA 1G5HA 3WTBA 3DVLA 5KIAA 2VZ0A 3I32A 1OH7A 3ZNOA 4BEBA 4ZRDA 5BVHA 2PKQO 1EDDA 1ZCAA 4QRDA 3OF2A 2FJ0A 2GZSA 1GQYA 3QVSA 1ZIYA 5DF1A 3P0HA 5C53B 3AU9A 1NRXA 1GZ7A 2JJ2A 2WTMA 5CEJA 5FWYA 4LF7B 1RE1A 2QG4A 1ESZA 1E2JA 1QWSA 3A9WA 3FFTA 3L40A 1Y6RA 5EIAA 1XZAA 2XQJA 3B3QA 3PFFA 3HNPA 4KXUA 4RZSA 4FFMA 4R1LA 5E3JA 1CUAA 1NM5A 2C77A 2IFTA 1UFOA 2NZWA 3EQ6A 3NQ41 4URHA 5DYYA 3TNDA 2B20A 2QMOA 4RK6A 4PN3A 1YCHA 4RESA 4RGVA 1ACLA 2OT3B 3GFKB 4LVNA 2ZTEA 1ESEA 4U6SA 4DCPA 5CBPB 2IPNA 4O4IA 3PUWA 4RVGA 5K7SA 5KC9A 2WJHA 4AT1A 5G2OA 2GNOA 2JGIA 2XUFA 3VAAA 3MGBA 4KXYA 3UAYA 4DLBA 4Q82A 4QJ5A 2LKDA 3RV3A 3IQFA 1A9RA 2AUMA 3K72B 3WBKA 1IPHA 2A1TS 3WL3A 2XJ9A 4JQCA 1D0VA 4RHXA 3TM5A 3W5JA 5BW8A 3SD7A 1T8WA 5KFGA 1QSLA 1FMCA 1VMAA 4FW8A 3ZUPA 2XBMA 1HYHA 1PJZA 4LWPA 5BO5A 1TZKA 1KO1A 3E7XA 3DVQX 3OEEA 5CVEA 5CDTA 1DB3A 1S9DA 1A7KA 3ZOKA 4MNTA 2JD1A 1TVEA 4V1CB 4KSBA 2R8PA 1Q7TA 3BB4A 1K1SA 1DBPA 3MWGA 1D8AA 2ZU0C 5GPBA 1KKXA 2FQYA 2JLBA 4JUCA 3PX6A 4C8MA 1FFCA 4IBOA 2VP0A 4YRTA 2ZIVB 4CCWA 4HGYA 2H3IA 4RVUA 3E48A 1D03A 3I1IA 1VPTA 4R83A 2JKZA 2V0NA 3WYCA 1PZHA 4ALKA 5B4UA 1JXEA 2BR5A 3QKIA 5AJVB 2FPIA 4FGKA 4L1KA 1U1DA 5C0YA 3BRCA 5ERGB 4IR9A 3PNPA 4R2HA 4MYHA 5C5JA 1YZQA 3KZMA 5HCIA 2FW1A 2IEGA 1TEZA 2FH5B 3WWYA 1Z4OA 1E64A 4QT4A 1R4MB 2AFIA 1KIAA 1SZCA 2H4ZA 3PLNA 4ZAVA 5KQSA 3ED5A 3B8EA 3KDSE 3ORHA 3IA7A 2JRLA 1ZIOA 5F5LA 2C22A 4EY8A 4L0CA 1NIPA 2VC2B 1LPBB 2A9OA 1R0XA 2WHYA 3CISA 4NTZA 5F7JA 1Z2NX 2W48A 1H4QA 2FPXA 3OJCA 1QQ6A 2I4IA 1JA9A 2FP4A 3QKRB 4G0MA 4IIGA 3W5IA 5CIWA 1BJTA 2R4QA 3GZ4A 4I4LA 1KYIA 4NCNA 1QHHB 3R5TA 4YAJA 5ULLA 4B82A 3QPUA 2AZXA 2QGFA 3T3FA 1L7VC 3K5WA 5AHRA 2ERYA 2FKNA 4M99A 5K3FA 3RYHA 5B7GA 1WPQA 2XVYA 2CVQA 3Q2OA 1TM1E 2C3PA 1RHJA 3F6CA 3X1XA 1FSSA 1LFDB 1R0SA 2R4TA 3HUDA 5I9SA 2LV8A 5BSMA 2GWHA 2NZ2A 2WM8A 3R8FA 2NV2B 3DKRA 1XTUA 3BXGA 1HTBA 2UV8A 5DBFA 1GGKA 1B73A 2G83A 4Z0PA 5CG1A 3ZDYB 4CF7A 1Z75A 3QZ8A 1DC6A 2PX8A 3EY9A 4DA8A 1R6XA 2A5GA 3V6KA 2VT6A 2MTBA 4OU5A 2X5NA 5A0LA 1R0BA 3LFHA 2I5HA 2CJXA 4LRUA 4R1NA 3IOEA 3D2QA 1G4AE 1ORIA 1U2DA 1WVIA 1Z4PX 3N59A 1XP5A 2VDPB 3AKDA 1NF3A 4UAUA 3K0FB 1F2TB 4G56A 5EIWA 4CCAA 4C80A 3RRBA 3ZLTA 4AG5A 4AY5A 1YCFA 2QUAA 3BFJA 1PQ4A 3ILSA 3KCNA 4MGIR 4L22A 2PBLA 3IPXA 4N4AA 4C0SA 2YTUA 5IKEA 2QY9A 1KZ4A 4FWTA 4FBTA 3V1TC 5IXJA 1ULHA 4LHEA 5AJTA 4ZVMA 3O2QB 4IF4A 4QZGA 1IVYA 2DECA 4NYJQ 1EXWA 3O9MA 5JSHA 2I3DA 3A36A 1MOZA 5KYGA 1DAMA 1GLGA 3RF6A 2WIAA 4UKDA 1XRNA 3HKEB 1TD9A 3INGA 3PJEA 1S0OA 4N40A 3V48A 1E1QA 4X66B 5CX4A 2XKKA 2BDTA 3VU9A 3N2GA 1V1RA 3H4IA 3MT0A 3I9OA 3C97A 5J0QA 3TAHA 4BLRA 5CB6A 3DV0A 2ANCA 1L7XA 5IRCD 1IPEA 2NW6A 1E9RA 4QFMA 5DTEA 3AU6A 1MW9X 1Y7LA 1O6ZA 1GTVA 1ZGGA 4XASA 1MXFA 4UD2A 2XB4A 1W75A 2OV6A 1RXVA 2W9XA 3GCGA 3OBBA 3OOSA 1M2VB 4M36A 2HQSA 3EULA 3RC9A 4Z7JA 5JFGA 1OZHA 2ZBRA 4OGKA 2JCGA 2ZSDA 5KYXA 1CRQA 3NUQA 2PO5A 1UJNA 1F4VA 3I9V6 4JVNA 3KHSA 1E94E 2A1JA 1KPGA 1ZLXA 4JUDX 4KBFA 4MVJP 3R3SA 4O4HA 1WHSB 4AO7A 3O4HA 1UFVA 2N46A 3ABQB 3H17A 1QH9A 3PWTA 4FC6A 3WYGA 1W581 4BFCA 2BFCB 1GUFA 2VOEA 2QTCA 1QYDA 1CKEA 4P35A 1DT5A 1ZUNB 3MGGA 3NVMB 3VNBA 1NJXA 2BJHA 2YS7A 2P2LA 4DL6A 3EF1A 3N0VA 3KAPA 4V0OA 3M6IA 1N6NA 4RKQA 2CKMA 2OXFA 1MOPA 3HKBB 3ZLJA 2QTWB 1DBIA 2HNKA 4LY0A 2IHYA 4NESA 3NBQA 2G36A 1EP2B 1WU8A 2X9VA 1RYMA 3HKDB 4KAFA 4W9NA 1TZJA 5A9SB 3SS7X 3GRPA 1N1DA 3GBPA 3NWPA 1IN7A 4ZAYA 4ZYYA 2X6TA 3Q8XB 1MAVA 1NKCA 4FFDA 1T15A 3B1VA 5AW5A 3TBHA 2RGCA 3RRJA 1H0HA 3I83A 4ZGWA 1GR0A 2WP8J 3EGWA 4TZKA 3UICA 3ISTA 4H4CA 2EJVA 4GZMA 4IIYA 3OJWA 1ZM4A 3OTQA 1U2EA 4JBWA 4KLAA 4P84A 4MGHA 5D5PA 5LP1A 5J2BA 3OQBA 3WLJA 2KK0A 1YVPA 3SU8A 5SICE 4RKEA 1MC1A 1Z2PX 2PTGA 2ZYGA 2HN9A 2B2XA 3KPWA 3M81A 1NR7A 5JCZA 1ZHHA 2MU2A 4LZZA 5L53A 1NTRA 1ZA1A 1U04A 2Q0QA 4GDFA 1KXJA 1T34A 3K09A 5EXXA 5JTIA 3WMWA 1RC1A 3P52A 4HS4A 5EHXA 3X2FA 2WYUA 3IT3A 1RM6C 1KSPA 2YN4A 1H22A 1QAOA 2MR5A 3PGLA 3M89A 5GV7A 4E2ZA 3P5SA 3CXRA 3R7NA 1T5LA 1O9GA 4A2CA 4C88A 10MHA 3L6EA 2YWHA 2NU7B 2NZJA 5KYUB 4CE6A 1NVAA 2LIVA 2JH1A 2GNAA 1A8UA 2X76A 3D6VA 4GP6A 2E4WA 2BTOA 3DD1A 3HV0A 2XPCA 3OOYA 5EQFA 1E8NA 1RIFA 4JXKA 3OCJA 1K6XA 4IIJB 3ZWPA 1AB6A 5JJKA 2FWAA 1Q15A 5C35A 4IO1A 4TTTS 5EL0A 5KDLA 1LU9A 4PPFA 2BMVA 4XQGA 5JV5A 1EE2A 4GWLA 4LNHA 5LL6P 2V74B 2IITA 1P1BA 3G8DA 4TSKA 2GBCA 4G5SA 3SDZA 1FNSA 1KC3A 4BUGA 1WD5A 2WMDA 3OX4A 4QPZA 5AUQA 3MWEB 3R4VA 4A8JC 4GICA 4TMVA 5TRTA 3NIDB 1NJ8A 3HNRA 3Q5GA 4RUKA 3LP8A 1VCMA 1X1CA 1DK3A 1QX4A 3LUDA 1KDZA 1N2XA 1XEWX 5IT9A 1MKYA 3C16C 1D09A 1OYWA 3TE7A 1OX5A 5EZYA 2HUNA 2WD7B 3UH0A 1DUSA 1GADO 4KXMA 1FTWA 4UZFA 3S27A 1BPYA 3FIUA 2OCEA 3N5KA 3ZHXA 1KI1A 4KTTE 1DKUA 1NN0A 5BXYA 2FFJA 4FFLA 4Y7CA 1IZ8A 4W1QA 2I65A 4IDDA 4HAUA 3HB9A 1JEQB 3IOBA 4HNHA 3AZPA 5DGDA 1LI7A 3TZEA 4DVGA 1YB5A 4YRJA 1L7MA 5ALXA 5CGZA 1UJMA 3JV7A 3KS9A 5A0VA 4Y9SA 2Q6TA 3EWIA 4EW6A 1V39A 1DK2A 1KEVA 1UZLA 3ND6A 3UMYA 3LDUA 2QW0X 4HDAA 3UKJA 1YRLA 3NTRA 1ZQWA 4LJXA 3QMMA 3P0RA 1THMA 4R1UA 3ZLBA 1V3UA 3OJUA 2BKXA 2DBVO 4CCHA 2FWBA 4NS4A 1YR9A 4PXSA 1GTMA 4AJJA 4D79A 3TGLA 1WUHS 1E6MA 1XB2A 1E5LA 1ZH0A 2I9PA 4P4GA 1P4RA 3LT4A 4P86A 2HA7A 1QYWA 3ZZ0A 5A3JA 3BGSA 5AVTA 4C22A 4ZK2A 3UN1A 1XZBA 1V41E 2Z08A 4F8EA 3V46A 2YXBA 2KVCA 1VIDA 1HDEA 1Q2UA 2CNWA 1ZQJA 1TC2A 1U7DA 1CDOA 2X5KO 1QHNA 2AEJA 2DWQA 2O2ZA 3EZGA 4XQ0A 1Z0ZA 5JYDA 3EW9A 1AQNA 1YTUA 4JBIA 1CNMA 1C0PA 1IHOA 1HRDA 2FG7C 2FY8A 2H00A 3FHCB 3N6VA 3OJEA 1C1DA 4JLKA 5C3UA 3SKVA 5BSWA 1GTRA 4NLLA 1VMKA 3UMSA 4OHXA 4KDRA 3M7IA 1YMUA 2AH5A 1MDFA 1F7VA 1KZ1A 2B1GA 2PMCA 1T3NA 3RV4A 5T5QA 3USZA 1E59A 4ZJYA 4N7MA 4R9SA 4XQ9A 5ALDA 2IK8A 5J5AA 5H3CA 1O6GA 1K27A 1G7RA 1S3SA 2VWGA 4FVTA 4KUEA 1NX6A 2OHVA 4L08A 4R05A 4DDUA 4LRSB 4OKSA 3CX8A 3FPHA 2QTZA 2FU5C 3S28A 2F1HA 1F20A 4LYFA 5TX7A 4C0AC 4LXTA 4LZNA 1R0WA 5KFFA 4S2UA 5DVZA 4DAEA 2D54A 1J70A 2E1PA 2YCLA 4JROA 2RGGA 3U9LA 1KDHA 4GFJA 2GRUA 5HJ2A 1TYCA 2I87A 3FHOA 1IN5A 1TRHA 3OFND 1ADCA 1PFUA 2GEBA 5IDQA 3RFUA 2DM6A 3CPJB 3FNIA 3RBEA 2X6QA 2X0IA 2CNKA 2HK6A 3PXGA 2HBLA 2D2XA 4L16A 1U0FA 4A6PA 1I7LA 1P74A 2C2KA 4G8CA 4RJTA 1BOFA 4PV7A 1WPXA 5ER9A 5I9LA 4C8OA 2A4MA 3E6AA 2HDNB 1LWOA 2IIQA 4LZOA 2AA3A 2X3UA 2YHUA 3DYBA 3OJFA 4MJ7A 3UJPA 3FKSD 1JQAA 2J67A 2A33A 2ZBUA 1TQ6A 3OECA 4R2KA 4W5JA 4C4YA 1RZVA 1VLJA 5DLDA 4A0FA 3M5PA 3GZNA 5EHNA 1A9ZA 3GLQA 3DMDA 4FTWA 4MUGA 1C7ZA 2PUVA 3VHRA 1TKDA 3RT1A 5A4KA 4TZ6A 3OZIA 4F96A 3A05A 1CHDA 4KYTA 5KFAA 3IKJA 2FMSA 3H1FA 2P1ZA 2AIRA 1JJFA 5KOYA 2OQVA 4CW7A 4EUEA 2HA3A 5JECA 4L5YA 4XWAA 4E33A 3CVYA 1NUPA 5KFVA 1ZM2A 3TO5A 4C6TA 4PX9A 2XYVA 1L5LA 1GD1O 4LJ6A 2HPZA 3QVJA 2C8LA 4O29A 5CVTA 2G9RA 4FINA 2WNIA 4EBBA 1GOTA 4ZI2A 5JVDA 2POQX 1XSLA 1X7ZA 2JFHA 1BW9A 2ZE6A 2WJJA 4AYXA 1GAQA 1PD0A 1A2BA 2WDPA 4HWRA 5L3QB 1SG6A 1OUQA 4H08A 1D9DA 5AM1A 1P17A 1TOAA 3NNDA 4NKRA 3LWBA 5MGBA 4OB6A 4IV5A 1HG0A 2J0EA 2O07A 4LZWA 1QLNA 2GM9A 4S1NA 5C8YA 4M0CA 4QQKA 2AJDA 2EJBA 2A92A 2QW1A 4C76A 4Y9UA 1PAUA 4IO0A 4D3XA 1N78A 2PSSA 4MFAA 1DXSA 3GGSA 5CJJA 3R0ZA 5SY4A 5EUCA 4BAZA 3ROPA 3TADA 2HZ7A 4QBKA 3UKOA 4CU5A 1M6VB 1DEAA 2H85A 1JDPA 4J07A 1KEKA 1JEEA 4G0YA 1NF8A 4TS1A 3ZDCA 5DM0A 3L79A 4BQQA 4QZDA 2WJZB 2P9TA 1ZQVA 3G0CA 2SBTA 3A1TA 4XVUA 4LJRA 3QJYA 3ZV5A 5EOZA 5AUNB 2A1TR 4QW8A 2WPNA 3N28A 3UEOA 2W11A 4RQ0A 2FFBA 2DQNB 1KI6B 5IT5A 4BO5A 4QXQA 2I91A 1JYEA 1VDZA 2QSZA 4DLAA 4G5OA 5JUWA 1A2QA 2KWIA 1DTEA 3MCWA 2IBSA 4DL7A 2LD4A 2HJSA 2IRWA 4FR2A 1L5HA 4Y6LA 5FWYB 3CYFA 1KI2A 3CZ9A 5CGQB 5KI6A 1TM2A 4YXMA 1QH8A 1TL7C 3KZVA 3HSYA 2QE7A 1MH1A 2ZRQA 5H5JA 3GA7A 3UV3A 3AFHA 1ZDMA 3HSSA 1ZNZA 5EWJB 1R6DA 1O8BA 3NORA 3GP8A 1KPIA 4QT0A 2FX3A 4JI4B 3REOA 4Q4AB 4QWDA 3RF9A 2ZUDA 1R12A 1Z73A 1Q57A 1Q77A 2IPOA 4NCJA 3AU8A 1HYGA 1OU0A 2R5NA 3MPOA 4J1TC 4NP6A 4QG7A 3FG9A 3RSOA 4P82A 3W5AA 2P3QA 4RQNA 3O0FA 3F3SA 5IS2A 1QU3A 2PS9A 1SVMA 5SYAA 3OEHD 3I6BA 4UBLA 1P7YA 2IYQA 4DGSA 4UVEA 2QJRA 2PI5A 3RJFA 4Q4JB 4BQPA 4TQAA 1QE3A 2GHTA 1XTIA 4WLFA 4S35A 1FUIA 2A1UA 1O94C 3ROFA 2HFKA 3EGIA 1IG6A 3S2GA 3V00A 3X3HA 1Z26A 2YZ2A 2WAXA 3AFNA 3K96A 5FRDA 5LQDA 1Y9DA 2MSKA 1MJFA 3SHOA 1MEEA 3RBVA 1XAGA 4Y2GA 3O8NA 4MKRA 5HQ3A 1WXHA 4H6PA 5GIOE 4UXIA 4E09A 1PX0A 1ED1A 2WIFA 4WHMA 5DEOA 5AMXA 3RVJA 3VU3A 4MEYA 4OXRA 4RCYA 2HRCA 4MSUA 3ICVA 5JAUA 2UZ1B 2PGIA 4MS4B 3BRSA 3STVA 1Z63A 2PX0A 4GNRA 2R8OA 1JRPA 3VR5D 3LCRA 3X2EA 4R81A 3WLTA 3U13A 2C2YA 3CZAA 5K6AC 3RJGA 3TIVA 3PGA1 4P92A 4JWTA 3O4VA 4IJ5A 4NJOA 2JEIA 2NSLA 4IAOA 2IU6A 1J4AA 4CMIA 2CUKA 1N2EA 4O6VA 2C9DA 1SKUA 2QRVA 1XZDA 1SJ9A 2RI6A 3H04A 2QRPA 4RY9A 3OT4A 3TF5A 1JMYA 2OP1A 8AT1A 1C4OA 1EFVA 2A9QA 2SHKA 4GE0A 5CJ2A 3IE0A 3QKRA 4EW2A 2GVZC 5G3ZA 2VJBA 5FR1A 5H4HA 4D5EA 3MGCA 2ONYA 9ICUA 4YV7A 3SQXA 2YFYA 4QKQA 3CQ9A 1QHIA 4PRYA 1X7GA 2JBWA 3QELB 3SKXA 1NYTA 3ZI0A 3TSCA 3FMGA 2LTAA 3MYYA 1GT6A 1PV2A 4UU8A 5ISMA 3QLJA 2VDRB 3IKTA 3QVKA 3ROXA 5FL3A 5AJWA 3IO3A 4KIFA 5EIBC 2YW9A 5GJBA 4OFZA 1QIDA 3C29A 4DSEA 3I72A 2GSWA 2QLLA 4ZAFA 2J3HA 3WK6A 3WMFA 1Y4DE 1O4VA 1XWIA 1RM0A 2A88A 3IBGA 2GJ8A 2Z5FA 3IE2A 1KA9H 1CJMA 3P94A 4G67A 1ZQNA 4IFEA 1FC0A 1S1CA 4C5BA 2OPHA 4D4GA 4F2RA 4YPVA 5KX5A 1IVNA 4B3MB 3O2SB 4GVPA 4JJ6A 1KJWA 4MVJE 5FORA 5TGTA 5LD2C 2G4VA 4WZAB 4GXRA 2BRUC 2QT1A 4PZOA 3EVTA 4QPNA 3MR6A 3E61A 3ZD9A 1ILWA 1LC3A 3ICPA 4QGHA 3WGMA 4B9SA 2O5VA 3KKNA 5DG8A 1JLMA 1F2TA 2XUGA 4KK4A 1T6BY 1Z83A 1N3YA 1ZJNA 7ICTA 2D2FA 5AM5A 3AMVA 3GX1A 1PEYA 2ID4A 4YR3A 1UXHA 3LXMA 3Q2KA 4GLBA 3KWLA 4J2TA 2HHQA 1G8YA 1Y6JA 3LM8A 4Q00A 3R75A 3WGOA 2HGZA 3KKAC 5ALPA 2G1UA 2ON6A 2WB4A 3IHQB 1E5TA 2LZ0A 3A1CA 4Z7OB 1XC9A 3OMLA 4IIVA 1RWVA 5D49A 3SSAA 4LVUA 2P1RA 1C3LA 4KIJA 1JN0A 1SVSA 1GCUA 1N4DA 2OP0A 1CS4C 3A28A 1R4MA 1ZBDA 4INOA 5GJWC 1I2CA 1ZQ1A 2IIVA 3IBSA 3KR9A 4N12A 5D3MB 3LG2A 1IUPA 1BX0A 1E4EA 3H05A 4NX2A 2G9QA 1E3DA 2IYFA 3HYCA 1A97A 3P26A 1UEXC 4BTVA 3VKHA 1DV1A 2FPOA 4ZVRA 3P9ZA 2BZ1A 4WNCA 2W0SA 5KFBA 4KMUA 1ZZGA 2YV3A 3EC2A 4OFXA 4XLLA 4YHBA 3KPVA 3MVEA 4AJOA 2Z2XA 3HY6A 1LLDA 5C8YF 1AKQA 2FW7A 3Q2IA 4ALJA 1E1QD 1WZEA 4K0RA 2D1QA 4I2EA 4OHMA 4MV7A 3ZKAA 4EYGA 1NI3A 5KPDA 5B66U 2B6NA 4CM6A 5FCDA 4HMOA 5FBVB 2XLBA 4N7JA 4CTOA 5A7FA 2EP7A 1USVA 4NL4H 3HCNA 3CLSD 3NKFA 2IE0A 4NATA 4OUKX 3VPDA 2E8OA 3KZXA 2FSVA 3NBYC 2GA8A 4EPRA 3DXZA 3N58A 2OEPA 2OUIA 1DO8A 1ECWA 1RPLA 5DHSA 4C5CA 3KTQA 1PR0A 3ML1A 4FCTA 1HE8B 4Q18A 1M1ZA 4JK1A 4R66A 2VG8A 3BULA 4YT2A 4KHZA 2Y66A 3PICA 1ZOPA 2DU8A 4Q9HA 5KYNA 1SRRA 4R8RA 5CX1A 4ZZ3A 9ATCA 1MW8X 1G1MA 2ZUEA 3JATA 1PVVA 2FVYA 2AMFA 2GMWA 4F8JA 1YVDA 4GDMA 2C7PA 2G7ZA 2REQA 2ZIXB 1TZ2A 2R8ZA 3B7WA 4RU1A 1M10A 3K0KA 5CLQA 1D2NA 1P3JA 3DVAA 1H6BA 4A1OA 5C1DA 4WINA 3QBJA 1ZYUA 1SKYB 2KYRA 1D8TA 4YWJA 4Y30A 2QM3A 1C9JA 3BTVA 1ULTA 4YJHB 5K0ZA 1QGUB 4KLOA 5J2CA 2MSEB 3RFTA 4UZEA 2FMQA 3M6UA 1NU6A 3P9SA 3INTA 3DTYA 3QXXA 4NONA 2VYVA 1JLRA 2BCEA 4UVHA 4LDAA 4ZVPA 5BOSB 2C99A 1UXKA 2FVXA 1JHAA 1C14A 4YV2A 4RUCA 2OTCA 4HEQA 4BNTA 3CC8A 4Q4DA 2CNBA 1RRGA 2FSFA 3I4CA 1IPFA 3GJ4A 3LC1O 3P9NA 3WQBA 4P3XA 4QZEA 2Z95A 3RFXA 3ORSA 1TK8A 3IQXA 2VA2A 3MGKA 2RP5A 1X94A 3NM5A 3FD8A 4O59O 3RJMA 4B80A 3RJ9A 1CUWA 2NVWA 1KH3A 1NJ6A 3QOWA 4JCOA 4I81A 3ZQ6A 3K6SB 2VPYA 4XIYA 3FYHA 2HHUA 4F7WA 1UJCA 3E5MA 2DKFA 4PLPA 4HYYA 4Z4CA 2NP7A 4C6HA 3JQGA 4ZODA 1ITZA 3BMNB 1TUBB 4JGGA 1NUTA 2RJOA 3H4VA 4OEHA 2P4EA 1WHSA 3D4NA 4C0LA 1P6XA 3AGPA 1PF7E 2WF7A 2G8NA 3K8OE 4IIUA 1CF9A 2GYYA 1PVPA 2WF6A 1EDOA 3C1ZA 2EKBA 1J5PA 4QYTA 2D6FC 4ND6A 5EPUA 2VSOA 4IQUA 1RVDA 1E1RD 1M0WA 2C5GA 4P0TA 4OBXA 5FUBA 5CW1A 1PNTA 2A1IA 3ANYB 4JLSA 4W5WA 3W78A 1JKXA 2J4FA 5IH3A 5DM4A 4DV6B 3KQTA 1M0TA 2AOVA 4MUYA 2E55A 1E77A 1XEXB 5CH5A 3V5NA 3ZU5A 3VR4H 1SKWA 1YSCA 3WAGA 3CW2C 1VKOA 5EMMA 2G6TA 5KPJA 3OQVA 2WIJA 4RD1A 3DOFA 3ZUGA 3DAFA 4PYOA 5E0KB 4C7MA 1GPYA 4UB8U 1P1FA 2NUBA 3L3BA 4M8NE 1COWA 2F9FA 2XRZA 1E79D 1N9GB 4ECYA 2CVFA 3CT6A 3NXKA 1NJGA 2R1ZA 2NU9A 1V4NA 1LXCA 1PNQA 3N0WA 2WAMA 3KC2A 3THWA 4LDZA 4EUHA 4Q1FA 2PT7A 4IQTA 2IEIA 4B48A 1KAEA 4JWMA 2JC3A 3FLEA 3Q88A 3U56A 4LFAB 1WTCA 1TQDA 4Z9AA 2R1TA 3HVIA 1JR6A 1QS0A 3KL4A 3RARA 4WLEA 4NLBA 2RH9B 1SC3A 4X93A 4DY6A 3A25A 4KV9A 3BMCA 3PB3A 4QBIA 2XCAA 1F4PA 3AHGA 1AIPA 4FLFA 4P34A 4RD3A 3V8VA 4CT0A 3JALB 5A4MS 2ABWA 1IU9A 1QFXA 2PD4A 3DTVA 3KAJA 1XPJA 3HDTA 4KFSA 3DDSA 2DKOA 4UQLA 1DS6A 1M8PA 1QHYA 4B83A 4ER0A 4BN4A 1QOQB 5K5EA 4PSCA 4G86A 5AP9A 3GUZA 1C3OB 4FFBA 4R6XA 4ROSA 1C9DB 5AKEA 2WWRA 1OKKD 2PU5A 2RH5A 4G1BA 3B9BA 3EJWA 3OZDA 3WYEA 4JXXA 4MQ5A 4K28A 5EG5A 1NC3A 1O9BA 2ZUBA 5KL1B 1Z2AA 3PJGA 4F97A 3B9JA 1JMVA 1RR6A 3UMCA 4AJ1A 1DBWA 5BN1A 1W46A 2XMPA 1CPYA 3LCVB 4FS1A 5TSDA 3MHPA 2ZBQA 4O3QA 4Z6DA 1XWWA 2W3SA 1IOLA 3SBEA 2I4OA 3W6OA 3EF3A 1HQDA 3LVVA 1YJXA 5B2ZA 3L43A 4WVFA 1YFLA 1XDDA 4FDAA 4EATA 3VA7A 2BELA 4LWQA 5CCEA 5FOQA 3QLVA 4UEQA 1DKQA 1TGYA 1ZY2A 3I53A 2VCEA 4LTNA 4HNAA 5EUBA 3U37A 2XBUA 4X1IA 3GV8B 1ZQXA 2XI9A 1BXZA 2VSYA 1O2DA 3L4EA 1S2LA 1SOMA 4CMHA 2IGBA 1X7XB 1GGMA 5JO9A 1SBQA 4JGBA 1OPRA 2Q45A 2V5VA 3OQ1A 4OU4A 2J32A 2MYNA 3SE0A 3E9CA 1M75A 1R00A 1QYCA 1Z74A 2HHLA 2HIHA 2Q9CA 1E99A 4OJ6A 2Y1OA 4HQOA 2FGJA 4ZHQF 1NDUA 4US9A 1XTPA 4PZZA 4B7ZA 3F1KA 2FMTA 1YRHA 2NOAA 3HGQA 4QQ8A 1PK3A 1UQTA 2IJGX 1I3MA 4M1MA 1VKJA 3ZHTA 3FWPA 1WXQA 2HK8A 2DBZA 4ZQEA 1XMPA 1QTMA 1KRPA 4KO2S 4C7VA 4HXYA 3N70A 3SYLA 4WZBE 3RC8A 2QARB 3E4CA 5WRFA 1UA1A 3SX2A 4Q8EA 1PWYE 2Y0DA 2Q1YA 3MOSA 2GPTA 3CF6R 5JBNA 3H99A 1O1YA 2M0NA 2CYCA 1LPPA 2FZLA 2JGDB 3D7NA 4A3SA 2CFSA 1ATIA 3H6GA 1V8FA 2HBYA 2XKJE 1WDWB 2HOQA 3GZJA 1N2OA 1TLLA 3GW8A 4GR5A 4JI3B 1NZJA 3C7DB 4DA7A 4R2MA 4YAKA 4EJSB 2W4QA 3DUWA 5AW7A 2ATXA 3IT1A 3L8CA 4RW0A 3U80A 4LG1A 2E48A 1MX3A 2AFIB 2AK2A 3PNLA 2H5XA 5JNWA 2DCMA 3OZBA 3I5UA 1WMEA 3LVWA 1G8FA 2XUZA 4HZGA 2FUNB 4QBGB 5FPQA 3WRWA 2Q8NA 1VSQA 3Q3EA 1DEXA 5GOZA 4IH4A 2C31A 4YS6A 4YC7A 4DA9A 1PUJA 4MPTA 2QD2A 4PYLA 2P5SA 3L7DA 5ANRB 4LK3A 1TVCA 1SZDA 2CJFA 2NUPB 3R3WA 2YJZA 4JL6A 3THVA 1AGRA 3DZFA 4XM2A 4BP3A 5BXQC 1DUVG 1CEEA 4GX2A 1W6RA 3GMIA 3LQ1A 3HZOA 3H5RA 3PE3A 3S6JA 1PYDA 2I8LA 3MFIA 1SHZA 2H54A 4I55F 4PPNA 3T95A 3TZQA 4BE7B 5E6RA 2K6GA 3QU5A 3RAEC 2WJWA 7ICKA 4NZPA 1UK9A 4F5NA 4GL4A 4I5GA 3NVYA 3ZDAA 4ZO9A 1QQ5A 2Z6VA 4I1YA 4U7HA 1MA7A 1JMKC 3QA9A 5IK2A 5EJ6A 3G79A 2ATLA 4JC5A 4MICA 1U8AA 2P9CA 1C3VA 5G3YA 4D41A 2WVJA 3QHPA 3UWPA 5BMVA 3IUJA 3IOYA 2OZEA 1PV4A 4NOLA 5F3RA 4CKBB 5I7EA 1GTL1 3MRSA 5DGHA 2XUHA 3QPCA 4MI9A 5KHOC 1E5QA 1PZFA 2JDID 1RAAA 3MAGA 1NLZA 4NAUA 3KYJB 3WNDA 4HDRA 1SWVA 3GJ5A 3W7BA 2AL7A 4XIFA 3DAGA 1VHJA 3VVMA 4MV9A 4EA7A 4HDKB 2P2YA 5KNDD 2I1QA 2VYNA 2JI7A 5G02A 2JI8A 1C0KA 2WZBA 4OJQA 3NRJA 4B33A