2OMLA

Crystal structure of e. coli pseudouridine synthase rlue
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
182
structure length
181
Chain Sequence
b'NQPTRVILFNKPYDVLPQFTDEAGRKTLKEFIPVQGVYAAGRLDRDSEGLLVLTNNGALQARLTQPGKRTGKIYYVQVEGIPTQDALEALRNGVTLNDGPTLPAGAELVDEPAWLWPRNPPIRRKSIPTSWLKITLYEGRNRQVRRMTAHVGFPTLRLIRYAMGDYSLDNLANGEWREVTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal large subunit pseudouridine synthase E
publication title The Crystal Structure of E. coli rRNA Pseudouridine Synthase RluE.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 47
structure length 181
sequence length 182
ec nomenclature ec 5.4.99.20: 23S rRNA pseudouridine(2457) synthase.
pdb deposition date 2007-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00849 PseudoU_synth_2 RNA pseudouridylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2omlA01
3.30.70.1560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-L RNA-binding motif 2omlA02
1DJ0A 2OLWA 1VIOA 2NR0A 2GMLA 4IQMA 4J37A 4NZ6A 4NZ7A 2NQPA 2NREA 4ITSA 1VS3A 2OMLA
chains in the Genus database with same CATH superfamily
2YWKA 2QEXS 3TEGA 2RKIB 5BR8F 4DSFA 4F26A 1LXJA 2KU7A 2GMLA 1AZSA 3EJMA 2Z2ZA 2WOMB 1FA0A 3W8GA 1O51A 3HFKA 4NL5A 4MKAA 2YX4A 2KJWA 5HMWA 1IJEB 2GHVC 3CDWA 2E1MC 1LWEA 1N5YA 4TYBA 1GEHA 2BKNA 4B08A 2YBVA 3T5LA 4G1PA 4NI2B 3UDCA 4P2MA 1O6XA 4DQRA 2VL1A 1RHRB 2KZMA 2FHMA 1PJ6A 3T9NA 1HLWA 3OTDA 3N6MA 3BEGB 4X4SA 2EK6A 1X4CA 5KFVA 3R5GA 3QZ8A 4O23A 4DV4J 4OHZA 1BY9A 3MR5A 4OL8A 3PFOA 3NWRA 4L76A 2HWIA 3LWMA 1IKWA 4DUYF 2MQOA 4CTAB 1S1WB 4YN3B 2LU1A 4KPYA 4PG5A 1SQFA 3OL9A 3LGNA 3KDNA 4HTIA 1F9HA 2QMWA 5KFJA 2XULA 3CDUA 1MMNA 5EGYA 2KTQA 2B9XA 2NUUG 4FPRA 3F41A 2DY9A 2EFNA 1JXVA 2ZOFA 3I4HX 2R7TA 3K5OA 3DLEB 3R2CJ 2LXFA 2P9GA 2HHHF 1IBLJ 3DN9A 4NZ6A 2PEHA 3BREA 1RAAB 2U2FA 2OPRA 1RA6A 3TQEA 8AT1B 2J8SA 4AL7A 2JJ4D 3CSKA 1M1KT 4USTA 1LW2B 4ZLLA 5K5MA 1G7CB 2HS0A 3BN7A 1VMBA 3JAMU 3O5TB 2XGQA 4RWXA 5HP1A 3ET6A 5KFKA 1WWHA 3DXSX 1J27A 5KFIA 3KOAA 5DM7Q 5J2PA 1RWNB 3B78A 1N32J 1WF1A 3HSJA 4DR4J 2XY6A 4FYVB 2BJEA 3M32A 4OZ1A 2H54B 1LWFA 3I56S 1TL5A 4WFAQ 2QC3A 4DF4A 1B99A 2AQ4A 2HHUA 2FGOA 2HFUA 3IGVA 1UW9A 2HNYB 1DTTB 2JHEA 3A3OB 1IKVA 2VICA 4CLTA 2CQBA 3G6ES 4ZP9A 5I3UA 3HULA 3I31A 3H2VE 2ZHOA 4FVCA 1RT3B 2E1CA 1QLNA 4LBIA 1JLCB 2HLTA 2EKYA 1WHYA 1KONA 2AZ3A 2AJ4A 4ZLPA 4LF5J 4LQ3A 2MGZA 2RU3A 1LFWA 3K57A 2PMWA 3D1HA 4P7VA 3CD7A 3Q2TC 3DGPA 4E0DA 3OFHA 2FVSA 3IR6B 3UN3A 4ED5A 4X2BA 1YGYA 1V9OA 3JQKA 4KC5A 4CLZA 1U48A 1YG0A 1XR6A 2KB2A 1YJNS 2XS2A 1OS5A 2AYGA 4DL2A 3PR4A 4TLQA 3ETMA 3I0SA 1U25A 1ZA2B 4MIAA 2W7OA 3K58A 1UVLA 2IA6A 3F73A 1TUGB 3C6UB 1MWZA 1VIOA 3AOAA 3I5BA 4PWWA 2ZE2B 3D6MB 4JBCA 2XTJP 3PZPA 1F1BB 1QAXA 1ZS6A 1JLQA 2VC0A 1KTVA 3MM8B 1VQ4S 1U1PA 2JEIA 1YZ7A 4R5PB 4J9OA 3TX8A 4MMOA 3SI8A 1KVIA 3TUJC 1JK9B 3KUGA 1R0AA 3GYGA 1S1XA 1WJ9A 4W98A 2AKWB 4DU8A 3CIZA 3HJVA 1YI2S 4RLEA 2LYVA 2X1BA 2BM0A 3GSIA 4FDFA 2QL7B 2J6UA 3KLIA 3M8SA 3W65A 4NLQA 4KY3A 1TAQA 2M3DA 2HVDA 2DNRA 5LXRA 1LWCB 3MMCB 4LVNP 1RSCA 5E5NA 3CCTA 3CCQS 2Z2LA 2GQ2A 2BE7D 2CXEA 3VV2B 3OFFA 1NLKL 3TJAA 3RB6A 5F8HA 2RE1A 3D5MA 4ID8A 1H2UX 3IG1A 1HBUA 1EX8A 1SC4B 2XQCA 2W4DA 1M5PC 4N56A 5C25B 2ZNYA 1UFWA 4NLVA 3OVAA 2N7YA 3AD8C 2QA4G 3V5RA 5SZTA 1Y00A 2EBGA 3UN5A 4DR6J 2OPSA 3A8IA 4NLUA 2ZH1A 1TFWA 3N5BA 5CCLA 4Y34A 1MNEA 5FJ4A 1PYSB 2HHPA 4TY8A 4ZIWA 3BN4A 4JI6F 4HKQA 4ZP8A 3AXMA 2AGPA 1QSSA 4X65F 2KFZA 4PG8A 4MK9A 1KQSR 2H4WB 4FXWA 2J0SD 1FE4A 3I82A 3ZTOA 4OI0A 5JJBA 4U8YA 4IH5A 2ZD1A 1YBUA 1VGYA 4WFYA 2R8KA 2AU0A 4TLRA 4A4JA 5IWAF 3LF0A 1BQMA 4J9PA 4OX8A 1I1GA 1N5QA 1NJXA 2BDPA 1HBNA 3PYGA 1U49A 6AT1B 2JLFA 3OD2A 3AXKA 4M5NA 1FKPB 1AUSL 4PQUB 4CLYA 4KKOB 1NSAA 3SMZA 2OI2A 5LMUF 3L4BC 2WZ1A 4UQTA 1KHWA 2IVFB 2CQ2A 1WSRA 3KK1A 3PY8A 4DQPA 2OJ3A 2EFGA 3KFWX 3KJQB 1CJKA 4ZPTR 3M2VB 4RW8B 5DZ6A 4ED3A 3ETOA 2DNZA 2FHJD 2JNJA 1RHUB 5FDLA 1Z2LA 2E5LF 2MZQA 3IAM9 1CVJA 1TUWA 4WTYA 4XO0A 1U7LA 2NXNA 4PUOB 1XJWB 5A0YA 4TXSA 1V6HA 1TKTA 3N9UC 1MMLA 4C11B 2FDNA 2HGNA 5KT6A 1S4EA 2HPUA 2D41A 5IFMA 1S1UA 2X3DA 3QWUA 4UW2A 2HQGA 4WPAA 4QIVA 3T41A 2J8AA 1Y10A 1RZMA 4KH0B 3H2LA 4RUAA 4I2QA 1A7GE 4ZPWR 1SUQA 5L1IA 4C6AA 1XEZA 5AE1A 4I6AA 3JS9A 1FVQA 2IRYA 2CQDA 3CJTA 2L3MA 2IM3A 2IRUA 4KGVB 3LP1B 1YVFA 3RGIA 3H42A 2ADBA 2M0GB 2ROGA 4RNOA 2VASA 3HCXA 1FDAA 3T1AA 1RT4B 3DOKA 2C3MA 3RR7A 5KT2A 2B5JA 2GMJA 1HBOA 2BRKA 4J90A 2GO8A 1URNA 1JXEA 4CLSA 3J80U 4I64A 2VFSA 3CC4S 3I55S 3IFEA 4WU2A 3PX0A 2UUWA 2QGFB 4YR3A 2QMUB 2JH3A 2A6MA 5IV4A 2GNKA 3EPIA 2YH0A 1X9WA 1KSPA 1DAXA 3RR8A 1RADB 1AFIA 3DRXA 4B02A 1PJ7A 1DZ5A 1H2VZ 4EO8A 2CPIA 4FBUA 1WC6A 1T9WA 2YQ0A 3C46A 4QOTA 4UOCA 4HACB 1A0OB 2K2PA 5LSOA 5L9XA 1FRHA 3D68A 1MU2A 1Q78A 2W2PP 1MMDA 3C15A 3LAMA 5HROB 2YH1A 2DB1A 1X4DA 2B9WA 3RRKA 1TL3B 1H7XA 3BQ2A 3BB5A 4F4ZA 1RYRA 2DISA 4YFUA 1KFDA 3L7UA 4WE1B 5EX3A 1HNWF 2HQCA 1IBKJ 4B9VA 1TTHB 5CD4A 4ZCMA 2F4VF 1WF2A 2GGPB 4P73A 3RG6A 1I3OB 4XPEA 1MLAA 3HP6A 1ZPVA 1M5OC 2PDAA 2UV8A 2K3KA 4PPZA 3LTOA 4KPCA 2DGOA 1U1MA 2LEPA 3GFYA 3G6XA 5HQMA 5KG1A 3FSXA 1FI4A 2V4JA 1U4BA 4X65J 2DHGA 4OX6A 4ZP7A 3ICLA 4BS2A 1C1CA 3T3FA 2MY7A 1M5KC 3T1YF 1GMVA 2DKOB 3RW7A 3ZZPA 1X31C 1HD1A 5LL6d 2DPJA 4ED4A 4WZMA 3DU6A 2FY8A 1NMEB 4HI2A 2V67A 1RDRA 5IV3A 1AUDA 3A8JA 4CNYA 4EGLA 3QLHB 2EG2A 1NXIA 3Q23A 5E3QA 1FFWB 2ASJA 2YKNB 2UUAF 3CO9A 2Y8YA 4DL3A 3CVKA 2KXHA 4QU6A 1RUSA 4DSKA 1OQ6A 1DBDA 2J0XA 4GVBB 3RBDA 5KFPA 2J0WA 2P6SA 2WVBA 4Y3CA 4LRFA 1U1QA 4DV3J 2IM2A 1HPZB 3MD3A 2KG0A 4GO5X 2UP1A 4OI3A 4ZJQA 3V4MA 3DRRB 2G1DA 5I42A 5HATA 1C1BB 2CZ9A 1VQSA 2ASYA 4HDGA 2YNFA 2O5DA 4KO0A 2NREA 2VHGA 5HO4A 4YEAA 2QG9B 3DMJA 1UPPA 4MFBA 4ANDA 2EFVA 4N76A 1Y5IB 4UQGA 3I32A 1DLOA 3VAGA 3FMWA 3IN5A 3PIOQ 1KP6A 2DNNA 3GFZA 2HRUA 1ZAXA 2HRYA 5DG9A 2LMIA 1SJ3P 2AT1B 3KNAA 5F8MA 3G2XA 5E3PA 1JLAB 2FVCA 5K9FA 1RT2A 4USUA 2YNHA 1RT5A 5K8OA 5F8IA 3G6YA 2MTLA 1FK9A 1N0UA 1K1SA 1CULB 1KOHA 2KYZA 3BF4A 2MZTA 2HNZB 1WC0A 1VQOS 5C2GA 3RTVA 4C2MA 4K4ZA 1F3VA 3I0RA 4D3HA 3CDEA 4K0KJ 1IM6A 2Y9HA 3PHEA 4Z37A 4O3RA 1Y5NB 5A76A 5J2QB 2AD9A 8ATCB 3W2VB 3OVBA 3GIRA 1IKXB 2RMLA 4P2XA 1KQGB 5IC4B 2B9YA 3BGRB 3JTOA 4F3QA 1GH8A 2ZOGA 3DRSB 1TAUA 4NPOA 5J1EB 4DPXA 1WF0A 3KXDA 2KM8C 3DCAA 5F9NA 1VBYA 1CJTB 4RUHA 3H90A 1QUVA 4JYAF 2VKZG 1HW8A 3DYAA 1G6BA 5MAOA 3AH6A 1W25A 3MFIA 4QWEA 4GKKF 4AUKA 3UCGA 1VYAA 4ECVA 1WDTA 5KG7A 4BC9A 5FD1A 5KFOA 1B0VA 3GG0A 4Y2IA 3FSYA 1HD0A 2ZUGA 4HEA9 1KNZA 1VQMS 3R6LB 2V8HA 2KFYA 3U1LA 2HYIB 1VK3A 5B0BA 3UR0A 1JNZB 3VF0B 2V63A 1U6ZA 2YQ3A 1XNRF 3OHAA 1RT1A 4ICLA 3PRBA 4JI0F 5KOWA 4NEYA 2ZITA 3N79A 4PYAA 3GP9A 3DM2A 1GQEA 2BOPA 3O6QA 3IBFB 2UUBJ 2WW4A 3KLEA 2Q79A 1X5OA 1FF2A 1TELA 3AD9C 1M0SA 5B08A 4RW7A 1SH0A 2V5HG 3OUYA 1YBTA 2FLOA 2XB2D 2HS3A 3K5LA 4DEZA 1HNIB 4IOAQ 5HJYA 4P7TA 2D3ZA 1HI1A 3BO4A 4ZPAA 2KH9A 4NLXA 2A1BA 5I4MA 1FXLA 5F3ZA 2ZE2A 3G4SS 2AGOA 3KLVA 2UUAJ 4OI2A 2CNOB 3H40A 1PCAA 2J6TA 3W64A 4LVOP 3OLBA 3TJ8A 4C97A 1MWYA 3JSMA 3CT9A 4DV0F 1RWWB 3BGFA 2RJZA 3ZZRA 4DSLA 1KVJA 2G0IA 4B3OA 1FEEA 4RW4A 3CWJA 4LSNB 3ZZUA 3MUVP 2KZZA 2JRSA 2CQ0A 3M2RB 3PG9A 3PEJA 1GXTA 4J7CA 2IPOB 4DPWA 2DNKA 2VPXB 4F4KA 2KHCA 1ZM3A 1JQGA 2W2NP 4S0MA 3W62A 3BS9A 4DV7J 3TZYA 4RWWA 1K9MT 2LXUA 2CADA 2YKQA 2DIVA 2Q66A 4H4KA 4C3KA 4OHWA 4JI8F 4CM2A 4ETZA 1UVIA 1RP5A 4PWUA 1F0XA 4GVLA 3J7A1 2D3O1 1LFPA 4QW8A 3D1OA 3H5UA 1P8GA 2CNKB 3K17A 2BJ8A 4RO0A 4PR6A 3JSBA 1OIAA 2LA6A 1FD8A 4P9SA 5L1JA 4H4MB 2JLEA 3NWGA 2XZWA 3SCIE 2HWTA 4FS1A 3VGVA 3SYZA 7FDRA 2E7VA 2ZZMA 2JVOA 3C14B 1JLGB 4CO5A 1RBOB 1ZBTA 4N7TA 3MECB 4CO4A 2KRRA 2XSFA 4PQUA 4NASA 2J7UA 4JI7F 4YHHJ 2LQBA 3PJWA 3PO4A 3MMAA 1QM9A 2WCXA 4JYAJ 4A8OA 3ZZOA 4USJC 3GB0A 1MN9A 3JQJA 1YJ9S 4DUZF 1HW9A 1K73T 3CJ4A 2K3IA 3M6VA 5D4NA 1PYTA 1CBKA 3V4IB 5LSLA 3EUNA 3QRPA 2ZZNA 4RW8A 2E5GA 1UVNA 4HDHA 1XR5A 3X1LB 1RHQB 2NUHA 4ZN3A 1GK8A 1T11A 4DFPA 2I1RA 4CRJA 2RRNA 1MROB 2UXDF 1B4SA 4TN2A 4O3NA 5M2UA 2GJIA 1S48A 1NPPA 3PRVA 5HAOA 3D6FB 1CQNA 2HHTA 3LPEA 4X4VA 4X84A 4PUOA 4KH1B 4Y00A 4MT1A 4DWIA 2E66A 3MDFA 2P8IA 2U1AA 2VKRA 1I94J 2IC3B 3HHLC 1SVDA 2M9KA 4QQBA 5AXMA 2MKKA 2HHXA 1VR6A 1HNZF 2NXJA 4B3MJ 3N4WA 1MWQA 3RB4A 4I69A 4YMEA 1VBXA 3HDSA 4RNFA 4BDPA 5DDOC 5A2QY 2HEKA 2RVJA 4B9SA 1T3OA 3BSOA 2ZVIA 1N33F 3CJRA 2NZ4A 1G1XA 4ANCA 4F02A 5J2MB 1HKAA 3LP1A 4EYHB 3PXGa 3IS9B 2CZVC 3FZBA 1ZETA 4O44A 2MXYA 1OYEA 1RT4A 4PXEA 4ECYA 3HK2A 1NKEA 3CUNA 4X4OA 4Q2LA 2P9CA 3CJKA 3IA0A 2HQ3A 5T7LB 1Y9OA 4M5JA 3G82A 1YHQS 4OV1A 2CDQA 3HXMA 3ZNUA 1FRXA 5K20B 1X7VA 2IVMA 1Z2ZA 3NGDA 5CYMB 4F4AA 1FRIA 3MFHA 4DLEA 3VGSA 3THPA 1CJUB 5IZHA 2AHOB 2OTLS 1QSLA 4B3SF 3SXLA 4OJHA 2DEJA 1IBMF 2QLWA 1G3OA 1NO8A 4LMZA 3UCZP 2V4RA 2H65B 4K50A 5E2QA 3TO8A 3SDEA 1WOOA 5HMXA 2C2ZB 6FD1A 1B0PA 2CQHA 2VZ9A 4DFKA 3BKFA 3PNIA 3NY0A 4YUDA 3IRWP 2AMCB 4NLSA 2NSBA 5HROA 2QX0A 1M5VC 3MCSA 3CO0P 1S49A 2VJUA 1TL3A 1HNVA 3F0NA 4X4QA 3HD1A 2XSJB 3DU5A 2RAQA 2HLUA 2E5HA 1FESA 2QZ8A 3QSYB 3M1VA 1PBAA 1JLEA 1FRJA 4C8YA 3DNCA 1H0HB 2VG6B 3MMBA 3HPOA 2X7IA 3IMQJ 4ILMA 3HVAA 4C8LA 5F41A 3QIPA 1AROP 1JJHA 3NL0A 4F0MA 2ZBCA 1REVB 1F5AA 1S77D 4P2SA 1KHVA 5KG0A 3CIMA 2J5AA 5I3PA 2FLPA 1FX2A 2AJFE 5C7PA 4JV5F 2DR9A 3Q8QB 2V34A 2JWNA 2B8PA 2OEJA 2VC1A 3SBMA 4PWDA 4KGMA 4J9NA 2ACMA 2F9DA 2WAQD 3EE3A 3CCWA 2FTRA 2L48A 2Q1LA 2PO4A 2GHPA 1XC9A 1W26A 4DN9A 2APOA 3EGWB 4FYXB 2BE2B 3UVJA 1J2VA 4JI7J 1NH8A 2D9OA 4DSJA 3BBBA 4L74A 5E0OA 3FKBA 2YKNA 2CFXA 4X4PA 4OQJA 2ZHAA 2VFVA 3R5AA 4LF9F 3QT7A 4DUZJ 1A9NB 3LGMA 2BXJA 4GVBA 4EUVA 4U8VA 4CCHA 1RT6B 4IO1A 2EPIA 1NJZA 4KHPJ 5G0RB 4NXMF 4DPYA 5LMNJ 2B4OA 3R5JB 4XDDA 4LF8F 2XGPA 4FBTA 3TVZA 2Z56B 4ANEA 3H59A 2MQQA 3KHLA 2ZJPQ 1U6FA 1SL0A 5DS7A 2V2KA 2MJUA 1HNZJ 2HGMA 1FNMA 3CCJS 4NLGA 1YDLA 1RWKB 1SJRA 5LJ5Y 2V68A 1SC3B 3EGNA 1Y11A 1VFJA 5DGBA 3R7BB 5B0GA 2ZH9A 1TL1B 3QAUA 1N33J 2OIHA 3GQCA 1FNXH 2EKNA 3OJUA 5H9FJ 1S7IA 3S7RA 3T6JA 1N4LA 5DM6Q 2HNZA 2L9NA 2WW8A 5DETA 4JB8B 3FSIA 3AQOA 4J9KA 4ZVGA 4B3RJ 3OL8A 3F44A 2B6AB 4ID5B 3W2VA 4UUXA 2DNQA 1YLXA 3PW5A 5D4PA 5D0HA 3GPAA 4AQYF 4TY9A 2DNHA 4PG6A 3MM5B 4DV5F 2CPXA 3NGUA 4NCGA 3TRGA 4FF4A 1HWKA 4X4RA 1V5IB 4LR7A 2GVDA 3HHKA 1CJTA 3S1TA 3QJJA 2Z30B 2F9JA 2DCLA 4J9RA 2MKHA 3BO3A 2EWHA 1HHTP 1U26A 1VQ7S 2WVCA 4NZ7A 5K14B 2VQFF 4QPTA 3MWBA 3QFHA 2CPZA 4TYAA 3M9NB 3E51A 3H2UB 3VHQA 5G4DA 3VAMA 1WC4A 1UVJA 3UPFA 3V6DB 2FJWA 1P1LA 5B0EA 3NBPB 3MGJA 3KK2A 2A10A 2XS5A 3W2WA 4DZDA 2DVIA 3A8EA 1IUJA 2ZM6F 5ITHA 1WHXA 5GMDA 1N5SA 4U9RA 4U67Q 1ACMB 4YDXA 3PM9A 1J5EF 4BWMA 2QL5B 2Q43A 4ZHRB 2C2MB 3CCRS 2BJ1A 1Y0HA 1HQEA 1S6PB 2XMVA 4JI2J 1KDNA 3R3TA 1U8SA 4IDKA 3FUYA 1M5SA 2Q6CA 4GC6A 4NMXA 4ZA1A 4F3MA 4GMKA 4NA3A 4LFCJ 1NBEB 2PT0A 1AZSB 2OPQA 1R43A 4ZPCA 2WB1D 1N34J 1FEHA 5CQGA 1RTIA 1N5YB 3GONA 3N6NA 3BV8A 2LP4A 4J9UE 4X4UA 3PKMA 1DURA 4IQMA 4M5KA 4C8MA 5HJXA 3BBCA 1N8RT 3FCWA 3BDPA 5ETPA 2OEMA 3D9BA 3I4PA 3QPIA 2CA9A 4DL0C 4NOHA 4KV8B 2KVIA 3IAS9 3KTQA 5ETKA 2DXEA 4YB5A 3MCNA 1W2IA 1C4AA 3MPUB 4C48A 3G8TA 3JB9k 1WSVA 4B9UA 1U2RA 5E7OB 2NYHA 2CPDA 4NLOA 3GYXB 2C28A 2HWHA 1D9AA 4U95A 1RAJA 4LBHA 1LW0B 5LM7E 4AT1B 1C2PA 3W61A 3VAJA 4NYOA 5M2RA 1H72C 4TU7A 4NXMJ 1R7IA 5KG6A 1Q5YA 3H98A 3IXQA 1U1NA 4J9SA 1ZH5A 1SCJB 4QYZJ 2MKIA 5KG3A 4FYWB 1HNXF 2L08A 5KFXA 1Q7LB 5H9EK 2OHDA 4DF8A 1DRZA 4RR5A 2G0CA 3BGUA 4ES1A 3LANA 3JTNA 4JI1J 2OPRB 4K2XA 4ZPDA 4F0KA 3SFGA 4URQU 2DHAA 2ERRA 4X64F 2ALZA 3THVA 2Z2YB 1EHWA 3TA0A 4DL7A 4TQSA 1JJCB 2VQEF 4IRDA 2AP6A 3X3UA 2W8KA 1X0PA 5IT9U 5HP1B 3ET6B 2J9DA 3M8PA 4DX6A 3OL7A 4DV6J 4Q2MA 1RAEB 3D6HB 1LWFB 4KHMA 3BO2A 2YPYA 1AXQA 3J7Z5 2DO0A 3MEDA 4F2SA 1UJ4A 1FHTA 1QTMA 2YKMA 2RF2A 2IIHA 1IKVB 4DR7J 5I3UB 5KFNA 4JP8A 4DV5J 5C42A 5F0UA 3Q2SC 2IMWP 3MECA 1W2BR 1RTJA 2RU9A 2CJKA 2VBZA 4OYIA 2PGCA 4YY3F 5ETTA 3ZTPA 2MGZB 2VQFJ 4R0EA 4J37A 3DGPB 2EVZA 5DZ7A 4Q8EA 2I38A 3RBEA 2LQJA 2IDLA 3T1HF 6FDRA 2VDIA 1UEKA 3QAEA 3OXLA 4KYZA 3I0SB 2I8EA 4K59A 3HZEA 4EK2A 2X1FA 2L9WA 3T5KA 4J9VA 2ZM6J 2EFOA 4A8WA 4NA1A 1BQXA 1J5EJ 1RISA 2OSRA 2LKZA 4WTOB 4ZVEA 3PRDA 4C98A 3IR5B 2XMWA 1JLQB 1N5TA 1X9SA 1F6TA 1U1KA 2AJ0A 3POTA 2K1RA 1KC8T 2LA4A 1U09A 1H6KX 5CAAA 2BV3A 3KKFA 1X4AA 3AAWB 4KRWA 2KXNB 1UW4A 4DS5A 3KLIB 2DH8A 1MN7A 2HSEB 3TARA 2ACYA 3GV7B 3OFEA 4G6VB 2DGWA 1HWLA 3LALA 1FTCA 5T7LA 1NJYA 4NLPA 2J6SA 4K4XA 2HFNA 5C5JA 1HMVA 5FLXY 2IM0A 3VAIA 3IG1B 3JXOA 1S57A 3TUZC 5SUHA 5CYJA 2Q6BA 2F8HA 2CJXB 2V9WA 1CJUA 2VG7A 1RCXB 3UDLA 3MM6B 3V2UC 4ZDNA 1PC5A 2RT3A 3RU0A 4OJ3A 2R2TA 1U0HA 2OFGX 1K0TA 2CVIA 2GHWA 1RU1A 1R8AA 3PW7A 2QO3A 2J7WA 4N47A 3QNWB 3MAAB 3L7OA 5D15A 2YPZA 2N3OA 2QIFA 4ZVHA 3DRYA 4LT6A 4LSLA 2MQLA 2ZD1B 2VB6A 2W9AA 1XNQJ 1BQMB 2Y1RI 4CM0A 2BQ3A 5HL7Q 1OPIA 4RW6A 3IBWA 1HBNB 1SKRA 1Q8BA 2A0FB 4LIWA 3WC2A 4X64J 1TMMA 1GXUA 3GU0A 3QRRA 2FC8A 4F8RA 2PI4A 3SSSA 3R5CA 4HHJA 3NMAA 4B17A 3KK1B 2UXCF 2DGUA 2Z8QA 4OYZA 2V6AA 1Y4ZB 3D7SB 5D6GA 1AT1B 4AXIA 5FDLB 1N52B 4LRCA 3CD6S 2BQRA 3ENAA 4OV6A 4CO2A 4LFBF 4V19J 1FFGB 1YJTA 4RUCA 4KBIA 2LVWA 2MZ1A 5A0YB 2AGQA 1SQEA 2J7KA 5CD4H 4NEZA 2UUCJ 1S1UB 3DLGA 3DC2A 3B6BA 2VU5A 4A8MP 2GQQA 4F3OA 4B3TJ 4IG0B 4I2QB 3OTBA 1IQTA 1RAGB 4LRDA 4NXNF 1SUQB 2W9BA 1F60B 2FZCB 3U1MA 4DI6A 5F8GA 1S1VA 1KLNA 1UWBA 4FXDA 4USHA 1RYSA 5F8NA 3CPWR 3HI9A 3OVSA 3QSIA 2IVYA 4F67A 3P49B 3T1HJ 4PYDA 3DOKB 2OTJS 1B0TA 3W66A 3NCPA 1IBCB 2HVEA 3KLGB 2UVWA 2B5JB 1HBOB 1QJHA 1VS3A 4PAAA 3EVWA 3CJ2A 5CZVA 3CD5A 5T41A 2F8EX 5F0WA 1S79A 2YNIA 2XCPA 2G2ZA 1GMUA 1U24A 4LF7J 1B3TA 3TOQA 4L6V3 2YNGA 3JYTA 1OY6A 4OYOA 3EZOA 1NDCA 1X4FA 3LWLA 2JC0A 3Q8UA 2XEXA 3GE9A 4DR1J 2JEFA 1RJJA 1OYDA 1VHIA 2PFFB 4OI6A 4TU9A 3DFEA 3RRHA 1PGZA 1IR1A 1BQNB 3R5DA 3PYDA 3AHPA 2L9DA 1TL7A 5B0DA 3Q8SB 3FQKA 4WXWA 3OTEA 2Y8WA 3BSCA 3O3LA 3QO9B 4DR5J 2R7XA 5HBMA 1MU2B 2B6AA 3C15B 2BX6A 1IQZA 3BYRA 2FB0A 1DARA 1BMQB 1IVZA 1B7FA 2LFVA 1RKIA 3ZZ0A 4RW9A 1X4GA 1O5JA 3EXCX 3PYFA 2R42A 3A3PB 4OX9F 2KXFA 5IQ6A 1Q79A 5CCMA 2UVVA 3BBFA 4L3KA 3ZO7A 4N5SA 3FFIA 1UVKA 3MTKA 3ZZYA 1UFLA 2VFRA 1ZOTA 3G86A 2VONA 1BGXT 1OY9A 3TP2A 2OLWA 1R0CB 2DJWA 4J91A 4C0OC 3L3CA 3WZ0A 3GG1A 2UUTA 1TKXB 2G13A 2IY5B 4HT7A 2FJVA 3EICA 1T9YA 5KFCA 5C24A 1F5BA 5KFSA 1Q81T 2DRBA 5HLFB 1QE1A 3SSQA 1AYEA 4XAKA 2HBZB 5ADZA 1T0TV 1X4EA 1WORA 2JDJA 4EZ6A 1KLMA 1R8BA 1QD1A 4EMDA 3K2YA 4Y2MA 3IP0A 1Q7YT 2WBRA 1OQ3A 4LF4F 3M2UA 4QWBA 3UD3P 4OMFG 1SPBP 2R8GA 3Q86A 2CG8A 1XMQJ 1H3DA 5HMYA 1XIQA 4EO6A 4OFZA 2XLJA 1DY3A 1OMSA 1K44A 1R8HA 1VRUB 5I42B 4PABA 4CLPA 3PO5A 2YNFB 4KO0B 4D3GA 3BZQA 3GR1A 2R7WA 2Y0SD 3DMJB 1NPKA 1TK8A 2LDIA 4KV8A 1JJ4A 2GAGC 4ZVSB 4MFBB 4Q7AA 1KBRA 1HI0P 1DLOB 3CJ3A 3U7JA 3OTOJ 3UFCX 5AXLA 4OX7A 3IC1A 3FVYA 4LRAA 2DNGA 1T9TA 4RNHA 4DR3F 4IO9Q 5HMZA 2YKAA 2KN4A 4LF2A 1YRTA 1S1TA 4RU2A 4K8RA 4FYYB 1S0NA 4CWBA 5A8KA 1RTHB 1PKUA 1RT2B 1D09B 4NXNJ 2YNHB 1RT5B 5KFTA 5FIIA 3ONQA 4HVZA 3DOMA 1FK9B 1LW0A 2X51A 3TR5A 4ZPVR 1HQUA 5CH7B 3K7RA 1AFJA 4RBTA 3CDBA 1WEXA 3I0RB 2YY3A 4JUZA 5IT9Y 2AX0A 1P9QC 3VVUA 4DBQA 2QFJA 2PMZD 1UPMB 3HX9A 3C8YA 2JOQA 2F4FA 1RGVA 4B9NA 4Y0FA 3GIIA 2AZ1A 5KFRA 1Z4UA 3GTYX 4PXBA 4LFAJ 3TA1A 3VZIA 3DXBA 3KJVA 5BYRA 4OHXA 2BKPA 4USVA 2FHOB 3H4DA 4ES3A 2HURA 5IOLA 2XHCA 3M8QA 4ELUA 3DYAB 2NXUA 3EZUA 5HVGA 4ATNA 4A47A 3A8KA 4BWJA 1TUVA 3NKYA 2OEKA 2B8QA 3U02A 1EETA 5BXIA 1RBLA 1TU0B 4OYAA 2JL9A 2WVDA 3E2EA 4NRUA 1OJ4A 4NYZA 4WCEQ 2YTCA 1TVRA 1RWVB 4CO1A 3SV4A 4FP9A 1RT1B 4ICLB 3OTCA 3M7VA 3ZNJ1 2E7XA 2VODA 1G2EA 4OI4A 2F40A 4ZLNA 3O2IA 3CMQA 1H2TZ 2V8VA 3NLCA 1WKKA 4TNOA 3DM2B 5ETMA 2C2OB 2F7VA 3KLEB 1DQAA 4I6WA 1N6QA 5ETRA 1IM4A 3T6BA 3NP5A 1RHKB 4RW7B 1N36J 1B70B 3OUYB 4AL5A 3HZGA 4LR9A 1WNEA 1HA1A 3M6XA 4QIFA 4W4MA 3JSYA 1QAIA 3OHBA 3VAFA 1BWVA 1U02A 2ILZA 2DNLA 4RX6A 2VOOA 4EFAC 3LW5C 2BACA 3MHYA 1HR0F 3VCDA 3W63A 4OHVA 3MPVA 2DO4A 3NGSA 4OZ5A 1S76D 4RNNA 5GMKa 3EXYA 2VBXA 2R7QA 1QDUB 4KJIA 4FKXA 1CC7A 3JTPA 5CA5A 1XERA 3BDEA 5BR8J 2HS4A 3VZHA 2V8DA 5KFGA 2I5JB 3CMES 3D54A 1U8WA 5J2NA 3JSMB 2ZDOA 3LP0A 5HSPA 3IWNC 2GJFA 2SXLA 2W25A 4N41A 4B3OB 2Q3PA 2CQPA 3LH2S 4RW4B 3S8SA 5LOQA 3C19A 1U2FA 1NB7A 4WXOA 3TANA 3KHRA 4DL4A 3IGNA 3HHLA 3THTA 1SJQA 2NS1B 2B9EA 4DOZA 4NZ0A 4CLKA 3TUIC 2C3OA 1SH3A 4RPFA 5KT5A 3QT5A 4KHRA 3W1YC 4XDCA 4DUYJ 3MM6A 1OSCA 3S6EA 5F8JA 2DRAA 1FWLA 1Y7PA 2ABYA 1KN6A 4WYLA 3A4TA 3W5XA 1ZZNA 1QAYA 1FCAA 3W9HA 1NDPA 3J81Y 2C22A 1T8EA 3ZC4A 1PILA 3SCKE 3MAAA 1DFDA 1H38A 3GV5B 4DUTA 2VG5A 2HHHJ 1R8CA 1PAUB 4IOCQ 2YKOA 2F3JA 5KOXA 1ZZFA 2HGLA 3TUPA 2XLIA 3A1YG 4UZCA 4X62F 2PSZA 3SCJE 2FVQA 5D3GA 5JXSA 1IR0A 2EK1A 4BC7A 3ZZZA 5RUBA 4DV2F 2YVSA 5KG5A 4K7QA 1F3FA 1HYSA 3ADAC 3R1LA 1T9UA 3MMAB 1KVKA 3TX0A 3RB3A 5IM0A 2IHR1 1WD6A 3DLKA 1Q53A 3NMRA 2GW8A 2RD5C 1NSKL 2GJ2A 2XYGB 3C6TB 4CP5A 2ZH5A 2RDIA 1NK5A 3FEZA 3J81j 4DQSA 1UTAA 4O3QA 3EVMA 2D74B 4DMZA 4DU7A 1CJVA 3NEKA 1T94A 3OSPA 4AL6A 4USKA 4LJMA 3V6KA 1UKUA 1SXLA 3C2PA 2KJVA 5DQGA 2DR7A 3AQPA 3CULA 4BHQA 3M8RA 2A3JA 5ETSA 1FJGF 4JV2A 2F65A 2AX1A 3ILLA 1CEZA 1BWEA 5I3QA 4IG0A 4M5IA 4IR9A 1X5PA 3NCRA 1SKSA 2UU9F 5HVFA 4J5OA 5MLCV 3Q8YA 4K5SA 3BKUA 5KFQA 1U6BA 4O44B 4Y28C 1PSDA 3UE2A 4C0BA 2FLLA 3K8VA 3KLGA 2WRMA 4X66F 2QMXA 3KLFA 1HR0J 4DS4A 2X3GA 3CJKB 2DT9A 4RJVA 3G82B 3VALA 2MLXA 5E3RA 1J5OA 5DO2A 1KKHA 1NUEA 4WKRA 2GQCA 1EB0A 3AFGA 4QR1A 1RLCL 3ZFVA 3R97A 2B43A 3KG0A 2P5VA 3O44A 3MXHP 4Q45A 2RNEA 4U6PA 2MPUA 4OLPA 1YITS 2HFZA 1X5TA 3GJTB 4C8ZA 1M1GA 1BQNA 4F4WA 3SDEB 5A6WA 2FD2A 2HVIA 2M5YA 3R6GB 3QO9A 1R8PA 3TJ9A 2E1PA 3TZXA 1YBAA 4V1Ak 5DG7A 1SL1A 1TV6A 2JZ5A 3G9CA 1TKDA 4QWAA 1HNVB 2LECA 2RRAA 2B51A 3RRGA 2HFOA 3CW2C 3SEOA 5A8RA 2MJNA 3VR1A 4GKJF 2HMIA 2EEYA 1JX4A 2EI5A 4E8UA 4NYPA 2FLNA 4QZVB 1W7WA 2C2RA 2QFIA 3M1VB 4EZ9A 2C1EB 1JLEB 2N3LA 1Y3KA 2OELA 2M8DB 3MMBB 1VQPS 3NS7B 3T5HA 1JMTA 2MKYA 3LAKA 4PRFA 3V81A 4XTTA 1YKWA 3QIPB 1ELOA 2XNRA 2J76E 2F1FA 4I67A 4KGKA 1NDLA 4K4VA 4JI6J 4HR2A 1FDNA 5GMEA 2ZKTA 4OZ0A 2DBBA 1U0SA 2BJ3A 4DL6A 1TKXA 2H51B 4PWDB 3DDIA 4EI2A 1Q8KA 1YRUA 2HFSA 5B0AA 5IWAJ 2MZSA 3K5NA 2WONA 5HLFA 1VQKS 2RQCA 3D0GE 5GAHI 1T3NA 1WI8A 2C2KB 2JSXA 4DV2J 2DYAA 1Q8LA 3UVJB 4WIQA 4DV4F 3GIKA 3UN2A 2H5IB 5LMUJ 4ZJOA 4IH6A 4G1QA 5EHHA 3GIJA 3PCOB 2HRTA 3RBZA 1D9DA 3K5PA 1RAOA 4QW9A 3TI0A 4J9LA 2GVZA 2ZVSA 2IAJA 2ZH2A 1VRUA 4DG1A 1ICEB 4RKUC 3PW2A 4ERDA 2E5LJ 4WFBQ 3PDNA 3G8QA 5E3CA 1IBLF 3UO0A 4YS2A 1HQ2A 3QATA 4I0WA 3EMTA 4HI1A 1N56A 4LBPA 5BJRA 4F04B 2I2YA 5HK4A 3CJ0A 4Y65A 3QGIA 4WZQA 2IJFA 2OP5A 2P6TA 1NHKL 1RTHA 4FPIA 3BQ0A 2VIHA 1PAEX 3QT8A 4KTQA 2HQDA 3PVXA 1VQLS 1EQMA 2PIIA 1N32F 3M30A 3MMJA 4DR4F 4MIWA 4PZVA 3ILIA 3JAMY 5DG8A 3RZAA 1SI9A 1QSYA 3K5MA 1BC6A 2GO9A 3RJMB 1T02A 2VOPA 3R5BA 2YX1A 3H0PA 4KGZB 3CDAA 4X66J 3LGHA 1LK7A 3MEGA 1FT8A 2W9CB 3CCMS 3UDVA 1TMJA 3EVOA 2IJRA 2J0QD 1RU2A 4NCGB 2GV1A 4QBUA 3DLJA 3Q89A 3KK3A 3RB0A 3NS5A 2GVDB 4P74A 1D8ZA 4ECZA 3ZZTA 2P2CB 2BABA 1ZM2A 2GIFA 5BYSA 5KFLA 1HWUA 4WK3A 2BR0A 2BRLA 5E41A 4LF5F 1N54B 4Q44A 3SZ2A 1Q1KA 1HHQA 3FBEA 3FEXB 4A8SA 1X5SA 2DHSA 5KFHA 1SV5A 7AT1B 2Z2MA 1TKZA 3D6TB 5KFYA 3P6YC 3Q22A 3NNCA 4DCPB 1XR7A 4UOHA 2XY5A 2RDJA 3C16A 3KK2B 2MY8A 4AE5A 1NZAA 3NAIA 3HVTA 1RTDA 3W2WB 1M1HA 1IR2A 3EGVA 2O1PA 2MYFA 2ZNZA 3UD5A 4O0NA 2QA4S 2A2CA 2V4QA 1HNWJ 3FJ2A 1UJ5A 5K8PA 2PA3A 2D69A 4ZVUB 5A8WA 2F4VJ 4JI5F 1FERA 3BYPA 3R1HA 1HQEB 3FZ2A 1YJVA 4LIRA 5IXUA 4ED2A 2GMHA 4IDKB 3W8PA 5LT5A 3DHXA 2G9OA 1L3VA 1UMJA 2G1HA 2R2RA 2CQGA 2OPQB 3LA0A 1VQ9S 3RAMA 2HKEA 4H54A 3E3XA 1SB6A 4U7UD 2KVQE 5CXTA 3KMQA 1RTIB 4BBYA 3H5SA 3HT0A 4ER8A 3CJQA 3NCQA 1R89A 4DR2F 5L46A 3T1YJ 2J9DE 2H4YB 3TAMA 5GAHU 3J7YI 3UD4P 4M8LA 2DK2A 2BW7A 1JKHA 2C2EA 3P5TL 1VISA 4PXDA 2PA8D 5F3TA 5F8LA 3MI7X 3FCHA 2PC6A 4FXVA 2ZH6A 3B8HA 1KOOA 4DX8H 1UL3A 3LQVA 1Q95G 4DR6F 2L41A 3Q24A 4JI3F 2V0NA 2B56A 4ZVFA 4FF3A 2I5JA 2ZBRA 1UA1A 3M8YA 2NYIA 5DLFA 3M6UA 2E29A 4A46A 1TFYA 5KFUA 2MZJA 3RAXA 4PCQA 2CJAA 4HHHA 4ZVTB 2CQCA 5E33A 5JVGQ 2C3PA 1SQGA 1YTYA 4G65A 1T7PA 4O3OA 1RA7A 1S0VA 1UZDA 2MQPA 1KEKA 4X4NA 2DPIA 2HAFA 3M9MB 4WIIA 3OLAA 1C0UA 2KI2A 3CC7S 4P71A 1F2GA 3MPYA 1U1RA 4FF2A 4CLUA 2CNNB 2ADCA 1GX5A 2CYYA 2G4BA 1EQ0A 5EX0A 1IJFB 2H1YA 3ENVA 3FCVA 2BM1A 3M8PB 1L3UA 4Y2CA 4B9LA 3CMAS 4O4GA 2DCUB 2FIUA 2OSQA 3PEHA 3UR3C 3PX6A 2LU2A 3P3DA 3MEDB 2JVRA 2BA9A 4U7CA 1KS2A 4ED7A 1M90T 1F2HA 3NXZA 3Q8VA 2ZZTA 3A13A 2YKMB 2RF2B 3LP2A 1TQLA 1KFSA 1NB2A 1V3RA 3PFEA 3UCUP 4F7VA 3CTRA 2OD6A 1UETA 4HH0A 2OH2A 5C42B 3HKWA 2GCFA 5DDPC 2GX8A 1RTJB 3M6WA 3VGTA 5DGAA 2ZC4A 5EDWA 2FYXA 5DJBA 2ZBIA 2MSTA 1NHUA 5ETOA 3DRPA 3HF5A 5IT0A 5LJ3Y 1XMBA 4ITSA 4USIA 2IYIA 1RXOB 4LF1A 4GKKJ 5D4LA 1NH7A 2K06A 4HL9A 3ZTSA 3QGPA 1JLBA 5IC6B 1SIZA 2R7UA 3C6TA 4C3LA 2RUSA 2DXDA 1JB0C 1N5VA 1RABB 3PACA 2IRXA 3OSNA 3KHGA 3AOBA 4A8KA 1ZM4A 3UQSA 2WTFA 1RK8A 4B9TA 3DDNA 1XNRJ 2HZAA 3OW2R 1EJ7L 4I2PB 2LEBA 2XHWA 3D3CJ 2FUG9 4JI0J 1RAFB 9ATCB 4USWA 4JI5J 4K4UA 1P9YA 4IFYA 4OYBA 1RWXB 3J80Y 2BQUA 3POTB 1JLFA 2K1RB 1D9FA 2JEGA 4PQAA 3C3LA 2CPFA 5DQHA 5DDRC 2MQMA 2DTJA 3IBCB 4ED6A 2R7OA 3BPDA 2CNLB 1VRTA 2VPZB 3BKTA 2OUGA 3QWPA 4RNMA 3BGOP 5IQQA 4DDFA 2RH3A 3CEDA 2XNQA 4DR2J 4OZ3A 2EFPA 3J7YU 4O3SA 3DI6A 5HN0A 3VTIA 1XK8A 1S99A 4CIOA 4ZVPB 4KFBB 2CUYA 2Y1JA 3FBFA 5KTQA 3MAQA 4Q43A 1VOMA 3LOUA 1HMVB 4QR2A 1C4CA 1WOSA 1PC4A 1F9FA 1YIJS 3T5JA 2E9RX 1IBKF 1Q4RA 4MIBA 2MHNA 3NS6A 3K89A 4A8XA 1TK5A 2VG7B 1S97A 1FRKA 4ED1A 5H9EJ 1U0HB 4JI3J 1B64A 5GAGI 3TVKA 4DV0J 2NR0A 4AFFA 4CH1A 3H20A 1RAIB 3MM7A 5HQ8A 2QL9B 1NKBA 4GC7A 2HNDB 2H48B 2WSCC 3D1QA 2WSEC 4JV1A 4LSLB 1UVMA 1YZ6A 1YK9A 3FQLA 2BE9B 2KFNA 2DHHA 4CT8A 3BJYA 4QR0A 4C8KA 2CZ4A 3KJNB 4RW6B 2V8GA 2UV8G 2MLYA 1QUPA 4IYQA 4OLOA 4ELVA 1JJ2R 1YJUA 2GS8A 4OYPA 4RL1A 4JI8J 1LV5A 4LF6F 3G8SA 3KDOA 3FBCA 4MH8A 2OMLA 3EWGA 3IRXA 2E9ZA 1RT7A 1EKSA 1F5CA 1KRPA 1SKUB 1LQ9A 4MK7A 3WIVA 4DV3F 1S72S 2PN6A 2CRLA 2RDDA 3M4XA 5D77A 2IYGA 2D3OR 1O0PA 2MKSA 5F9LA 1NAQA 4CLLA 4CQ1A 1PO6A 4QWCA 4FNIA 1AW0A 1BE4A 1NKCA 3JSRA 4CYUA 2I9SA 4DQIA 3DOLA 1E6YA 4H4OA 1WEYA 1H73A 5KFMA 4RBUA 1WG1A 2NLWA 3HJFA 3KYLA 3DLGB 4EBCA 2DIUA 1GFWB 2EBEA 4M5MA 1Y3JA 1VC5A 2RQMA 4IFVA 3TVYA 1YJRA 2W9BB 4Q8FA 3FRZA 1NNDA 2M2BA 5AXNA 1T95A 2FC9A 5CYQA 3KLHA 2OPPA 2KT5A 4MAKA 1S1VB 4YR0A 1UWBB 2BBEA 1T03A 3CD0A 1YJ7A 2UXDJ 1X4BA 4K0KF 3AA8A 2ZEJA 2AYMA 4OHYA 1HARA 3FC9A 1GNKA 5AE3A 5CABA 4V19X 4IG3A 2HQIA 2ZH7A 2YNIB 5AT1B 1S0OA 5A2QU 3AD7C 3GWCA 2X1GA 5EN1A 2YNGB 1WC1A 2COLA 4R8UA 3JYTB 3LUYA 3TZZA 2W7AA 5ETLA 4HYKA 3W7BA 3VQSA 4C4WA 1R31A 3PKYA 1SJ1A 4Q0BB 4RUBA 3OJSA 3SQGA 3DLBA 1TL7B 4WU3A 1S6QA 2KG1A 4I7FB 3D67A 1FRLA 2DGTA 2DGSA 2IM1A 2YWEA 1WG4A 1DTQA 4FYDA 4WKYA 4NLDA 2ZJQQ 3CF5Q 1DQ8A 5HBMB 4XPCA 3W3SA 3GZ7A 1U2CA 1D0EA 1NSPA 2V94A 3DGVA 2W9CA 3E01A 5J1NA 1UFKA 4RW9B 1VQYA 4MYTA 4NLRA 1SIWB 3D0HE 4R25A 5AXKA 4FN5A 1WTFA 4CLWA 4DSEA 1VC0A 3HHNB 3MEEA 1RACB 2XZDB 1E6VA 1CC8A 4JOUA 2HHVA 3FFIB 4B3SJ 2HHSA 1L5UA 3SQOP 3ZTQA 1NK9A 1QVFR 1CPZA 3OR2A 2E9TA 1IBMJ 4M5DA 3KHHA 5GAGU 2UUBF 1N0VC 3UWTA 3DDKA 1SH2A 3B4DA 4N8NA 5KG2A 4FKYA 4ZJLA 1YWXA 2NXEA 1OSDA 5GAEI 3WQPA 1QTNB 1RCOB 2A2DA 3HVRA 2K7KA 2WB4A 2DGQA 3BPSP 5C24B 2FZKB 1MG7A 1T05A 3FMBA 5KFDA 1QE1B 5L9NA 4C8OA 1H7WA 1EP4A 3AODA 2J9CA 2EXUA 3F56A 1EKRA 3EGZA 2UVUA 1HI8A 1S9EA 2KM8B 1VIXA 2QT7A 1OWXA 3HSGA 2BANA 1KLMB 4Q5VA 4ED0A 1WHVA 2NXCA 3I6PA 3HSDA 4I1TA 4KGXB 4QIWD 1M5HA 1RLDA 4LF6J 4CZCA 3OR1A 4P52A 1K8AT 3V6HA 1FWKA 2RKIA 3M2UB 1VJWA 5EWFA 4OZ2A 1XWLA 2GA7A 2WOMA 4F4XA 3H5YA 4M5HA 2H9ZA 1I51B 3RAQA 2OO4A 2HW3A 4ECSA 2XLKA 2XMJA 3MEKA 4JV5J 2POKA 2CPJA 5L1KA 2VDHA 3PR5B 4MYUA 1I5OB 4P6QA 3ISND 4NI2A 2FVRA 3ZTRA 5D78A 2I0XA 4FNHA 3W9JA 2QLJB 5HI7A 2GIRA 3M8WA 3TEHB 2H3EB 1VK8A 1S1TB 4DV7F 2RSQA 2YWHA 2BVZA 5A8KB 1LKZA 1T9XA 4CTAA 1S1WA 1HHSA 2ATCB 2A6OA 4LF9J 2R2SA 3WIUA 4IRKA 1URRA 4O4RA 3CCZA 1FD2A 1RTZA 1BUXA 1GAOA 1JWWA 1CQMA 3DOMB 4WFZA 2DXFA 3IM9A 4GO7X 1S9GB 1HQUB 2FHKA 2ZJRQ 1S6UA 3DLEA 4LF8J 4U7UK 3VAKA 1U1OA 1NSQA 3AY0A 2K7JA 2QTWA 4WK1A 3HHLD 4J9MA 1FRMA 4F2RA 3QQCD 2Y0BB 3HKZD 1VHFA 2XG8A 3Q8PB 2ZHBA 2H5EA 2VH7A 2B4PA 3MM9B 2XI3A 2E5IA 1OPZA 5AJ3F 3KMSA 2W2MP 3CB4A 2RQKA 2R2UA 3AA9A 4DPUA 3KJVB 1C0TB 1LW2A 2CIMA 3L09A 2IMOA 4YHHF 4A48A 3KG4A 2M70A 2EC2A 1RHMB 1S10A 2XO7A 3M8QB 4JI4F 2XM3A 4IQXA 4KQZA 4EBEA 2RHQB 1X8DA 4K4WA 2FQQB 2FVPA 4ENOA 3QBCA 4I6YA 1EETB 3B82A 1B7YB 3EDRB 2JC1A 1S0MA 1GMWD 1FNOA 3GJSB 3L9ZA 3P5BP 1VRQC 2HNYA 5HANA 1DTTA 3PIPQ 1TVRB 4AQYJ 2UXBF 4QIGA 2XWYA 1Y5LB 1I94F 1U47A 3C66A 2IJNA 2W24A 4P10A 2FGCA 2R7VA 2DGVA 4ECRA 1HFEL 1Q86T 3ENWA 1FTRA 2ZWPA 3I5CA 4ZCIA 2AWZA 2FJDB 1VQ8S 4B3MF 1RT3A 2B7BB 4F36A 4O3PA 3TNVA 1HBMB 1JLCA 1VC6A 4NWBA 4A8FA 3K8WA 1BLUA 2AEFA 1EARA 4CLFA 2QYGA 5GADI 1N6QB 2ZH8A 1QVGR 4WF9Q 4Y2KA 2E1RA 5GAEU 3MOZA 2F8MA 5ETVA 4K4YA 3QIDA 4PPDA 5KT3A 1WELA 3RYLA 2PI5A 3CE8A 2PE8A 2G0JA 5K8MA 3UW1A 1ZTTA 3J7ZT 4NE9C 3PJ9A 1TR0A 3PW0A 4I2PA 4WP9A 4WYWA 3OL6A 2OGUA 3C6UA 2O01C 1SJFA 2O66A 1EAYC 4UUWA 5L1LA 4WP8A 4EEYA 2KYXA 3MM8A 1UEUA 3G87A 2LDYA 4R5PA 3V6JA 1VBKA 4C9DA 2RB7A 1FVSA 3OXFA 1PJ5A 4KE5A 1RWMB 5THWA 3GCXP 3US5A 1S4FA 3HMJG 2N82B 2WK4A 3R7NB 5J2NB 3LP0B 2PD1A 2DNYA 4F25A 2B0GA 1DJ0A 4HHUA 1RBAA 2E44A 2GFFA 1LWCA 3MMCA 2D9PA 2HK2A 4MTPA 3T9ZA 4Y2AA 4KFBA 3H4BA 1NK4A 4M95A 3HHLB 2WSFC 4OJ1A 1WG5A 4ZLJA 1N48A 1WI6A 2CJQA 3BM7A 4MKVA 3KG1A 2KT3A 5BYQA 4CH7A 2XMUA 5DLGA 5C25A 2LCWA 3QT6A 1R3NA 4DPTA 2V9KA 2XC9A 2CDRB 1LEOA 4I68A 3NGRA 5JMNA 1R6YA 2ASLA 3QGGA 4PKDB 1YJWS 2O67A 4DLGA 1CS4B 3UNYA 2VBYA 4NA2A 4YDDB 3CJ8A 2HNDA 2VG5B 2WVEA 2CWXA 1HNXJ 2HVZA 3M05A 3G96A 4G3IA 3BR8A 2RQ4A 5DRKA 4P2FA 4DL5A 2HZVA 2XMTA 3MCMA 5D3GB 3RW6A 4F4YA 5AJ3J 3ISNC 2JLGA 2HAIA 4M5GA 4WFXA 4ZITA 4OI1A 5ETQA 1ZPWX 2HK3A 1UA0A 3GJRB 1FKPA 2Y1LB 4KKOA 1HYSB 4LRBA 3W60A 1RQ0A 2ZH4A 2KDOA 4FZVA 4NCAA 2VQEJ 3P4UB 2R8HA 1ZYQA 4JI4J 4WP3A 4JV0A 3TWZA 3N6LA 1YX2A 1YSJA 2IDEA 1TP7A 5IM0B 1ZTWA 1NCLA 1UAWA 1VCTA 2QLFB 1QY7A 3DLKB 3DLHA 1S5ZA 1WKLA 2H5JB 4AXJA 3M2VA 2QA1A 4KHPF 2OMOA 4UY8T 5LMNF 2AJ2A 4YQWA 3D2WA 3AT1B 1CJVB 1IKYB 2V50A 1Q82T 2UXBJ 3RBXA 1VQ5S 1IN0A 4C11A 4O0IA 4ECWA 2MSSA 4ALZA 3QYYA 5KFZA 1K1QA 3MUMP 3A12A 2I6WA 2XO6A 3WX8A 3LPYA 2CQ4A 4EU0A 4YY3J 1FJ7A 3I9V9 3GYNA 5GADU 3OFGA 2OAUA 1IWGA 4IKAA 4YB6A 2FPHX 1TZ0A 1UCNA 1Q5VA 2ZOMA 3CJ5A 1QAJA 3G71S 2QJ3A 5ETNA 3L95X 1H74A 3UDEA 3MOJB 2BJ9A 2DR6A 4B3RF 3KLFB 2BKOA 3Q0AA 3FEYB 2MZRA 3MR3A 3BSAA 1J5OB 1KWMA 2DEIA 5AE2A 4K4SA 2AW0A 3ITHB 1UZHA 2QLBB 3EPGA 1DHMA 4B9MA 5B0FA 3VWSA 2HBYB 2ZBQA 5CHCB 1P1TA 4C0HA 4DSIA 2OFHX 2HVHA 2DNMA 3N0VA 2MMYA 2J9EA 4Q0BA 4TQRA 3D4JA 2XCAA 1S12A 1BD6A 4I7FA 1NK8A 5D8HB 5DQIA 4W92B 4HACA 2DR8A 2W2OP 4KSEB 2XMAA 2DY1A 2EFQA 2C3YA 2BZ2A 5FLXU 4OZJA 5B0CA 2VD3A 1VBZA 1TV6B 1ZM9A 2ZDPA 5KT4A 4BLGA 3E8OA 3MR2A 1SBRA 2QYCA 4ILLA 4RZRA 5A8RB 4YB1P 2HMIB 4WE1A 2CJYB 3MCOA 2CG4A 4UT4A 3HSZA 2V2ZA 2CVEA 2QRRA 4M63A 3HD2A 3MR6A 3ILOA 2GGPA 2WVFA 1AB8A 2YQ1A 3V81B 1RB0A 1KQFB 4JI2F 1UP1A 3N01A 4LFCF 1PYOB 2ZBPA 4KT0C 3U1NA 3OT9A 3WDOA 3VQTA 1N34F 2AEJA 2IBKA 1G4CA 3NOGA 2R3VA 4F0HA 3HFZB 3GSDA 2VA3A 1FJEB 2CJ9A 5KFWA 4A8YA 4DJBA 2FHJA 2WONB 3KWMA 5HVHA 4L75A 3IWXA 4X4TA 1PBUA 2DH7A 3FNNA 1SC1B 3WBZA 1WUUA 1KR4A 1OY8A 3HO1A 2YWGA 1ROFA 3GJQB 2CQ1A 3VVTA 1WEZA 3ISZA 3QLHA 3CCSS 4WJBA 1GTEA 2D3UA 5U47A 4G1QB 4QU7A 3R2DJ 2LXIA 1VDHA 3HT3A 1U1LA 2VBWA 1BHNA 2UXCJ 4ZP6A 3CGIA 4ECTA 2UZAA 1NEEA 2BJ7A 1HPZA 2GVZB 1FKOB 2N4DA 2GIQA 2IAJB 4U96A 4K5RA 4DG1B 3DRRA 3H5XA 1C1BA 1D8YA 2WHOA 4XIUA 2OD4A 3W5YA 2B4VA 4LFBJ 3QMQA 3GCWP 1L3SA 1GT8A 5C2CA 4C3MA 1AA1B 1NZ8A 3UI3A 2O3DA 5D0RA 3BH6B 4NLWA 1FX4A 2F5GA 2BW2A 1RI7A 1PIEA 5HQLA 4JI1F 3CCVS 3HHEA 4J9QA 4EYIB 2W2QP 4HLBA 4YP3A 2JFKA 4KAIA 3WC0A 1N88A 2E1AA 1JLAA 5EUHA 2AYBA 4DPOA 4P72A 3D28A 1I6JA 2W4CA 4OYWA 3K59A 2B7CB 1CULA 3M30B 2VJVA 4DV6F 1S9GA 4QPXA 2E5JA 3CJSA 2KL8A 1VI7A 1NU4A 1LK5A 1PG5B 4UZBA 2FJXA 4DX5A 2F63A 2R7SA 2YXLA 1S9FA 1X9MA 5J2QA 4YOEA 3MEGB 1IKXA 2VUGA 1WDDA 3W9IA 1FKAF 3AB4B 3MURP 1NPRA 5H1SV 2KO1A 3BGRA 4PXCA 4C8NA 4DR7F 3MM9A 5M2PA 3DRSA 3KUHA 2N4CA 3MAHA 5J1EA 2Z57B 4ZK7M 2K8GA 1R27B 3PJXA 3BH7B 1TL4A 4QYRA 5L39A 1UJ6A 2BOAA 3R7SB 1C0TA 4URSA 5KFBA 2VA2A 3KK3B 1WKJA 1V5VA 3AJ2A 1A6LA 3AJ1A 3PW4A 1XN9A 2QLXA 3JQMA 4PG7A 1NDKA 1HIYA 1WC3A 4ES2A 3OXGA 4MKBA 3PHTA 1RHJB 5KFEA 2ILYA 3TAQA 2M4MA 1SV5B 1TKZB 1RE1B 2BYCA 4NLYA 2VPWB 3GR0A 2B4UA 4LUBA 3UNGC 3C16B 2JEJA 3HVTB 3PTWA 1RTDB 3QJPA 1KD1T 1CSJA 3H8YA 3PX4A 4I4BA 4A8QA 4Z7YA 4OX9J 4USMA 4DXLA 2VPYB 2IA0A 2MB0B 2CPEA 3KNGA 3P96A 5A8WB 4ZKAA 3TZWA 2CPHA 2XS7A 2MDAA 3SIPB 1HBMA 1GXLA 2AJQA 3B54A 3ENQA 3PV8A 2AJ1A 4CDIA 2ROEA 3FBBA 2EC0A 2HZCA 1NHVA 2JX2A 2RHSB 5L8RC 2X1AA 2W7PA 3NG8A 4L3NA 2RS2A 8RUCA 1LWEB 2YX7A 4MJKA 5EWEA 4UOGA 2AEMA 2DD8S 4W90B 1YQHA 4E98A 1HNIA 4DFJA 2Y1IA 3TAMB 2CWKA 3FGVA 1XMOF 1V3ZA 3PYEA 3A3NB 4QJVA 3EX7B 3TA2A 5L38A 1UWAA 1JKHB 1LNQA 5EWGA 3CCES 2FJAB 3Q8RB 1Q8IA 2GAHC 2R9LA 2HBRB 4HH1A 3ZXWA 1IKWB 1ITPA 1YRXA 4WBFA 4YR2A 2AV5A 3IO1A 3IWLA 2RUGA 3IR7B 4LF4J 2LQ5A 3IM8A 5CZXA 3CC2S 3DLLQ 2QV6A 3WHIA 3SSRA 1Q0NA 2AYEA 2LEAA 1Z1ZA 3SV3A 4G1IA 3GIMA 2QSFA 4N8OA 4R0JA 2B3TB 2XBPA 4ED8A 3ILJA 4WWSA 3M8ZA 3GMGA 4LSNA 4K4TA 1FO1A 2HG4A 4OZLA 2VFUA 3M2RA 2BEFA 2R8IA 1XNQF 3D0IE 1H98A 1S6OA 3QGHA 5E3AA 2VF3A 3MF5A 2RILA 4ZN1A 4DR3J 2E7WA 4DN0A 3KJFB 1MSWD 1C0UB 1X60A 3G6VA 1NJIT 4AD6A 4ZPBA 2QSWA 2DGXA 3FDSA 4IR1A 5J2PB 2NCKL 2ZKUA 2DHXA 4O4GB 1X4HA 2PEBA 3N28A 4M5LA 3M32B 1CS4A 4OJGA 2Z4PA 2OKQA 4DFMA 2V2QA 2W4PA 4H4MA 1RKJA 2MHEA 2CAJA 2KT2A 5B7WA 4DCOB 1S59A 3LP2B 5IT4A 5B09A 2FJEB 1GMWA 1Q16B 2FY1A 3C14A 1JLGA 4CH0S 2UUCF 2C42A 4NX9A 2P9EA 3RUBL 3O8WA 4B3TF 4ZMMA 3DRPB 1KQKA 2DITA 4XK8C 4YB7A 2HIYA 3D66A 3KUEA 3TQ1A 2XYPB 4PG4A 3V4IA 5D0EA 1SKWA 1TK0A 3OPKA 1JLBB 1EIYB 3Q83A 3T19A 5DDQC 3BGLA 5GVQA 2CKWA 1MROA 1WOPA 3AOCA 1K47A 4KIAA 4ZVQB 3TAPA 4IUFA 1VJQA 5KAKA 1D1UA 1IKYA 4KR0B 2HBQB 3MPDA 2ZUAA 3N5FA 1FE0A 2MKJA 2W1BA 2IC3A 4LQ9A 2C3UA 5IS2A 3O1LA 4LF7F 1D3WA 3WX4A 2FZGB 1UEVA 1XQIA 2DNPA 3B4MA 2MQNA 3FK4A 2NZCA 1LWXA 1FJCA 4IFYB 2RS8A 1FXDA 1L3TA 4H4KC 1APSA 2RRBA 2KHDA 1HWJA 3M9OB 4DR1F 1JLFB 1X0FA 4L72B 4M1KA 3H7HB 3W5ZA 3VGUA 1R0AB 2ZC3A 3P45B 1S1XB 2ZFHA 3DHWC 1VLOA 1WACA 2ASDA 2ZH3A 3HHDA 2FJBB 5J2MA 2ROPA 4ZCLA 1VRTB 1R0BG 1NK7A 3ULHA 3IS9A 3P8BB 4MKYA 4OYMA 4DR5F 3D3BJ 4NCBA 3CNQP 2YKPA 1FWPA 1ZAWA 3DI6B 3R8YA 2N7CA 2RIJA 1T9VA 1XMOJ 1HWIA 1NM2A 1REGX 2KKHA 3I96A 5H9FK 2C2DA 3ITHA 5D4OA 4FVMA 1F9EB 1HBUB 3R9LA 3BR9A 5CYMA 2PMHA 2KRBA 4LSZB 4LR8A 3J7AN 1GTHA 3NGTA 4K2JA 5JUMA 1NK6A 2NQPA 3MZIA 3SCLE 1FXRA 1VLYA 2XMMA 2CJBA 4IOBA 4DV1F 1MW7A 2OPSB 4FF1A 2IFXA 2VV5A 4M94A 4TVAB 4UY85 2NPFA 2BMBA 4DQQA 3NAHA 1SL2A 4CNZA 4ECUA 2QE5A 4TY8B 3VAHA 4CO3A 2MQ8A 2A18A 3EM1A 3MM7B 4P75A 2Z0GA 4ZCKA 2Y3YA 1RWPB 1CLFA 3S01A 5KFAA 2R8JA 2CPYA 1DQ9A 1KTQA 2BUNA 2XZTB 2XSJA 4CO0A 1V3SA 4OZNA 4CI0B 4ILRA 2WBMA 3DKDA 4RU9A 5J1PA 2EG1A 2M88A 2LQ8A 1SC6A 3MTJA 3BSNA 2DRDA 3J81U 2XMKA 4Z2XA 2VG6A 5T14A 5JVHQ 4Y6IA 3K0JA 1P27B 2HQFA 3IRXB 2PFDA 7FD1A 4IRCA 1RT7B 1REVA 1XMQF 1CJKB 1XTZA 1JNRB 2V8PA 3MUTP 3CCUS 3QZ7A 4NRTA 1RWOB 1BXNA 4TU8A 2QA2A 1RWUA 5KFFA 1IWAA 1EZZB 3EZ5A 2LQ9A 4EWTA 4X62J 4CYUB 3DOLB 2LLZA 4ECXA 4NMLA 4ELTA 3HLUA 1E6YB 2AIRB 4H4OB 3L7PA 1TKTB 4ZOSA 2XYHB 3AJDA 2YWFA 3OTOF 2BE2A 3FRYA 2R4FA 3MD1A 1WC5A 1NJWA 1R6VA 1WHWA 3GFXA 4ZS6A 1XBWA 1SJ4P 3GLJA 4E2FB 4IFVB 4UF4A 2V69A 4HT5A 1O8BA 2ZWOA 4C7QA 1RT6A 5CYQB 3KLHB 4WFNQ 2DNOA 2OPPB 5G0RA 1FKOA 4L73A 1T03B 3TYTA 4F50A 3NGKA 4URGA 1LOUA 3OV7A 2W01A 2DR5A 5KT7A 1WTBA 2M52A 4IG3B 3BQ1A 4N77A 1ZA1B 2HFVA 1HL6A 4IH7A 4GRSA 2C2NA 2CQIA 3QFWA 2NSCA 3MR7A 4LFAF 3QRQA 3I87A 2DH9A 3CXCR 4R8UB 5KG4A 1FJGJ 4DCJB 1NRKA 2M7SA 1NK0A 3EDQB 4Z7CA 1VQNS 2MEWA 4UTGA 4QYZK 2VFTA 4KB7A 3I9ZA 4NLTA 2QN6B 1TL1A 4CT9A 2UU9J 3LO3A 4ZVRB 1L3KA 4I56A 4OYXA 1CG2A 2ALYB 4TKTA 3SQGB 2JFDA 4ZVOB 1FFSB 3TW0A 1S6QB 4DZ6A 3SFUA 3HFVA 5A6PA 4QWDA 1GX6A 2GC8A 1DTQB 2D7SA 4QCLA 1ZAVA 4ID5A 4DX7A 3ELHA 2D1CA 2YWWA 2W8LA 3E01B 3MPWA 2MLZA 1P6TA 4HTJA 2GZOA 2AF6A 3CCLS 3MM5A 4PEOA 1IXKA 1FDDA 2NPIA 3HM9A 3GILA 3MEEB 2HHWA 3I5AA 2MKCA 1FDBA 3OBIA 1E6VB 1LXNA 2R7RA 5K8NA 3OQ2A 5D0GA 1JIHA 4DV1J 3OR2B 5K14A 4M5DB 4DHVA 2UVRA 4EBDA 2V4JB 2XI2A 2XY7A 4OIXA 4QIEA 3NNHA 1N36F 4ZIVA 3AB2B 2Z58B 2BJDA 3U27A 1U45A 1C1CB 5LSRA 4ETXA 3EYZA 4BCAA 3V6DA 4AYBD 3H25A 2V2VA 1OO0B 2EW9A 3NBPA 9RUBA 3GV8B 3QJLA 1T05B 4UOFA 4RBVA 2G2OA 1EP4B 4LREA 3NRBA 3R27A 4GKJJ 4MK8A 3NOCA 2HHQA 2XWXA 5LXYA 1VQ6S 2HIQA 1ULRA 2M8HA 3HVWA 1S9EB 3NNAA 3GFHA 4FS2A 2BANB 4ZHRA 2IBOA 2CQ3A 2ATLA 1RAHB 3OR1B 1JXLA 1S7HA 1S6PA 1K0VA 4ECQA 2G2YA
chains in the Genus database with same CATH topology
2YWKA 2QEXS 3OSPA 4AL6A 3MOZA 1J2VA 2F8MA 2RKIB 5BR8F 4LJMA 4DSFA 4K4YA 1NH8A 4F26A 2D9OA 1LXJA 2KU7A 3QIDA 2GMLA 4DSJA 4PPDA 3V6KA 2WOMB 1UKUA 1FA0A 5KT3A 1O51A 5E0OA 1WELA 2YKNA 3HFKA 1SXLA 2CFXA 4NL5A 3RYLA 4MKAA 2YX4A 4X4PA 3CE8A 2KJWA 2PE8A 4OQJA 5HMWA 2ZHAA 2PI5A 3C2PA 2KJVA 2VFVA 5K8MA 5DQGA 3R5AA 2DR7A 1IJEB 3UW1A 2GHVC 3CDWA 4LF9F 1ZTTA 3AQPA 3CULA 3J7ZT 2E1MC 1LWEA 1N5YA 1A9NB 3LGMA 4TYBA 2BXJA 4BHQA 3M8RA 4EUVA 2A3JA 1TR0A 1FJGF 3PW0A 4B08A 4I2PA 3T5LA 1RT6B 4G1PA 4CCHA 4IO1A 2EPIA 4JV2A 3UDCA 1NJZA 4WYWA 2AX1A 1CEZA 5G0RB 4NXMF 1BWEA 5I3QA 4IG0A 3OL6A 4DQRA 3C6UA 4IR9A 1X5PA 2O01C 3NCRA 1SKSA 2VL1A 1SJFA 2O66A 2B4OA 2KZMA 2FHMA 4XDDA 2UU9F 4UUWA 5L1LA 3T9NA 4EEYA 2KYXA 3MM8A 4LF8F 3OTDA 3N6MA 4J5OA 3BEGB 4X4SA 2EK6A 1UEUA 1X4CA 2LDYA 5MLCV 2XGPA 4R5PA 4FBTA 3V6JA 4K5SA 5KFVA 3TVZA 3QZ8A 4O23A 4C9DA 2RB7A 3H59A 4OHZA 1BY9A 1FVSA 3OXFA 3MR5A 5KFQA 4OL8A 3PFOA 1U6BA 2HWIA 3LWMA 4KE5A 2MQQA 4O44B 5THWA 3KHLA 2ZJPQ 1U6FA 3US5A 1IKWA 4Y28C 4DUYF 1S4FA 2MQOA 1PSDA 4CTAB 1S1WB 3HMJG 3UE2A 2N82B 2WK4A 4C0BA 2FLLA 3K8VA 3KLGA 2WRMA 5J2NB 4X66F 2QMXA 1SL0A 2LU1A 4KPYA 4PG5A 5DS7A 3OL9A 3LGNA 3KLFA 4DS4A 4HTIA 2V2KA 2X3GA 2QMWA 2MJUA 3LP0B 5KFJA 3CJKB 2DT9A 2XULA 2HGMA 2PD1A 3CDUA 2DNYA 4F25A 1FNMA 2B0GA 3CCJS 1MMNA 4NLGA 1DJ0A 5EGYA 2KTQA 2B9XA 3VALA 5E3RA 1J5OA 2NUUG 4FPRA 3F41A 1SJRA 2E44A 2GFFA 5DO2A 5LJ5Y 2EFNA 1LWCA 4WKRA 3EGNA 3MMCA 2GQCA 1VFJA 5DGBA 2D9PA 5B0GA 2ZH9A 1TL1B 2ZOFA 3I4HX 4QR1A 2R7TA 3K5OA 4MTPA 3QAUA 3T9ZA 4Y2AA 4KFBA 3H4BA 3DLEB 1NK4A 3ZFVA 2OIHA 4M95A 3HHLB 2WSFC 3GQCA 1FNXH 2LXFA 2B43A 4OJ1A 1WG5A 3OJUA 5H9FJ 3KG0A 2P9GA 2P5VA 2HHHF 3S7RA 3O44A 3T6JA 3MXHP 1N48A 1WI6A 5DM6Q 1N4LA 3DN9A 4NZ6A 2HNZA 2L9NA 2CJQA 3BM7A 4Q45A 2PEHA 3KG1A 3BREA 2WW8A 2RNEA 4U6PA 2MPUA 2KT3A 5DETA 5BYQA 4CH7A 3FSIA 3AQOA 4OLPA 1YITS 4J9KA 2HFZA 1X5TA 4ZVGA 2XMUA 5DLGA 3F44A 5C25A 2LCWA 3OL8A 4C8ZA 2B6AB 1R3NA 2U2FA 1BQNA 2V9KA 2XC9A 4ID5B 4F4WA 3W2VA 4UUXA 3SDEB 5A6WA 2DNQA 2FD2A 2OPRA 4I68A 2HVIA 1RA6A 2M5YA 4AL7A 2JJ4D 1R6YA 3PW5A 3CSKA 3QO9A 1R8PA 1M1KT 1LW2B 5D4PA 2ASLA 4AQYF 5K5MA 4TY9A 1G7CB 2HS0A 3BN7A 1VMBA 3QGGA 1YBAA 5DG7A 3O5TB 4PKDB 2DNHA 4PG6A 3MM5B 1YJWS 1TV6A 1SL1A 2JZ5A 2O67A 3G9CA 4DLGA 1TKDA 4DV5F 2CPXA 4QWAA 2XGQA 4NCGA 3TRGA 1HNVB 4RWXA 2LECA 5HP1A 4FF4A 1HWKA 5KFKA 1WWHA 3DXSX 2RRAA 4X4RA 2VBYA 4NA2A 3KOAA 5KFIA 2B51A 3RRGA 2HFOA 3SEOA 4YDDB 5J2PA 3B78A 5DM7Q 5A8RA 2MJNA 1WF1A 2HNDA 2VG5B 3HHKA 3VR1A 4GKJF 3S1TA 3QJJA 2HMIA 2HVZA 2F9JA 2DCLA 4J9RA 2MKHA 1JX4A 2EI5A 2XY6A 4E8UA 4NYPA 3BO3A 4QZVB 2EWHA 2FLNA 2BJEA 3M32A 1HHTP 3M05A 1U26A 4OZ1A 2C2RA 1VQ7S 1LWFA 4NZ7A 3G96A 5K14B 4G3IA 3M1VB 4EZ9A 3BR8A 1JLEB 2N3LA 1Y3KA 2RQ4A 3I56S 5DRKA 4DL5A 2VQFF 2XMTA 5D3GB 1TL5A 4QPTA 4WFAQ 3RW6A 4F4YA 4DF4A 3MWBA 2M8DB 3MMBB 1VQPS 3T5HA 3ISNC 2AQ4A 1JMTA 2HHUA 2JLGA 3LAKA 4PRFA 2FGOA 2HAIA 2CPZA 4TYAA 4WFXA 3V81A 4OI1A 3M9NB 1ZPWX 1UA0A 3E51A 3IGVA 1FKPA 2HNYB 1DTTB 2JHEA 3H2UB 3QIPB 1ELOA 4KKOA 1IKVA 5G4DA 3VAMA 2XNRA 1UVJA 2CQBA 3G6ES 1HYSB 2J76E 3UPFA 3V6DB 2FJWA 2F1FA 1P1LA 1RQ0A 5B0EA 2ZH4A 2KDOA 4I67A 4KGKA 4K4VA 3NBPB 4FZVA 4ZP9A 3MGJA 5I3UA 4NCAA 1FDNA 3I31A 3KK2A 2A10A 2R8HA 1ZYQA 2XS5A 3H2VE 2ZKTA 4JV0A 4OZ0A 3W2WA 3N6LA 2DBBA 1YSJA 5IM0B 1TP7A 2DVIA 3A8EA 4DL6A 1ZTWA 1TKXA 1UAWA 2ZHOA 1QY7A 3DLKB 3DLHA 4FVCA 1RT3B 2E1CA 1IUJA 1QLNA 4PWDB 2ZM6F 4AXJA 3M2VA 1JLCB 1YRUA 2HLTA 5ITHA 2QA1A 2EKYA 1WHYA 5B0AA 4KHPF 2MZSA 2OMOA 1WHXA 1KONA 2AJ4A 4ZLPA 1N5SA 4U9RA 4U67Q 3K5NA 2MGZA 2WONA 4LQ3A 4YDXA 5HLFA 1VQKS 4UY8T 3PM9A 2RQCA 1J5EF 3D0GE 4BWMA 5LMNF 2RU3A 2Q43A 4ZHRB 5GAHI 1LFWA 4YQWA 1T3NA 3K57A 1WI8A 3D1HA 4P7VA 3Q2TC 3CD7A 3DGPA 4E0DA 2JSXA 3CCRS 1Y0HA 3OFHA 2FVSA 3IR6B 3D2WA 1HQEA 1S6PB 4ED5A 2XMVA 4X2BA 1Q8LA 1IKYB 1YGYA 3R3TA 1U8SA 4IDKA 1V9OA 1M5SA 2Q6CA 4KC5A 4GC6A 4ZA1A 4F3MA 1Q82T 4DV4F 4GMKA 3GIKA 4NA3A 1U48A 2PT0A 1YG0A 2OPQA 1XR6A 4IH6A 1R43A 2KB2A 4G1QA 1VQ5S 5EHHA 1IN0A 4ZPCA 2WB1D 3GIJA 4C11A 4O0IA 1YJNS 2XS2A 4ECWA 2MSSA 1OS5A 2AYGA 4DL2A 4ALZA 3QYYA 3PR4A 5KFZA 1FEHA 4TLQA 1K1QA 5CQGA 3I0SA 1RTIA 3MUMP 1N5YB 3N6NA 1D9DA 3K5PA 1U25A 4X4UA 4QW9A 3PKMA 1DURA 4IQMA 3LPYA 4MIAA 3TI0A 4C8MA 2CQ4A 4EU0A 2W7OA 3K58A 1N8RT 3BDPA 1UVLA 2IA6A 4J9LA 3F73A 1FJ7A 2ZVSA 2IAJA 3I4PA 3I9V9 3QPIA 3C6UB 1MWZA 3GYNA 2ZH2A 1VIOA 5GADU 1VRUA 3I5BA 3OFGA 4DG1A 2ZE2B 4RKUC 2OAUA 4DL0C 4NOHA 4JBCA 4KV8B 3PZPA 3PW2A 4IKAA 4ERDA 2KVIA 4WFBQ 1QAXA 3PDNA 1JLQA 2VC0A 3IAS9 1KTVA 3MM8B 3G8QA 3KTQA 1VQ4S 1U1PA 4YB6A 2JEIA 5E3CA 2FPHX 1TZ0A 4R5PB 4YB5A 1IBLF 2ZOMA 4J9OA 1W2IA 3CJ5A 1C4AA 1QAJA 3G71S 3TX8A 4MMOA 3SI8A 1KVIA 3L95X 3TUJC 3G8TA 3JB9k 1JK9B 4I0WA 1R0AA 3MOJB 4B9UA 1U2RA 1S1XA 5E7OB 4B3RF 2CPDA 4HI1A 1N56A 4NLOA 3CIZA 5BJRA 3GYXB 2C28A 1YI2S 4RLEA 3KLFB 3Q0AA 2LYVA 2X1BA 3FEYB 2BM0A 2I2YA 2HWHA 1D9AA 3CJ0A 4Y65A 3QGIA 3KLIA 2J6UA 4WZQA 3M8SA 2IJFA 4NLQA 1RAJA 1TAQA 2MZRA 3MR3A 1LW0B 1C2PA 2M3DA 2OP5A 2P6TA 3BSAA 3VAJA 4NYOA 5M2RA 4TU7A 1RTHA 1J5OB 1R7IA 5KG6A 2DNRA 5AE2A 2AW0A 3ITHB 5LXRA 1LWCB 3H98A 4K4SA 3MMCB 4LVNP 3BQ0A 3IXQA 3EPGA 1U1NA 1DHMA 4J9SA 1ZH5A 4B9MA 5E5NA 4KTQA 3CCTA 5B0FA 3PVXA 3CCQS 3VWSA 1VQLS 2Z2LA 2GQ2A 4QYZJ 2MKIA 2PIIA 1N32F 3M30A 5KG3A 1HNXF 3MMJA 5CHCB 3OFFA 4DR4F 2L08A 4MIWA 5KFXA 3JAMY 3RB6A 5DG8A 1P1TA 1Q7LB 2RE1A 5F8HA 3RZAA 3D5MA 4ID8A 4C0HA 1H2UX 3IG1A 1HBUA 1SI9A 4DSIA 2OFHX 1QSYA 3K5MA 2HVHA 2DNMA 4DF8A 1DRZA 3N0VA 2W4DA 2MMYA 2J9EA 2G0CA 2GO9A 1M5PC 4Q0BA 1BC6A 4TQRA 4N56A 5C25B 2ZNYA 1T02A 2VOPA 1UFWA 2YX1A 3BGUA 2N7YA 3R5BA 4NLVA 4ES1A 3OVAA 2QA4G 3V5RA 3CDAA 2XCAA 3LANA 5SZTA 1Y00A 1LK7A 3MEGA 2EBGA 3JTNA 1BD6A 2OPRB 1FT8A 4K2XA 4I7FA 4ZPDA 1NK8A 5DQIA 2OPSA 5D8HB 4NLUA 3SFGA 2ZH1A 4W92B 1TFWA 2W9CB 4URQU 3N5BA 2DR8A 3CCMS 2DHAA 5CCLA 4Y34A 2ERRA 1MNEA 4X64F 4KSEB 5FJ4A 2ALZA 3THVA 2EFQA 2HHPA 2C3YA 2BZ2A 3TA0A 4DL7A 4TY8A 2J0QD 3BN4A 4TQSA 4OZJA 5B0CA 2VD3A 4JI6F 1VBZA 1TV6B 4HKQA 2VQEF 1ZM9A 4IRDA 4ZP8A 2AP6A 3X3UA 2W8KA 4NCGB 2ZDPA 1X0PA 5KT4A 2AGPA 2GV1A 1QSSA 5HP1B 4X65F 2KFZA 4QBUA 3E8OA 4PG8A 4MK9A 3DLJA 1SBRA 3MR2A 1KQSR 2J9DA 3M8PA 2QYCA 3KK3A 3RB0A 4ILLA 4RZRA 5A8RB 3NS5A 4FXWA 4YB1P 3OL7A 1D8ZA 4ECZA 2HMIB 4WE1A 2J0SD 3ZZTA 1FE4A 3I82A 4OI0A 2CG4A 5JJBA 4Q2MA 2BABA 4IH5A 2ZD1A 1ZM2A 1VGYA 4WFYA 5BYSA 5KFLA 1HWUA 4TLRA 1LWFB 4WK3A 4A4JA 2BRLA 5IWAF 4KHMA 3BO2A 2AU0A 3LF0A 1AXQA 5E41A 4LF5F 3J7Z5 1N54B 2CVEA 4Q44A 1BQMA 3SZ2A 1Q1KA 2DO0A 2QRRA 4M63A 3MEDA 3MR6A 4J9PA 4OX8A 1I1GA 1N5QA 2GGPA 1NJXA 2BDPA 4F2SA 1HBNA 3FEXB 4A8SA 1X5SA 2DHSA 5KFHA 3V81B 1U49A 1KQFB 1UJ4A 2JLFA 1FHTA 1QTMA 2YKMA 4JI2F 1UP1A 1SV5A 2RF2A 2Z2MA 1TKZA 3N01A 5KFYA 1FKPB 4PQUB 3P6YC 3Q22A 4KKOB 3NNCA 1IKVB 1XR7A 3SMZA 4LFCF 5LMUF 4KT0C 5I3UB 3U1NA 5KFNA 2XY5A 2RDJA 3KK2B 3WDOA 5C42A 5F0UA 4UQTA 2MY8A 4AE5A 3VQTA 1NZAA 1N34F 3NAIA 3Q2SC 3HVTA 1RTDA 1KHWA 3W2WB 3MECA 2IMWP 2IVFB 2CQ2A 1W2BR 2IBKA 2O1PA 3KK1A 2MYFA 2ZNZA 3PY8A 1RTJA 2QA4S 2A2CA 3GSDA 2V4QA 2VA3A 4DQPA 2OJ3A 2EFGA 3FJ2A 3KFWX 1FJEB 2RU9A 2CJKA 2VBZA 1UJ5A 4ZPTR 2CJ9A 3M2VB 4RW8B 5K8PA 5KFWA 2PGCA 4A8YA 2PA3A 4DJBA 4YY3F 2FHJA 4ED3A 3ETOA 2WONB 2DNZA 3KWMA 2MGZB 2FHJD 5A8WA 4R0EA 5FDLA 1FERA 1Z2LA 3IWXA 4X4TA 4JI5F 4J37A 2E5LF 2DH7A 3FNNA 3WBZA 3R1HA 1HQEB 3FZ2A 1YJVA 4LIRA 5IXUA 2MZQA 4ED2A 1KR4A 3IAM9 2GMHA 2EVZA 1CVJA 3HO1A 2YWGA 4IDKB 4WTYA 1ROFA 4XO0A 1U7LA 5LT5A 3DHXA 2G9OA 2CQ1A 1L3VA 4PUOB 1UMJA 1WEZA 2R2RA 4Q8EA 2CQGA 3ISZA 3QLHA 2I38A 3CCSS 4WJBA 1GTEA 2OPQB 1VQ9S 3RBEA 2LQJA 5A0YA 3RAMA 2D3UA 4TXSA 1V6HA 5U47A 1TKTA 4G1QB 3T1HF 4QU7A 6FDRA 3N9UC 4H54A 2LXIA 3E3XA 1MMLA 4C11B 2FDNA 2HGNA 3QAEA 1SB6A 3OXLA 5KT6A 3HT3A 1U1LA 5CXTA 2HPUA 2VBWA 2D41A 3KMQA 3I0SB 1RTIB 4BBYA 5IFMA 2I8EA 1S1UA 4K59A 3QWUA 3H5SA 4ZP6A 4UW2A 3HZEA 3CGIA 4ECTA 2X1FA 2L9WA 3T5KA 4QIVA 3NCQA 2UZAA 1R89A 1NEEA 2J8AA 4DR2F 1HPZA 2J9DE 1FKOB 2EFOA 2N4DA 2GIQA 2IAJB 4A8WA 4NA1A 1BQXA 3H2LA 3TAMA 5GAHU 3J7YI 4RUAA 4I2QA 4K5RA 4DG1B 1A7GE 3DRRA 4ZPWR 1RISA 2OSRA 2LKZA 3UD4P 3H5XA 1C1BA 4ZVEA 1SUQA 3PRDA 4C98A 5L1IA 3IR5B 1D8YA 4M8LA 2WHOA 4XIUA 2OD4A 2XMWA 2B4VA 1XEZA 1JLQB 2DK2A 5AE1A 4I6AA 3QMQA 1JKHA 1FVQA 1N5TA 2C2EA 1X9SA 2IRYA 2CQDA 1L3SA 2L3MA 2IM3A 1GT8A 2IRUA 3P5TL 3LP1B 1YVFA 1U1KA 4C3MA 4PXDA 2PA8D 5F3TA 2ADBA 2AJ0A 2M0GB 3POTA 2K1RA 2ROGA 5F8LA 4RNOA 1KC8T 3MI7X 2VASA 1FDAA 3T1AA 1RT4B 2LA4A 3DOKA 1U09A 2O3DA 1H6KX 3FCHA 3UI3A 2C3MA 2BV3A 2PC6A 3KKFA 1X4AA 4FXVA 2ZH6A 4NLWA 2BW2A 3B8HA 5KT2A 3RR7A 3AAWB 1RI7A 1KOOA 2B5JA 4DX8H 2GMJA 4KRWA 1UL3A 1HBOA 2KXNB 1UW4A 3LQVA 4DS5A 3CCVS 4JI1F 4DR6F 2BRKA 3HHEA