2OMLA

Crystal structure of e. coli pseudouridine synthase rlue
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
182
structure length
181
Chain Sequence
NQPTRVILFNKPYDVLPQFTDEAGRKTLKEFIPVQGVYAAGRLDRDSEGLLVLTNNGALQARLTQPGKRTGKIYYVQVEGIPTQDALEALRNGVTLNDGPTLPAGAELVDEPAWLWPRNPPIRRKSIPTSWLKITLYEGRNRQVRRMTAHVGFPTLRLIRYAMGDYSLDNLANGEWREVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of E. coli rRNA Pseudouridine Synthase RluE.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Ribosomal large subunit pseudouridine synthase E
total genus 47
structure length 181
sequence length 182
ec nomenclature ec 5.4.99.20: 23S rRNA pseudouridine(2457) synthase.
pdb deposition date 2007-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00849 PseudoU_synth_2 RNA pseudouridylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.580 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2omlA01
3.30.70.1560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-L RNA-binding motif 2omlA02
4NZ6A 2OMLA 4IQMA 1VIOA 1DJ0A 2NR0A 2NQPA 1VS3A 2GMLA 4J37A 4ITSA 4NZ7A 2NREA 2OLWA
chains in the Genus database with same CATH superfamily
2Z30B 1DLOB 4KR0B 4DPTA 3PKMA 2C3YA 3HULA 1HQEA 4LF6J 1R8AA 2W1BA 3D6FB 4FYXB 3NMRA 5B0FA 4F3MA 5AE1A 3UVJB 4I64A 5MAOA 3ILIA 3HDSA 2D3OR 3BSCA 4OI3A 1HR0J 1N48A 4PG6A 5L9NA 2UUAF 2ACYA 4IFYA 5CYQB 3GIKA 2ASDA 2ILYA 1XC9A 3CCMS 1PO6A 2GGPA 3HFZB 1S57A 1FFWB 1FK9B 1TELA 4QR1A 3NL0A 1N0UA 1U1PA 5L38A 2OPQB 2ZC4A 3GFXA 2GFFA 3H59A 3UN2A 2YWWA 3ZTRA 1HNVB 1RE1B 3GG1A 4ZVUB 3TVZA 2VBYA 1S59A 2CQ4A 4B9UA 2EFGA 2ZH3A 2SXLA 3U02A 4IFVA 1JJCB 2V8VA 1HBNA 1BY9A 1FRLA 2HAIA 1RT5A 1ITPA 3HHLC 4LRBA 3FNNA 1CJUA 1X4DA 4DR7J 5G0RA 1UFWA 1OSCA 2DNLA 4WZQA 5C2CA 1YSJA 2DO4A 3POTA 4DR1F 3OL8A 1SXLA 1S1VB 4WE1B 1TKXB 4JBCA 3AOAA 1FNMA 3SQGA 2MJUA 1IBMJ 2WTFA 3HSZA 1FXRA 1UPMB 4CWBA 4DV0F 2Y1JA 4JI5F 4QPTA 3KK1B 2R2UA 1UWAA 3PR4A 4FBUA 2RVJA 1U6ZA 2UXCJ 2BRLA 3KG4A 4OI0A 1X5SA 4PUOB 1FCAA 3WDOA 1CSJA 2KU7A 3MM9A 5LJ3Y 3M9MB 2ROPA 3ZTPA 2F5GA 1Q5YA 2MLXA 3CJKB 1FKOB 1UKUA 2JX2A 4MKAA 3L09A 3MTJA 3AB2B 4QZVB 3UR0A 1VQ6S 3GLJA 3TQ1A 4U8VA 3NWRA 3EM1A 3CJ5A 2BM1A 1S5ZA 4WFYA 1K0VA 1PG5B 3O1LA 1RACB 4IO1A 4NMXA 1ACMB 2MY8A 4Q2MA 2HS0A 2XZWA 2CKWA 4RBTA 1HKAA 2O66A 4C8KA 3CCVS 3ZZOA 1AYEA 3C6TA 1DLOA 2VQFF 5C42B 2IYGA 3KYLA 3TEHB 3UO0A 2DH9A 3OT9A 1CJKB 2LYVA 4IR9A 2ZZNA 2R2SA 1FXLA 1NKBA 3N6LA 3EPIA 5A8WB 3C8YA 2EFNA 4GKJJ 2I38A 2J0WA 2BE7D 1VBKA 4OZ3A 1WC0A 4EO8A 2W24A 4KHPJ 1RZMA 2V4JA 3EWGA 1KR4A 2GQ2A 2VBWA 1RT2B 4KO0B 5A76A 3GYXB 3LW5C 3CMES 2E44A 5KT2A 5FD1A 2ZHAA 5CA5A 3FJ2A 2NPFA 3OXLA 4RU9A 1N8RT 2UU9J 3SCJE 2XLIA 4ES1A 3OR2A 4NLOA 3NP5A 5BJRA 2AEMA 2RE1A 2APOA 4AXIA 2QL5B 1NSKL 2UUAJ 5CABA 4B3SF 3M8QA 5LXRA 2XLJA 1IM6A 1TKZA 2FZGB 3CUNA 1K47A 1VQYA 5ETPA 3PX4A 4B9VA 2VG7B 4J9QA 3CSKA 4ZITA 2LQ5A 4ALZA 4U9RA 2V4RA 2H48B 4OLOA 2E7WA 2EG2A 2VODA 2K7KA 2NUUG 5KFPA 4O44B 1NKEA 2YWGA 4DU7A 1QVFR 3M8ZA 2GHPA 2WZ1A 2EFPA 1TR0A 2YNGA 4UUXA 3PW0A 3A12A 4RW9B 3TRGA 3I0SB 5F9NA 4ID5B 1RT7B 2C1EB 3NAHA 1RT2A 8AT1B 1UFKA 2JZ5A 3AH6A 3EVOA 3H2UB 3LH2S 5J2NA 3QGIA 3ZZPA 1B7FA 2AJFE 3ZXWA 1J2VA 2OHDA 5GADI 4OYAA 3V2UC 4DUZF 1ZZNA 3V6JA 2YKNA 5C25A 3SFGA 5DM6Q 2LDYA 4FKYA 3GP9A 1S10A 2UVRA 2NQPA 2WONB 3U1MA 1S1XA 4J9VA 4DFMA 2YWFA 2HHUA 1FDNA 4DR2F 2VC1A 2ADBA 2POKA 3VGUA 3CXCR 1DTQB 4ICLB 1EIYB 4GC7A 3MECB 3OSNA 2GJFA 1S77D 3MM6A 5H9EJ 3FMWA 2NZ4A 4WXWA 4OQJA 1U26A 4RW4A 4AFFA 4TU9A 2G2ZA 3O3LA 3VWSA 4NE9C 3PYEA 3BN7A 3FSYA 3GU0A 3GV7B 3WHIA 2H51B 2OD4A 3BYPA 4YB7A 3MR5A 2DH7A 3OFHA 4K8RA 4B3MF 2W2OP 2MZJA 1TMJA 2QSFA 2FGCA 1FRHA 1CBKA 3IAM9 1JLCB 4NWBA 1NAQA 5BYRA 4DUTA 4Z37A 4QWDA 2C42A 4QWEA 3IFEA 2CAJA 4QR0A 3SQOP 3CJ8A 4RUAA 2KJWA 1LFWA 2XMJA 3E2EA 1WC3A 4A8KA 1WNEA 1AZSB 2CRLA 2KH9A 1XERA 3UE2A 2CPEA 4OV1A 4OYPA 3NEKA 3A8KA 4RZRA 1R8PA 2Y0SD 2ROEA 3K17A 4AD6A 3W63A 1KDNA 5K14B 1C0TB 4C2MA 4ECUA 2DITA 4DPOA 4ZPTR 1S72S 3MD3A 2CQBA 3HFKA 3NGSA 4PWDA 3TZYA 2CPXA 1L3VA 3EPGA 4F36A 4OI1A 3DM2A 3PG9A 2VG6A 3AA8A 2Q79A 3H8YA 2DGVA 3IR6B 1S6QB 1UJ6A 3PRBA 4DL6A 3OSPA 4LSNA 3D1QA 3OXFA 1ZM3A 2XMKA 4FYWB 2XZTB 4TLQA 4KPYA 4WU3A 4PYAA 1NJXA 3W65A 1R8CA 2PIIA 2ZDOA 2OEJA 2PFFB 4ED8A 4LQ9A 2OFHX 1S0MA 4TQRA 4FF2A 3BR9A 3D6TB 4GVBA 5EN1A 3I0SA 3CW2C 2HVEA 2QTWA 4YEAA 3B4DA 3RB4A 1FF2A 4OJ1A 3B6BA 2W7PA 2P9CA 4UTGA 3U1NA 1NSQA 8RUCA 1HHQA 2WW8A 2IRXA 3EYZA 1NJIT 1FKAF 3W1YC 4F0MA 2FYXA 5F8MA 3T9ZA 4OHWA 4ER8A 1E6VB 3FK4A 3V6HA 1BWVA 2UUWA 4DV2F 1HBMA 4ZN3A 3SI8A 1XMOF 3CCUS 3Q2TC 3KLVA 1YVFA 3ELHA 5HP1A 3HP6A 4I2PB 1VBXA 4GKJF 5KG2A 1UMJA 5C24B 4M5LA 3W9IA 3RBZA 4X2BA 4TKTA 4ZP7A 3TAMB 4RNNA 3CIZA 3I5CA 2DXEA 2RSQA 3LGNA 5GAEU 3TA0A 4F0KA 2V4QA 4DQQA 2JHEA 2BDPA 4B3TF 1N88A 1KOHA 4J9UE 1NK6A 1HWIA 2FVCA 3W64A 4NLPA 1RSCA 1EX8A 2D1CA 5SZTA 3LTOA 2C2MB 3NGRA 1FJ7A 4YR0A 1UJ4A 2MHEA 5LJ5Y 1VQ7S 1FWLA 3GSDA 2NXUA 2L3MA 2XNQA 1RWVB 4OYBA 4EWTA 2MKKA 3KWMA 4IRDA 1B4SA 2WW4A 2MQMA 4CO5A 5D4PA 4CT9A 4J9SA 1XN9A 1WEZA 2R7UA 1X4FA 2EWHA 2RNEA 3H4DA 4QWBA 4RNHA 1OO0B 3CCES 2VPYB 1J5OB 1FJGF 3UQSA 3OJSA 5D0EA 4F02A 4G1IA 5GAGI 2ZFHA 4NI2B 3S8SA 2PI4A 1XBWA 2D41A 1G1XA 1KFDA 2OTJS 4P2SA 1VI7A 4B02A 2RUSA 1FDDA 1VCTA 4NXNJ 5IOLA 3JQKA 2C2KB 1EHWA 1RGVA 1SV5A 2WSCC 2DNGA 5K8PA 4USJC 1VMBA 3DOLB 1NK7A 2DGWA 3CCTA 3H40A 2EI5A 3DKDA 3D4JA 1UFLA 1CS4B 2RMLA 4EZ6A 1PYSB 1I3OB 2DGUA 3TZXA 3ITHA 4IOCQ 3T5JA 4Q0BA 1VJQA 1SL1A 5KFCA 1NMEB 1MN7A 4ETXA 3PO4A 1XNQJ 1LW2B 2OP5A 3QYYA 2ZM6F 2HAFA 1ULRA 3IM9A 1S6PA 4FYVB 2B9EA 4Q7AA 4WBFA 2IJNA 2N3LA 2AYMA 3KJQB 1PAEX 2HPUA 3IRXA 1FJGJ 4IG0B 3GJSB 4DCPB 1RAOA 1X8DA 3T1AA 3KK2A 1JLAA 1HMVA 1MROB 1RB0A 1H2VZ 2RUGA 3IG1B 4M63A 2Q1LA 4NRUA 5LXYA 2UXBJ 2ALYB 3UN3A 2CG8A 2G0IA 3PY8A 4L73A 3VAKA 3AD7C 3V6DB 4CP5A 2GQQA 4F25A 4NYPA 2CPJA 3TAQA 1VC6A 1QDUB 1HBOB 4M1KA 1KNZA 2M3DA 2HHHJ 1B7YB 3Q83A 5FLXY 1RTZA 3VAGA 3V4IB 5KFSA 3SDEB 2DHSA 1BE4A 4I6AA 1Z1ZA 1RTJA 4BC9A 1YJRA 5EWEA 3KUGA 4ILMA 1FKPB 2G1HA 2PI5A 3DCAA 3P5BP 2FIUA 4ZHRA 5IS2A 2L48A 4I7FB 3IR7B 2IVMA 3CEDA 4NEZA 2YX1A 5KAKA 1IKXB 3DYAA 3EZOA 4ED0A 4ZVFA 2ASLA 1G6BA 5KFMA 1S49A 4WU2A 1OS5A 1Y5NB 2QC3A 3IBWA 4M5DA 5BYQA 4DG1A 5I3UA 1IQTA 3L9ZA 1J5OA 2XSJB 2J0XA 5A8RB 4ECWA 1VQPS 1K9MT 3S7RA 2OO4A 4KQZA 2AIRB 5F41A 3I6PA 1AB8A 2LDIA 2MZTA 2P9GA 3PHTA 4P71A 4DMZA 2V50A 1NK9A 3EXYA 1N6QB 1VIOA 5HN0A 4J90A 1S9GB 5IC6B 1M1GA 1SKRA 3IWLA 1H6KX 4JI0F 4Z7CA 1MU2B 1N5QA 4B9TA 3JS9A 1GXLA 2E5GA 2AT1B 1DHMA 4JV0A 5DQHA 2XMUA 4LF9F 4NLGA 3K5OA 2HHQA 1FNXH 2YNGB 2XBPA 3RW6A 2ABYA 2FGOA 3VAJA 4UUWA 1NDPA 1J27A 1QUPA 4HH1A 5KFLA 1YDLA 1MWQA 3BR8A 1DZ5A 2DR7A 4V19X 2VBXA 1UVMA 4X4VA 4DPYA 3THVA 2AW0A 3CJTA 1IKXA 3OHAA 4DWIA 2CZ9A 1T9VA 2WOMA 1JLCA 3OHBA 1PJ7A 1RT1A 1HNIA 2E5HA 2LA4A 1S1TA 3ZFVA 3DLJA 4CO3A 4EMDA 5IXUA 3OQ2A 3CCRS 1YJWS 2IMOA 3BSNA 1XR6A 2MYFA 1U6FA 2KL8A 2K8GA 3RUBL 3DNCA 2HHPA 2B7BB 1IJEB 1PC4A 2HS3A 1FVQA 1ZETA 2IA6A 4DSIA 4FBTA 1XNQF 1JLBB 1VGYA 2DNYA 4HR2A 1RA6A 3MECA 4MKVA 4O4RA 5K14A 5C5JA 1U0SA 2YPZA 1REVA 4PG5A 3G6YA 2JEJA 4LF5J 1P9QC 5A2QY 4J9PA 1IKYB 5CQGA 3N5BA 4CLFA 5DS7A 2B4OA 4DV5F 4FNIA 1RTIB 3LP0A 3IN5A 1HNZJ 1E6YA 1J5EF 3CDEA 5J2PA 1U0HB 1SC6A 5LSRA 3Q8RB 4ECVA 3NNHA 1T11A 1A7GE 1Q8IA 1S1UA 2VDIA 3F73A 2BACA 1YZ6A 2LLZA 4DU8A 1KD1T 2BKPA 1S6PB 1JJ2R 2AGPA 2DJWA 2F63A 2V34A 1H3DA 3EICA 3GCXP 3HHLA 3QLHA 4A8QA 1P27B 4DPXA 1T02A 3DDKA 3ZC4A 3HLUA 1Q5VA 2FQQB 3H2VE 5F3TA 1S12A 3H90A 4TU8A 2IBKA 2WBMA 2XMTA 1C0TA 4KH1B 3CULA 1EARA 1AW0A 4ITSA 1FWKA 3SYZA 5JVHQ 2CVEA 3BDEA 4ZVOB 1KONA 1UJ5A 3C19A 1C1BB 2ZKTA 3Q8PB 2CDQA 1F9HA 1W2BR 1GEHA 1S6QA 4WFXA 1AUSL 1HQUA 4R8UA 4L6V3 2ZBIA 5GMDA 2DCLA 3SCIE 4ZIWA 3MCOA 3F41A 3MR7A 1XEZA 2QL7B 4MKBA 2M52A 1S99A 4ES2A 1RTIA 5GMKa 1UAWA 4DV5J 4K0KJ 2C2NA 1RBAA 2ZDPA 5CXTA 3RW7A 2PGCA 2RHQB 4ZIVA 1FRIA 2HIQA 3KLEB 2XS5A 2BEFA 2K3IA 1RWWB 1X5OA 2AJ4A 2VC0A 2W25A 3H5SA 4PZVA 7AT1B 2F40A 2K1RB 4X65F 2KG0A 4K4YA 1D9FA 2QO3A 1D1UA 3HD1A 3ADAC 4LIWA 4C3KA 2YKMA 4E98A 2E7XA 1YLXA 5B0BA 3K0JA 1R8BA 4BDPA 4P6QA 3PO5A 4CYUA 2HGLA 2G4BA 2HHHF 4OZ5A 2Z2LA 2DHXA 1A9NB 2ACMA 4B3TJ 4DQIA 3DHWC 4IOBA 1GXUA 4ZLNA 1S1WA 4FF3A 1FHTA 1PGZA 4K59A 4DI6A 3RU0A 4HT7A 1VC5A 1L3UA 1VQNS 2DTJA 1TL3A 1M5VC 3WIVA 5AXMA 1HYSB 2E7VA 4WFBQ 2BOAA 2OMOA 4MFBB 4QJVA 2VA2A 1F3VA 3C14A 2DNZA 3FRYA 4ZS6A 4J9KA 1FTCA 4WYLA 4P73A 2DKOB 4KHMA 4C8MA 3OJUA 4LFCJ 3G82B 2ZBQA 3TX0A 4ECRA 2DNQA 2IRYA 4HVZA 1TAUA 5KOXA 2NZCA 3ILLA 4WFZA 2B6AA 1EP4A 2DGTA 2HFNA 1DURA 3AQPA 3OBIA 1RXOB 2MJNA 3VHQA 2VJVA 4GO5X 2JC1A 3MOJB 5KG1A 4X4SA 2CNOB 2XI3A 3CD5A 4USTA 3J7YI 3QT8A 4BBYA 1RTHA 3CJ3A 3MM9B 5ADZA 3MEGB 3L95X 4I6WA 3MFIA 2VFRA 2IIHA 4FVCA 4CLLA 3G6VA 1MWYA 4NXMJ 1KVJA 4U7UD 1QAXA 1LW2A 2YVSA 3DC2A 2HMIA 2KKHA 4EK2A 3DLKB 3BGRB 2VUGA 3I4PA 1JLGA 3I4HX 4K7QA 2V9KA 1HPZA 3FUYA 2ZH1A 4J9MA 4DUZJ 1RADB 2MZSA 4HI2A 2HEKA 2F1FA 2E1RA 1VJWA 2M9KA 1WUUA 2NS1B 4DV1F 4EFAC 3OV7A 1SIWB 4ELTA 1MMNA 2UXCF 4JI7F 3DI6A 5CHCB 2QLWA 2XQCA 3CB4A 1VOMA 4ZPAA 4BC7A 1RTDA 3MFHA 4FNHA 4GKKJ 2HRTA 5HROA 3GIIA 5LMNJ 1T9YA 2HBQB 4JP8A 2O01C 4A4JA 2MQOA 1WC6A 2B6AB 1EZZB 3KLGB 2CQ3A 4DSFA 2FTRA 3EJMA 3T19A 1W2IA 2RQ4A 2PMHA 3MMAA 4Y28C 3K5MA 1RT3B 4J5OA 3IS9A 1UVJA 1C1CA 2E1PA 1LWCA 3F0NA 1CQMA 1NKCA 1VQ5S 3M2VB 2XG8A 2OPRA 3TO8A 2WB1D 2BKNA 4PPZA 1ZAWA 3JAMU 3VAHA 4YHHJ 1S97A 1TMMA 2KYZA 4DBQA 1WKJA 2V4JB 4LVNP 4ED7A 1ZA1B 1D3WA 2UZAA 5IM0B 1FO1A 5L1IA 3N4WA 4G1PA 5LL6d 4LFAJ 1T8EA 5CCLA 1YTYA 2IDLA 2DGOA 4WJBA 1RT7A 3MI7X 2BW2A 5HATA 2GVDB 3Q86A 1YBAA 2GNKA 4PXEA 5B0EA 1VLOA 3QFWA 3CPWR 1HNWJ 3JSYA 1I51B 1SBRA 4FN5A 3WX8A 3QRRA 2RF2B 4DR4F 4X4QA 1U8SA 3C46A 2CQ1A 2AQ4A 5KT3A 2BJ9A 5KFAA 3Q23A 2ZNYA 2I2YA 5ETTA 1S76D 3QJJA 4ZP9A 4JI4J 2ZOGA 2CQ0A 2QIFA 1VRUB 5J2MB 3BKFA 1NDKA 1CC8A 3L4BC 3IMQJ 1YBTA 4X62F 3K5NA 4MK7A 1HI8A 1GTHA 3JQMA 4FF4A 2HBZB 2DIVA 2V94A 2F3JA 5KFGA 3HK2A 2VOPA 1M5SA 3MAHA 2MQNA 2JOQA 5E3QA 2MSSA 1QJHA 3QJPA 4M8LA 1VQ8S 1JKHB 3H42A 3TZWA 4LF7J 1RHUB 2IVFB 4Z2XA 4LSLA 2D7SA 2ZHOA 1S6OA 2IVYA 3PACA 3J7Z5 4JOUA 2XM3A 2VKZG 3J81U 1TFWA 5D4OA 1R27B 4FKXA 2M70A 4HT5A 1ZAXA 2MLZA 4L74A 1T9TA 3A8IA 3CCSS 3PX0A 3KK2B 2GHVC 4KGVB 1XR7A 5KT6A 5ETLA 1IR2A 4B9LA 2UUTA 1QD1A 2IAJA 2GMLA 2HFSA 2XMMA 4IDKB 5IQ6A 4I2QA 3BH6B 2GCFA 3PZPA 1BQXA 1RAEB 2MEWA 3AD9C 3DLGB 4ZDNA 4CLPA 4E8UA 3LP1A 4N41A 4I1TA 2VQEF 3K57A 2FJXA 4XPCA 1SUQB 3CWJA 4A8MP 2UV8G 4B3RJ 2CDRB 3CDBA 1JLFB 2E9ZA 3MEGA 3Q2SC 1R0BG 2AWZA 4NLRA 1B0PA 3NS7B 4MYUA 1U1QA 1RT1B 4E0DA 2LEPA 1S1UB 3JSRA 3L7PA 4PXBA 5L46A 3LOUA 4OJGA 5CYQA 3W2VA 1DFDA 1M5HA 3CJ4A 2OSRA 4C48A 2Y8WA 4IH5A 4YDXA 4NI2A 1NM2A 5ETNA 3S1TA 5GMEA 1VC0A 3JTOA 1TVRB 2VZ9A 3FZBA 2HGNA 2ZH6A 1T05B 1JLEB 3N79A 2UUCF 3TJAA 3N28A 2JL9A 4Y6IA 1O0PA 1RUSA 3FEZA 4M5IA 3G86A 4USKA 3HVAA 3C15B 3KUHA 2Y0BB 1S0NA 2CNNB 3PJXA 1U1LA 4YN3B 2J0SD 1Z2LA 5KG3A 1FX4A 2J9EA 4DJBA 3TUPA 1IBLJ 1U2FA 1TUVA 3B82A 3EXCX 1GQEA 2I0XA 4CLWA 1KKHA 1OPIA 2J5AA 2CJKA 1IVZA 2ZJQQ 2BANA 3H5YA 3DMJB 4FXDA 5A6PA 1NLKL 5KG0A 5A8WA 2V68A 4W90B 2HQGA 3M8PB 2G0CA 4PRFA 3PYGA 2DHAA 1IKVB 2CPYA 4DV4J 1K1QA 5DZ7A 3GTYX 2AX1A 2BM0A 4FDFA 4RPFA 4C3MA 3MEDB 5IQQA 5T41A 2JEFA 1HW8A 3H7HB 4F4WA 2E1MC 5DRKA 3U27A 3M9NB 2FJWA 4B3OA 1GX6A 3MD1A 5EX0A 2JVRA 2W4PA 2NLWA 3P49B 2DXFA 2QE5A 3M32B 3N9UC 1QTMA 4X65J 1FESA 3I9ZA 1RWOB 2LP4A 2YX7A 1IXKA 4ES3A 1D9DA 3CD0A 2OGUA 3THPA 1HBOA 4K4WA 1O5JA 2FHOB 2A18A 3KLEA 3ZO7A 3PR5B 4L72B 2EFVA 1KVIA 3ET6B 3TJ9A 4QR2A 5DZ6A 2AF6A 2VHGA 4USUA 1BUXA 3CMQA 3US5A 3VCDA 4F0HA 1LOUA 4YUDA 4DV6F 1NHUA 2GC8A 3DRSA 3RTVA 1N52B 3D7SB 2OEMA 2BVZA 3S01A 2DHHA 3T1HF 3DLLQ 4V19J 2X1AA 3ISNC 1FWPA 3QRQA 3M30A 2C2RA 5ETSA 2QFIA 4LUBA 3O6QA 4BWMA 1C2PA 1OYEA 2DNRA 2YKNB 5C25B 2KM8C 4ZMMA 2DR5A 2CADA 3NMAA 3D5MA 4DSKA 4P2FA 5D4LA 3CF5Q 4X64F 3L3CA 1GAOA 4ID5A 5T7LA 1TL5A 3LAKA 5D77A 5J2NB 1OY8A 1VYAA 4QOTA 3LAMA 1HARA 1TL7A 4P7VA 2D3UA 1FFGB 1PBUA 5M2RA 4A8OA 4JI7J 4MFBA 4XAKA 2RB7A 2DYAA 2VV5A 1OMSA 2ZD1A 3NY0A 2R7TA 1RWPB 1VIXA 2N7YA 1SQFA 5JXSA 3QT6A 2R3VA 4NA3A 2XMVA 4A8WA 2NXNA 1Q78A 3K2YA 1XTZA 2HRYA 3QAEA 5HSPA 1YJ7A 3M6VA 4ED3A 4X4OA 4J7CA 1EKSA 4ZPDA 3KDNA 4G1QB 1C4CA 3KMQA 3HO1A 2Z2ZA 4FVMA 4QU6A 4WWSA 4CM0A 2RQCA 4N8OA 3A3NB 2MB0B 3A1YG 1CLFA 1S9FA 2C3MA 1U7LA 5C7PA 2F65A 4I56A 2R8IA 1R89A 4R5PA 1V3RA 1TK0A 3FSXA 2CIMA 4YP3A 2Y9HA 4OX9J 3EGVA 2KRBA 2VASA 3DRRA 4JI2J 1JB0C 4O3RA 3ETMA 4FS2A 1YK9A 3C6UA 3IO1A 5HI7A 2WB4A 5HBMB 3MR3A 1V9OA 2AJ0A 1CQNA 1ZBTA 1CJTB 1UEVA 3C15A 3NLCA 4TXSA 4Y34A 2BR0A 4G65A 1S0VA 2KZMA 1X60A 3GR1A 2BKOA 2BMBA 1RAFB 2RIJA 4YHHF 2KM8B 2E5LJ 3HZGA 2BJEA 5G0RB 3BO4A 2FB0A 2GIFA 5ETVA 5G4DA 5I4MA 3TOQA 1RT3A 3H2LA 4NLSA 4XDDA 5C42A 4ZJQA 2DB1A 5DG7A 1Q81T 2BJ8A 2QLXA 2RDIA 4UQTA 2GAGC 1IKWA 4L76A 2YBVA 2XEXA 1WORA 2H4WB 4I7FA 4RBVA 2XB2D 2B8QA 3HHLB 1HNXJ 4L3NA 2JLGA 4CH7A 2QZ8A 4ZOSA 2XY5A 2B4UA 3IBCB 4Y2IA 4KSEB 3LP2B 2RT3A 3CD6S 1NK0A 4NLYA 2X1GA 3NGDA 2M8HA 5J2PB 3HPOA 2KHDA 2YKQA 3UW1A 3P6YC 4B3OB 1CVJA 1F5BA 1FKOA 3DRYA 5E3AA 4ZJLA 4AXJA 3T9NA 1RHJB 1F60B 3OR2B 4PR6A 2JRSA 3QIPB 3E8OA 2ZOMA 5CZVA 3Q89A 2HRUA 2QX0A 2DXDA 3VQTA 3R5DA 3R27A 1UWBB 5T7LB 3ZZRA 2YNFA 2L41A 2EC2A 1S79A 4U7UK 2DNNA 3EX7B 2LA6A 1Q86T 1RHRB 2FUG9 2B4VA 2DISA 5IV3A 4U7CA 4OYIA 4XPEA 1N36J 2HNYB 2J8SA 5F8JA 2RRNA 2IAJB 3BJYA 5T14A 3UN5A 1B0TA 2R2TA 1FXDA 1UW9A 1WTBA 2FVPA 3PXGa 4N8NA 5ETRA 4DZDA 5RUBA 3Q0AA 3LPEA 2BOPA 1UW4A 2Z8QA 1Q79A 5KFNA 4W98A 4ZVPB 4UZBA 3GQCA 2R7QA 5DDRC 2HKEA 2AEFA 2BE2B 2BJ3A 2BV3A 3N0VA 5F9LA 2FJVA 5A0YA 2JC0A 1NHKL 3SSRA 5KFFA 1SC3B 5KFWA 1G2EA 2HFOA 3AQOA 3BEGB 3HHDA 2YNIB 2HLTA 2X3GA 4HDHA 3TI0A 4C8LA 4NA1A 4NCGB 4AT1B 4K5RA 2IFXA 2LEAA 2PDAA 2H54B 4H4OA 2J6TA 3T6JA 4CYUB 5EWFA 4QW9A 1HA1A 1IBKJ 5ETOA 2CZVC 1X5TA 3HHLD 3I55S 4Y2CA 2FHJA 1S6UA 3K8WA 1D0EA 1URNA 3TVYA 4RUHA 1HR0F 1UVIA 1WG1A 3DGPA 4OMFG 1RA7A 1IKYA 3MM6B 3GYNA 1ROFA 4LFCF 5DGBA 2B9XA 4NLVA 4J9RA 4YB5A 5A6WA 1X7VA 3V6DA 1N34J 1R6YA 1IBLF 4CRJA 4PXCA 2KFYA 1U24A 3ZZYA 1UVLA 1NB2A 3OLAA 1YJNS 2X1BA 3ZNUA 4AYBD 3R9LA 2ZJPQ 2U1AA 2UV8A 5J1PA 2HNDB 3OTCA 2DHGA 3KHRA 2OTLS 1WKLA 4RWXA 3NXZA 4CLSA 1X31C 1FRKA 1VQ4S 3Q24A 1LQ9A 4P72A 3W5ZA 3ZZTA 3MAAA 3CCJS 4EGLA 3QQCD 1M1KT 4ZJOA 2D3ZA 2KFNA 2H9ZA 2MLYA 4JI8F 2IC3B 3PW5A 1EETA 1UEUA 3DOKB 4UZCA 4RJVA 1YX2A 2MGZB 3MURP 1DBDA 3MMCB 4G3IA 4UY8T 3R2CJ 1S1WB 2C3PA 2HWHA 4I0WA 1TU0B 2KRRA 4BCAA 4DR5F 1RAJA 3BGOP 5KFUA 4N7TA 3UDEA 3HJFA 3UFCX 3OR1B 1R6VA 3NGKA 1RHQB 2AYGA 1ZOTA 3JYTA 1NUEA 4QBUA 5HQ8A 1Q8KA 3MUMP 1XJWB 3DI6B 2WSFC 2K1RA 3CDWA 3IXQA 5GADU 3MGJA 2DD8S 2MY7A 2VH7A 2VICA 1F5CA 3R5BA 1IKVA 5L39A 2VFTA 4OYZA 3IC1A 3V81A 1T95A 2HVDA 4OZ2A 2NUHA 3WBZA 2Z2MA 5KFZA 1EQ0A 1QY7A 3FC9A 4MTPA 3VVTA 2KT3A 1V6HA 3NCRA 1P9YA 2V8DA 5HK4A 2NXEA 2W2PP 2AGQA 4ANCA 4F2SA 1GNKA 3OL9A 2G13A 2MKSA 3T1YF 1C0UB 3KJFB 4NASA 2NXCA 4P74A 3CJSA 2RDJA 1HI0P 1BXNA 1QE1A 4KGKA 3BGUA 1S1TB 4TLRA 4QWCA 3PHEA 2CJQA 2DGSA 2QMWA 1LW0A 2K2PA 2C2ZB 3M2RB 4PG4A 4F4KA 2YNHA 2JNJA 4Z7YA 1RYSA 3KLHA 4O4GA 3ET6A 2CQGA 1LNQA 1TFYA 4WFAQ 5KFVA 4B9NA 3BH7B 2I9SA 1TUGB 3HX9A 3QNWB 4OV6A 4Y65A 4NLWA 3KUEA 2QV6A 4MAKA 1BWEA 2VD3A 3K7RA 3KLFA 1MU2A 4KJIA 1NZ8A 4LBHA 5CH7B 3R1HA 5CD4A 2CPDA 1NDCA 2RQKA 2HVZA 3P96A 1N6QA 1KP6A 3AXKA 2VFVA 3UDLA 2VJUA 4PG7A 4JI1F 2HHSA 2ATCB 3VZHA 4HKQA 2GVZB 3CCZA 1NNDA 1R0CB 3LWLA 3NWGA 4OIXA 4MJKA 4NMLA 5E33A 1T7PA 4OX8A 1QUVA 3OVSA 4OX9F 4ED4A 3RBXA 3PFEA 1TK8A 4LF1A 1VISA 1KHVA 2VG5B 4ENOA 1LWEA 2MQ8A 1BQNB 4ILLA 2QSWA 4H4KA 2MKIA 2GJIA 2V2ZA 2GVDA 3R5JB 4KYZA 4KGZB 1XR5A 2RILA 4IH6A 1P1LA 4LR8A 3OL6A 4CH1A 2UU9F 1I1GA 4DL0C 1TKTB 2AJQA 1YBUA 1BHNA 3D0IE 5KFKA 2OD6A 3QIDA 5KFIA 1S7HA 4X84A 5CYMA 4F26A 5HP1B 2DR9A 1N32F 2B51A 1WEXA 2UP1A 4N76A 3U7JA 3VGVA 3MPVA 4B08A 4U8YA 4F4XA 3DDNA 1U09A 2XZDB 2A3JA 4JI2F 1BC6A 2KO1A 2X7IA 2J8AA 3POTB 5HMWA 3G6ES 2M5YA 5A8KA 1IBMF 1VHIA 1GMWD 1S4FA 2EEYA 2OPRB 3KLIA 1CJKA 4NYZA 4USMA 3GILA 2W9BA 4F7VA 2UUBJ 3LF0A 5FJ4A 1PIEA 1Y00A 3SV4A 3TP2A 3RB6A 2L9DA 3P5TL 3W5YA 3GMGA 1S7IA 4KRWA 4HHUA 3TUIC 3W2VB 1A6LA 5LMUJ 1O51A 4CO2A 1BQMB 1WDTA 3CNQP 9ATCB 5IT4A 2KVIA 1C0UA 4USWA 4DL2A 2IHR1 4R0JA 4Y2AA 5EGYA 3R1LA 5EWGA 2CQ2A 1AA1B 1W26A 4OHYA 5FDLA 3J7A1 4C4WA 5DLFA 3HFVA 3L7OA 1ZM4A 1KEKA 3E51A 2V67A 1YI2S 4EBEA 4M95A 1GMVA 2W2NP 1JX4A 3FBCA 2HLUA 4RBUA 2O67A 4WK1A 1CC7A 2XC9A 1UWBA 2CPFA 2H65B 1CULB 4W92B 1VK3A 1X4GA 1TVRA 2NSCA 2C2EA 2DO0A 5EUHA 3D54A 4QYZJ 4X4UA 3OFGA 3FRZA 5ETKA 1CS4A 1FRMA 4O3QA 1K73T 3V4MA 4C7QA 2VFSA 2E9TA 2XYGB 1R7IA 4KE5A 3DMJA 3BO2A 4DQSA 3PRVA 4DF8A 3M8QB 4LF6F 1TKDA 4CDIA 5B0CA 3MM5B 2C3OA 3D1OA 3RYLA 2VFUA 4IRCA 4OHXA 4U95A 3FZ2A 4LFBF 2CJBA 4CT8A 4WKRA 2W4DA 2C2DA 3BZQA 3OTOJ 1KN6A 4K4SA 3W9JA 1DQ9A 3UVJA 1OSDA 3OPKA 3QT5A 2LCWA 1HWKA 4KFBB 1VLYA 3HHKA 4CZCA 1SKWA 1D8ZA 1WI8A 2BYCA 4LF4F 3M2RA 1UVNA 3O44A 2YNHB 1JLAB 4OL8A 1RJJA 1T05A 4V1Ak 2OH2A 5F8GA 4IG0A 1OJ4A 4ELVA 4OI4A 3CO0P 3QWUA 3PKYA 3GIJA 4ED5A 4LF7F 2BXJA 1IR0A 2CZ4A 1W25A 4C6AA 2FHMA 1BMQB 1Y4ZB 2BX6A 4ZCIA 3M1VB 4YFUA 2HNYA 3WC0A 2AHOB 4JB8B 4KV8A 1U8WA 3DRPB 1JMTA 3PRDA 4CLZA 2Q43A 2BJ1A 2EBEA 1GX5A 1SJ1A 2Z2YB 3M8YA 5DDOC 2HWIA 4DV7F 1VHFA 2FY8A 4NYOA 4OYMA 4OI6A 5E3RA 1WEYA 1T03B 3MTKA 3VGTA 2RS2A 2I8EA 4RLEA 1RTHB 2ZE2B 4ZHRB 3G71S 4JI5J 3TUZC 1V3ZA 2E66A 2KT2A 3HM9A 4B9SA 3AJDA 3IGNA 4DR2J 2J6UA 4CNYA 2CJXB 3ENVA 3NOGA 3NNCA 4HYKA 1KRPA 2PT0A 4YB6A 2EKNA 1JQGA 3AJ1A 4MMOA 4DR3F 4NZ0A 5CZXA 4CI0B 4NCGA 4S0MA 5HQLA 3UNGC 4ZKAA 3UD4P 2VONA 2B3TB 3UR3C 2DEIA 1Q7YT 4P10A 3W61A 1KLMB 2HQDA 4Y0FA 4WIIA 4QCLA 4A8FA 2JEIA 2KJVA 1JJ4A 4IFVB 3MMCA 2IM1A 2ZD1B 3H0PA 2RQMA 4ZCMA 5I42A 2PSZA 4N5SA 2RF2A 3AT1B 4WTYA 3UDCA 3GPAA 4CM2A 2BJ7A 4AL6A 1I94F 5D3GA 2AMCB 3M2UB 2E5IA 4LREA 1V5VA 2W9BB 3IWNC 3G4SS 5HLFB 1N5TA 2VG6B 4TU7A 2DPJA 3FVYA 1S9GA 3W60A 4LR7A 4B17A 2XCPA 2LQ8A 3QAUA 5KG4A 9RUBA 1HNZF 1FJCA 3GFZA 5IM0A 5F8IA 5LM7E 4HHHA 3BSOA 4QIWD 3DGVA 1WOOA 1U25A 4B9MA 3I87A 3HT3A 1N32J 3MHYA 3V81B 2QN6B 4OHZA 2BRKA 3CCWA 4ZK7M 2DBBA 2Z4PA 2HW3A 3PFOA 4Y2KA 1JK9B 3GIRA 1YJUA 2ZH4A 4F3OA 2DRAA 3KHHA 1XNRF 3N01A 4I2PA 2CFXA 2HFUA 1C4AA 1VRTA 1SJRA 3NBPB 1M5OC 4H4OB 4CCHA 2DRBA 4O3OA 1T9WA 3HCXA 1FT8A 3CJ2A 4GMKA 1DQ8A 5H9EK 3E01A 3MPWA 4LRFA 1RISA 1RT6B 1S9EB 3DHXA 2HVHA 2J7KA 2P2CB 3F44A 1H2UX 2NSBA 3V5RA 5KFYA 1FD8A 3QPIA 3AY0A 2QG9B 3DLGA 2L9NA 3DFEA 4MIWA 4HACB 2CQCA 1RWMB 4KKOA 4TQSA 1ZYQA 4JI6J 3FFIB 4OI2A 2BBEA 3TA1A 1KFSA 5AT1B 4PUOA 1WJ9A 3T5KA 3MR6A 4DSLA 2MHNA 1KVKA 1P8GA 2P9EA 3RBDA 2GJ2A 2P5VA 2LFVA 2Y1LB 2JLFA 2IPOB 2N82B 5B09A 1KSPA 2GV1A 3D3CJ 5H9FK 3HSGA 4DFKA 4DCOB 5HQMA 2D3O1 2FZKB 1WF1A 1RAHB 2LECA 5HVFA 1RWNB 1KQGB 1HBUB 3QFHA 2B9YA 2FHKA 4LBIA 1SQGA 5H1SV 1M5KC 3A13A 4I67A 2MKCA 2E29A 5H9FJ 3FQKA 3ZZ0A 1N5VA 2QT7A 3VAFA 4AQYF 2FVSA 2RRBA 3ONQA 4IO9Q 2QA1A 4O3SA 1Q8LA 5GAHU 4QU7A 2H5IB 3S6EA 2XMAA 3M8RA 4JV1A 2XS2A 4PQUA 4I2QB 3FBFA 1Q53A 5B08A 4MKYA 2V6AA 4LMZA 4DS5A 3I9V9 1JXVA 2MZQA 4CLTA 3GE9A 3K5LA 5J2MA 4ZVEA 4BWJA 2J7UA 3DOLA 1JLFA 4XK8C 1IKWB 2IRUA 1WOSA 4DOZA 5GVQA 3ZZZA 1RTJB 3PNIA 3N5FA 3WQPA 5BYSA 3PV8A 2PA8D 2BQRA 1HD0A 1VQSA 2AV5A 3BM7A 3KNAA 2WK4A 3OUYB 1MMLA 2VPZB 4ECYA 2HMIB 3O5TB 2XNRA 1F6TA 2P8IA 4NXMF 1X4CA 1VS3A 2V69A 3GG0A 3Q8UA 1BGXT 2BE9B 2GAHC 1NCLA 3LUYA 1HMVB 4HHJA 1SL2A 2YWEA 1IBKF 1H74A 3KK3A 2ZUGA 1GMWA 3IRXB 4KTQA 4R8UB 3RB0A 1SC1B 3ZTOA 5EDWA 3EUNA 2ZBRA 3ILJA 2GIRA 1URRA 5CYJA 1SQEA 1Y0HA 2OI2A 1CJUB 1W7WA 3PDNA 1I94J 2IBOA 4P2MA 1Q0NA 6FDRA 2MDAA 3GJTB 3H98A 2M2BA 3OFEA 4O44A 4KH0B 4WCEQ 4ECQA 2HYIB 3X1LB 4ZLPA 3FBBA 4WP9A 1WHXA 3K59A 4KPCA 5HROB 5L1KA 2FLNA 3LP2A 1H7XA 3GB0A 4OZ1A 2HBYB 5E7OB 2AJ1A 4QIEA 2R42A 1UL3A 3WZ0A 1T9UA 3UPFA 4ID8A 1DAXA 3IAS9 1IN0A 1BQMA 3GSIA 5A0YB 4NZ7A 1N33F 1WC5A 5THWA 1VRTB 3DLKA 3DU6A 3M9OB 3CMAS 3SBMA 3X3UA 1LWEB 3MUVP 4F4AA 4X4NA 2BJDA 4KBIA 4N77A 3BPDA 3QJLA 3RAXA 5KFTA 2MXYA 1DTQA 3LO3A 2G9OA 1YJTA 3LGMA 1F2HA 4QYRA 5HMYA 1HBUA 4ILRA 4ED1A 3KMSA 5D8HB 4LIRA 2G2YA 1RT4B 5BR8J 5J1NA 3LGHA 1F0XA 2XO7A 4Q8EA 1LEOA 1EP4B 3MEEB 2AGOA 4C8YA 4F4YA 3M1VA 3QATA 4RW7A 1DY3A 4NOHA 2XSJA 2R8GA 2JWNA 2CNKB 3MF5A 2HWTA 1C1CB 4ZVSB 1DRZA 2WOMB 2L9WA 3R7SB 1RKIA 2JH3A 2W4CA 4EZ9A 1RWKB 1PILA 1J5EJ 2HZVA 3G9CA 2YH0A 1HWLA 2CJYB 2DRDA 5IWAF 1N5SA 3HT0A 3M2VA 3AJ2A 3T41A 1V3SA 3THTA 2LU2A 1Y7PA 4DDFA 3I56S 1Q82T 3KNGA 4M5JA 1YQHA 1FI4A 5K8MA 3M8SA 1QSSA 3KHGA 5BXIA 4PAAA 1VQKS 2KFZA 3M7VA 1NJZA 3MM7A 4H4MB 3DXBA 1AUDA 1HBMB 3PX6A 3RRKA 3KJVB 2OKQA 1LK5A 2F8EX 1E6VA 2B5JB 4IOAQ 2RJZA 2HNZA 1JXEA 1CJVA 2PE8A 1NH7A 4NX9A 4DSJA 3T1HJ 4ZPBA 4F04B 1SPBP 3DOMB 2B9WA 2KTQA 4KHPF 1S0OA 3J81j 2WVFA 5ITHA 1PAUB 2H4YB 5DDQC 1SUQA 3WC2A 3ILOA 4HEA9 4KIAA 4EU0A 1SH3A 4L75A 3JSMB 1YG0A 4NLTA 4DZ6A 5CCMA 2BUNA 4DX7A 4OX6A 1M5PC 5E3CA 4DX8H 2CQDA 4LF8J 2DCUB 4LSNB 1TUWA 4KY3A 4TY8A 2DR8A 1K0TA 1X5PA 3T6BA 4Q44A 4DL4A 2ZUAA 1WKKA 2NYHA 3HVWA 4CO1A 2NXJA 3C16B 3JTNA 4WTOB 2MGZA 1QLNA 2ZHBA 2KI2A 3PVXA 3FMBA 3TNVA 2YH1A 1SJ3P 2PFDA 4LSLB 2CXEA 3EZUA 4EYIB 3RAQA 1LXJA 1JXLA 3DLHA 2F8HA 4DPUA 3AAWB 2LKZA 4K4VA 1NJWA 3TAMA 3DDIA 4A8SA 2F4VF 1FDBA 1LXNA 3QIPA 2WCXA 2HFVA 3GZ7A 4YMEA 5HO4A 1OYDA 1NU4A 2O3DA 1HHTP 3KTQA 4MIAA 3SV3A 1U47A 4DS4A 2F4FA 3R97A 2ALZA 1VQ9S 3RJMB 2V63A 4UOFA 1YZ7A 3AOCA 4ZPVR 3WX4A 4PEOA 1PYOB 4OZLA 2PC6A 3NS5A 2W9CB 3PM9A 1T3NA 2JDJA 1Q95G 1N5YA 3TEGA 1FKPA 2UUBF 1V5IB 3I31A 5KT4A 4MH8A 3W7BA 1GXTA 4U96A 4PKDB 4U6PA 2XGPA 5DM7Q 3BBFA 4MIBA 4ZVHA 2OLWA 3MMBB 1EB0A 1XQIA 3K58A 2E9RX 4NA2A 1KOOA 3C16A 2GHWA 3EVWA 4M5HA 4GKKF 2R7XA 2V8GA 3NKYA 2HFZA 5K20B 3RB3A 4PWUA 1SH0A 3UCGA 2AD9A 1SJQA 3ULHA 2HG4A 3DRXA 3GFHA 2KDOA 1RQ0A 2HK2A 1B0VA 1NPRA 5IT9Y 3M6WA 1L3KA 4FPRA 3PW4A 2WONA 1U48A 1MROA 3IG1A 2RKIA 1U2CA 2AJ2A 1FNOA 1ZTWA 1R3NA 3J81Y 1N56A 3MCNA 1N54B 4C98A 4NRTA 1KTVA 2HZCA 1NRKA 1CPZA 1TQLA 5FLXU 1N33J 2QEXS 5AXNA 3VV2B 3A4TA 2WBRA 3NGUA 3M8WA 5F8LA 2XO6A 5J2QB 1PKUA 2QMXA 2Z56B 4LJMA 1H7WA 3VGSA 5A8KB 1ZA2B 1YIJS 3I32A 2KN4A 2AKWB 3R5AA 3BN4A 3KLGA 5L1LA 2VB6A 1B64A 1RWXB 1NK8A 1KWMA 3BKUA 2RD5C 3HHNB 4X66J 4AQYJ 3MR2A 3RR8A 3BS9A 3F56A 4ZPWR 2YNIA 2JSXA 4AL7A 3ZTSA 3MOZA 3QSYB 2FLLA 1NBEB 1IUJA 4TY8B 2ZWPA 3M6XA 3L7UA 5DQIA 4QQBA 2W8LA 1F5AA 1K44A 4NLUA 3SMZA 3I0RA 1UZDA 3SZ2A 3MEDA 4LVOP 4P75A 4ANEA 1XMQF 5KFDA 1H72C 4LT6A 1NXIA 2ILZA 5KOWA 3EMTA 2BA9A 2FJDB 3KHLA 1SJ4P 4ZP6A 2K3KA 4M5GA 1BD6A 2MPUA 1LWFA 3A3OB 2PD1A 3QGHA 3DU5A 2E1AA 5HANA 5F3ZA 1NB7A 1UA1A 1RBLA 1QSYA 2HHTA 1WC4A 4J9LA 4IQXA 4JI4F 4AL5A 1UETA 1BLUA 1XWLA 2H3EB 3NCQA 3HXMA 4EEYA 2BQUA 3PW2A 2D69A 3FFIA 4X66F 4F8RA 1GH8A 1FTRA 3D2WA 3J7YU 2XHWA 5D78A 4CTAB 2K06A 1N0VC 3MM5A 3R3TA 4NXNF 3HVTA 1WD6A 5J1EB 2KXNB 1G7CB 3CC4S 4OZ0A 3EZ5A 4NLQA 2D9PA 4QIGA 2Z0GA 3MAAB 2DNKA 1XIQA 5C24A 5KFXA 4K4XA 3MZIA 3W8GA 1RWUA 2WVBA 2AYBA 3A8JA 4RNOA 4DV1J 2W01A 4WP8A 4PABA 2DVIA 3ENWA 4P52A 4H4KC 1G4CA 3D6MB 5DG9A 8ATCB 2NPIA 3DLEB 2V2QA 4FXWA 4YDDB 3UCZP 3HSJA 3W9HA 1L3TA 5LMUF 4OFZA 4DCJB 3OTBA 3SSSA 1X4HA 4IDKA 4CLUA 4Y3CA 2OJ3A 2A0FB 1MMDA 2R7VA 3BQ0A 2J6SA 1YWXA 2R8HA 1M90T 4LFAF 3G8QA 2ZOFA 4QWAA 4NCBA 2OPPB 4KV8B 3JYTB 3UD3P 4LRAA 4UOCA 3RRGA 2D74B 5HL7Q 4PG8A 3GIMA 2YQ0A 1EKRA 2GIQA 5HLFA 5HMZA 1B70B 2G0JA 2HQFA 1KLNA 3FBEA 1HL6A 2G2OA 1UCNA 1UVKA 4YY3J 3BQ2A 1B3TA 3I96A 1OQ6A 3CT9A 3KXDA 4RW6B 5D15A 2B8PA 5M2PA 2W8KA 5HJYA 4IUFA 3PW7A 5DLGA 4WXOA 2J7WA 2OSQA 4QIVA 5D4NA 3G96A 5F8NA 2X51A 4URQU 1QE1B 1FX2A 5L8RC 2A2CA 3PJWA 1Z2ZA 4DHVA 3OTOF 2Y1IA 1TKTA 2XLKA 2V8PA 4DL3A 1UPPA 2HK3A 1TKZB 4RW8B 3RZAA 2E1CA 1YJVA 1E6YB 1VRQC 4M5MA 3W66A 2W7OA 2Q6CA 3N6NA 2ZH2A 2V5HG 3M6UA 5E3PA 1JLQB 2X3DA 4DLEA 4UT4A 3ITHB 4Q0BB 3TA2A 3MCMA 5GAHI 3TZZA 4LF2A 3CCLS 1XMQJ 4R0EA 2N3OA 1IWGA 4O23A 1X4AA 3BKTA 3M05A 3NCPA 3VQSA 1BQNA 2HZAA 2GVZA 5EHHA 2J9CA 4ZVRB 4EI2A 1N4LA 1OWXA 3PYDA 3QGGA 2KG1A 2IMWP 2FPHX 3CD7A 3R6GB 4KAIA 1REGX 2FC8A 4OYOA 2XMWA 4O0IA 4DX5A 3PIPQ 4DLGA 3AA9A 1C1BA 3CVKA 2F4VJ 3TJ8A 5CAAA 2HVIA 4IKAA 3BDPA 4CLKA 1NZAA 3GV5B 1H73A 2KVQE 3RRHA 4LF8F 3P8BB 5D3GB 1LWXA 2P6SA 2AZ1A 2WRMA 1TL3B 3FEXB 1JLEA 1ZZFA 3UNYA 1HYSA 2KZZA 3R7BB 3K5PA 2FZCB 2ZJRQ 4DUYF 2I5JB 5IZHA 3JB9k 1U1RA 3DLBA 3MMAB 3IWXA 3OTDA 1WTFA 1O6XA 1SH2A 2PMWA 4RW7B 4ZN1A 4B3RF 2HNDA 4JI0J 4JI3F 3CC7S 5F8HA 5F0WA 2YKPA 1YHQS 1DARA 2OPPA 4WK3A 1MW7A 1TL4A 1X4BA 3QO9A 3SFUA 4DR7F 1PSDA 4JV2A 1M1HA 2BZ2A 2N4CA 4O3NA 1SL0A 4LF5F 2HHXA 1LWCB 4M5DB 4J91A 4DF4A 1SB6A 1RU2A 3QZ8A 1JLGB 2W2QP 1QSLA 1UP1A 2CNLB 3DLEA 5DJBA 3GYGA 3Q8QB 4I69A 4JI8J 3OVBA 1TTHB 2DPIA 2H5JB 2HQCA 2BABA 4J9NA 1FA0A 3G8TA 4P7TA 3H20A 3BYRA 2QFJA 4ECZA 3NS6A 2HQIA 3ENQA 3FSIA 4TN2A 4DFJA 3EE3A 2HQ3A 1I5OB 2A6MA 1KBRA 3OL7A 3ZNJ1 2Z58B 1Z4UA 2IM2A 2DNMA 2MKHA 3N6MA 1VQLS 1H2TZ 1RT5B 1JNZB 4K50A 3V4IA 2IYIA 2W2MP 4OZJA 3HD2A 2OFGX 1IWAA 2KXFA 4OJHA 3SDEA 4DR6F 1GFWB 4JI3J 1MSWD 2QYGA 4UQGA 1RCOB 2ZC3A 1OIAA 4RO0A 1FFSB 2VPXB 3QO9B 4C0HA 3M8PA 4ZVTB 2A2DA 2W7AA 1WOPA 3KK1A 1JNRB 3GJRB 3JQJA 3MPUB 1MNEA 2HBRB 1FERA 2R2RA 2HHWA 1RCXB 7FD1A 2RKIB 3KOAA 2XWXA 5E5NA 2R7WA 2PEBA 2K7JA 3FDSA 4OYWA 1EQMA 2HSEB 2R4FA 1RBOB 2EW9A 2WVEA 2YKAA 1VFJA 2CPHA 3AHPA 2QA4G 1T3OA 4DG1B 5I3UB 3DM2B 1OY6A 1RP5A 3W8PA 2XY7A 2OPSB 2CQPA 1RT4A 1HBNB 5KG5A 5DG8A 3DRPA 4Y00A 4F50A 1F9EB 2QL9B 3CDUA 4PCQA 5I42B 4J9OA 3C6TB 5AXLA 4YY3F 1ZM2A 1HQUB 4PYDA 3TW0A 3W2WA 4RWWA 3MXHP 3PCOB 1H0HB 5I3QA 2YKOA 1RLDA 1NPKA 1HI1A 2W9CA 3CE8A 1SV5B 2P6TA 1IBCB 3KG0A 2PMZD 2E5JA 4XIUA 4K0KF 1FEEA 3LPYA 4EBDA 2UVWA 2FVQA 3NRBA 1RLCL 4FXVA 2LXIA 4WYWA 4ANDA 5JUMA 1XK8A 1VQOS 2VPWB 1Q4RA 5DQGA 4KC5A 3JAMY 2MMYA 4K2JA 2EFQA 2WVCA 2QLBB 3LQVA 4A48A 4FF1A 4DFPA 4X64J 4ELUA 2ZVIA 2NCKL 3SCKE 3T3FA 2NREA 2YX4A 2VL1A 4X4PA 1TL1A 2IA0A 2LQ9A 4L3KA 5KFQA 1Y11A 4HLBA 3PIOQ 3D1HA 3BB5A 3ICLA 4IH7A 1Q7LB 3J7ZT 4JYAJ 3DRRB 4LR9A 1YGYA 3P45B 4NZ6A 4ZCLA 5C2GA 1SC4B 1FE0A 3W2WB 5IT0A 3J80U 1WSVA 2RDDA 3D0GE 3MEEA 2MQPA 2LMIA 3ETOA 2B56A 4DUYJ 3EGWB 3HKZD 3SCLE 4BLGA 1JWWA 2YKMB 2EKYA 4DN0A 1H38A 2MTLA 1U1NA 1L5UA 4G1QA 4YR3A 2DNPA 2CWXA 2GMHA 3DOMA 1RHKB 1PYTA 2F9DA 1SJFA 1LV5A 2DK2A 1HQEB 2OUGA 1DTTB 2VG7A 3FKBA 3ISND 4IQMA 5HVGA 1XMBA 3BGLA 4A46A 5AJ3F 1R31A 1ZH5A 3H5XA 5IC4B 3TQEA 2IJFA 3KJNB 4ECTA 3NBPA 6AT1B 2UVUA 3B54A 1FEHA 1TV6A 2D9OA 3ENAA 4I6YA 3T5LA 3MM7B 2X1FA 4F67A 3I82A 2YXLA 2OELA 3RBEA 2IJRA 3A3PB 4BHQA 2OMLA 4C11B 1QVGR 2YTCA 4MT1A 1RHMB 2JJ4D 2FVRA 3GR0A 1FRJA 5B0GA 2QA2A 2AP6A 5U47A 2YQ3A 2OAUA 3WIUA 4M5NA 1MN9A 2O5DA 4EO6A 4TNOA 4NLXA 5CYMB 4ICLA 1R0AB 1R8HA 3JSBA 2FJBB 4K4ZA 3PTWA 2GS8A 2VQEJ 3G82A 3UWTA 5DDPC 4DV6J 5ETMA 3BF4A 3GONA 1NEEA 3KFWX 1B99A 5J2QA 5DGAA 3QWPA 3JSMA 1FRXA 1D9AA 4K2XA 4USHA 1S4EA 2Y1RI 4QPXA 3HI9A 2QMUB 3IP0A 2VIHA 2XSFA 4CTAA 3AOBA 3IGVA 1HIYA 2ZNZA 3G8SA 5F0UA 4DSEA 2BQ3A 2LQBA 4G6VB 1FJEB 2E5LF 1WI6A 1AZSA 3MUTP 4E2FB 3HHEA 2GO8A 2DGXA 5KFBA 4GO7X 2A10A 2CPIA 3DGPB 2B5JA 3Q22A 4UY85 1Y3JA 1PCAA 4CO0A 1CJVB 4C0OC 4LF4J 1WF0A 1AXQA 4RW8A 4R25A 5IWAJ 2UUCJ 3CJKA 1MLAA 3TYTA 3TAPA 2XULA 1RTDB 1Y5LB 4UF4A 1GTEA 1F2GA 1RKJA 2XYPB 4CO4A 3CC2S 1X0FA 1NSPA 4M5KA 2ZH5A 1CULA 1QAYA 4I4BA 3T1YJ 4PQUB 1F3FA 2CYYA 3SXLA 1RAGB 5JMNA 2Y3YA 1TKXA 3SQGB 1LFPA 1VR6A 1U4BA 1HNWF 4DR4J 4X62J 2O1PA 5D0RA 4DEZA 4YOEA 4EUVA 3MWBA 3IRWP 2QGFB 4WP3A 4GVLA 2WSEC 2FC9A 2CVIA 3P3DA 4LRDA 1M0SA 3QZ7A 1HWUA 2VA3A 2CJAA 2IY5B 1U1MA 2M8DB 2VF3A 3NOCA 4DV2J 4EYHB 1P6TA 1NHVA 3KKFA 1K8AT 1QAIA 4RW6A 2CPZA 1SKUB 1WELA 1N34F 3OFFA 4KT0C 3MM8A 2B7CB 2V0NA 2OPQA 3G6XA 1CEZA 2JLEA 2U2FA 2V2KA 2LEBA 1AFIA 4LSZB 3UD5A 2XTJP 3GCWP 2EXUA 1WHYA 4RU2A 2B43A 3M32A 4WPAA 2MSTA 4YS2A 2UVVA 4QYZK 2HURA 2FJAB 1K1SA 2LU1A 2M7SA 4I68A 4C8ZA 1NSAA 4IYQA 1YKWA 2RAQA 3BPSP 3PYFA 1IJFB 4QIFA 1MG7A 4UW2A 3RR7A 3H5UA 4CH0S 4LF9J 1SKSA 4GRSA 4LQ3A 3OD2A 4C9DA 1U49A 1KHWA 4RUBA 2KXHA 1HQ2A 5E0OA 4DXLA 3D28A 4GC6A 1HLWA 3PEHA 3Q8VA 1VQMS 4Q43A 1JIHA 2PA3A 3I5BA 2MQLA 3PEJA 2B0GA 2V2VA 1I6JA 3CJ0A 2ZE2A 1RYRA 2M4MA 4JV5F 1FDAA 3D3BJ 3QLHB 3QSIA 2MQQA 1TL7B 5LMNF 4NCAA 1RK8A 4KHRA 1TK5A 2J76E 3IM8A 4NPOA 1H98A 3KLHB 4KO0A 1YJ9S 3OTEA 3C2PA 4Q5VA 1LKZA 2ROGA 1VDHA 4WF9Q 1CJTA 5KFRA 5J1EA 4F4ZA 2C3UA 3C6UB 4HTIA 4F3QA 3KK3B 1T94A 3OW2R 5HBMA 4DR5J 2DR6A 2GW8A 1P1TA 2EG1A 3W62A 3FQLA 4B3MJ 4DN9A 2ZM6J 4W4MA 3MEKA 1YRTA 4OYXA 3M2UA 2HGMA 3TARA 2I5JA 4ZA1A 1UA0A 1HFEL 4JUZA 2AZ3A 2H1YA 3BGFA 4HACA 2Q6BA 5GAGU 4YR2A 1X0PA 2XWYA 3C14B 1WACA 3R5CA 4P2XA 3CGIA 4O4GB 2J9DE 5LOQA 4WIQA 1SCJB 2VQFJ 3RG6A 3BQ1A 1OQ3A 4FYDA 4TVAB 1S9EA 5EX3A 3Q8SB 1TP7A 2EC0A 2DY1A 1UTAA 3CIMA 3FGVA 5HAOA 4PWWA 2VBZA 2A1BA 3TANA 4U67Q 1A0OB 3IR5B 1ICEB 2VKRA 4Y2MA 2XHCA 4AUKA 1YITS 3E3XA 2R8KA 2UXDJ 4HI1A 3HZEA 3LALA 4OJ3A 5AXKA 4QW8A 5BR8F 4YB1P 3VAMA 1PBAA 2OPSA 2ZBPA 3ZZUA 4USIA 1HW9A 4DL5A 1L3SA 3TVKA 1AROP 3UI3A 1T9XA 3MM8B 4ECSA 5FDLB 3D6HB 2LXFA 2EK6A 4URSA 3VTIA 3BO3A 1IQZA 4JI1J 2F8MA 5KG6A 5SUHA 3EDRB 4ZVGA 1LWFB 5IFMA 2QJ3A 4DV3J 1NDLA 2YWHA 3TR5A 2DH8A 2WVDA 1WG5A 1CG2A 1Y9OA 5JVGQ 1NK4A 2MZRA 3H25A 4BS2A 4J37A 4AE5A 4PWDB 2ZH7A 3D68A 4RNMA 4H54A 3RAMA 4WKYA 3EGZA 5JJBA 4ERDA 1RAIB 3MDFA 3QRPA 1EAYC 3O8WA 1ZTTA 3MPYA 4UOHA 4RW9A 4TYBA 4HL9A 3R8YA 4NEYA 3OLBA 2FY1A 2JEGA 4OHVA 2QLFB 3HVTB 1WWHA 4KKOB 2BE2A 3UCUP 2PO4A 1XMOJ 3QBCA 4A47A 1R43A 3PJ9A 4ETZA 2ZH9A 4FYYB 4D3HA 2YY3A 4C97A 3LWMA 4JYAF 2RHSB 1SVDA 2GGPB 4RL1A 2RH3A 3HJVA 1FK9A 1UEKA 1D09B 1ZM9A 2ZBCA 1TV6B 2CUYA 4IFYB 5DO2A 5K9FA 5K5MA 4ATNA 3VVUA 3D66A 3LA0A 4FZVA 4OLPA 3KJVA 3KDOA 4OX7A 2M88A 1WG4A 1G3OA 4RW4B 2HHVA 5AJ3J 4X4TA 3DN9A 4RX6A 3SEOA 2C22A 2OIHA 4WZMA 4HTJA 4KGXB 3GWCA 2YPYA 5A8RA 5MLCV 2DNOA 5I3PA 4DL7A 2QRRA 4FS1A 4C8OA 2XS7A 1HD1A 1REVB 1ZAVA 2ZKUA 3CDAA 3P4UB 3W5XA 2R7OA 4ZLLA 3HF5A 5DETA 5KG7A 3B78A 4A8XA 1JLQA 1WSRA 5D0HA 3K89A 7FDRA 2XI2A 1N5YB 3QGPA 3BBBA 1EJ7L 2I1RA 2F9JA 4XDCA 2BANB 3ZTQA 3OR1A 4USVA 1S1VA 3Q8YA 4WE1A 3VZIA 2EPIA 4RUCA 2QA4S 3D67A 2EBGA 2IM3A 1ZPWX 2CG4A 3VR1A 5KTQA 3EGNA 3CJQA 1F1BB 1HNIB 3DRSB 3U1LA 4DPWA 4R5PB 3FCWA 4FP9A 1ZS6A 3OUYA 2Y8YA 4JV5J 2IC3A 2GZOA 4ED2A 1U2RA 5KFOA 1D8YA 4XTTA 2R8JA 1HNVA 2ZWOA 4ZPCA 1YRUA 1KS2A 4KFBA 4C11A 4N56A 2GX8A 2ZVSA 3M4XA 2IM0A 5L9XA 2LVWA 1KLMA 2LXUA 3IA0A 1HNXF 1QTNB 2V9WA 4CIOA 2MKJA 3UDVA 5B0AA 4NL5A 1NJYA 3RGIA 4LFBJ 5D0GA 2ZITA 5K8OA 1Q16B 1WF2A 3OVAA 3LANA 2N4DA 4DV4F 1WDDA 2C2OB 3JXOA 3LP0B 4DR6J 2DEJA 2ZEJA 3K8VA 2DNHA 3A8EA 3GFYA 1VBYA 4Q45A 1VRUA 1OY9A 1T03A 3FCHA 2B4PA 4GVBB 2JVOA 2N7CA 1UZHA 3BREA 5B7WA 3LP1B 2ASYA 2PEHA 4K5SA 5M2UA 4OZNA 1TAQA 1ZPVA 5KT5A 2HIYA 1FD2A 2F7VA 3MMBA 4DV0J 3I0RB 5FIIA 2KB2A 4LBPA 3NG8A 3SIPB 4HDGA 3HVRA 1F9FA 1GT8A 1SIZA 3AODA 4PXDA 3W3SA 4H4MA 4A8YA 1PJ6A 5HJXA 2UXDF 5IT9U 4NLDA 1NH8A 1U1KA 4RNFA 2WAQD 3HMJG 2CJ9A 4F2RA 1APSA 1HHSA 2J0QD 2Z57B 3KG1A 2JFKA 2JFDA 1LK7A 2FDNA 2LQJA 3QMQA 5KT7A 2OEKA 1EETB 3DOKA 4UOGA 2I6WA 4ECXA 1FVSA 1U45A 3TWZA 2G1DA 2HS4A 3MMJA 4URGA 4IRKA 1NO8A 1Q8BA 5HVHA 3E01B 3J80Y 1GK8A 4Q2LA 2M0GB 2XY6A 1N36F 3B8HA 2MKYA 3HSDA 1GMUA 4MK8A 3TUJC 4FPIA 1RABB 4RKUC 2ERRA 1JJHA 3QT7A 1U0HA 2AX0A 2KYXA 4Q8FA 4YQWA 2YWKA 2RS8A 4WFNQ 2AU0A 4CQ1A 2XYHB 4ZCKA 2DGQA 2FHJD 1Y10A 4D3GA 1S48A 2DY9A 2FJEB 4B3SJ 1WHVA 2NR0A 5LT5A 4DR3J 4K4TA 2ZH8A 2Q66A 3HKWA 3NGTA 2ZZTA 4O3PA 2R9LA 6FD1A 2EVZA 3AXMA 5E41A 2W9AA 3BGRA 2VG5A 1IM4A 5D6GA 1X9SA 3D9BA 3NAIA 4IR1A 1DJ0A 3AD8C 3OXGA 5L1JA 3DYAB 5CD4H 2YQ1A 2WHOA 4IG3A 2AYEA 1RT6A 1X9WA 5E2QA 1OPZA 4DQRA 1KC8T 2FLOA 4ZVQB 2RU9A 3IBFB 1QAJA 1S1XB 3AB4B 3B4MA 4P9SA 1T0TV 2EFOA 2V8HA 5B0DA 2MZ1A 2HNZB 4XO0A 1RU1A 4RR5A 4MK9A 1DQAA 1TL1B 1U02A 5LSOA 2ASJA 2FLPA 2GA7A 2ZZMA 1IR1A 4MYTA 4DR1J 1RAAB 4KGMA 2YNFB 3R6LB 2XGQA 1KTQA 2PN6A 5A2QU 3SSQA 1PC5A 1X9MA 1NPPA 3KLFB 2GQCA 3I5AA 3O2IA 3KLIB 1QM9A 2VOOA 2XCAA 2GO9A 3R2DJ 1Y3KA 2GMJA 5HMXA 3AFGA 2CWKA 3ISZA 1KQFB 4C8NA 2R7SA 5KFEA 3BSAA 2CA9A 3FEYB 3C66A 2KT5A 4ZLJA 1XNRJ 3D0HE 2COLA 2IDEA 4K4UA 3VF0B 5KFJA 1Y5IB 1DTTA 3M30B 4N47A 1MWZA 5AE3A 2ATLA 1KQSR 3J7AN 1VK8A 4C0BA 4IG3B 1PJ5A 3MAQA 1NK5A 5K8NA 3G87A 2R7RA 2Q3PA 1HPZB 4ZP8A 4X4RA 1TZ0A 4TY9A 3JTPA 2UXBF 2NYIA 4DQPA 1U1OA 2H5EA 3TX8A 5AE2A 4ED6A 2EK1A 1AFJA 1RDRA 2AEJA 2RU3A 3R5GA 1AT1B 2DIUA 3EDQB 1JLBA 3GJQB 1KQKA 1X4EA 4JI6F 1VBZA 3GV8B 1YRXA 4TYAA 4DV7J 3NNAA 4CLYA 1U6BA 1FE4A 1Q1KA 3FCVA 2ADCA 2FD2A 2RRAA 1ELOA 4KB7A 4M94A 3CTRA 3EVMA 5KFHA 3BV8A 4DV3F 4DX6A 2A6OA 5IV4A 4CNZA 3IS9B 2CQHA 1JKHA 3MCSA 5LSLA 2C28A 3C3LA 3R7NB 3DXSX 4HH0A 3V6KA 5ETQA 3H4BA 2DT9A 2BW7A 3CO9A 1SI9A 2VU5A 1WC1A 4LRCA 2KHCA 5GAEI 3BBCA 2CQIA 1LW0B 3T5HA 1HWJA 2J9DA 3CJRA 4EBCA 1WHWA 1O8BA 4O0NA 3MPDA 2QYCA 4PPDA 3CCQS 1RI7A 2VDHA 2L08A 3VAIA 3VALA 1R0AA 2QLJB 4C3LA 4PQAA 3G2XA
chains in the Genus database with same CATH topology
1DLOB 4KR0B 3PKMA 2C3YA 1HQEA 1R8AA 3NMRA 5B0FA 4F3MA 5AE1A 4I64A 5MAOA 3HDSA 2D3OR 3BSCA 4OI3A 1N48A 4PG6A 5L9NA 2UUAF 2ACYA 4IFYA 5CYQB 3GIKA 2ASDA 2ILYA 1XC9A 3CCMS 1PO6A 2GGPA 1FK9B 4QR1A 3NL0A 1N0UA 1U1PA 5L38A 2OPQB 2ZC4A 3GFXA 2GFFA 3H59A 1HNVB 3GG1A 3TVZA 2VBYA 2CQ4A 4B9UA 2EFGA 2ZH3A 2SXLA 3U02A 4IFVA 2V8VA 1HBNA 1BY9A 1FRLA 2HAIA 1RT5A 3HHLC 3FNNA 1X4DA 5G0RA 1UFWA 1OSCA 2DNLA 4WZQA 1YSJA 2DO4A 3POTA 4DR1F 3OL8A 1SXLA 1S1VB 4WE1B 1TKXB 4JBCA 3SQGA 1FNMA 2MJUA 2WTFA 1FXRA 4DV0F 2Y1JA 4JI5F 4QPTA 3KK1B 2R2UA 3PR4A 4FBUA 2RVJA 1U6ZA 2BRLA 3KG4A 4OI0A 1X5SA 4PUOB 1FCAA 3WDOA 1CSJA 2KU7A 3MM9A 5LJ3Y 3M9MB 2ROPA 3CJKB 1FKOB 1UKUA 2JX2A 4MKAA 3L09A 3MTJA 3AB2B 4QZVB 3UR0A 1VQ6S 3TQ1A 4WFYA 3CJ5A 2BM1A 1K0VA 3O1LA 4IO1A 2MY8A 4Q2MA 2HS0A 2XZWA 2CKWA 4RBTA 2O66A 4C8KA 3CCVS 3ZZOA 3C6TA 1DLOA 2VQFF 5C42B 2IYGA 3KYLA 2DH9A 2LYVA 4IR9A 2ZZNA 1FXLA 1NKBA 3N6LA 3EPIA 5A8WB 3C8YA 2EFNA 2I38A 2J0WA 4EO8A 2W24A 2V4JA 1KR4A 2GQ2A 2VBWA 1RT2B 4KO0B 3CMES 3GYXB 3LW5C 2E44A 5KT2A 5FD1A 2ZHAA 5CA5A 3FJ2A 2NPFA 3OXLA 4RU9A 1N8RT 3SCJE 2XLIA 4ES1A 3OR2A 4NLOA 3NP5A 5BJRA 2RE1A 2APOA 4AXIA 4B3SF 3M8QA 5LXRA 2XLJA 3CUNA 1TKZA 1VQYA 3PX4A 4B9VA 2VG7B 4J9QA 3CSKA 2LQ5A 4ALZA 4U9RA 2V4RA 4OLOA 2E7WA 2EG2A 2K7KA 2NUUG 5KFPA 4O44B 1NKEA 2YWGA 1QVFR 2GHPA 2EFPA 1TR0A 2YNGA 4UUXA 3PW0A 3TRGA 4RW9B 3I0SB 5F9NA 4ID5B 1RT7B 3NAHA 1RT2A 2JZ5A 3AH6A 3LH2S 3H2UB 3QGIA 3ZZPA 2AJFE 1J2VA 5GADI 3V2UC 4DUZF 1ZZNA 3V6JA 2YKNA 5C25A 3SFGA 5DM6Q 2LDYA 1S10A 2UVRA 2NQPA 2WONB 3U1MA 1S1XA 2HHUA 2YWFA 1FDNA 4DR2F 2VC1A 2ADBA 2POKA 3CXCR 1DTQB 4ICLB 4GC7A 3MECB 3OSNA 1S77D 3MM6A 5H9EJ 3FMWA 2NZ4A 4WXWA 4OQJA 1U26A 4RW4A 4AFFA 4TU9A 3O3LA 3VWSA 3BN7A 3FSYA 3GV7B 2OD4A 4YB7A 4B3MF 3MR5A 2DH7A 3OFHA 2MZJA 2QSFA 2FGCA 1FRHA 4NWBA 3IAM9 1JLCB 5BYRA 1NAQA 4Z37A 5KFDA 4QWDA 4QWEA 2C42A 3IFEA 4QR0A 4RUAA 2KJWA 1LFWA 2XMJA 3E2EA 4A8KA 1WNEA 2CRLA 2KH9A 1XERA 3UE2A 2CPEA 4OV1A 4RZRA 1R8PA 2Y0SD 2ROEA 4ECUA 5K14B 1C0TB 4C2MA 2DITA 4DPOA 4ZPTR 1S72S 3MD3A 2CQBA 3HFKA 4PWDA 1L3VA 2CPXA 3EPGA 4OI1A 3DM2A 2VG6A 3AA8A 2Q79A 3H8YA 2DGVA 3IR6B 1S6QB 1UJ6A 3PRBA 4DL6A 3OSPA 4LSNA 3D1QA 3OXFA 1ZM3A 2XMKA 4TLQA 4KPYA 4WU3A 1NJXA 1R8CA 2PIIA 2ZDOA 2PFFB 4ED8A 4LQ9A 2OFHX 1S0MA 4TQRA 4FF2A 3BR9A 5EN1A 3I0SA 4YEAA 3RB4A 3B4DA 1FF2A 4OJ1A 3CCES 2W7PA 2P9CA 3U1NA 1NJIT 3EYZA 2WW8A 2IRXA 1FKAF 5F8MA 3T9ZA 4OHWA 1E6VB 1K8AT 3V6HA 4DV2F 2UUWA 3SI8A 1HBMA 3Q2TC 1XMOF 3CCUS 3KLVA 1YVFA 5HP1A 3HP6A 4I2PB 1VBXA 4GKJF 5KG2A 1UMJA 5C24B 4X2BA 4TKTA 4ZP7A 3TAMB 4RNNA 3CIZA 3I5CA 2RSQA 3LGNA 5GAEU 4DFMA 3TA0A 2V4QA 4DQQA 2BDPA 2JHEA 4B3TF 1N88A 1KOHA 1NK6A 1HWIA 2FVCA 4NLPA 2D1CA 5SZTA 1FJ7A 4YR0A 1UJ4A 2MHEA 5LJ5Y 1VQ7S 3GSDA 2NXUA 2L3MA 2XNQA 4EWTA 2MKKA 3KWMA 4IRDA 4CO5A 2MQMA 4J9SA 5D4PA 4CT9A 1XN9A 1WEZA 2R7UA 1X4FA 2EWHA 2RNEA 3H4DA 4QWBA 4RNHA 1OO0B 2VPYB 1J5OB 1FJGF 3UQSA 3OJSA 4F02A 4G1IA 5GAGI 2ZFHA 3S8SA 2PI4A 1XBWA 2D41A 1G1XA 1KFDA 4P2SA 1VI7A 4B02A 1FDDA 1RGVA 1SV5A 2WSCC 2DNGA 5K8PA 4USJC 1VMBA 3DOLB 1NK7A 2DGWA 3CCTA 3H40A 2EI5A 1UFLA 2RMLA 4EZ6A 2DGUA 3ITHA 4IOCQ 3T5JA 4Q0BA 1SL1A 5KFCA 3PO4A 4ETXA 1LW2B 2OP5A 3QYYA 2ZM6F 1ULRA 1S6PA 4Q7AA 2IJNA 2N3LA 2AYMA 2HPUA 3IRXA 4IG0B 1X8DA 3T1AA 3KK2A 1JLAA 1HMVA 1MROB 2RUGA 1H2VZ 3IG1B 4M63A 4NRUA 2Q1LA 5LXYA 3PY8A 3VAKA 3V6DB 2GQQA 4F25A 4NYPA 2CPJA 3TAQA 1VC6A 1HBOB 4M1KA 1KNZA 2M3DA 5FLXY 3VAGA 3V4IB 5KFSA 3SDEB 2DHSA 4I6AA 1Z1ZA 1RTJA 4BC9A 1YJRA 5EWEA 4ILMA 1FKPB 2PI5A 3DCAA 2FIUA 4ZHRA 5IS2A 2L48A 4I7FB 3IR7B 2IVMA 3CEDA 5KAKA 2YX1A 1IKXB 3DYAA 4ED0A 4ZVFA 2ASLA 1G6BA 5KFMA 1S49A 4WU2A 1OS5A 1Y5NB 3IBWA 4M5DA 5BYQA 4DG1A 5I3UA 1IQTA 1J5OA 2XSJB 2J0XA 5A8RB 4ECWA 1VQPS 1K9MT 3S7RA 2OO4A 4KQZA 5F41A 3I6PA 2LDIA 2MZTA 2P9GA 4DMZA 1NK9A 3EXYA 1N6QB 1VIOA 5HN0A 1SKRA 1S9GB 3IWLA 1H6KX 4JI0F 4B9TA 1MU2B 1N5QA 1GXLA 2E5GA 1DHMA 4JV0A 5DQHA 2XMUA 4LF9F 4NLGA 3K5OA 2HHQA 1FNXH 2YNGB 2XBPA 3RW6A 2ABYA 2FGOA 3VAJA 4UUWA 1S76D 1QUPA 4HH1A 5KFLA 1DZ5A 2DR7A 4V19X 3BR8A 1UVMA 4JYAF 4X4VA 2VBXA 3THVA 2AW0A 1IKXA 3OHAA 4DWIA 2WOMA 1JLCA 3OHBA 1RT1A 1HNIA 2E5HA 2LA4A 1S1TA 3ZFVA 3DLJA 4CO3A 5IXUA 3CCRS 3OQ2A 1YJWS 1AUDA 2IMOA 3BSNA 1XR6A 2MYFA 1U6FA 2K8GA 3DNCA 2HHPA 2B7BB 1IJEB 1PC4A 2HS3A 1FVQA 1ZETA 2IA6A 4DSIA 4FBTA 1XNQF 1JLBB 1VGYA 2DNYA 4O4RA 1RA6A 3MECA 5K14A 5C5JA 3G6YA 4PG5A 1REVA 2JEJA 1P9QC 5A2QY 4J9PA 1IKYB 5CQGA 3N5BA 5DS7A 2B4OA 4DV5F 4FNIA 1RTIB 3LP0A 3IN5A 1E6YA 1J5EF 3CDEA 5J2PA 4ECVA 1SC6A 5LSRA 3Q8RB 3NNHA 1A7GE 1Q8IA 1S1UA 3F73A 1KD1T 2BACA 2LLZA 1S6PB 1JJ2R 2AGPA 2DJWA 3HHLA 4A8QA 1H3DA 3QLHA 1P27B 1T02A 3DDKA 3ZC4A 3HLUA 3H2VE 5F3TA 4TU8A 2IBKA 2WBMA 2XMTA 1C0TA 3CULA 1AW0A 4ITSA 5JVHQ 2CVEA 3BDEA 3Q8PB 1KONA 1UJ5A 1W2BR 2ZKTA 1C1BB 2CDQA 1S6QA 4WFXA 1HQUA 4R8UA 4L6V3 2ZBIA 2DCLA 3SCIE 3F41A 4ES2A 1XEZA 4MKBA 2M52A 1S99A 1RTIA 5GMKa 1UAWA 2ZDPA 5CXTA 3RW7A 2PGCA 3KLEB 1FRIA 2HIQA 2XS5A 2K3IA 2VC0A 1X5OA 2AJ4A 2W25A 3H5SA 3SYZA 1T03A 1QSYA 2F40A 2K1RB 4X65F 2KG0A 4K4YA 1D9FA 2QO3A 1D1UA 4C3KA 4LIWA 2YKMA 4E98A 2E7XA 5B0BA 3K0JA 1R8BA 4BDPA 4P6QA 3PO5A 2G4BA 2HGLA 2HHHF 4OZ5A 2Z2LA 2DHXA 1A9NB 4DQIA 3DHWC 4IOBA 1GXUA 1S1WA 1FHTA 1PGZA 4K59A 3RU0A 4HT7A 1VC5A 1L3UA 1VQNS 2DTJA 1TL3A 1M5VC 1HYSB 5AXMA 4WFBQ 2OMOA 4MFBB 4QJVA 2VA2A 3FRYA 5D3GA 2DNZA 4J9KA 4ZS6A 1FTCA 4WYLA 4C8MA 4KHMA 3OJUA 4ECRA 2DNQA 2IRYA 4HVZA 1TAUA 5KOXA 4WFZA 2B6AA 1EP4A 2DGTA 2HFNA 1DURA 3AQPA 3OBIA 2MJNA 4GO5X 2JC1A 3MOJB 5KG1A 4X4SA 2XI3A 3CD5A 3J7YI 4BBYA 1RTHA 3CJ3A 3MM9B 5ADZA 3MEGB 3L95X 4I6WA 3MFIA 2VFRA 4FVCA 3G6VA 1MWYA 1KVJA 1QAXA 1LW2A 2YVSA 3DC2A 2HMIA 2KKHA 3DLKB 3BGRB 2VUGA 3I4PA 1JLGA 3I4HX 2ZH1A 2V9KA 1HPZA 4J9MA 2VODA 2MZSA 4HI2A 2F1FA 2E1RA 1VJWA 2M9KA 4DV1F 2NS1B 4EFAC 3OV7A 1SIWB 4ELTA 1MMNA 2UXCF 4JI7F 3DI6A 5CHCB 2QLWA 3CB4A 1VOMA 4ZPAA 4BC7A 1RTDA 3MFHA 4FNHA 5HROA 3GIIA 2MQOA 2O01C 4A4JA 2B6AB 3KLGB 4DSFA 2CQ3A 2FTRA 3T19A 1W2IA 2RQ4A 2PMHA 3MMAA 4Y28C 3K5MA 1RT3B 4J5OA 3IS9A 1UVJA 1C1CA 1LWCA 1CQMA 1VQ5S 3M2VB 2XG8A 2OPRA 3TO8A 2WB1D 4PPZA 1ZAWA 3VAHA 1S97A 2KYZA 4DBQA 2V4JB 4ED7A 4LVNP 1D3WA 2UZAA 5IM0B 1FO1A 5L1IA 3N4WA 4G1PA 5LL6d 1T8EA 5CCLA 1YTYA 2DGOA 4WJBA 1RT7A 3MI7X 2BW2A 1YBAA 2GNKA 4PXEA 5B0EA 3CPWR 4DR4F 3JSYA 4FN5A 1SBRA 2RF2B 4X4QA 1U8SA 3C46A 2CQ1A 2AQ4A 5KT3A 5KFAA 3Q23A 2ZNYA 2I2YA 3QJJA 4ZP9A 2ZOGA 2CQ0A 2QIFA 1VRUB 5J2MB 1CC8A 3K5NA 4X62F 4MK7A 1HI8A 1GTHA 3HK2A 4FF4A 2VOPA 2DIVA 2V94A 2F3JA 5KFGA 1M5SA 3MAHA 2MQNA 2JOQA 5E3QA 2MSSA 1QJHA 3QJPA 4M8LA 1VQ8S 1JKHB 2IVFB 4Z2XA 4LSLA 2D7SA 2ZHOA 1S6OA 2IVYA 3PACA 3J7Z5 4JOUA 2VKZG 1TFWA 5D4OA 1R27B 4HT5A 2M70A 3PX0A 1ZAXA 3CCSS 3KK2B 2GHVC 1XR7A 5KT6A 4B9LA 2UUTA 2IAJA 2XMMA 2GMLA 4IDKB 5IQ6A 4I2QA 2GCFA 3PZPA 1BQXA 3DLGB 4ZDNA 4E8UA 3LP1A 4N41A 4I1TA 2VQEF 3K57A 2FJXA 4XPCA 1SUQB 3CWJA 4A8MP 2UV8G 3CDBA 1JLFB 2E9ZA 3MEGA 3Q2SC 2AWZA 4NLRA 1B0PA 4MYUA 1U1QA 1RT1B 4E0DA 2LEPA 1S1UB 3JSRA 3L7PA 4PXBA 3LOUA 4OJGA 5CYQA 3W2VA 1DFDA 1M5HA 3CJ4A 2OSRA 4IH5A 4YDXA 3S1TA 1VC0A 3JTOA 1TVRB 2VZ9A 3FZBA 2HGNA 2ZH6A 1T05B 1JLEB 3N79A 2UUCF 3N28A 2JL9A 4Y6IA 1O0PA 3FEZA 3G86A 3HVAA 1S0NA 3PJXA 1U1LA 2J0SD 1Z2LA 5KG3A 2J9EA 4DJBA 1U2FA 1TUVA 3B82A 3EXCX 1GQEA 2I0XA 2CJKA 1OPIA 2J5AA 2ZJQQ 2BANA 3H5YA 3DMJB 4FXDA 5A6PA 5KG0A 5A8WA 4W90B 3M8PB 2G0CA 4PRFA 2DHAA 1IKVB 2CPYA 1K1QA 2AX1A 2BM0A 4C3MA 3MEDB 5IQQA 5T41A 2JEFA 1HW8A 4F4WA 2E1MC 5DRKA 3U27A 3M9NB 2FJWA 4B3OA 1GX6A 3MD1A 5EX0A 2JVRA 2W4PA 2NLWA 3P49B 3M32B 2QE5A 3N9UC 1QTMA 1FESA 3I9ZA 2YX7A 1D9DA 1IXKA 4ES3A 3CD0A 3THPA 1HBOA 4K4WA 1O5JA 2FHOB 2A18A 3KLEA 4L72B 2EFVA 1KVIA 4QR2A 2AF6A 4DV6F 3VCDA 3US5A 5J2QA 1LOUA 4YUDA 1NHUA 2GC8A 3DRSA 3RTVA 1N52B 2BVZA 3S01A 3T1HF 3DLLQ 4V19J 2X1AA 3ISNC 3M30A 2C2RA 4LUBA 3O6QA 4BWMA 1C2PA 2DNRA 2YKNB 5C25B 2KM8C 4ZMMA 2DR5A 3NMAA 3D5MA 4DSKA 5D4LA 3CF5Q 4X64F 3L3CA 1GAOA 4ID5A 5T7LA 1TL5A 3LAKA 5D77A 5J2NB 4QOTA 5M2RA 3LAMA 1HARA 4P7VA 2D3UA 4A8OA 4MFBA 4XAKA 2RB7A 2VV5A 2ZD1A 2R7TA 1VIXA 2N7YA 5JXSA 4NA3A 2XMVA 4A8WA 3K2YA 1Q78A 1XTZA 2HRYA 3QAEA 3M6VA 4ED3A 4X4OA 4ZPDA 4G1QB 3KMQA 1C4CA 3HO1A 4FVMA 4QU6A 2RQCA 4N8OA 2MB0B 1CLFA 3A1YG 1S9FA 2C3MA 1U7LA 4I56A 2R8IA 1R89A 4R5PA 1V3RA 3FSXA 2CIMA 4YP3A 2KRBA 2VASA 3DRRA 1JB0C 4O3RA 3C6UA 3IO1A 5HI7A 2WB4A 5HBMB 3MR3A 1V9OA 2AJ0A 1CQNA 1ZBTA 4TXSA 1UEVA 4Y34A 3NLCA 5D8HB 2BR0A 1S0VA 2KZMA 3GR1A 4YHHF 2KM8B 2RIJA 3HZGA 2BJEA 5G0RB 3BO4A 2FB0A 5G4DA 5I4MA 3TOQA 1RT3A 3H2LA 4NLSA 4XDDA 5C42A 1Q81T 2DB1A 5DG7A 2QLXA 2RDIA 4UQTA 1IKWA 2XEXA 4I7FA 4RBVA 2XB2D 3HHLB 4L3NA 2JLGA 4CH7A 2QZ8A 4ZOSA 2XY5A 2B4UA 4Y2IA