2OMOA

Putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
b'NLYFQGHMYVTIVYASVKTDKTEAFKEATRMNHEQSIREPGNMRFDILQSADDPTRFVLYEAYKTRKDAAAHKETAHYLTWRDTVADWMAEPRKGVIYGGLYPTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DUF176
molecule tags Oxidoreductase
source organism Nitrosomonas europaea
publication title X-ray structure of putative antibiotic biosynthesis monooxygenase from Nitrosomonas europaea.
rcsb
total genus 22
structure length 105
sequence length 105
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2omoA01
3QMQA 2ACYA 1Q8BA 2L3MA 2K1RB 4OJ1A 3DCAA 1S6UA 3FGVA 3HX9A 2G9OA 5B0AA 1FEEA 1APSA 2KYZA 2OFGX 4Q2MA 1X0PA 1KVIA 2LQ9A 3QGPA 4OIXA 2CRLA 1TL5A 1AW0A 1VQSA 2GGPA 2PD1A 1OSDA 2GO8A 3WDOA 1N5QA 2BJDA 2OMOA 3KKFA 2K7JA 2Q3PA 2AW0A 1FVSA 1TUVA 3BF4A 3HF5A 5B0CA 1N5TA 3DXSX 1P8GA 3LO3A 2N4DA 2OFHX 1N5VA 3K7RA 2ROEA 1LQ9A 2XMWA 3E8OA 3IWXA 4Q2LA 1WD6A 2XMUA 2W4PA 1CC7A 2EW9A 3KG1A 4QOTA 2QLWA 2QIFA 5K9FA 1W2IA 2XMTA 4FNHA 5KAKA 2GGPB 5B08A 2GCFA 2W4CA 3TRGA 1K0VA 3FRYA 4NL5A 1FESA 5B0EA 3CJKA 1TR0A 2HFNA 2ZDPA 3UDCA 1SI9A 4YDXA 1AFJA 1CPZA 1R6YA 2HQIA 1ULRA 1GXTA 1Y3JA 2KKHA 1FD8A 1TL4A 2BBEA 3HFKA 4A4JA 2BUNA 2N4CA 2AJ0A 4HL9A 5F0UA 1OQ6A 4A47A 5B0BA 1AFIA 2BYCA 5B0FA 1YJTA 4HI1A 1Q8LA 4Y2IA 1SB6A 3F44A 4ZA1A 2GV1A 2QLXA 1P6TA 4YEAA 2RILA 3IWLA 4A46A 1URRA 1RJJA 2IYIA 5B0GA 1FE0A 4U9RA 2KT3A 1X8DA 4A48A 1JWWA 4DN9A 4DPOA 1U7LA 3HHLA 4Y2KA 3VTIA 2FHMA 2ROPA 2XMJA 2HIQA 2OP5A 5T7LB 1QUPA 2FTRA 1OPZA 2W4DA 5T7LA 2RMLA 4HH1A 2JDJA 2IYGA 2HLTA 3BGUA 2AP6A 1CC8A 3KG0A 3GZ7A 3HHLB 3BR8A 3BM7A 4Y2MA 5B09A 1FE4A 1S6OA 2K1RA 1IUJA 1Q53A 3BN7A 4OJGA 5F0WA 3T9NA 2VH7A 2RU9A 1FVQA 2XMVA 1Y0HA 3HDSA 1KQKA 2PGCA 3HHLC 4EFAC 2LXFA 4FNIA 4DL0C 5A6WA 5B0DA 1OQ3A 1Y9OA 4OJ3A 3MZIA 5IXUA 2K7KA 1YJRA 2FIUA 2GA7A 3BB5A 4NPOA 2HFOA 4OJHA 2AJ1A 4HH0A 2VV5A 3CJKB 2OKQA 1YG0A 1YRXA 3TNVA 2QYCA 4F67A 5A6PA 1VQYA 1SQEA 1MWYA 3HHLD 3LGMA 2XMMA 1Q4RA 2LQBA 3FMBA 1GXUA 1N5SA 3BDEA 1JK9B 2LDIA 1TZ0A 2N7YA 2ROGA 1MWZA 1KVJA 2FB0A 2RSQA 1YJVA 3I9ZA 2XMKA 2KT2A 1YJUA 1Y3KA 2OD4A 2BJEA 2OD6A 2GFFA 1XBWA 2ZDOA 3MCSA 3KNGA 3TOQA 2HLUA 2ASYA 2K2PA 2IFXA 4HI2A 3LGNA 1V3ZA 1X7VA 4ZOSA 2OAUA
chains in the Genus database with same CATH superfamily
2XSFA 3LTOA 4M5GA 3W9HA 3KLHA 4PG7A 1ZPWX 2GQQA 4LSNB 3QRPA 2D3ZA 3J7AN 5KFIA 2ZNZA 2I38A 4IH5A 4KT0C 1S6UA 4NLRA 3BPSP 2E44A 3MMCB 3BQ0A 4JI4F 1N5YB 4C0BA 2BOAA 2AKWB 2QL5B 1V6HA 4RPFA 5C25A 1M5OC 1RTJA 2DNNA 2M3DA 3K2YA 2QX0A 4NZ0A 3MM7A 1S99A 3Q8RB 1U1OA 4LR9A 3AJDA 2PI5A 1AFIA 2VIHA 1FTCA 2IAJB 3MGJA 3R7BB 5L46A 1URNA 2CQDA 2XY6A 3LWLA 2FVPA 1WNEA 4ZK7M 4KH0B 1WEZA 4QZVB 2QEXS 1N5TA 2VJVA 2W01A 3HFVA 3T1YF 2C2KB 2B8PA 2G2ZA 3DFEA 3V6DA 1REVB 4DU8A 3KMQA 2ZOMA 2DYAA 4IG3B 5LMNF 4C4WA 2CXEA 2F63A 4PG5A 5DRKA 4XPCA 2QTWA 3F73A 3DLJA 2J6TA 4M95A 3CIZA 1YI2S 5A2QU 2Q1LA 4C8LA 5IFMA 3PRDA 3J80Y 2W2QP 1VRQC 1H2UX 2F8EX 1SBRA 1S6PA 1X31C 2XZDB 3DGPB 5KAKA 3CC2S 2GGPB 1UA1A 1D1UA 1XNRJ 2RRBA 4LFBJ 2MTLA 3UD5A 4WFYA 3RUBL 2FHJA 4L76A 4P2SA 5B0EA 5EWFA 1TR0A 4FYVB 2R7RA 1U1QA 1TAQA 2LDYA 3T5HA 2OH2A 4OZ1A 1ULRA 2DHXA 3PRBA 2JL9A 4ZCMA 4JI3J 2D3OR 1MWQA 1RAGB 4R0EA 5F0UA 4PAAA 2UUBJ 4Y00A 4D3HA 3D7SB 1V3RA 2WVFA 2ABYA 5GAHU 1HQEA 3BQ1A 3IS9A 1C4AA 3BYPA 3ITHA 5U47A 4DX7A 4CLUA 2YVSA 2FJDB 2XZTB 2MKYA 3BBFA 4DBQA 1S7IA 3VF0B 2R2SA 2RRAA 1JWWA 2D69A 3IN5A 3N0VA 3Q8PB 3DDNA 3POTA 1FK9A 2WOMB 1U7LA 4I7FA 5HP1B 1QAIA 4WWSA 1PBAA 1N33F 1CQNA 4DL7A 1T05B 1T9XA 2RH3A 2V63A 1LFWA 3B82A 3V5RA 4QQBA 1U26A 5J1NA 2WZ1A 1K73T 2B4UA 2HYIB 1TVRA 1CQMA 3KWMA 3MHYA 5M2RA 5GADU 4O44B 3DRSA 4BC9A 4QR1A 3JTPA 3S1TA 1NM2A 3CCMS 2YNHB 5J2QA 1LFPA 4PXCA 3W65A 4DG1B 3PV8A 2CVIA 2E5HA 2XMVA 3LUYA 4OZ2A 4S0MA 2M2BA 4FF1A 4EFAC 4Q0BA 2FHKA 4DCOB 2V2VA 1AUDA 3UWTA 4U7UD 1CJUB 2RF2A 2DB1A 4A8QA 3EMTA 3NCRA 5LSOA 4LF5F 4C7QA 1HWKA 3IO1A 2FPHX 3KMSA 1SC3B 2Y3YA 3A8KA 3BKUA 3MCOA 4RW6B 1R0BG 3CE8A 3RBZA 4CO3A 1VISA 4OYXA 3UNYA 4C2MA 3NY0A 2CAJA 3MMAA 3BKTA 4QW8A 4KQZA 5KFYA 4F67A 3M2VA 2QMXA 5A6PA 3KLGA 2XO7A 3IRXA 2IRYA 1T0TV 2W9AA 1Z2LA 4NYPA 2KXHA 4NLWA 4RBVA 2B56A 4IDKB 4LF2A 4X4SA 1RT7B 2KT2A 5FD1A 1NDLA 1H2VZ 1X9MA 1Y5NB 2IVYA 5F3ZA 4K4SA 4DFJA 3CO9A 4NOHA 4MKYA 4OX7A 1RAEB 1OY6A 2MDAA 4U7CA 3KLEB 1N32F 1V3ZA 3M2UA 3VAIA 3IMQJ 4ECUA 1TP7A 4KE5A 3V6DB 4LUBA 4ELTA 4UF4A 3OHAA 1JLBB 4F36A 4C11B 3BDPA 3C6UB 3DOLA 2NUHA 3FGVA 4KO0A 1YWXA 4ZP9A 4K4WA 1C1BA 3PO4A 3W9IA 3M4XA 4DV1F 1LWXA 1F9EB 4QIWD 3THPA 2VJUA 3CGIA 2COLA 1S6PB 4AFFA 2R2TA 4J9KA 1FO1A 4KFBB 2RQKA 1W26A 4LRBA 4KRWA 2BJDA 1FDAA 3KKFA 3MAAA 1F3FA 2HHHF 3IR5B 2PIIA 4WFXA 3FDSA 4RUAA 4EUVA 3B4DA 4DCPB 1N5VA 2QLJB 3PY8A 2GHPA 3IWXA 2VD3A 2BZ2A 2OGUA 4J9LA 1BWEA 4PG6A 3O3LA 4RNHA 2EW9A 3TX0A 4A8KA 1JJ4A 4QOTA 3T5LA 1YJ9S 1RAAB 2XMTA 3QGGA 4DR2J 4IOCQ 1XN9A 1RAIB 2W2OP 5E5NA 1J5OA 4IYQA 1MLAA 4ZPAA 2NPFA 3QT6A 4OHWA 2V8HA 2KXNB 4OHXA 3DU6A 3MEDA 3CJKA 3I0SA 3KJNB 1QSSA 3HI9A 3TVZA 3FC9A 4MYUA 2KKHA 4Q43A 3HSZA 1FD8A 3JSRA 4A4JA 1HNXF 2KJVA 4FPIA 3SFGA 2RDDA 2VFSA 3ISZA 3R5AA 4CO5A 4MT1A 1CLFA 1N52B 2CWKA 2W9CA 3IXQA 4M8LA 2GQCA 1X4HA 3PYFA 2FC8A 5HVFA 5L1IA 1FCAA 4OZ0A 4MFBA 5CD4A 1QSYA 2OJ3A 4DSLA 4LBIA 1VK8A 1XR6A 1Q7YT 2VG5A 4DG1A 2XI3A 2HHSA 2IPOB 3O44A 3TARA 3N6LA 5J2MB 2MZRA 1WELA 4M5IA 5CYMA 2DNOA 4OLOA 1DY3A 2NLWA 4MIBA 4ZJLA 4RWWA 2C2EA 1SQFA 2XLKA 5CD4H 3BGLA 8ATCB 4ED5A 3OW2R 1UVKA 4Y34A 3D66A 3SDEB 5DDPC 4QR2A 1S1TA 3NCQA 2J7WA 1Q5YA 1RAHB 2UU9J 1TKZA 5HATA 2KG1A 3KLHB 4Y2MA 3QAUA 4ZN1A 1PYOB 4DR3J 1Q53A 4Y2AA 2EEYA 4NRUA 3KLEA 4NZ6A 3B6BA 5KG4A 1WOOA 3M2UB 5LMUJ 1OYDA 3OV7A 2Z2LA 4JI1F 1JLAA 1KHVA 4MKVA 2QMWA 9RUBA 4IDKA 1N36J 4RUBA 3PX0A 3L4BC 4NE9C 3JXOA 3M30B 2IM1A 2CPIA 3BGRA 1UEKA 4NYZA 3QZ7A 3T5JA 4W90B 2YNGB 3K5NA 3LAKA 2KDOA 1RISA 1KLMA 2KXFA 2GS8A 2IIHA 2R7QA 4XK8C 1KOHA 4X62F 2RD5C 3CJKB 5D3GB 2EFVA 2DH9A 3MECB 2HIYA 3TNVA 2RS2A 3PW2A 4ED4A 1T9UA 4KTQA 3Q89A 3SBMA 2LQBA 4N77A 2BKNA 4DUYJ 3OT9A 5IM0B 1AROP 1BHNA 2WOMA 2Y8YA 1BMQB 4RW6A 2WONB 3ZZZA 3D6MB 3Q23A 4DL5A 2BE7D 3HM9A 1WWHA 4CTAA 3TA2A 3CPWR 4ER8A 3M30A 3MF5A 3PO5A 3LP0B 2J0XA 5E3RA 3BO2A 4C0OC 4I64A 2J76E 2GFFA 3LP2A 3MMBA 5H9EJ 3CMQA 1KVIA 4F4AA 3TOQA 2K2PA 4JB8B 2BKPA 2X3DA 3SQOP 3AB2B 4DPWA 5DDOC 2L3MA 2Y0SD 4QWAA 2XS5A 2AJFE 4CLFA 5BYQA 1R8CA 3FEZA 1JMTA 3OL7A 2ZH8A 1ZM9A 3CWJA 3HX9A 5IM0A 1S5ZA 2LA6A 4I1TA 5D0HA 5DETA 3EDQB 1NH8A 5J2PB 3OTOF 1KFSA 4PKDB 2XNRA 3ZFVA 4K4VA 1APSA 3C2PA 3ZNJ1 2IDEA 3QGPA 4LF6F 4MKAA 4WYLA 1Q79A 1WC6A 1JLBA 2HGNA 2PA8D 2J9CA 3EDRB 3G71S 2RUGA 4O4GA 1RT5A 2AWZA 3US5A 1D8YA 3R97A 4I56A 4ERDA 3TYTA 4X4VA 3CJ8A 3SIPB 2GAHC 8RUCA 4L3NA 3QJJA 1HQ2A 5KT5A 2B8QA 3IS9B 1U49A 1QE1A 2FJEB 3OFEA 5AT1B 4LF6J 1YIJS 1FHTA 5CABA 1PJ5A 5BR8F 3I87A 2VHGA 2C22A 3J7Z5 1UVMA 2JC0A 3DLGB 5EX0A 2OLWA 4X66J 2ASLA 1Q8IA 5C2GA 5KTQA 2HBQB 3BBCA 1NB2A 4KR0B 4XDCA 4WP8A 3KXDA 4PCQA 4QWDA 3M9MB 2R42A 4H4OA 4AE5A 4DUZF 2AJQA 1EETA 1ZAVA 5HLFA 1GMWA 5CHCB 2M8DB 2UXCJ 5HJYA 4ZVRB 2PEBA 1OO0B 4FXVA 1RHMB 4NI2A 4ZDNA 1R8AA 4G1QA 3RJMB 3SCKE 2B6AA 1RHJB 5KT4A 1S1VB 1OIAA 1RWMB 3ITHB 2ZH2A 2XY5A 1S0OA 4GKJJ 2RILA 4AL7A 2A6OA 6FD1A 4B9NA 4BDPA 5I42A 4Z7CA 2WVDA 1TL3A 3OTCA 2HK2A 3LPEA 1Q82T 4F2RA 2XWYA 4DV7J 2JLEA 4DPOA 5KFMA 3DN9A 5J2NA 1BQNA 4L73A 1NDKA 4GVBB 5DDQC 3GILA 5C5JA 3H25A 3QJPA 5KFKA 2OP5A 1X4CA 2AIRB 3TUPA 4PWDA 1O51A 1RAOA 1RAJA 4B08A 3PHTA 2XCAA 1WDTA 2MZSA 1MMNA 5B09A 3CEDA 4IRKA 1AT1B 3TX8A 4RBUA 3ZXWA 2ZUGA 1TL3B 2CPHA 3MAHA 4ELVA 3MUVP 1HBNB 3HDSA 2JEGA 4PUOA 2KRRA 4YB1P 5F8MA 1VFJA 3D67A 4ID8A 2HHQA 4OJ3A 3VHQA 1QD1A 2RQMA 3CCVS 3LALA 3OUYA 4DSKA 2AU0A 2MKCA 3ZC4A 3ADAC 3QO9A 1NBEB 2HNDB 1S0NA 4L74A 3D1QA 5CYQA 2UVRA 1HNIA 2AMCB 1N6QB 1TK0A 2BVZA 3J81Y 3NRBA 4OZLA 2QL9B 3H4BA 2ZHBA 5LMUF 4F50A 2HBZB 2HGLA 3ZTPA 1U24A 1GXUA 1TQLA 4ZPVR 1ZM3A 2ZH6A 5LSLA 3G8QA 1Q16B 3MM8B 2GIRA 5B7WA 5LT5A 2QA4G 1NZAA 2DNGA 1X9WA 3E2EA 4LR8A 4PR6A 2CIMA 3CB4A 3M05A 1Y4ZB 1FRKA 2PMHA 3QLHA 5AE1A 3DLKA 3NBPA 2LLZA 4U8YA 3IRWP 1FWKA 1CEZA 2R7UA 1LWCB 2WSFC 3GR1A 5F41A 5GAGU 4ZHRA 2KM8C 1DQ9A 5CA5A 4YR3A 1KNZA 5E7OB 2HVHA 1Z2ZA 3RRGA 2K1RB 4NLSA 3EJMA 2GW8A 1PJ6A 4NXMF 4NLYA 4UOGA 4A8WA 3RB0A 4WIQA 3HD1A 4LJMA 7FD1A 1DZ5A 2EG1A 4HKQA 5EWGA 4AD6A 2OFGX 1XEZA 1TL7A 3GYNA 2VPZB 4V19X 4N8NA 4RR5A 1WG4A 1WSRA 1ZS6A 4DF4A 4JV0A 1S48A 1S49A 1C1CA 1RKIA 1WTFA 2CQBA 3ISND 4P7VA 5E2QA 3UN5A 4EO8A 4DV4J 4ZVFA 2E7WA 3ETMA 1U0HA 4YB6A 1VS3A 4QPTA 2APOA 4CNZA 4UW2A 1CBKA 3O8WA 2CNNB 5I42B 1ZA2B 2E1MC 2WW8A 4JV5J 2HFSA 2VC1A 2H3EB 4O3OA 1F3VA 2VDHA 1E6YA 1FFGB 2B6AB 1CJVA 5I3UB 1NB7A 3KG1A 3OTDA 4CTAB 4B3SF 1WC3A 4WE1B 3DRSB 4X4NA 5A8KB 1LW0B 1RU1A 3G6ES 1KONA 3BN4A 5L1LA 1D8ZA 2GIFA 2VKRA 2DY9A 2OPQB 2QYGA 3VAGA 2HBYB 1C1BB 3JSMB 2DISA 4EZ6A 4GVBA 1SI9A 2EC0A 4PXBA 3K57A 2HQIA 2FJWA 1S77D 4J37A 1RWXB 3M8PB 4PABA 2YNGA 3D3BJ 2Y1IA 3HZGA 4A8MP 1NCLA 1QDUB 1YJTA 1SL1A 1R43A 3OTEA 3F44A 3PEHA 3VZHA 2V69A 4OX8A 1YK9A 1FXDA 2VPXB 3C14B 2CKWA 3IWLA 1U8WA 4FKYA 5C42B 3W62A 4Q44A 2ZH1A 3HSDA 4IO9Q 1JLGB 2DO0A 2JOQA 2LFVA 4CLZA 2XGQA 3PCOB 2YKAA 5HMYA 3FRZA 3R27A 2BM1A 4EEYA 1EKRA 2J9DE 2X7IA 1S9EA 2MYFA 3AT1B 3CTRA 4FN5A 4WTYA 3CD0A 3R5DA 1NH7A 1RT3B 1SV5B 3AQOA 4GO7X 3AAWB 4HVZA 2KU7A 2MZJA 4NWBA 4CYUA 2MB0B 3P3DA 4F0KA 1TUWA 1RK8A 2O3DA 3TJ8A 4K7QA 4TVAB 2EBEA 2EFOA 4QU6A 4HACA 5HMWA 4ILRA 1HA1A 2HVDA 1VGYA 3KG4A 5HBMA 3KK3A 1FDBA 4DQPA 1YQHA 2A1BA 3I6PA 1XTZA 4M5DA 4DLGA 2HFVA 4CDIA 1D3WA 1OYEA 4UTGA 4CLYA 1Q0NA 2FLPA 3CDBA 4HT5A 2ZE2B 3H2LA 3LP2B 2Q66A 2Y8WA 5LL6d 1SUQB 1T8EA 1PYTA 4K2JA 4LBPA 1FKAF 1JLEA 2F8HA 2O1PA 2ZUAA 3UCZP 1YJRA 1T03A 4JV2A 2DRDA 1FEHA 2OEMA 5AXNA 3QRRA 3AHPA 2FZCB 3NGDA 3ELHA 3CCWA 3RBDA 3UQSA 2RB7A 3VCDA 2YWEA 5CXTA 4E98A 1NK9A 4HDHA 3QT8A 5GMEA 2FVSA 3HHLD 2CZ9A 4X2BA 3NEKA 4FF4A 1LKZA 4F4YA 2OEJA 4LF9F 3BSCA 2RQCA 2WSEC 4LF4J 1SJ4P 1BE4A 1TZ0A 2N7YA 2QSWA 3Q8UA 2KJWA 3TZYA 2ROGA 4CO0A 2C2NA 4PG8A 2B43A 2RSQA 2BQ3A 3QATA 3QGIA 1PAEX 1HBOA 3ZZ0A 2DXFA 3MMBB 2CADA 2IY5B 1DQAA 1FXRA 4WP3A 3FEYB 4Q5VA 1VC0A 3MR3A 4ED6A 1L3VA 2V4RA 4RU2A 1EB0A 3M9NB 2VDIA 2G0JA 5F8NA 3BPDA 2CQ0A 4P6QA 5M2UA 4WJBA 1OPIA 4KFBA 5EGYA 5FLXY 4TNOA 1N33J 3K58A 3MCMA 1VQOS 1R0CB 4KV8B 4LSLB 1QM9A 2FVCA 1M1HA 4ZVHA 4ZVTB 1AW0A 1WEXA 2YKMA 2PD1A 2LU1A 3MPUB 2YQ1A 3OFFA 4RZRA 2JFDA 1M5PC 4NA3A 2V94A 5HANA 4KBIA 2DD8S 5KOXA 2AZ3A 1VLYA 4UQTA 2HBRB 4YB5A 3NL0A 1VOMA 1BC6A 3KUEA 3W64A 4ZVOB 1F6TA 2XLJA 4M5HA 4DU7A 4OX9J 5BXIA 2YNIB 1H74A 4KKOB 1R3NA 1UCNA 3J7A1 3I5BA 3EVOA 1PBUA 3GCWP 4B3OB 4YB7A 2MZTA 1SVDA 1RB0A 2BE2A 1RP5A 2YPZA 4IKAA 4ANDA 2VONA 4LFBF 3SXLA 3C15A 2PN6A 2GCFA 4OYWA 4QPXA 3PHEA 3OJUA 5KG2A 3BYRA 2IA6A 5K5MA 4CH1A 1VYAA 2C2ZB 3IR7B 4NL5A 5D0RA 4K4XA 2WVEA 1KDNA 4FYDA 3K0JA 1J27A 2KI2A 1RT3A 1SV5A 4TQRA 4W92B 4OHZA 1ROFA 2ZBQA 1ACMB 2Z2ZA 1AZSA 1X4FA 2BUNA 2P6SA 1FRIA 1KQGB 3IA0A 3PG9A 4ZJQA 5SZTA 3KHHA 1IBKF 4OLPA 3MTKA 3CJQA 1S1XB 3AOCA 2KH9A 1RTDA 1AUSL 1T03B 4ZLLA 1HYSA 2A2CA 1HBUB 1S12A 2PDAA 3AOBA 3GJQB 1T02A 2FQQB 3N6NA 3UE2A 2BJ9A 2QZ8A 3PW7A 3D54A 4Q0BB 2Z4PA 4PQAA 5IS2A 4MKBA 4DN9A 4OMFG 3HHKA 3C6TA 1WKKA 2DNHA 3R5JB 4F2SA 2D3O1 2V4JA 2UXBJ 5GMDA 4QR0A 5JUMA 4RNNA 2X1FA 3JAMY 2VZ9A 4OZ3A 3FCHA 3EGWB 2IVFB 5FLXU 2RKIA 4ED8A 4KHPF 1UPMB 2DR6A 3DOLB 4KO0B 2VUGA 2IMOA 3MMJA 4DR5F 1JJ2R 4I7FB 1LW0A 3IBCB 5EWEA 2E5JA 3ILIA 2L41A 1C4CA 3BM7A 3GIMA 3SCIE 2M4MA 2VOPA 3ENVA 4HYKA 3ET6A 3ULHA 4C3LA 5HROB 2XQCA 2ZM6F 3OHBA 1VQ7S 1L3SA 1QSLA 3CMES 1VI7A 2E1RA 4TQSA 3FFIA 1X5TA 3M32B 1RT7A 2GHWA 4FKXA 2KTQA 4N56A 3CJ4A 4DR5J 3NS5A 3SZ2A 2PEHA 2FIUA 1HIYA 2HAFA 5J2QB 2DNMA 2MGZA 2FHJD 4AYBD 2L9WA 4LF7J 1R8HA 1QTNB 3LW5C 4O4GB 2WRMA 4KHMA 3CCES 4LFAF 2YWGA 4OJHA 1CVJA 2LYVA 1TMMA 1U0SA 2CNOB 3EGNA 4C97A 2QA1A 4HTJA 3AD7C 2ZH4A 2IRXA 3PACA 4C3MA 1DBDA 5HQMA 1MWYA 1VIOA 3GFXA 2VKZG 4TU8A 2QRRA 3CCJS 3T1AA 3G6VA 3NKYA 2GVDB 2CQCA 1S9EB 3OPKA 1PC5A 3Q2SC 1IJEB 3V4MA 5DLGA 5GAEU 2W7OA 2KFZA 1G2EA 2ZJRQ 3QRQA 2XNQA 2RAQA 1PAUB 1T95A 3I9ZA 4O3RA 2OUGA 5ETLA 3P5TL 1NSAA 3D6FB 4IRDA 2C2MB 4PQUB 2ASYA 3LA0A 2J9DA 4HI2A 3EXCX 5E3CA 4CM2A 4N5SA 2XM3A 1VQ5S 4M5DB 4DPTA 1UW9A 4LRAA 2CUYA 3OXFA 4JI8F 2AGQA 1D0EA 2HZCA 3CC7S 2VODA 2R7SA 2ACMA 2IA0A 3M8PA 4EZ9A 1G7CB 5DLFA 2JEFA 2HVEA 3IRXB 2OPRB 2EFNA 3NS6A 4NASA 1QUVA 2Z30B 3CD6S 3EZOA 4EK2A 1Q5VA 1SXLA 1QTMA 3JSMA 3DOKA 1K1QA 4GO5X 4YOEA 1HNWF 3CULA 5A8WB 4L3KA 3N01A 1LWFB 2ZVIA 3VVUA 1NPRA 1L3UA 2WVBA 5D6GA 3MMCA 4A8FA 1TKXA 1YBTA 3NXZA 1K0TA 2UVWA 2K7JA 4LSZB 4OYPA 4RWXA 1RTZA 3R5BA 3VAJA 3ILJA 3JTOA 2A6MA 3D0GE 4X65J 3UDEA 1TFYA 2VBWA 3GP9A 5AE3A 2VQFJ 7AT1B 3GMGA 1FDDA 1FJGJ 4Y6IA 1C0UA 5KFOA 3R2CJ 3DLKB 3NBPB 3QT7A 1V5VA 4ENOA 1S1XA 5IC4B 3R1LA 2CPDA 3UCGA 4DR2F 2ZFHA 3G4SS 4AQYJ 2CQHA 1B0PA 1MW7A 3IG1B 4NLPA 2IC3B 1KP6A 3RAXA 2DR5A 3HKZD 3MFHA 3MOZA 1FNMA 3FJ2A 1R0AB 2RKIB 3D1HA 3IBWA 1KFDA 2AZ1A 2W4CA 4CLWA 3NNAA 3X3UA 1HMVA 3EGVA 4O4RA 4QW9A 3HCXA 4YDDB 3TAQA 1F5BA 1X0FA 3PRVA 5JVGQ 1IWGA 3G9CA 2ZD1B 2VU5A 4JI2J 1TUGB 4B9VA 1OQ6A 2MXYA 3U02A 2UV8A 2G1DA 4NLXA 2JFKA 2H5IB 3TUJC 3UCUP 2DHAA 5EDWA 4ECWA 1NRKA 1SB6A 4DV5J 3CDUA 2M0GB 5C42A 1YZ7A 2GV1A 4WFAQ 1URRA 2ATCB 1K9MT 2O66A 4I2PB 1IBMF 2ZBCA 3PJ9A 4OYIA 4C0HA 1WKLA 4DR7J 1RUSA 4O3PA 3M8SA 5I4MA 2W2MP 2BX6A 2HWIA 1HW8A 4USUA 4B9LA 2EBGA 2ROPA 4KSEB 2HIQA 3NGRA 1IBKJ 1RA6A 5DQIA 2YXLA 2FZGB 2LU2A 3DRRA 5FDLA 3HKWA 3W61A 2HWHA 1PO6A 2HQFA 3G86A 3POTB 3GV7B 1HI1A 5HP1A 4B3OA 4C8ZA 1S0MA 1H0HB 3LOUA 4R0JA 2EI5A 4P52A 3LWMA 3CJ2A 3SEOA 3PM9A 4B02A 3IP0A 1SH0A 3T9NA 4DUTA 1RHQB 3VVTA 3PIPQ 2CA9A 3H7HB 1FVQA 3MUMP 1BQXA 3R5GA 5D0EA 5JMNA 3GYXB 3HHLC 4Q45A 4DL2A 3OSPA 3VAMA 5D77A 4DL6A 3RAQA 1HR0J 2NXNA 3RW7A 4ELUA 5H9FJ 5K8PA 4USWA 3T1HJ 3EUNA 1TMJA 4YFUA 4DS4A 4DFMA 1RLDA 2CQ4A 1YJ7A 5D15A 4USKA 1L5UA 3MR7A 2W1BA 1VHFA 1S1TB 3Q83A 4HH0A 2Y0BB 3T1YJ 1IQTA 1LWFA 3M8QB 2ATLA 1VQ9S 5BYSA 4TU9A 1HR0F 5ETSA 1JXVA 2W7AA 2DR7A 4EWTA 1KHWA 2AX0A 4IO1A 1X5PA 4J9MA 5ETQA 3SSRA 1VBZA 3R7SB 1UP1A 1PG5B 5AXMA 4DV3F 1X5SA 2OO4A 4USJC 4EYIB 4LFAJ 1NK0A 1FNXH 2HS3A 3M8YA 2MPUA 3TZXA 5AJ3F 2HZVA 3MCSA 3KNGA 4MK7A 4Z37A 3V6HA 1VQNS 4LF1A 1N0UA 4OI1A 1GNKA 8AT1B 1SKWA 2B4PA 2HMIB 2YKOA 3NNCA 4IRCA 4X4UA 3A4TA 3VALA 3DRPA 1F60B 3MUTP 2BQUA 1Q81T 1EAYC 1HMVB 5ETVA 3EM1A 1AA1B 1NPPA 2YX1A 3CT9A 1MMDA 3FQLA 4J9NA 2Z56B 3D28A 3ICLA 4H4MA 5AE2A 4J9QA 5ETOA 1Y7PA 3TUIC 3WX8A 5G0RB 1N54B 2I9SA 1R0AA 5KFWA 2ZBRA 2UP1A 3G87A 4GC7A 1B70B 1GMUA 1N5QA 1TELA 2H9ZA 3PDNA 5HVHA 1ZAWA 2F40A 1FKOA 5KOWA 3HF5A 2UXCF 2I1RA 2K06A 3NLCA 4ZPWR 4ZIWA 3VGUA 3LO3A 2F9DA 2YNIA 1I51B 3OLAA 2XC9A 4RW8B 1H7WA 3OSNA 4HHHA 3C66A 1FTRA 3M1VB 1IN0A 4DL3A 2XMWA 2ZC3A 2C28A 3CJTA 5DM7Q 4LFCF 2R4FA 2HG4A 4DOZA 3KTQA 4AXJA 4KJIA 5BJRA 3A13A 2VFVA 5KFRA 3KK3B 2OPPA 2VOOA 2PFFB 3ZZTA 1W2IA 3MDFA 3PKYA 2BRLA 3FBBA 5A8RB 2XHCA 4LVNP 1NJYA 1K47A 2BABA 4NLQA 3DKDA 4ATNA 4BCAA 2CJBA 3HT0A 1RTJB 1IWAA 1LWEA 2EFGA 4OQJA 2ADCA 1RT6A 1TV6B 4ID5B 1U6ZA 1YVFA 2LXUA 3VAKA 3R2DJ 1JLQB 3M6UA 1WTBA 1FJCA 3HJVA 1YBUA 2DNKA 2IC3A 2BBEA 3HFKA 2N4CA 5B0BA 4TLQA 3IAM9 1B7FA 4Y2IA 3D0IE 3TANA 2R2RA 1UL3A 1YHQS 1B3TA 3GSDA 2GVZA 5CZXA 3P49B 3IGNA 3SYZA 2X51A 2XS7A 2E9RX 2NQPA 3CCSS 1A6LA 2B4VA 4RUHA 5H1SV 1AXQA 4X4RA 3TAPA 1FE0A 4QJVA 4U9RA 2R7XA 3FQKA 3KLVA 3HD2A 5J1PA 3D6HB 2GVDA 3WZ0A 1D9DA 3S8SA 3IFEA 1KRPA 3PYDA 3L7PA 1DQ8A 4JBCA 4USMA 2M5YA 5G0RA 2MKIA 2MQOA 1UFLA 1EX8A 4Q7AA 4YR0A 2ASJA 3AD9C 1T05A 4KHPJ 2JDJA 4I69A 2DY1A 2HLTA 4X4TA 2AP6A 3HFZB 2NSBA 3H8YA 4K5SA 2CJAA 1WHYA 1MU2B 3HHLB 4FF2A 2ZZNA 4G1IA 1YGYA 1NPKA 2ZKTA 3B54A 3O2IA 2R8HA 5F8LA 4IG0A 5K8OA 5KT2A 4UUXA 2BANB 3NAIA 4WXOA 2KB2A 2YNFA 3FFIB 3M32A 4DL0C 1RWPB 1RWUA 3KHRA 3L3CA 2JLGA 5DGAA 1J5EF 3QLHB 2FGOA 4I2QB 4RLEA 4ZVGA 4USTA 4CH7A 3OVBA 3Q8QB 4OHVA 3W8GA 1ZM2A 2WBRA 3K5LA 1HLWA 1TKXB 2C3YA 3PW0A 3PX6A 2NYHA 4FP9A 2IAJA 1KEKA 1YTYA 2B7BB 3EWGA 1LWEB 3BREA 1U1LA 2OKQA 2NUUG 2XYPB 3ILLA 4NRTA 1RADB 2DNLA 3RYLA 1GAOA 2KZMA 2XMMA 2BMBA 2DGQA 2LMIA 4DV4F 3BDEA 2AEFA 1FA0A 1RI7A 3P96A 1H73A 1MWZA 4LSNA 2D9OA 2KN4A 1O6XA 4P73A 2XMKA 5BYRA 4LIWA 3O5TB 4I6AA 2BJEA 3G2XA 3JS9A 1IM4A 3A12A 1VHIA 2F4FA 2XSJB 3DI6B 3ET6B 1UKUA 3BZQA 5SUHA 1ELOA 4ZOSA 4DX8H 4ZLJA 2FJAB 3JTNA 3TI0A 3H5XA 5IQQA 4DR6J 2SXLA 1FKPA 2GO9A 4F02A 1TKZB 3ZZPA 1N36F 1VRUB 4UZCA 3U1MA 2M7SA 4P2MA 3FK4A 1S1UA 3BSOA 1M5VC 4YY3J 2R2UA 4IH7A 1R7IA 2P5VA 4TN2A 2QN6B 1FEEA 2CPFA 3AY0A 2HS4A 3GPAA 3A1YG 1U1KA 1EARA 2MLXA 2LQ9A 1DLOA 3M8RA 1NJXA 1OSCA 2WK4A 3ETOA 4FYXB 2WSCC 5ETRA 2JX2A 3V4IA 4DWIA 4FBUA 1I1GA 3HK2A 5C2CA 3KLIA 1FDNA 2G13A 2V2KA 1N8RT 4DX5A 2Q3PA 2ALZA 4PEOA 3CD5A 4MFBB 1S1WA 2EK1A 3MEGB 1KQFB 1C0UB 4QYZJ 1EQ0A 1NEEA 4RNFA 1F9FA 2IVMA 5K14B 5LM7E 1KC8T 4DSIA 3CJ3A 2MQNA 1U48A 4OI6A 3B78A 4OL8A 3WX4A 1NJIT 2QA2A 2VL1A 4NEYA 1KN6A 3R5CA 4JI0J 3FCVA 3GU0A 5DJBA 3DDIA 1SJFA 1QLNA 2J7KA 1LK5A 2WB4A 2YWHA 4C8NA 4WTOB 1WF1A 4CLSA 2ERRA 2D3UA 3CO0P 4WK1A 3KK1A 3UDCA 4A8YA 3UD4P 4DR6F 2ZHOA 1FJ7A 1BXNA 5L39A 4H4KA 4U95A 3DLGA 5H9EK 1S6QB 4JI2F 1ZAXA 4C11A 1DTTB 3I4PA 3DOMB 4NA1A 5B0FA 4CZCA 3S6EA 3Q24A 1YJWS 1Q8LA 2ZC4A 3CDEA 3DRXA 2AJ4A 3B8HA 2V4QA 5KFBA 2I2YA 2B0GA 5CQGA 3DU5A 3L95X 5HVGA 1P6TA 4FBTA 2DGOA 2C42A 3MM5B 4ANEA 2FLOA 4TLRA 3W2VB 3RW6A 1FX4A 1C2PA 4DQQA 5GADI 4G1QB 1CG2A 4ECTA 2HQCA 4PG4A 3I32A 1RT5B 5KG3A 3X1LB 5HBMB 4PZVA 3QPIA 4K4ZA 1FF2A 1OWXA 1W2BR 2PMWA 4AUKA 2BW7A 2DR8A 3DNCA 2L9DA 3HZEA 5AJ3J 2ZH9A 1ZETA 4B3TF 3FSIA 4CO1A 1K44A 2BEFA 3IWNC 1BQNB 3S01A 4F8RA 3M6XA 3VWSA 2AYGA 5A8RA 1HWUA 2MY8A 3W9JA 3GIJA 2CQGA 2ILYA 5D4NA 4KGZB 1BQMB 2FZKB 2LKZA 2POKA 3GCXP 1E6YB 2VPWB 3N9UC 2P9GA 4K59A 2LXFA 4X84A 1MROA 2H48B 2B51A 3ENQA 1RT4B 1REVA 3EVWA 3G82B 4OI4A 5ETNA 3W60A 3VGSA 1DAXA 1QY7A 1NKEA 2B5JB 1BY9A 2IJRA 4B17A 1HQUB 1OY9A 4DN0A 3MPWA 3Q2TC 2I8EA 4X64F 3DLHA 3MURP 3MTJA 1P1LA 4EU0A 3NMAA 4C48A 2OSQA 2LEBA 1HWIA 1FI4A 1CULB 2HNYB 4H4MB 3SDEA 1VQYA 2H5EA 2B9EA 4N47A 3VV2B 1H3DA 3M9OB 4M63A 3HHEA 2MKKA 4JI4J 2V5HG 5KFCA 4GKKF 2QSFA 4URGA 1IKYA 2QC3A 1NU4A 2KG0A 1FFWB 2OPPB 4NCGA 2IM0A 1CSJA 2M52A 4PPZA 1FRMA 3Q8SB 2B5JA 2XBPA 5J1EA 3EGZA 1CJTA 3O1LA 4G1PA 4P7TA 2OD4A 3UVJA 2YH1A 1MMLA 2W9BB 4V19J 2G4BA 5IOLA 5F8IA 4DUZJ 2EFPA 3C46A 1X7VA 2HRYA 1FWLA 2DHSA 4WYWA 5E0OA 3UW1A 4C3KA 1DRZA 2BDPA 1MN9A 1EZZB 2RNEA 3NCPA 3EX7B 4NXNF 2Y1JA 3KK2B 1TU0B 4MIWA 3SMZA 4UQGA 2V8VA 3OXGA 4HACB 3MEKA 4L6V3 4P71A 5KG0A 3W7BA 2HWTA 3BV8A 1S4FA 3LF0A 2J6SA 4ZCIA 2HK3A 1X0PA 4LF8F 4M5LA 4C98A 3P8BB 2HHXA 3JYTA 2JJ4D 5IQ6A 2V4JB 3EZ5A 2MHNA 2NSCA 3DGPA 3A8IA 3VQTA 2DT9A 2VQEF 3V81A 3KHGA 1M1KT 2ZZMA 3TZWA 4O3QA 1TUVA 2AW0A 3BF4A 2BM0A 2AT1B 3HXMA 5J2MA 4JV1A 4QWCA 4DV0J 1GH8A 3SI8A 3PX4A 2ZITA 3C14A 4OZJA 3MM6B 4XDDA 3U1NA 4NLTA 5HQLA 3PR4A 4QU7A 2W4PA 1I5OB 2WONA 1RDRA 3T6JA 1F2GA 2H4YB 3RB4A 2EWHA 2DHHA 3A3OB 1U6BA 4F7VA 5IV3A 2X1GA 2R7WA 1F5AA 4KGVB 1FRXA 1H6KX 2F65A 2UVUA 2R7TA 1NZ8A 5KG1A 3V6KA 3K17A 3TQEA 3EYZA 5C24B 4F0MA 1U1MA 3IM8A 2HPUA 1FK9B 3MPVA 2VB6A 1TFWA 2EVZA 1DTQA 1Y3JA 2BE2B 4I4BA 3Q8VA 2IBKA 5CYJA 2H54B 4HTIA 4B3RF 3OR1B 3AFGA 3FZBA 4HI1A 3MCNA 4IFYB 3MM9A 3GIKA 3WC2A 2W2NP 2QLXA 4ZA1A 1XR7A 2DBBA 1RT1A 1CS4A 1WOSA 2FYXA 3W5XA 3PW5A 2C2RA 1BQMA 1VBKA 4WU3A 3HULA 5L9XA 3GV5B 2KT3A 3S7RA 1XNQF 1V5IB 3CSKA 2B4OA 2WBMA 3DM2A 2UU9F 1XMQJ 2V9WA 4AQYF 4ZP8A 4NLDA 2DPIA 2DRBA 2BRKA 4NYOA 2ZZTA 4K5RA 4DQSA 1PILA 2FHMA 4EYHB 3JYTB 4FS2A 2QL7B 4C8OA 3BGUA 3I55S 2FD2A 2A10A 2DNZA 4PPDA 2RE1A 1ZPVA 1PGZA 2HMIA 1XNQJ 2WCXA 1FKPB 3BR8A 2JVRA 1VRUA 2W8KA 2Z58B 1S7HA 2MQMA 3GG0A 1KD1T 1LWCA 2M9KA 4NLGA 1T94A 4WBFA 2PGCA 4DZDA 5A0YB 4Y3CA 4XO0A 3T5KA 4UY85 1QAXA 3OL9A 1JXLA 3QQCD 2C3OA 1TK8A 1SC6A 4UZBA 3ZZRA 3UPFA 2Y1LB 4O0IA 5J1EB 1DTTA 1RTHB 1N34J 4RO0A 2I6WA 2JHEA 3IBFB 2VG7A 2HFUA 2Z2MA 5DQGA 1R6VA 3MM7B 3OFHA 2VV5A 1TKTB 1Z4UA 1GX6A 3NP5A 1YG0A 4HHUA 3AXMA 3V2UC 4WFBQ 5LJ3Y 3GJRB 2Y1RI 4R5PA 1SQEA 3HT3A 2ZH7A 2AGPA 4DR4F 1S10A 2P9CA 2J0QD 4WZMA 3ZO7A 4JV5F 2R7VA 5HAOA 1UA0A 4B3SJ 4USVA 1NKCA 1RHRB 3T9ZA 3I5CA 4YP3A 2KYXA 5L38A 3CC4S 4J9SA 4CLKA 5KT7A 1RT1B 3JSYA 1T9VA 1Y3KA 2XSJA 3U1LA 2QFIA 3MEGA 3A3NB 4TY8A 4RUCA 4MH8A 2DNRA 2ZDOA 4FXWA 4J9UE 3QZ8A 1HNZF 3TW0A 2BANA 4OX9F 3LGNA 3DRYA 3K5MA 3RU0A 1S4EA 4U96A 2ACYA 2YKPA 2ASDA 1S72S 1TAUA 1B0TA 4NCGB 5KFJA 2JEIA 3HMJG 1EETB 4DR1J 1RBOB 4MYTA 4N8OA 5T14A 4GC6A 5H9FK 2CPYA 2KYZA 2CJXB 1WORA 4DSFA 1PYSB 3FCWA 3D1OA 1RHUB 3F41A 3M8QA 4ZP6A 3T41A 1WJ9A 1E6VA 2ZNYA 1TL5A 3FBEA 4NMXA 1O8BA 3M7VA 1T9TA 2CPXA 2GGPA 4ICLA 3TVYA 4A8OA 3KK2A 4LF9J 4C8KA 2DIVA 5G4DA 3W63A 4ECVA 4WKRA 1UPPA 3ZTOA 2YY3A 3DXSX 5T41A 3IC1A 4YUDA 1VQKS 2GMJA 1P8GA 2HRTA 2UXDF 2EXUA 2N4DA 2NXJA 3VR1A 3HHNB 4YR2A 1YLXA 4DSEA 4CLPA 5F8GA 2F9JA 1NMEB 1UFKA 3T1HF 1HQEB 1S97A 3OL8A 3H0PA 3ISNC 1LXJA 1GFWB 2QIFA 2X1AA 2ZKUA 1N0VC 2JH3A 3GTYX 2IRUA 4P9SA 1YRTA 1KTQA 4CNYA 5B08A 1TVRB 5LJ5Y 2J7UA 2CZ4A 4YQWA 5IT9Y 3H5UA 3TRGA 3KK1B 4ED3A 1SKSA 3DDKA 2OPQA 4GKJF 2HZAA 4MJKA 1S79A 2HFNA 4P74A 4YDXA 1R6YA 2DRAA 2HHWA 1GXTA 3THTA 1I94J 2HNZA 2HVIA 1KTVA 3PYEA 3JQMA 2AJ0A 2A2DA 4EBEA 1Y5LB 2CQ2A 5ADZA 2GIQA 4DDFA 1NJWA 4HEA9 1UMJA 1UVNA 3SSSA 4EBDA 1VBYA 2DGWA 5KG5A 4DJBA 1X4DA 2OSRA 4WKYA 2QMUB 2W25A 3OFGA 4RW8A 4CP5A 3K8WA 1KLNA 2DXDA 3H59A 5KFGA 3UN2A 3TJ9A 4ZITA 2P2CB 4NCBA 3FNNA 2I0XA 2JC1A 4E0DA 3G96A 3HJFA 1RTIB 2I5JA 3SCLE 2UXDJ 1VQLS 4K0KF 1YRUA 2QE5A 1E6VB 3NWGA 1NXIA 1U8SA 4OI0A 2C3PA 4HH1A 3R1HA 3IR6B 3HVTB 5LOQA 1VCTA 1CC8A 1NUEA 2VC0A 3FMWA 3KG0A 4OX6A 2UUAF 2N7CA 4WE1A 4FPRA 4U8VA 4A8XA 4WZQA 3QO9B 2K1RA 2HQ3A 2J8AA 3ZZOA 5MAOA 2RU9A 3W8PA 1SL0A 4CH0S 1UETA 2W9BA 3AODA 4J9PA 2EC2A 2LCWA 2ZE2A 3DXBA 1WDDA 4FNIA 4QBUA 3QFHA 2OTLS 2EPIA 4DS5A 2KZZA 2MMYA 2RT3A 3M6VA 5KFVA 1X4GA 1IQZA 1NK7A 4O44A 4DLEA 2XTJP 1RACB 1XJWB 1RYSA 2HQGA 1YZ6A 2CQPA 5KFDA 3QSIA 3W5YA 1X4EA 2GC8A 3KDNA 3MR2A 2R9LA 2GJ2A 1CULA 2HNYA 5E33A 3J7YU 4CYUB 3C8YA 1XC9A 2G1HA 4RU9A 4RJVA 4DPYA 2UUCF 2CPZA 3AXKA 4D3GA 1IXKA 1JK9B 2LQ8A 1VJQA 4M5KA 2FY1A 2VG7B 3R6LB 3CJRA 2DH8A 1CJVB 1GT8A 2KRBA 5I3UA 2M88A 3BGOP 4PXEA 2J9EA 2FUG9 5EHHA 2LEAA 3QFWA 3GSIA 3OUYB 3G8TA 2VICA 4FS1A 5IC6B 3WQPA 4IG3A 2XI2A 4Q8EA 5CCMA 2D74B 4HDGA 2YNFB 1HWLA 1HBNA 4O23A 2JZ5A 4KIAA 4J7CA 4LBHA 4TY9A 4UOHA 4WIIA 3LPYA 3WC0A 3KJVA 1XIQA 5FIIA 1SJQA 3DCAA 1ZA1B 1HFEL 4ZVPB 3TUZC 2PSZA 3RRKA 4WP9A 2R7OA 1JIHA 5KFEA 3I0SB 4OHYA 2YX4A 1V9OA 1HPZB 3TA1A 3H5YA 3WBZA 3HVTA 5C25B 1SCJB 2CQ1A 2NS1B 5D4LA 4ZPBA 2V2QA 2PE8A 3OQ2A 3BH6B 3VGVA 2A3JA 2WAQD 2YWFA 5KFNA 1J5OB 1P9YA 2DKOB 4NXMJ 2OPSA 1WC4A 4XAKA 1TTHB 1GXLA 2XCPA 4O0NA 3K5PA 3KJVB 1SJRA 2W24A 5K20B 1JLAB 5DDRC 3GV8B 4DV2F 5DQHA 3QSYB 1D9FA 4RW9A 4KY3A 1IKXB 4CI0B 4CO4A 1M5KC 1LQ9A 5GAGI 3DMJA 4K50A 5KG6A 1KQSR 3QIDA 1VC5A 2YQ3A 1OJ4A 4IG0B 1GMVA 2W7PA 5KFQA 4KHRA 1NDPA 2OMLA 2VPYB 1SC4B 3HHDA 4ZCLA 4ZLNA 4O3NA 5A2QY 4DUYF 1FWPA 4W4MA 3GB0A 4FZVA 4ZKAA 3KNAA 1QJHA 1U2FA 5C24A 3MFIA 1RCOB 4OYBA 2R8IA 2FLNA 3DLLQ 2YKNB 5KFXA 4PWWA 5HQ8A 4WFZA 2E9TA 3M2RB 1AFJA 1RWVB 2ALYB 2ZH5A 3C6UA 1R27B 4LF7F 3L7UA 1SIZA 3W2WB 4DL4A 2AV5A 2BYCA 1WI6A 3UFCX 3PVXA 1IBLJ 4YS2A 1QVGR 1RZMA 2ZWPA 3OXLA 2CPJA 2E1AA 2FDNA 1SH3A 4ZCKA 2DHGA 1S1WB 2BJ3A 5A0YA 4MTPA 3R8YA 3OTOJ 2R8KA 4ZLPA 1PC4A 2H5JB 2IYIA 4IH6A 3I56S 1KSPA 3NGSA 2B9WA 4K2XA 4BC7A 2JEJA 3FEXB 1EJ7L 1WHXA 1DFDA 2K8GA 1IKYB 2DGXA 2HHUA 4H4OB 1MU2A 2YBVA 3HHLA 5JVHQ 5HLFB 3HLUA 4EO6A 3FSYA 2XMJA 2RQ4A 1RA7A 5D4PA 5KG7A 5LMNJ 3CUNA 2L48A 4IOBA 3J81U 4PXDA 3I0RA 1N88A 3CCTA 2EKYA 3GIRA 4URQU 4U7UK 5D3GA 3GZ7A 1NKBA 1IR0A 2NZ4A 3BN7A 4ES1A 2VH7A 5ETKA 3K8VA 1KQKA 5KT6A 4JUZA 1IR1A 1H7XA 2GAGC 4OZ5A 1RT2B 1OMSA 2C3UA 4CWBA 2XHWA 1OQ3A 1Y9OA 2AQ4A 3SCJE 3EPIA 3PKMA 3KUGA 3LP0A 2AYMA 2E5IA 1M90T 3N4WA 2ZD1A 2L08A 3V81B 4JI7F 4DQIA 2WW4A 2YKMB 1GQEA 2CJKA 4JYAJ 1O5JA 4DPUA 4FF3A 5IWAJ 5KFLA 4X65F 1JLQA 2FJXA 3DOKB 1FNOA 2FJBB 3KLGB 1O0PA 1UZDA 4BLGA 4DQRA 3EPGA 1AB8A 3PFOA 3R7NB 1S0VA 2ZH3A 1ZTTA 1JKHA 2BA9A 2I5JB 2KVQE 3L09A 4QWEA 1RWOB 4C9DA 1NO8A 3C6TB 1D09B 1KVJA 4PYAA 1JLEB 2RS8A 3HPOA 4PYDA 4EGLA 6AT1B 1IBCB 5IWAF 3HVRA 2IMWP 3H5SA 2WB1D 1FD2A 3QWPA 4NCAA 2AF6A 2ZVSA 4NA2A 4OI2A 3Q8YA 2NR0A 2Z2YB 1Q1KA 2BE9B 3IAS9 1RBAA 4YMEA 1UWAA 2HNZB 3CCQS 4YHHJ 2JNJA 4IR1A 3P6YC 4JI0F 1V3SA 2YH0A 3M2RA 2G2OA 2YPYA 1RCXB 2NXCA 2VFRA 3OBIA 3SQGA 3WIVA 2ZEJA 4RNOA 3TQ1A 1XMOJ 3NMRA 2QGFB 3T3FA 1NHVA 1VQSA 3DRPB 3KUHA 3SFUA 4ZMMA 1KLMB 5DG7A 1XK8A 2CPEA 7FDRA 2VBXA 3DM2B 3H98A 5CYMB 4BBYA 4ZIVA 4YHHF 4LR7A 1LK7A 1JJCB 5C7PA 1HHSA 1U02A 3E01B 2MQLA 3GYGA 2IHR1 2OFHX 4MK8A 1WOPA 2MJUA 2FJVA 4PRFA 3UDVA 3K59A 1HBOB 2XMUA 1WUUA 3P4UB 1CC7A 2G2YA 1U6FA 2EG2A 2JSXA 3CJ5A 4Y0FA 4ED0A 4KAIA 1G6BA 2R3VA 2X1BA 5KFTA 4P2FA 5K9FA 1AZSB 4CT8A 1VK3A 4JP8A 2AYEA 2IJFA 4PWUA 2RU3A 2A18A 3DRRB 4QWBA 1K0VA 1VR6A 1UW4A 3CNQP 3QIPB 1WKJA 2DH7A 1WF2A 2DITA 2UUBF 1XNRF 2LECA 3DYAB 4MIAA 3LGHA 4E8UA 5KFHA 2HHVA 1UWBA 1JNRB 2JWNA 2ZOGA 3BGRB 3Q0AA 2E5LJ 2AHOB 2J0SD 1UJ6A 2M70A 4I6WA 4OZNA 2Q6BA 1P1TA 1WACA 1BD6A 3UDLA 2ZBPA 4ETZA 1VQ4S 2KFYA 4LF4F 3G6YA 4ILMA 2V8GA 1SIWB 2O01C 5B0GA 2XG8A 2O67A 1F1BB 1RLCL 1CJKB 2JLFA 1Y5IB 4I0WA 1Y10A 4M5JA 3DHWC 5LXRA 3BJYA 4QIFA 2CG8A 1NLKL 2E7VA 4TYAA 4EI2A 4Y2KA 4X64J 4F3OA 2FC9A 3VTIA 1JLFB 3PYGA 1B99A 1FRJA 4CRJA 2HRUA 2GHVC 2FTRA 4X4QA 1OPZA 2W4DA 4F4XA 3EXYA 1IBLF 3BO4A 3CDAA 3CF5Q 2V50A 3CDWA 1KOOA 3ENWA 3KLFB 2XYHB 4J9OA 2CVEA 4AL6A 1SJ3P 1WC5A 3UNGC 1HBMA 5J2NB 2ZJPQ 4GKKJ 4UUWA 4C8MA 3D3CJ 3LANA 4KC5A 4DXLA 4ECSA 1NJZA 1S6OA 4R8UB 4AT1B 2F1FA 3W2VA 1SL2A 3WHIA 1QAYA 1LEOA 5K8NA 1U25A 3I5AA 2OHDA 2X3GA 3KFWX 3PXGa 4UT4A 1LXNA 2BQRA 1RKJA 3N79A 2JVOA 1CJTB 2IBOA 4JI5J 4MMOA 2E5LF 5F8HA 3SV4A 4NI2B 1EHWA 4B3MJ 1UVLA 1KKHA 3BB5A 1DJ0A 2HFOA 2W8LA 1QAJA 3MR6A 2P6TA 3HP6A 1YITS 1S57A 3RAMA 2E1CA 5MLCV 5L1KA 1IKWB 1EQMA 4CCHA 5CAAA 3VZIA 1NNDA 3FUYA 1XWLA 2DK2A 3C16B 4J5OA 4JOUA 4QIEA 1AYEA 3DC2A 3UO0A 3OLBA 2DGSA 1W25A 2MLYA 1U1RA 2W2PP 5KT3A 4ZS6A 1YX2A 2FB0A 3PZPA 3F56A 3NNHA 3DHXA 4OYOA 2KM8B 1UAWA 4FVCA 4P72A 1HI0P 3W66A 1KR4A 5ITHA 3MAQA 1IKXA 3JB9k 1T9WA 1XBWA 2V2ZA 3BSAA 1QE1B 2H1YA 4Y2CA 3CCZA 2AJ2A 2FY8A 3I31A 2L9NA 6FDRA 2ADBA 4IFYA 4KGKA 4ZN3A 1J5EJ 2NZCA 2OAUA 4ED7A 2ZOFA 4ZVSB 3CCUS 1VQ8S 4UOCA 4ILLA 2VBYA 4A8SA 1N34F 3GFZA 1XQIA 2MQ8A 4N7TA 2B9XA 3TAMB 3C16A 1X60A 5AXKA 2VA3A 4LF8J 3AJ2A 3OVSA 3D5MA 1RT6B 1TV6A 4G3IA 4Q2MA 1ZH5A 2LP4A 4RW7B 1YKWA 2HS0A 4ZVUB 3MECA 4OIXA 3M6WA 4WU2A 1S1UB 1FFSB 1OSDA 3MI7X 4JI8J 2OMOA 1HNXJ 2AGOA 3NAHA 1RTIA 2KT5A 4DV0F 4CLTA 1FVSA 4B9MA 3KOAA 1VDHA 1ZTWA 1RQ0A 1JLGA 2PC6A 2ZWOA 1U4BA 1MSWD 3DMJB 3W1YC 2ROEA 2UZAA 5GVQA 1FXLA 2AEMA 4TY8B 1IM6A 1NSPA 2MY7A 2YNHA 3MM9B 1TL1B 2HHTA 1HKAA 1TK5A 1RTDB 3P5BP 4XTTA 4DV6F 2Q43A 3B4MA 3H2UB 4F0HA 1HHTP 4QYRA 5E3AA 4K0KJ 3NOCA 3H4DA 4OYMA 2ZM6J 4YY3F 1T7PA 1P9QC 1YBAA 3GE9A 1RXOB 1X4BA 2BXJA 3D4JA 1VBXA 2CQ3A 2RRNA 2YKQA 4LREA 2VQFF 5J2PA 1GTHA 2OPRA 4DX6A 2ZDPA 1SC1B 5HL7Q 1XR5A 3VQSA 1CPZA 1JLFA 2LXIA 2PFDA 2CJQA 2YX7A 3OTBA 4M5MA 4E2FB 2CG4A 2XO6A 2HHHJ 2RIJA 5A8KA 2NXUA 2NREA 4B3RJ 1X5OA 1TL1A 2XULA 4MK9A 2FHOB 2KVIA 1Y11A 1MROB 4WK3A 3M8ZA 3U27A 3M1VA 4RW9B 4DCJB 1IVZA 5IT0A 3KHLA 1EIYB 2VA2A 2OEKA 3GLJA 2OIHA 4A48A 3NWRA 2AX1A 1FKOB 4NMLA 3ZTQA 4ITSA 2RJZA 3MM8A 4LMZA 1FJEB 4M94A 1UVJA 2F4VF 3UN3A 4ZPDA 4DV5F 4F3QA 1GMWD 1S9GB 2EKNA 2QJ3A 4RW7A 4K4TA 2HAIA 4I68A 5IZHA 4G65A 1G4CA 2RMLA 4M1KA 1DHMA 2H4WB 2IYGA 3OR2A 2MLZA 1M1GA 3GIIA 1TKTA 3NS7B 3GR0A 3MPYA 4FVMA 3AQPA 1X4AA 4P75A 3G8SA 2K3KA 1IUJA 1HNVA 4I67A 2C2DA 1VQ6S 4G6VB 4X66F 1LW2B 1ITPA 2CJYB 1RT2A 2D41A 2GVZB 3TWZA 4L72B 2QA4S 1XMOF 5CH7B 3CJ0A 3FSXA 5A6WA 5B0DA 3Q22A 3DGVA 1ZZFA 3ONQA 1A0OB 3FBFA 2FLLA 4KPCA 1ZYQA 5FJ4A 4JI7J 1UJ5A 2M8HA 5K8MA 3NGUA 4NXNJ 5DG9A 3W5ZA 2HGMA 3I4HX 3CIMA 1A7GE 1WG5A 1DLOB 3SQGB 3M8WA 4KH1B 3OL6A 2V34A 2LA4A 5ETMA 2U1AA 2CNKB 4ZP7A 4H4KC 3FZ2A 2QLFB 5IT4A 4QYZK 4RL1A 4ED2A 3I96A 1VRTB 2VASA 2GNKA 4USHA 5IV4A 3BR9A 5CCLA 1YJVA 5RUBA 1HBUA 3MXHP 1KWMA 2F8MA 1M0SA 3FBCA 5K14A 4NLUA 4KYZA 1HD0A 2HLUA 1MN7A 2E5GA 3C19A 3PJXA 2CJ9A 3PR5B 3RB3A 4LF5J 2GQ2A 1C0TA 2BOPA 4PUOB 3QMQA 2PI4A 4BS2A 1KS2A 1VIXA 2CFXA 3DYAA 2NCKL 4Y65A 1UWBB 3AB4B 2CZVC 3PW4A 1TL7B 4J9RA 5M2PA 3BO3A 3BQ2A 4NZ7A 3QIPA 4UOFA 1N6QA 1J2VA 4LRDA 2N3LA 1G3OA 3T19A 5A76A 3CD7A 4B9TA 4DR7F 3QAEA 5HO4A 4BWJA 3RRHA 2P9EA 3K5OA 3WDOA 3O6QA 1CJKA 4NLOA 5EX3A 4TU7A 2IDLA 1T3NA 2MSSA 2E1PA 1PKUA 2J6UA 2MQQA 5DGBA 3MM5A 4ES3A 1RWNB 3K7RA 2BR0A 4LRFA 1Q86T 1CS4B 2C2OB 1JQGA 3DI6A 5CZVA 4CM0A 4KGMA 2B3TB 2W9CB 1WD6A 2MZQA 2OELA 3MWBA 3V6JA 4BWMA 4X4OA 3HSGA 1SPBP 3QGHA 5ETPA 5EUHA 4ECXA 2MHEA 3Q86A 1BLUA 3TEGA 1IJFB 4TKTA 1YSJA 4ECQA 2R8GA 1LNQA 2QO3A 1EKSA 2DCLA 3OR2B 5E3PA 4C6AA 4ZVEA 5JJBA 1XMBA 2P8IA 1UZHA 4ED1A 1U2RA 5LXYA 2ZBIA 3TZZA 3GJTB 1FESA 1I94F 5ETTA 1TKDA 1RBLA 5D78A 3U7JA 2DPJA 5E3QA 3D9BA 3TAMA 2PT0A 3EICA 3ZZUA 4B3MF 2D9PA 1QVFR 1H2TZ 4ZPCA 4A47A 2C3MA 2F3JA 4ZVQB 1REGX 2HFZA 2DEJA 4RKUC 3TP2A 2ZJQQ 4XIUA 4OYZA 2UXBF 1RT4A 3G82A 2E29A 1CJUA 2RF2B 2XWXA 1VC6A 1SUQA 4A46A 4O3SA 1RU2A 2F7VA 2QLBB 2Z8QA 3GJSB 2V8PA 5F9LA 1R8PA 1HNVB 2DJWA 3BKFA 1L3TA 3OR1A 3RZAA 3IM9A 1HHQA 2YWKA 1RGVA 5DS7A 2WTFA 4IQMA 4F4ZA 3THVA 2HURA 3GONA 3IGVA 4LIRA 1WEYA 3M2VB 4WXWA 4CLLA 5A8WA 1QUPA 4QIVA 5T7LA 3ZZYA 1IKWA 4AXIA 2CNLB 2YQ0A 3GG1A 5I3QA 4USIA 2VQEJ 1NK5A 3MPDA 1FT8A 1NDCA 3LQVA 3TR5A 4WFNQ 3OVAA 4IQXA 1R89A 4RBTA 4QCLA 2BV3A 4NEZA 3LP1B 2XLIA 4I2PA 4F4KA 1B64A 3GWCA 5DG8A 1Q95G 3TEHB 3TJAA 1Y0HA 1PCAA 1RWKB 4GRSA 1L3KA 1S1VA 3EE3A 1JX4A 2BJ1A 1B0VA 2HKEA 1BUXA 2K7KA 2V8DA 3I82A 4P10A 1HNZJ 2DTJA 3D0HE 1DARA 3DOMA 4Q8FA 4QIGA 1ZOTA 4R25A 5KFUA 3FVYA 5DZ6A 1JKHB 3VGTA 3AH6A 5L9NA 3W3SA 1F0XA 2HHPA 1R31A 3AOAA 3ZTRA 3ZNUA 3UR0A 3NGKA 4DZ6A 1RE1B 4LRCA 2QYCA 3RG6A 4X4PA 4ES2A 4KPYA 3LGMA 4F25A 3JAMU 2KFNA 1Q4RA 1HPZA 2KHCA 3A8JA 2MKSA 4HT7A 4DV6J 2MKJA 1H38A 3MOJB 5KFAA 5GAHI 1UVIA 2DEIA 4URSA 3CW2C 2VG5B 1MNEA 3EZUA 3D2WA 2CYYA 2MJNA 1U47A 2B9YA 2CDQA 2AEJA 1HD1A 2VF3A 1W7WA 3UVJB 1KVKA 4KKOA 2XGPA 4IR9A 4LVOP 2ZHAA 3BGFA 2XS2A 4ALZA 1ZZNA 5D8HB 1NHKL 4OJ1A 1DURA 3KLIB 1C1CB 1S6QA 2RVJA 3E3XA 4K8RA 5GAEI 5IT9U 2EK6A 3DLEA 3NOGA 2G9OA 3GFHA 1HW9A 1UEVA 5HJXA 5FDLB 5KFPA 3J80U 2LEPA 1UFWA 4DPXA 3VAFA 4M5NA 1FRHA 2FVRA 3RR8A 1HQUA 1WF0A 3JSBA 1Q7LB 3UD3P 3N28A 2J8SA 1ICEB 5LSRA 4U67Q 2XY7A 5DZ7A 2DNYA 1UEUA 1UTAA 1SKUB 1RYRA 2DO4A 3C3LA 2F4VJ 2B7CB 2GZOA 1WHWA 4FYYB 3NGTA 1VJWA 4P2XA 2MZ1A 4WF9Q 3E8OA 4GMKA 1U09A 1WC0A 4H54A 4K4UA 3RGIA 1OS5A 1HBMB 4K4YA 2VG6A 3H40A 2QLWA 3P45B 3AJ1A 4Z7YA 3MEEA 2G0IA 2J5AA 2YTCA 4NLVA 4DHVA 4DMZA 4EBCA 2XMAA 3V4IB 2DVIA 2KL8A 4C8YA 3FRYA 2VFUA 1ZBTA 4RW4A 3R9LA 3SSQA 3KDOA 4KV8A 4LSLA 5CYQB 3HO1A 3KJFB 3D68A 2DIUA 4DFPA 2H65B 1TL4A 9ATCB 3OJSA 4L75A 2D7SA 2XZWA 4JI6F 2E7XA 1P27B 1KBRA 2DGUA 4ECRA 1VQMS 1SJ1A 1GK8A 1K1SA 3RBXA 3N6MA 4JI1J 1HYSB 2PMZD 1XERA 3RB6A 3KJQB 3GQCA 4UY8T 3AA9A 3MM6A 1M5HA 4J91A 1HARA 4W98A 1RJJA 3W2WA 2QG9B 3HVAA 4DR1F 1X8DA 1Q8KA 2HW3A 1F5CA 3MAAB 2BKOA 5THWA 4X62J 3KLFA 3VAHA 4KGXB 4DI6A 1RSCA 1NHUA 1Z1ZA 4R5PB 1K8AT 4ANCA 4RNMA 1IR2A 5L8RC 3MR5A 2UUWA 2D1CA 1HNIB 3L7OA 3A3PB 3TO8A 3A8EA 4LQ9A 2ILZA 2IJNA 2U2FA 2Y9HA 3N5BA 1SKRA 1Q78A 3BH7B 2C1EB 1FE4A 1S59A 1M5SA 2HQDA 4OJGA 4F26A 2N3OA 3LAMA 1B4SA 4DFKA 1F2HA 1I6JA 2DGTA 5HI7A 4PQUA 4ECYA 2LQJA 1RABB 2RDIA 5IXUA 4EMDA 2V68A 3H90A 2XEXA 1GX5A 5BR8J 3J7YI 2YWWA 4XPEA 1VQPS 4JI6J 3LP1A 3F0NA 2BACA 2DNQA 3TA0A 1JNZB 4HHJA 5HMXA 2DCUB 1BWVA 1WSVA 3R3TA 2GMLA 4NPOA 4LQ3A 4DV3J 4PWDB 4RW4B 2NYIA 2MSTA 2UV8G 4ID5A 1GEHA 1YRXA 3QYYA 1BGXT 3MMAB 1H72C 2IM2A 1S9GA 3H42A 3I9V9 5E41A 1JLCA 2QFJA 1FERA 1PJ7A 3FMBA 3DLEB 2HNDA 5DO2A 1N4LA 1HL6A 1SQGA 1T3OA 1YDLA 3OD2A 3IG1A 4I2QA 2BJ8A 2A0FB 3KYLA 1YJUA 2PA3A 2OD6A 1IBMJ 1LV5A 2HVZA 4DV2J 1LW2A 2R8JA 3E01A 3E51A 4HL9A 4LT6A 2DXEA 1I3OB 1FX2A 1T9YA 2Q79A 2V9KA 1Q8BA 2V6AA 3EVMA 5D4OA 1U1NA 1JJHA 4DV7F 2GMHA 1DTQB 4KB7A 4N76A 3PJWA 2G0CA 3PIOQ 3ZTSA 5F8JA 3I0RB 2J0WA 4OYAA 5B0AA 2EFQA 2NPIA 2YKNA 4WCEQ 1R8BA 2GX8A 3LH2S 4Y28C 4DV1J 3ENAA 1IKVB 4FYWB 4CIOA 1N48A 2UUAJ 2CRLA 2WHOA 5JXSA 2WVCA 1GTEA 4LFCJ 1S76D 2UUCJ 3PEJA 3FKBA 1FRLA 1NSQA 2GO8A 2K3IA 3BBBA 4Z2XA 3DLBA 1D9AA 2E66A 3BS9A 3CCRS 2FVQA 3RR7A 4TYBA 3G6XA 4BHQA 1JB0C 1OY8A 5B0CA 1WC1A 3CMAS 1U1PA 3H20A 2N82B 3WIUA 4B3TJ 1SH2A 1RAFB 1N56A 4OI3A 2Z0GA 4HR2A 2RHQB 3MD1A 5GMKa 2QV6A 2AYBA 2VFTA 4Q2LA 4JI3F 1WG1A 2MEWA 4N41A 4JI5F 2LVWA 1U0HB 2UUTA 2RHSB 1A9NB 1PIEA 4F4WA 4FNHA 4DSJA 4YN3B 5KFZA 1VMBA 4B9SA 3PFEA 5KFFA 4IUFA 3QT5A 3QNWB 1F9HA 4DF8A 2OTJS 5HMZA 3RBEA 2CQIA 4FDFA 2HSEB 1N5YA 2KO1A 4IFVA 1U45A 2DNPA 5F3TA 2XB2D 2MGZB 2XYGB 3CCLS 2IM3A 3ILOA 2FGCA 3R6GB 4NX9A 3RTVA 2RUSA 4J90A 2VBZA 1X9SA 4MAKA 4YEAA 5EN1A 3MD3A 3PNIA 3AA8A 3CXCR 4J9VA 3PTWA 1NSKL 2MKHA 1LOUA 1EP4A 5F9NA 1YJNS 3CVKA 1Y00A 2OPSB 1VRTA 1NK8A 4AL5A 4IFVB 3AD8C 1PSDA 4FXDA 4CQ1A 1JLCB 3GFYA 4JYAF 2H51B 2CDRB 5HN0A 2HEKA 2O5DA 5T7LB 3TVKA 1S9FA 5HK4A 3MEDB 2CWXA 1HI8A 1HWJA 2E9ZA 1NK4A 1HNWJ 2LQ5A 3MEEB 2UVVA 1RTHA 4HLBA 3H2VE 3J81j 3HVWA 1XMQF 3UR3C 5DM6Q 2NXEA 5D0GA 2BJ7A 2GJFA 2OI2A 1EP4B 2V67A 3K89A 5F0WA 4DR3F 4B9UA 4OFZA 1G1XA 2DGVA 1UJ4A 1VLOA 2F5GA 3CJSA 4WPAA 4RX6A 4ZHRB 3QJLA 5I3PA 3SV3A 4OV1A 2GJIA 3J7ZT 3MZIA 4ZPTR 4ZJOA 2AD9A 2Q6CA 1WI8A 1H98A 3N5FA 1ZM4A 4R8UA 1WHVA 5HSPA 2GA7A 4ICLB 4DEZA 2JRSA 3T6BA 2AJ1A 5AXLA 1IKVA 3L9ZA 3UI3A 4ETXA 1N32J 4CT9A 3BSNA 2PO4A 4I6YA 2RDJA 1U2CA 2V0NA 4V1Ak 4OV6A 1NK6A 2DR9A 5L1JA 4GVLA 1MG7A 1T11A 3C15B 1N5SA 3D6TB 2LDIA 3QWUA 1B7YB 1NAQA 2MQPA 2VG6B 4U6PA 1C0TB 4ECZA 1JXEA 3HSJA 1RWWB 2KHDA 3JQJA 3NG8A 3QBCA 4CO2A 4F3MA 3JQKA 3BEGB 4TXSA 1FJGF 4F04B 4DR4J 5HROA 2Z57B 2QT7A 5KFSA 2IFXA 1RHKB 2BW2A 4IOAQ
chains in the Genus database with same CATH topology
2XSFA 3KLHA 4PG7A 1ZPWX 2GQQA 4LSNB 2D3ZA 5KFIA 2ZNZA 2I38A 4IH5A 4KT0C 1S6UA 4NLRA 2E44A 3MMCB 3BQ0A 4JI4F 1N5YB 4C0BA 1V6HA 5C25A 1M5OC 1RTJA 2DNNA 2M3DA 3K2YA 3Q8RB 4NZ0A 3MM7A 1S99A 1U1OA 2PI5A 1FTCA 2IAJB 3MGJA 1WNEA 1URNA 2CQDA 2XY6A 3LWLA 2FVPA 4ZK7M 4QZVB 1WEZA 2QEXS 1N5TA 3V6DA 3T1YF 3KMQA 3DFEA 1REVB 2ZOMA 4IG3B 5LMNF 4M95A 4QU6A 4PG5A 5DRKA 4XPCA 3F73A 2J6TA 3DLJA 3CIZA 1YI2S 2Q1LA 4C8LA 5IFMA 3PRDA 3J80Y 1H2UX 2F8EX 1SBRA 1S6PA 5KAKA 3CC2S 1UA1A 1D1UA 3H5XA 2GGPB 2RRBA 4WFYA 2FHJA 4P2SA 5B0EA 5EWFA 2R7RA 1TR0A 1U1QA 2OH2A 1TAQA 2LDYA 3T5HA 4OZ1A 1ULRA 2DHXA 3PRBA 2JL9A 4ZCMA 2D3OR 4R0EA 5F0UA 4Y00A 4D3HA 1V3RA 3BQ1A 2ABYA 5GAHU 1HQEA 3IS9A 1C4AA 5U47A 3ITHA 2YVSA 2FJDB 4DBQA 3VF0B 2R2SA 2RRAA 1JWWA 3IN5A 3N0VA 3Q8PB 3DDNA 3POTA 1FK9A 2WOMB 1U7LA 4I7FA 5HP1B 1QAIA 1N33F 1CQNA 4DL7A 1T05B 2RH3A 1LFWA 3B82A 3V5RA 4QQBA 1U26A 5J1NA 2HYIB 1K73T 2B4UA 1TVRA 1CQMA 3KWMA 3MHYA 5M2RA 5GADU 4O44B 3DRSA 4BC9A 4QR1A 3JTPA 3S1TA 3CCMS 5J2QA 2YNHB 1LFPA 4PXCA 4DG1B 3PV8A 2CVIA 2E5HA 2XMVA 3LUYA 4FF1A 4Q0BA 2M2BA 4EFAC 2FHKA 1AUDA 3UWTA 2RF2A 2DB1A 4A8QA 5LSOA 3NCRA 4LF5F 4C7QA 1HWKA 3IO1A 2FPHX 3KMSA 4RW6B 3CE8A 4CO3A 4C2MA 4RNOA 3MMAA 4QW8A 4KQZA 5KFYA 4F67A 3M2VA 2QMXA 5A6PA 3KLGA 2XO7A 3IRXA 2IRYA 1Z2LA 4NYPA 2KXHA 4NLWA 4RBVA 2B56A 4IDKB 4X4SA 1RT7B 2KT2A 5FD1A 1X9MA 1H2VZ 1Y5NB 2IVYA 5F3ZA 4K4SA 4DFJA 3CO9A 4NOHA 4MKYA 4OX7A 2MDAA 4U7CA 3KLEB 1N32F 1V3ZA 3M2UA 3VAIA 4ECUA 1TP7A 4KE5A 3V6DB 4LUBA 4ELTA 3OHAA 1JLBB 4C11B 3BDPA 3C6UB 3DOLA 2NUHA 3FGVA 4KO0A 1YWXA 4ZP9A 4K4WA 1C1BA 3PO4A 3M4XA 4DV1F 3THPA 4J9KA 4QIWD 3CGIA 2COLA 1S6PB 4AFFA 2R2TA 1FO1A 4KFBB 2RQKA 4KRWA 2BJDA 1FDAA 3KKFA 2HHHF 3IR5B 2PIIA 4WFXA 3FDSA 4RUAA 4EUVA 3B4DA 1N5VA 3PY8A 2GHPA 3IWXA 2VD3A 2BZ2A 4J9LA 1BWEA 4PG6A 3O3LA 4RNHA 2EW9A 4A8KA 1JJ4A 4QOTA 3T5LA 1YJ9S 2XMTA 3QGGA 4IOCQ 1XN9A 5E5NA 1J5OA 4IYQA 4ZPAA 4OHWA 2V8HA 2KXNB 4OHXA 3DU6A 3MEDA 3CJKA 3I0SA 1QSSA 3HI9A 3TVZA 4MYUA 2KKHA 4Q43A 1FD8A 3JSRA 4A4JA 1HNXF 2KJVA 3SFGA 2VFSA 3ISZA 3R5AA 4CO5A 1CLFA 1N52B 2W9CA 3IXQA 4M8LA 2GQCA 1X4HA 2FC8A 5L1IA 1FCAA 4OZ0A 4MFBA 1QSYA 2OJ3A 4DSLA 1VK8A 1XR6A 1Q7YT 2VG5A 4DG1A 2XI3A 2HHSA 3TARA 3O44A 3N6LA 5J2MB 2MZRA 1WELA 5CYMA 2DNOA 4OLOA 2NLWA 4MIBA 4RWWA 2C2EA 2XLKA 5CD4H 3BGLA 4ED5A 3OW2R 1UVKA 4Y34A 3SDEB 5DDPC 4QR2A 1S1TA 3NCQA 2J7WA 1TKZA 2KG1A 3KLHB 4Y2MA 3QAUA 1Q53A 4Y2AA 4NRUA 3KLEA 4NZ6A 5KG4A 3M2UB 3OV7A 2Z2LA 4JI1F 1JLAA 1KHVA 2QMWA 4IDKA 3PX0A 3QZ7A 4NYZA 3M30B 2IM1A 2CPIA 3BGRA 3T5JA 4W90B 2YNGB 3K5NA 3LAKA 2KDOA 1RISA 1KLMA 2KXFA 2R7QA 4XK8C 1KOHA 4X62F 2RD5C 3CJKB 5D3GB 2EFVA 2DH9A 3MECB 3TNVA 2RS2A 3PW2A 4KTQA 2LQBA 4N77A 5IM0B 1AROP 2WOMA 4RW6A 3ZZZA 2WONB 3Q23A 4DL5A 3HM9A 1WWHA 4CTAA 3TA2A 3CPWR 3M30A 3MF5A 3PO5A 3LP0B 2J0XA 5E3RA 3BO2A 4C0OC 4I64A 2J76E 2GFFA 3LP2A 3MMBA 5H9EJ 3TOQA 2K2PA 3AB2B 5DDOC 2L3MA 2Y0SD 4QWAA 2XS5A 2AJFE 5BYQA 1R8CA 3FEZA 1JMTA 3OL7A 2ZH8A 1ZM9A 3CWJA 3HX9A 5IM0A 4I1TA 2LA6A 1KFSA 5DETA 5J2PB 1NH8A 3OTOF 4PKDB 2XNRA 3ZFVA 4K4VA 1APSA 3C2PA 3QGPA 4LF6F 4MKAA 4WYLA 1Q79A 1JLBA 2HGNA 2PA8D 2J9CA 3G71S 2RUGA 4O4GA 1RT5A 2AWZA 3US5A 1D8YA 4ERDA 4I56A 3TYTA 4X4VA 4L3NA 3QJJA 5KT5A 3IS9B 1U49A 1QE1A 2FJEB 3OFEA 1YIJS 1FHTA 5BR8F 3I87A 2C22A 3J7Z5 1UVMA 2JC0A 3DLGB 5EX0A 2OLWA 2ASLA 1Q8IA 5KTQA 4KR0B 4XDCA 4PCQA 4DUZF 4QWDA 3M9MB 4H4OA 4AE5A 2AJQA 1EETA 1ZAVA 5HLFA 5CHCB 2M8DB 1OO0B 4FXVA 4ZDNA 5KT4A 1R8AA 4G1QA 3SCKE 2B6AA 1S1VB 1OIAA 3ITHB 2ZH2A 2XY5A 1S0OA 2RILA 4AL7A 4B9NA 6FD1A 4BDPA 5I42A 1TL3A 3OTCA 4F2RA 1Q82T 2XWYA 2JLEA 4DPOA 5KFMA 3DN9A 5J2NA 1BQNA 5DDQC 3GILA 5C5JA 3H25A 3QJPA 5KFKA 2OP5A 1X4CA 4PWDA 1O51A 1RAJA 4B08A 2XCAA 2MZSA 1MMNA 5B09A 3CEDA 4IRKA 3TX8A 4RBUA 2ZUGA 1TL3B 2CPHA 3MAHA 4ELVA 3MUVP 1HBNB 3HDSA 2JEGA 4PUOA 2KRRA 4YB1P 5F8MA 1VFJA 4ID8A 2HHQA 4OJ3A 4DSKA 3CCVS 2RQMA 3LALA 3OUYA 2AU0A 2MKCA 3ZC4A 3QO9A 2HNDB 1S0NA 3D1QA 5CYQA 2UVRA 1HNIA 1N6QB 1TK0A 2BVZA 3J81Y 3NRBA 4OZLA 3H4BA 2ZHBA 5LMUF 4F50A 2HGLA 1U24A 1GXUA 1TQLA 4ZPVR 1ZM3A 2ZH6A 5LSLA 3G8QA 1Q16B 3MM8B 2GIRA 5B7WA 5LT5A 2QA4G 1NZAA 2DNGA 1X9WA 3E2EA 4PR6A 2CIMA 3CB4A 3M05A 1Y4ZB 1FRKA 2PMHA 3QLHA 5AE1A 3DLKA 3NBPA 2LLZA 3IRWP 1CEZA 2R7UA 1LWCB 2WSFC 3GR1A 5F41A 5GAGU 4ZHRA 2KM8C 1DQ9A 5CA5A 4YR3A 1KNZA 5E7OB 2HVHA 1Z2ZA 3RRGA 2K1RB 4NLSA 2GW8A 4NXMF 4NLYA 4A8WA 3RB0A 1DZ5A 4LJMA 7FD1A 2EG1A 4HKQA 5EWGA 2OFGX 1XEZA 3GYNA 2VPZB 4V19X 4N8NA 1WG4A 4DF4A 4JV0A 1S48A 1S49A 1C1CA 1RKIA 1WTFA 2CQBA 3ISND 4P7VA 5E2QA 4EO8A 4C4WA 4ZVFA 2E7WA 4YB6A 1VS3A 4QPTA 2APOA 4CNZA 4UW2A 3O8WA 5I42B 2E1MC 2WW8A 2VC1A 4O3OA 1E6YA 2B6AB 1NB7A 5I3UB 3KG1A 3OTDA 4CTAB 4B3SF 4WE1B 3DRSB 4X4NA 5A8KB 1LW0B 3G6ES 1KONA 3BN4A 5L1LA 1D8ZA 2VKRA 2OPQB 4EZ6A 3VAGA 3JSMB 1C1BB 2DISA 1SI9A 2EC0A 4PXBA 3K57A 2HQIA 2FJWA 1S77D 4J37A 3M8PB 2YNGA 2Y1IA 3HZGA 4A8MP 1YJTA 1SL1A 1R43A 3OTEA 3F44A 3PEHA 3VZHA 4OX8A 1FXDA 2VPXB 5C42B 2CKWA 3IWLA 2ZH1A 3PVXA 4Q44A 4IO9Q 1JLGB 2DO0A 2JOQA 2XGQA 2YKAA 5HMYA 3FRZA 3R27A 2BM1A 4EEYA 2J9DE 2NPFA 1S9EA 2MYFA 4FN5A 3CTRA 4WTYA 3CD0A 3R5DA 1NH7A 3AQOA 1RT3B 1SV5B 4GO7X 3AAWB 4HVZA 2KU7A 2MZJA 4NWBA 2MB0B 3P3DA 2O3DA 1RK8A 2EBEA 2EFOA 5HMWA 4ILRA 1HA1A 1VGYA 3KG4A 5HBMA 3KK3A 1FDBA 4DQPA 1YQHA 2A1BA 3I6PA 1XTZA 4M5DA 4DLGA 1D3WA 2FLPA 3CDBA 4HT5A 2ZE2B 3H2LA 3LP2B 2Q66A 5LL6d 1SUQB 1T8EA 1FKAF 4JV2A 1JLEA 2F8HA 2O1PA 3UCZP 1T03A 1YJRA 5AXNA 1FEHA 3AHPA 3NGDA 3CCWA 3RBDA 3UQSA 2RB7A 3VCDA 2YWEA 5CXTA 4E98A 1NK9A 4HDHA 2FVSA 4X2BA 3HHLD 4FF4A 1LKZA 4F4YA 4LF9F 3BSCA 2RQCA 2WSEC 1SJ4P 1TZ0A 2N7YA 2QSWA 2KJWA 2ROGA 4CO0A 4PG8A 2B43A 2RSQA 2BQ3A 3QGIA 1HBOA 3ZZ0A 3MMBB 1DQAA 1FXRA 3FEYB 4Q5VA 1VC0A 3MR3A 4ED6A 1L3VA 2V4RA 4RU2A 3M9NB 5F8NA 2CQ0A 4P6QA 5M2UA 4WJBA 1OPIA 4KFBA 5EGYA 5FLXY 4TNOA 3K58A 1VQOS 4KV8B 4LSLB 1QM9A 2FVCA 4ZVHA 1AW0A 1WEXA 2YKMA 2PD1A 2LU1A 3OFFA 4RZRA 2JFDA 1M5PC 4NA3A 2V94A 4KBIA 2DD8S 5KOXA 4UQTA 1VLYA 4YB5A 3NL0A 1VOMA 1BC6A 2XLJA 2YNIB 4KKOB 1R3NA 3J7A1 3I5BA 4B3OB 4YB7A 2MZTA 4IKAA 4LFBF 2BE2A 1RP5A 2VONA 3SXLA 4QPXA 2PN6A 2GCFA 3OJUA 3PHEA 5KG2A 2IA6A 5K5MA 4CH1A 3IR7B 4NL5A 4K4XA 4FYDA 3K0JA 2KI2A 1RT3A 1SV5A 4TQRA 4W92B 4OHZA 1ROFA 3T19A 1X4FA 2BUNA 1AFIA 2P6SA 1FRIA 1KQGB 3IA0A 3KHHA 5SZTA 1IBKF 4OLPA 3MTKA 2KH9A 1S1XB 1RTDA 1T03B 1HYSA 2A2CA 1HBUB 2PDAA 3N6NA 1T02A 3PW7A 3UE2A 2QZ8A 4Q0BB 3D54A 2Z4PA 4PQAA 5IS2A 4MKBA 4DN9A 4OMFG 3HHKA 3C6TA 2DNHA 4F2SA 2V4JA 4QR0A 5JUMA 4RNNA 2X1FA 3JAMY 2VZ9A 3FCHA 3EGWB 2IVFB 4KHPF 2RKIA 4ED8A 4DR5F 3DOLB 4KO0B 2VUGA 2IMOA 3MMJA 1JJ2R 4I7FB 1LW0A 5EWEA 2L41A 2E5JA 1C4CA 3BM7A 3GIMA 3SCIE 2M4MA 2VOPA 3ENVA 4HYKA 1VQ7S 3ULHA 4C3LA 5HROB 1L3SA 2ZM6F 3OHBA 1QSLA 3CMES 1VI7A 2E1RA 4TQSA 3FFIA 1X5TA 3M32B 1RT7A 2GHWA 2KTQA 4N56A 3CJ4A 3SZ2A 3NS5A 2PEHA 2FIUA 5J2QB 2DNMA 2MGZA 2FHJD 4AYBD 2L9WA 1R8HA 4O4GB 3LW5C 3CCES 2WRMA 4KHMA 4LFAF 1CVJA 2YWGA 4OJHA 4K0KF 2LYVA 3EGNA 4C97A 2QA1A 4HTJA 2ZH4A 2IRXA 3PACA 4C3MA 1DBDA 1MWYA 1VIOA 3GFXA 2VKZG 4TU8A 2QRRA 3CCJS 3T1AA 3G6VA 3NKYA 3OPKA 2CQCA 1S9EB 3Q2SC 1PC5A 5DLGA