2OMOA

Putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
NLYFQGHMYVTIVYASVKTDKTEAFKEATRMNHEQSIREPGNMRFDILQSADDPTRFVLYEAYKTRKDAAAHKETAHYLTWRDTVADWMAEPRKGVIYGGLYPTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of putative antibiotic biosynthesis monooxygenase from Nitrosomonas europaea.
rcsb
source organism Nitrosomonas europaea
molecule tags Oxidoreductase
molecule keywords DUF176
total genus 22
structure length 105
sequence length 105
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2omoA01
1TL4A 1X7VA 4HI2A 2VV5A 2HIQA 2N4DA 2GA7A 1YRXA 3BF4A 3FGVA 3K7RA 2FHMA 2FIUA 3DCAA 3WDOA 2ACYA 2EW9A 1SI9A 4HH0A 3QGPA 1W2IA 4OJGA 3FRYA 4Q2LA 1S6UA 2HFNA 2XMKA 2OP5A 4HI1A 1AW0A 4HL9A 1S6OA 4OJHA 1ULRA 1N5QA 3HF5A 4FNHA 2K2PA 3DXSX 2KYZA 1OPZA 2KT3A 3KG1A 3HX9A 2JDJA 2BJEA 1GXTA 2BJDA 3HFKA 3HHLC 4OIXA 5B0FA 2W4DA 2PGCA 5KAKA 2HQIA 5T7LB 3BR8A 2W4PA 5F0WA 3HHLD 1FESA 1QUPA 1FD8A 2AJ1A 1OQ3A 3E8OA 4NPOA 1KVIA 4F67A 3HHLA 2QIFA 1FE0A 2FTRA 4Y2MA 4A48A 1APSA 1X8DA 3LO3A 4Y2KA 2ASYA 4DN9A 2OAUA 2K7JA 2OMOA 1WD6A 1YJVA 1JWWA 1MWYA 3MCSA 2FB0A 4DPOA 1FEEA 2ROGA 5B0CA 1K0VA 5T7LA 2AP6A 1R6YA 1RJJA 3TOQA 2CRLA 4U9RA 1KQKA 2GV1A 1JK9B 2OFHX 2ROPA 2XMWA 2ZDPA 4OJ1A 2RSQA 1TZ0A 1YJTA 2L3MA 5F0UA 2GO8A 1LQ9A 1Q53A 2N7YA 3KKFA 2G9OA 1FVSA 2AW0A 2HLUA 1CC8A 2KT2A 2OKQA 1SQEA 4ZA1A 2ZDOA 2W4CA 5A6WA 4YEAA 2Q3PA 2XMTA 1N5TA 4A46A 3IWLA 3HDSA 3HHLB 1SB6A 1Y3JA 2KKHA 2HLTA 1TUVA 2BBEA 2VH7A 2LQ9A 2QLWA 2PD1A 4FNIA 2ROEA 4DL0C 2RMLA 3GZ7A 2GCFA 2RU9A 2LDIA 2XMUA 1OSDA 2K1RB 5B0DA 1Q8BA 4NL5A 1YG0A 2XMJA 2OD4A 2OD6A 3TRGA 4EFAC 1TL5A 1Y9OA 1CPZA 1Q8LA 1GXUA 2BYCA 2GFFA 2GGPB 1YJRA 4A47A 5B0EA 5B0GA 3LGNA 5A6PA 4OJ3A 2LQBA 3KG0A 4QOTA 5B0AA 1Q4RA 2LXFA 2AJ0A 4Y2IA 2RILA 1P8GA 3CJKB 5IXUA 1P6TA 1CC7A 1Y3KA 1VQYA 2K1RA 2N4CA 2K7KA 4HH1A 1KVJA 4ZOSA 1V3ZA 1IUJA 2IYGA 2XMMA 3BN7A 1FE4A 1Y0HA 5K9FA 3MZIA 2BUNA 2GGPA 3F44A 1FVQA 1AFJA 2IYIA 1X0PA 1U7LA 2QYCA 3LGMA 1YJUA 1OQ6A 1MWZA 1N5VA 3BGUA 3BM7A 1AFIA 4YDXA 4A4JA 3IWXA 5B09A 3VTIA 3KNGA 3T9NA 1N5SA 3CJKA 2IFXA 5B08A 1TR0A 2HFOA 3TNVA 1VQSA 3FMBA 4Q2MA 5B0BA 1URRA 1XBWA 3BDEA 3QMQA 3UDCA 2OFGX 3I9ZA 2QLXA 2XMVA 3BB5A
chains in the Genus database with same CATH superfamily
2AT1B 4XIUA 2CXEA 3MD1A 4WK3A 2PA8D 4PQAA 3FGVA 5KFKA 2IMWP 1X5SA 4FVMA 1X9MA 2GMHA 1SPBP 3SZ2A 2AGOA 2UXDF 4NCGB 2D1CA 1YVFA 4Y00A 2EW9A 2EK6A 3BV8A 3K5NA 1RT7A 1UPPA 4JI4J 1VC5A 3NNAA 4ZP6A 5E7OB 3BDPA 4HL9A 4J9PA 4KJIA 1MSWD 2G13A 1RT3B 3H2UB 5KG6A 1SKWA 1KSPA 2WRMA 5CYQA 5FLXY 2W25A 4ES2A 4DU8A 5K8NA 1XWLA 3BPDA 2KT3A 1QSYA 3A3PB 1ZM9A 2I1RA 4RR5A 1KOHA 1VS3A 5T7LB 4L76A 3EXYA 2YQ0A 1YLXA 2FUG9 4RBUA 2V2QA 4JI7F 3IGVA 4GVBA 2XI3A 1S77D 1F5CA 1VQNS 3MURP 4A8KA 3NCRA 2ZITA 2R2TA 2O66A 2D9PA 4Y2MA 4AYBD 3MM7A 3LO3A 1QUVA 4P2SA 3GSDA 2E7WA 3J80Y 2DRDA 4R0JA 4UW2A 2JLEA 1RWVB 2DNKA 2RHSB 4J90A 2E1RA 3TVYA 3VHQA 3J7Z5 3M9MB 3V81A 1XMOJ 3I6PA 2MYFA 4CLTA 1D9DA 5T7LA 2MLXA 2AF6A 2RAQA 2OHDA 2X3DA 1MU2A 1HWKA 2GO9A 2HQ3A 3IFEA 2HGNA 3TEGA 2SXLA 5CCLA 4O23A 2NR0A 2NXJA 2V8HA 1T9XA 3ILIA 1T94A 3A8KA 4F0KA 3QSIA 5KG0A 4OHYA 3MM7B 2DH9A 4ZPVR 3IM8A 2G9OA 3NCQA 2VA2A 4I2QB 4UOHA 3CCRS 1WF2A 2CPJA 2L9WA 5IS2A 2V50A 3RBDA 1V3SA 4DSJA 2O3DA 4I69A 4BS2A 4LBHA 5DG9A 1F5BA 4MMOA 3PHTA 2VDIA 4Y0FA 2CDQA 2HBRB 3S6EA 2XGPA 1ZH5A 1UFLA 1HD1A 2BE7D 3DHWC 2P5VA 3W66A 3W5XA 2MDAA 2QJ3A 2HVDA 3IBWA 2XC9A 1S6QA 5D8HB 1YDLA 2J8SA 2FJBB 2RMLA 3SSSA 1VQOS 2GQ2A 4ED5A 3AXMA 2PO4A 2FVRA 2B8QA 3GLJA 5ETKA 2OPRB 1BWVA 3OVAA 4IH5A 1YG0A 2KDOA 3IRXA 5J1EB 4NXNF 1TFYA 1TL5A 5EX3A 3DDKA 2FHJD 3LPYA 3KLIA 3OVBA 9ATCB 2AD9A 4BHQA 2W9CA 5LJ5Y 4DR6J 4OJ3A 1JLAA 4EYHB 1JLFA 3DLJA 3HCXA 3NKYA 2DT9A 2JWNA 4B08A 4ZVQB 5HBMA 2DRAA 3D5MA 1M1KT 4USIA 4A8WA 4G3IA 1KTQA 4YR0A 2KXNB 3SCJE 3GJRB 4K5RA 5JUMA 2OELA 1RHUB 2KFZA 2DHSA 4EZ6A 3DGPA 3HSDA 4IO1A 4NXNJ 1IUJA 3UN2A 3M8RA 2D69A 2EFOA 4Y34A 5AXNA 1RT3A 2X1AA 2MY7A 4TVAB 2BVZA 1MG7A 4JP8A 2UUWA 4I6YA 3MR6A 3FBFA 1F6TA 4PPDA 2BE2A 2PT0A 1U7LA 2ILZA 4P6QA 5J1NA 4ZVEA 1QY7A 2V8DA 2AEMA 2YWHA 3DKDA 3EXCX 4ILRA 1FKOA 2ZBIA 5D4LA 3T6BA 1GX5A 5H9EK 2RF2B 2G1HA 2VFVA 2ZE2B 7FD1A 2HK3A 4B3RJ 1R8PA 4UTGA 3FBCA 3U27A 2MQPA 2QYGA 4MK7A 1C4CA 2KXHA 1F5AA 1UEVA 1CJKA 2VKRA 3IS9B 4JI0F 3L7UA 3HULA 4K2XA 4L74A 4YP3A 4AD6A 4EBCA 1U49A 1NBEB 2H4WB 5E3RA 1YBUA 2WVFA 1UFWA 1ZPWX 3DRRB 3CCJS 4RW7A 1NK9A 1IWGA 2RQMA 3H7HB 2L08A 4JUZA 3BSCA 2ZKTA 7FDRA 1GEHA 2R8HA 2B43A 4LSLB 2F4VF 1VLOA 2G0JA 3JXOA 3MEKA 4HI1A 1FEHA 3LALA 3UCZP 5I42A 1SH2A 4QR0A 5KFOA 2J6SA 4NLSA 1N5QA 1Y11A 2ABYA 3D7SB 3M30A 2JOQA 2WTFA 2BJ7A 1ZZNA 1OPZA 5KG7A 2PIIA 1EQMA 1XC9A 2C28A 4B9UA 5DLFA 4HDHA 4RL1A 5DZ7A 4E2FB 3PXGa 3DNCA 3ZNJ1 3M4XA 1X5TA 4UY8T 1SIWB 4K7QA 4TN2A 1ACMB 5ETLA 3DLHA 4H54A 3KHHA 1HYSB 4W92B 3KJVA 1YJ9S 5KFCA 3FFIA 3AH6A 3KTQA 1J5EF 2UXCJ 2F4FA 1HW9A 3PG9A 2L9DA 3EWGA 5ETVA 3VQSA 3EVMA 3KLHB 1RHJB 4UOCA 5KFAA 1MWYA 3NOCA 2JVRA 1YI2S 4L75A 5F8GA 3K2YA 1P27B 1L3VA 2HSEB 4URQU 1IBCB 5HMYA 3GP9A 3OFHA 4O3RA 1FNMA 1VK8A 2AP6A 3TOQA 3H5YA 4K4VA 1IM4A 2FVQA 4J9SA 4RBVA 1JK9B 4DLEA 1N33J 3T3FA 2GMJA 5HL7Q 8ATCB 3VGSA 1JLAB 1X4HA 3HT3A 2Z4PA 1K8AT 4X4UA 2ZZMA 3J81j 3TQ1A 2CQGA 1K47A 2JLFA 3Q8YA 4PRFA 1L3SA 3Q8SB 1JX4A 1S1VB 2L48A 3L95X 4WZQA 2VFRA 4I1TA 1HBOB 3O6QA 3RRGA 1U1NA 2FDNA 4LF9J 3GZ7A 5HP1B 2VBWA 4LSZB 1RTDB 3BSAA 1KFSA 3OFFA 2DNRA 2B51A 2U1AA 5CH7B 2VG6A 1N88A 2UXBF 3ZTRA 2C2KB 1Z2LA 2EKYA 2EFGA 3K8WA 4K4TA 1YJRA 1UFKA 4IFVB 2BMBA 1UETA 3LGNA 4USWA 4U96A 4U8YA 5DS7A 5A8RA 3VQTA 3HVWA 4ANDA 1NKCA 1S10A 4LJMA 1NK5A 3H98A 5HVGA 3DM2B 3HVTB 5G4DA 4M5DB 5GMEA 2ZHBA 2E7XA 2FD2A 3FVYA 4OZLA 4B9MA 2DEIA 1CC7A 3N01A 3ZZUA 4ZP9A 4IRKA 1RTDA 3ILLA 2PN6A 3HM9A 4LSLA 5GAGI 1LK7A 1RT7B 2WVBA 2YKPA 2CVEA 1SQFA 4WTOB 2W24A 2XO6A 2AGQA 2GC8A 4KGXB 5L1IA 4OX9J 2ZD1A 3D6MB 5HATA 2FLNA 3CCUS 1K0TA 1WOSA 4QWDA 4ENOA 5AE1A 3MM5B 1HI0P 4KFBB 3NG8A 1J2VA 4ZLPA 1N5SA 3I0RB 5HJYA 4IOCQ 3V4IB 4WKRA 2HFOA 3QAUA 2O01C 1Z2ZA 1URRA 4M94A 8AT1B 3RW6A 4DR2J 1VC0A 3GSIA 1SH3A 3KMQA 4AL5A 3PY8A 2KN4A 2N7CA 2BE9B 2MQLA 2HGLA 2V9WA 2HFZA 4Y6IA 4JYAF 3G8SA 4QIEA 2LYVA 3MEEA 3D3BJ 3SSQA 1U8WA 2QSFA 1EETB 3ADAC 2UZAA 4NMLA 1S6UA 5IT9U 1HHTP 5DQHA 4ZS6A 3HF5A 2FVSA 3HKZD 1JIHA 1DAXA 1RWMB 1MNEA 1S5ZA 2RD5C 1SJRA 4ZPTR 4JI1J 2JDJA 2W2NP 2K3IA 4F0MA 1ZETA 3QQCD 2UVWA 5I3PA 2C3MA 2HZVA 2HHHF 3R6LB 3SV4A 1O8BA 4IG0B 2VD3A 1PBUA 5F0WA 2F7VA 1WDDA 5KFQA 4LF8F 3Q2TC 2UXBJ 4F4ZA 2IRXA 1WF1A 4FDFA 3OUYA 4ZPAA 1FRXA 2CIMA 1U1OA 3IC1A 2CJAA 1SJFA 2R2SA 3BGFA 1QM9A 3FBBA 5DETA 5H1SV 1R0AA 4CT9A 5F3TA 1HBOA 4JV2A 1P1LA 2LVWA 1R3NA 1VDHA 2A6OA 4M95A 1RLDA 3ENWA 1FFWB 4BC9A 4NCGA 2EC0A 5I4MA 1P1TA 2EK1A 1UA1A 4DSFA 3GPAA 4CCHA 4K4SA 3BO3A 1K0VA 2BKOA 2EXUA 1S99A 3UI3A 2YX7A 2JEFA 4NLWA 1JXLA 2VG5B 3G8QA 3HSZA 1KQKA 2QX0A 3FKBA 5KFEA 4Q5VA 3PX0A 4LF4F 4QYZK 3R2DJ 1TUGB 1FJCA 4KHRA 1JLEB 3H5UA 3VZIA 3SI8A 1CVJA 3IWNC 3DM2A 3HVTA 5HBMB 5HMWA 2G2YA 2KT2A 1FCAA 4ZA1A 2ZDOA 2Q6BA 3JTNA 4OYMA 1TKZA 2XMTA 2DGOA 2KI2A 3DU6A 1HLWA 2X1FA 1S1UA 2DGSA 3BKTA 3HHLB 4CLUA 1J5OA 2HLTA 4LBIA 3X3UA 4DL3A 3D54A 1F9EB 5DM7Q 1ZBTA 4HKQA 2BBEA 2DBBA 4I2PA 2XLJA 3ZZ0A 2XB2D 5E2QA 2VQFF 1XIQA 2VBXA 3R5BA 2JFKA 4MYUA 1B0TA 2JVOA 2DGUA 4ZKAA 4ZJQA 4XPCA 2R7RA 3MOZA 3D67A 5IV3A 1PGZA 2BW7A 3HFZB 1CJVB 3Q8QB 3V6JA 1HMVB 3ENQA 4JI6F 3CIZA 4OHXA 4CP5A 2ZH2A 3QFHA 2C2RA 4I67A 2J8AA 4RNHA 5B0GA 2DK2A 3N9UC 1UZHA 2JEJA 2JSXA 5B0AA 3UDVA 3OL6A 3Q2SC 4LF5J 1WI6A 2G4BA 3DFEA 4EO8A 4HTJA 3ISZA 1O5JA 2M5YA 2OTLS 4QZVB 2UUAF 1NLKL 3FDSA 2BACA 1TKXA 2B7CB 4D3HA 4J9KA 1P6TA 5KFDA 4KQZA 3W8PA 1U0HA 4RUCA 1T3NA 4EI2A 3ISNC 3AHPA 1KVJA 4ZOSA 1TL1A 1PAEX 4P52A 3PIOQ 3M2RA 4MK9A 4DV1F 1FX2A 1RDRA 2KVIA 4W98A 5K9FA 3IR6B 2ATLA 1N48A 2DPIA 5HVFA 1WJ9A 3BSNA 4IH7A 4I68A 1S7HA 1M5OC 2I0XA 1HQ2A 1W7WA 3O44A 4ITSA 2AYEA 5K20B 4BBYA 1UEUA 3IWXA 3D3CJ 2OIHA 2IVMA 1IKYA 4F4KA 2X3GA 2Q6CA 2EBGA 2WOMA 4FKYA 4A8XA 1VQLS 4PAAA 2BR0A 5FJ4A 4GMKA 3JQJA 5KFUA 4C97A 3BDEA 4DV5F 1VFJA 2J6UA 3P49B 4WU3A 5KFTA 3M2RB 2KJVA 3UNGC 3J7AN 1G1XA 4C0OC 2PMHA 4ZVHA 2AV5A 2FYXA 2ACYA 2OMLA 2HZCA 4O0NA 1RT5B 4RZRA 4HHJA 2BZ2A 2V4QA 1W2IA 2BJ9A 4LF1A 3VAMA 3K8VA 3TZWA 3VGVA 2LDYA 5E3PA 5C24B 4Q0BA 2OH2A 3EGVA 1G6BA 4N7TA 1IBKJ 4JV0A 1V5VA 1N6QA 2CNLB 1FWPA 1G3OA 1GX6A 1M1HA 2A3JA 2BJDA 5HMZA 4Q44A 1V3RA 2BKNA 2VB6A 2Y1IA 1N34F 1WEZA 1HHSA 1SJ4P 2HNDA 3KG4A 1Q78A 4W90B 2E5HA 2UUTA 1IBMF 1F9HA 3TVKA 1NKBA 1JJCB 3H5XA 1VRTA 3IG1B 4NPOA 1S97A 3H2VE 4S0MA 4PG4A 1R8AA 4M8LA 3W9JA 1UVNA 3IBCB 3R97A 1S9EB 1WC5A 2BANA 4F4XA 1PJ6A 4DI6A 1SL0A 2OAUA 4J9UE 3MM8A 3W2WA 5IM0B 2VBZA 4JI8J 1TL7A 3O8WA 4DL5A 3X1LB 3ITHA 2CKWA 3BYRA 4CIOA 4EZ9A 1NXIA 3M05A 3OBIA 3U1NA 4RU2A 5E33A 1HNWJ 1RAOA 1AA1B 1PYSB 3MGJA 4ZPDA 4XPEA 2BOPA 1MN7A 1X60A 1FNOA 1R0CB 3M30B 3ZZYA 1SQGA 1NPKA 4UOGA 1ZS6A 1EIYB 4NCAA 4WF9Q 2WHOA 3I96A 3KHGA 2EC2A 1S1XA 1WELA 3J7YU 2VQEJ 2IBKA 3R1LA 2IA6A 5CXTA 2NXCA 2ZFHA 4CWBA 4U7UD 2KZZA 4I6AA 2DNQA 1HWLA 3C8YA 5JXSA 3W2WB 1DTTB 4ICLB 5AT1B 3CCES 2PC6A 2ZM6F 2AJ4A 3GCWP 3OTBA 3CE8A 2HRTA 2VPYB 3ITHB 1VI7A 3VVTA 4CH0S 1T7PA 2XS5A 1HNWF 1Y3JA 4NLYA 4RW6B 3SIPB 2IMOA 3H4BA 4A8MP 1YITS 1T03B 1HD0A 2UVRA 3QGHA 3WC2A 5KFVA 3M9OB 2R2RA 3TA2A 3UN5A 5A8WA 3CXCR 2H48B 1BQNA 1S1WB 2CWXA 2CQ3A 1NJIT 4KHPJ 4ZP8A 2Q79A 5E3QA 2K1RB 4XTTA 4ZCLA 2RUSA 1SL1A 2RDDA 2WVCA 3RU0A 3BS9A 4ZK7M 3FEZA 4LQ9A 1D9AA 2Y3YA 3UO0A 3OHBA 4YUDA 4M5MA 4YY3J 1RA6A 4KGKA 5KFMA 3OLAA 4M1KA 3OVSA 2QMXA 2KU7A 3EVWA 2KRRA 3W60A 2XHWA 4DQIA 2YQ1A 4KO0A 1NSQA 3VVUA 4JI6J 2F8HA 1H0HB 5IT0A 2V94A 5GAGU 1Q4RA 3ZZRA 4OI2A 1S1TB 3FQLA 1VCTA 2LXIA 2DR9A 2M8DB 1BC6A 2FLPA 3MDFA 3MEEB 2GVZA 1XR5A 4IQMA 2XLIA 1T95A 2W7AA 3PVXA 3M9NB 3QIPA 4TY8B 5IZHA 2IYGA 4UOFA 1FE4A 3ZZZA 3MEGA 4FS1A 1X4DA 2QRRA 4O3SA 4Z7CA 1N6QB 3LA0A 6FD1A 4YR2A 3BM7A 2XGQA 4A4JA 2HFVA 2ILYA 3KJNB 5L9NA 3G87A 2E5GA 3BH6B 3AD7C 2HK2A 2IFXA 3ZO7A 1DY3A 1TR0A 3R8YA 4DCJB 5CYMB 1KOOA 1RT4A 3TNVA 1VBKA 2A18A 3WIUA 4PG8A 3QRPA 2ASJA 3MMBB 1REGX 1SCJB 1QAXA 1K1SA 1T9VA 2Q1LA 1S9EA 3C19A 4XAKA 3UDCA 3QIPB 4X4QA 5GAHI 2E44A 3O2IA 4IRDA 3QJLA 1VMBA 4GVLA 1W2BR 1NB7A 2NYHA 2GS8A 3BF4A 3K89A 2UUBF 3UWTA 1VJWA 4KTQA 1D0EA 2BE2B 4H4MA 2C2ZB 1LW2B 1WHWA 1YBTA 2ZZTA 3RB6A 4IR9A 1A9NB 3DOLB 3LOUA 2EKNA 5BR8F 3UCUP 1WI8A 4NWBA 5KT4A 1ELOA 4USJC 3DOMA 2HWIA 1S1XB 3MMBA 1DLOB 2HBQB 2HQGA 1F3FA 3ISND 3LP0B 3M8YA 1NU4A 5J2PA 1IM6A 2Q43A 2WSFC 3TA0A 3KHLA 1RADB 2KFYA 2QL5B 1KVIA 4KH0B 1WG4A 4HTIA 4WP3A 5J1PA 4DV6J 4ECXA 1TK5A 1S1UB 2QIFA 3HHLA 5KFFA 3K5PA 1OYDA 1RK8A 3D1HA 4DBQA 3GIJA 2PEHA 3BKFA 1SC6A 1PBAA 3O3LA 5CYQB 4CO0A 5A8WB 3K5MA 2XZWA 3SMZA 2HYIB 1E6YA 2COLA 1X4BA 3PEJA 5ETPA 1EETA 1IVZA 1CJVA 1VYAA 2GJFA 1R6YA 5CAAA 1T3OA 1K73T 1JKHB 2B4OA 1RE1B 3EGNA 3ZXWA 2QLBB 5KFLA 1VHIA 1HNVA 1NDLA 1TZ0A 4V19X 4HACB 2MZTA 3D28A 4LUBA 3B4MA 3UDEA 3CJQA 4NLDA 3G4SS 2KHDA 1SVDA 4ELUA 4DUYF 4DQRA 2W4CA 4DV5J 2ZHOA 4OX9F 2ASLA 1Q7LB 3CCZA 3OV7A 2A2CA 2Z2MA 2MB0B 4BLGA 1XNRJ 3W3SA 1FD2A 2MHNA 4HT7A 3CW2C 3M6WA 4LR8A 5M2PA 5ETQA 3CCSS 2BM0A 4MT1A 1NK4A 1RAJA 1TUVA 4F50A 1DTQB 2XYPB 3E51A 2OEKA 3NEKA 4FNIA 5K14A 4DR5J 3HXMA 3RTVA 4J37A 2XMUA 1Y5IB 1RI7A 2E7VA 2F65A 3OR1B 3G6XA 2HURA 3ILOA 1UTAA 3CJ0A 3WQPA 3D6FB 4X84A 3WX8A 4DV1J 3NAHA 4ECSA 4CRJA 2AJQA 1WNEA 4IFYA 1IKYB 1M5SA 3EX7B 3HHEA 4NE9C 2NXNA 1U1MA 2HQDA 1RBLA 1RT4B 3R3TA 1SV5B 1HI8A 5B0EA 3MUTP 2XS7A 3CD6S 2HFUA 3NS6A 4EYIB 4NEZA 2CUYA 1B0VA 1GMUA 1KVKA 1VRQC 3I32A 4C0HA 1N36J 3UFCX 1DTQA 5KFXA 1FRLA 4TU9A 1IBLJ 1S6QB 1SC4B 3EUNA 5IXUA 4NZ6A 4FS2A 4PWDB 4DL7A 4PUOA 2O67A 3HHNB 1MLAA 2KJWA 4DV4F 4N8NA 1VQ7S 1J5OB 5SUHA 3D0IE 4TNOA 1ZAVA 3T9ZA 5DGAA 1RAHB 8RUCA 1VRUB 4OZ0A 2UXDJ 4QIGA 2HVEA 1PO6A 4I6WA 2LEPA 4NLQA 3K17A 2GGPA 4RO0A 3VGUA 2BJ1A 2CJXB 4IFVA 2KM8C 2CPXA 4K8RA 1AFJA 1H38A 4I56A 1J27A 2AHOB 2WAQD 3A3OB 3LP0A 1MN9A 2X1GA 2GQQA 1S9GB 2DJWA 3DLKA 3JSRA 2CJYB 2VPXB 2J9DE 2KRBA 2C3YA 4USHA 5CQGA 3D6TB 3HLUA 4M5HA 4CTAB 1NDCA 2LP4A 2X51A 4ZVSB 2CPIA 3GG0A 4NASA 1SKSA 3HSGA 2ZH5A 3OT9A 4DL0C 2F8EX 3PYDA 2EWHA 1X7VA 3DRXA 3TR5A 4NLUA 1FXRA 2B4UA 4OX8A 1BMQB 1F9FA 1YRXA 5F9LA 2VPWB 3PFEA 4F7VA 2HKEA 1U0HB 1E6YB 2ZBQA 3AB2B 1S49A 3CJRA 4MK8A 5KT5A 2AJFE 3PO5A 3AQPA 2E1AA 3Q8VA 1AW0A 4JI3J 4KFBA 1WC0A 4NXMF 4NZ0A 2B4PA 3PV8A 3IR7B 2H5IB 3H0PA 3KK2A 3PYEA 2ZH1A 3V4IA 2V8PA 4PR6A 1DQAA 2I8EA 1FKAF 3PW2A 4CO1A 3HHLC 3MAAA 2HMIB 1YQHA 2RVJA 1RHQB 1SBRA 1MMLA 5CD4A 2PGCA 4O0IA 5KFZA 3N0VA 3CULA 3HP6A 5C42B 4BDPA 3HT0A 3BN4A 3MR2A 5K5MA 1TU0B 3E8OA 3HHLD 4TQRA 2D3OR 3W63A 4OI0A 3UVJB 4ZPCA 1RT1A 2J76E 2CPDA 2DITA 3BBBA 1L3TA 4DCOB 4NEYA 1HNXJ 4PXCA 1NKEA 3CMQA 1T03A 3OJUA 4ZN1A 1WTBA 4MKAA 3ZTOA 2ALZA 3ZFVA 2HAFA 5HVHA 3UD5A 1BQNB 2XZTB 3ZZTA 3BZQA 1RWOB 1KLMB 2FB0A 2FJAB 1Y10A 3PYFA 3JQKA 1Q95G 3EZUA 4DXLA 5B0CA 1KQGB 2OUGA 4FYVB 2VQFJ 5GADU 3GU0A 5KFJA 1K9MT 2HHTA 2OFHX 1OWXA 2MZ1A 3WIVA 3M2VB 4OJ1A 3EPIA 1U2RA 5GMDA 5BYQA 3H59A 1YJTA 3WC0A 1OY9A 3CJ4A 3OTCA 3AJ1A 2R7SA 3EZ5A 2B6AB 1X5PA 4CNZA 4RW4A 1HYSA 3KLHA 2L41A 1U48A 3PJXA 3WBZA 3C46A 2J6TA 2DHXA 3UNYA 4DS5A 2KKHA 1ZPVA 2BANB 3FCWA 3TARA 3Q24A 5IWAF 1NK6A 1SJQA 5IM0A 3LWMA 3MUVP 1QTMA 1U25A 1NH8A 2RU9A 4MIWA 4P7VA 4DX5A 1DZ5A 3QJPA 4P75A 1Q86T 1EHWA 1JLEA 3CEDA 2MKSA 1FF2A 2CZ4A 5CCMA 4DV2J 3W5ZA 1R31A 1JLQA 2XMJA 2B6AA 3PR5B 1Q79A 2GIRA 2RH3A 1WF0A 2ZC3A 3RAMA 4DUZF 1Q8LA 2W01A 3MPWA 3T5HA 1U6FA 2I2YA 2ATCB 5LSRA 1BQXA 3GR0A 1Q81T 1WC4A 1NEEA 2ZNYA 4IRCA 4YN3B 4P71A 1FX4A 3NGKA 4M5NA 1T9TA 1KONA 3ZNUA 4Z2XA 1N32J 2YPYA 1Y3KA 2IA0A 5EDWA 1NSKL 2WCXA 2Y8YA 4LFBF 1GQEA 4DZ6A 1KRPA 3DOLA 2CWKA 1PG5B 2IJNA 2DCLA 3BN7A 2R8IA 2OPSB 4F25A 3KK2B 2V34A 3D1OA 1RCOB 1WKKA 2V4JA 1RAIB 2IYIA 1IR0A 2Z58B 4O3PA 5A8RB 1FXLA 1DLOA 1P9QC 1EZZB 5E3AA 5J2PB 4KGMA 5L8RC 3JSMB 1XNQJ 2KTQA 1WHXA 2E5JA 5GAEI 4M5DA 4ZVTB 4DR3F 4DQQA 1UVKA 1U45A 4IG3B 2ZBCA 3CJKA 4ED6A 1CJUA 2HRYA 2HS3A 2LCWA 2LEAA 3DLBA 3PW0A 3E2EA 4CDIA 1JWWA 2DNHA 1XBWA 2V2VA 4KAIA 1IR1A 4OI6A 2PI4A 2QLXA 3H90A 2HS0A 2QSWA 2V5HG 2E66A 5I3UA 1TL4A 1KC8T 4EBEA 2VV5A 3CJSA 2HIQA 4V1Ak 3PRVA 2DIVA 2GA7A 3ZC4A 2DNNA 2XNRA 3HK2A 4F2RA 2PFDA 3HI9A 4RWXA 4PXEA 2MLYA 5C25A 2HS4A 4HDGA 3NNCA 4DSIA 2R7WA 2MZRA 4MKYA 3A8IA 5LL6d 1RISA 4LRFA 3WHIA 4DZDA 4EO6A 1NJZA 4OZ1A 1R7IA 1ZOTA 2GVDB 4OJHA 2GHVC 4OZNA 3MFIA 5DGBA 3QSYB 2K2PA 2BRKA 1UEKA 2F5GA 3HSJA 3MD3A 1FJEB 4RBTA 4ZN3A 3DLEA 3KG1A 4DR7F 4F3OA 3AFGA 2FJXA 1YJWS 4N8OA 3MM9B 1O0PA 2HNYA 2KG1A 3A12A 1TK0A 4OL8A 2A6MA 3CB4A 1FESA 1YTYA 1K44A 3FCVA 2M7SA 5KFNA 1EB0A 1WC3A 4MH8A 2FJWA 5E41A 4NOHA 5AXKA 4ED1A 2H54B 4ELVA 4RUAA 1DHMA 1NAQA 1S0MA 4MFBB 2BABA 3FQKA 5K14B 5DLGA 5ETSA 2IAJB 2YKOA 3PTWA 4URSA 4N41A 4TLRA 3BJYA 4LSNB 2R3VA 3PKYA 3NS7B 3N6LA 1TK8A 2J9EA 2AMCB 3HZEA 2CRLA 2FJDB 3KLGA 4MKBA 4ZHRA 1RWXB 2LQ5A 5EWEA 3L3CA 3F73A 2V0NA 3HO1A 1QD1A 2AGPA 2YX4A 7AT1B 3AOBA 3LAMA 1U09A 4ETXA 4OI4A 1RAGB 3CJ8A 5C2GA 1YSJA 2VIHA 4OYZA 3GV5B 1RUSA 4UZBA 2DPJA 5EWFA 5M2UA 1B3TA 4ID5B 2V2KA 2R7OA 1OYEA 1S12A 3PNIA 1N5YA 1FDDA 4RW9A 4FKXA 4DFPA 2E5IA 1F60B 3FBEA 4C3MA 2J0SD 2VG5A 4LF7J 4QIWD 3MWBA 4CM2A 2VUGA 5IC6B 4EWTA 2NZCA 2RKIA 3QPIA 3P4UB 3PW4A 1HNZF 4ZVUB 5HMXA 4NLXA 5KG3A 1VLYA 4A8QA 4K0KF 5CZXA 3MM5A 4YDDB 3TRGA 2OD6A 6FDRA 4X64J 2CQPA 3GYGA 3NGUA 1RWPB 3TJAA 4ZLLA 2EPIA 4JV5F 4ID5A 1XK8A 1HNVB 3TZYA 3E3XA 1NNDA 1LWEA 3KK3A 4WK1A 3R1HA 2OPQB 3NBPB 1BUXA 2L9NA 2LXFA 1WSRA 2Q66A 2MJUA 5FD1A 1GAOA 1I3OB 5CYJA 1C2PA 4M5LA 2ASDA 1T9UA 2LLZA 4FN5A 2K1RA 1KEKA 2O1PA 2GHWA 3F41A 2DISA 3T1YJ 2XWXA 4LVNP 1HMVA 2RRBA 5EX0A 4BC7A 4IOBA 1NZ8A 4X2BA 1ITPA 2VHGA 5KFBA 1VK3A 4RUBA 1RT2B 3M8ZA 1H3DA 3DLEB 3CDAA 4F3MA 2DY1A 2Y1LB 3A1YG 3OXFA 2MSSA 4FYWB 2NS1B 1Q0NA 2D3O1 1U4BA 2QMUB 3MM9A 3OTOJ 2YNGB 2AU0A 1RCXB 3US5A 2X1BA 3C66A 3M32B 4QU7A 1TKXB 2P9EA 4X4VA 2C2MB 1FRJA 3B82A 1RT1B 4CLWA 4ZITA 1WWHA 4J9VA 2OFGX 1JLCA 3NXZA 3UR0A 2XYGB 3BB5A 3AOCA 5KFRA 4HI2A 4DQSA 2LQJA 3N6MA 4JV1A 1FK9B 1MW7A 2ACMA 3IA0A 4ZVPB 4CLZA 2ZUAA 4AL6A 4B3TF 3AXKA 4I0WA 3RYLA 2ADCA 2FZGB 2CAJA 4ED4A 2ZVSA 3TZZA 4LFCJ 1YBAA 3NP5A 2DYAA 4UQGA 1VGYA 1FDBA 1YRUA 5A2QU 4QIVA 4NYOA 4TYAA 5JVGQ 1FT8A 3R5DA 3V81B 1H7XA 1QAIA 5D0EA 4ZHRB 1IKVB 4QWAA 2XCPA 1KTVA 2KYZA 4WFZA 5JMNA 1U1KA 2IDEA 1EKSA 1GXTA 1RHKB 4DG1B 2A0FB 2DXDA 2IM1A 1U1RA 2QFIA 5G0RA 4ELTA 1HR0J 1WKLA 2W4PA 4KV8B 4PPZA 4B9SA 2M88A 2AJ1A 3ZZPA 2XY7A 3TUZC 4WJBA 3ET6A 2DVIA 3RR7A 2EG2A 3VGTA 4Q8EA 2E9ZA 4L72B 3EE3A 1RLCL 2CA9A 1X4CA 1X9WA 2G0IA 2ZZNA 2B4VA 3M8QA 4G1QA 3R9LA 3TAPA 1C0UA 1T11A 2NLWA 4TLQA 3UPFA 4RJVA 4QWCA 4Q0BB 3AOAA 2OMOA 2CPYA 1FNXH 4WYLA 2DR7A 1FFSB 4R0EA 3VAFA 3NRBA 2HBZB 3QFWA 1N36F 2Y1JA 1D8YA 4DU7A 4G1PA 2NQPA 5LXYA 1R0BG 1RJJA 1ZAXA 3RB0A 2MSTA 3HZGA 3KWMA 2OTJS 4DR5F 2M9KA 4U9RA 1VRTB 3IG1A 2B7BB 3S01A 1CJTB 9RUBA 1T8EA 2J7UA 3C16B 4U95A 1ZAWA 2RSQA 1WACA 2QL7B 1EJ7L 2A2DA 1UVJA 3R7SB 3FC9A 2GO8A 1HQEB 1PYOB 1WORA 4XDCA 1W26A 2N7YA 2DHAA 2OPQA 1NM2A 3NBPA 5EUHA 3Q0AA 2G2OA 2WVEA 2M52A 3MMCB 4ZCMA 2F9DA 1NK8A 3ZZOA 5J2QB 5HO4A 4M5GA 4NLGA 4PWUA 3HDSA 5HROA 3KYLA 1R27B 3M6UA 3HJVA 4DHVA 3H40A 5MLCV 4GC6A 4O4GB 3THVA 3OD2A 2XM3A 2Z0GA 4KY3A 4OZ5A 2PD1A 2QA1A 3D68A 2WSCC 3GMGA 4GO7X 1DBDA 2HHVA 5F8NA 1KN6A 3HMJG 2IPOB 2GCFA 3W9HA 3H4DA 1KLMA 3K5LA 2I9SA 3VAKA 2I38A 3CD0A 1CBKA 2XQCA 3EDQB 3IBFB 1IQZA 2QA2A 1PSDA 2YNGA 4TU8A 4EFAC 1F1BB 4WYWA 3U02A 3W9IA 3OW2R 3M32A 3MMCA 3TI0A 3L7OA 1DTTA 4ICLA 2YNHA 2YKMB 2QA4G 3P96A 4OI1A 4A47A 2CADA 2QL9B 4OQJA 3VF0B 3JSYA 1NRKA 2GIQA 1H2VZ 3DDNA 3N5BA 2P6TA 2CNKB 1ZTTA 1IXKA 5KT3A 1U1PA 1HR0F 1JJHA 4P10A 4C8MA 4ER8A 2ZWOA 2R7QA 5LMUF 4DQPA 1LWCA 4PZVA 2CQ2A 2IC3A 1D8ZA 3SDEB 4C8YA 1V3ZA 3CWJA 3KJFB 3M8PB 5C24A 1HWIA 1Y0HA 2FPHX 1FRIA 2Z2YB 3NCPA 3ZTPA 5DG8A 3KMSA 3SCKE 2FHOB 4ZVGA 4DCPB 5F9NA 2X7IA 2VICA 5C2CA 4Y3CA 4KHMA 4K2JA 4YB5A 5IQQA 3SQGB 3Q89A 1OQ6A 3KDNA 5G0RB 5SZTA 2HGMA 3D4JA 3L7PA 1SH0A 1S1TA 1NUEA 3T9NA 3FSIA 4DV0J 2UU9J 1SIZA 5IV4A 2FLOA 3C2PA 3SCLE 4DJBA 3P5TL 3AB4B 4KGZB 3T5LA 1ZM4A 5JJBA 2XS2A 3HHDA 1ZTWA 2C2OB 2ZBRA 2RU3A 4QW9A 4EBDA 5AXLA 4AQYF 3W65A 3PYGA 1EKRA 2FIUA 1KQFB 4IDKA 2YWEA 2BQRA 4J9NA 4Q2LA 4LIWA 1ROFA 2IRYA 3MF5A 3KLGB 4FNHA 1WOOA 3GQCA 4DPUA 1CS4A 3JAMU 1D9FA 2UUAJ 4UZCA 2V4JB 2HHUA 3IS9A 3HX9A 4JI7J 2HHWA 3BEGB 2M0GB 5B0FA 5KFWA 2MZQA 5DDOC 1LEOA 2ALYB 4O4RA 4OV6A 2XYHB 3EM1A 3EVOA 1KLNA 4RKUC 2DGXA 4FVCA 1FD8A 1Z1ZA 4QR1A 1RYSA 2VC1A 5C5JA 1UJ6A 4JI2J 1TAQA 3GB0A 1VOMA 4AE5A 4MIAA 5I3UB 4ED2A 1Y00A 3S8SA 5LMNJ 5H9EJ 5HSPA 4DR6F 3A8JA 1WG5A 4TU7A 4KIAA 3BQ1A 1RP5A 3PFOA 5L9XA 2DH7A 2MXYA 2CG4A 2FY8A 3J7ZT 4LRAA 3MAAB 2HMIA 2E1PA 2Z30B 3CJ5A 2HBYB 3T41A 5A8KB 3QAEA 4PXBA 1X31C 5T41A 4FPRA 1T05A 1FRKA 3G71S 3HVAA 3VWSA 4M5KA 1TL3B 4RW8A 2IM2A 4OLOA 3CC2S 1XR7A 4ZVOB 4Y65A 3N28A 3FMWA 2IHR1 1V6HA 2B5JB 4P2XA 1TAUA 1BHNA 2IVFB 3P45B 3BH7B 2RS8A 2HAIA 4AFFA 3GIRA 3KKFA 2YH1A 1FVSA 3CNQP 4PABA 2OKQA 1C1BA 3HD1A 2RNEA 4L3NA 4MTPA 1IJFB 4I4BA 1SXLA 4U8VA 3TJ9A 4WP9A 4WWSA 3W61A 4DR3J 1T05B 1FWKA 1U8SA 2XWYA 3MPDA 1QDUB 2XSJA 2GJIA 2K3KA 4HEA9 4PKDB 4DV7F 4TXSA 3OL8A 1X0FA 3IAS9 2CJKA 3OFEA 2BOAA 2W2OP 3DOKB 3CT9A 4LBPA 1TKDA 4W4MA 4YB1P 1X4EA 3MCOA 1A6LA 2VFUA 3ETOA 4AXJA 2ZH3A 4JI2F 4LVOP 4DFKA 2E9TA 3MMJA 4LRDA 3DRSA 4FZVA 4LIRA 2ERRA 4LFBJ 4FXWA 4UUWA 4DR4F 2HHSA 4E98A 2V4RA 2P6SA 1S72S 2OGUA 4G1IA 5ETOA 4DWIA 5CHCB 1KHWA 1X4AA 2M2BA 3LANA 3PZPA 1R8BA 1U6BA 1MROB 2M8HA 1RXOB 2ZH4A 2WW4A 3OL9A 4HHUA 3PJ9A 3PHEA 5IQ6A 4QBUA 5BYRA 1RGVA 4ILLA 1X9SA 3QLHB 4F36A 3K58A 3D1QA 3RB3A 2VG6B 2VZ9A 3QATA 2HWTA 3MCNA 2P9GA 3THPA 4KSEB 2VASA 3G8TA 1KKHA 4WIIA 1FJGF 3MZIA 2VOOA 4ZCKA 1B7FA 3DRPA 1LWFB 2HIYA 1GFWB 4QR2A 3DN9A 2AEFA 3K5OA 4N77A 3DOMB 3SSRA 1SUQB 1QJHA 4CLYA 3OTEA 5D4PA 3J7YI 4NRTA 4TQSA 2NZ4A 1CLFA 3TX0A 4YDXA 3UN3A 4RNOA 5AE3A 1A0OB 3CIMA 1YKWA 2APOA 2XEXA 5B08A 1U1QA 1RTZA 3AJDA 1C1CA 1CULA 1ZM3A 2M4MA 1VQSA 2PSZA 4HHHA 4CH7A 2FY1A 3KUHA 4GRSA 4O44B 1B64A 2JJ4D 2XMVA 2KB2A 4UY85 2UUCF 1BE4A 1JLGB 1Z4UA 3T1AA 5HI7A 3GJSB 4MAKA 1LWFA 4HR2A 4WCEQ 3SV3A 2ZD1B 2CQIA 1L3UA 2LXUA 2MZSA 1NZAA 3I4HX 1TV6B 2POKA 4C11B 4WPAA 4OJGA 2DKOB 2FC8A 4J9LA 1M5VC 2HFNA 2OP5A 1Q82T 4CTAA 1S6OA 4KKOB 1JKHA 2V2ZA 4NX9A 1CJUB 2FQQB 3PR4A 2DCUB 2ZH6A 1CJTA 1YZ6A 2QA4S 1LNQA 3R27A 4K50A 1G4CA 3HFKA 3OQ2A 3OPKA 2VOPA 2KFNA 5AJ3J 2DNGA 1PILA 4ECTA 4HVZA 3OHAA 1RTJA 1MU2B 2EEYA 4ZP7A 5D3GB 1NHUA 1XTZA 4JI5F 1HNXF 2UXCF 2J7WA 4XO0A 1N32F 3R5CA 2HRUA 4P7TA 2W2PP 4J9QA 2XSFA 1K1QA 3CO0P 2J0XA 3TA1A 4RNNA 3CDWA 4A48A 4AT1B 1X8DA 2UV8A 1B70B 3P3DA 2K7JA 1GXLA 1S7IA 1FK9A 3I5BA 1HBNA 1NO8A 4OHZA 1KNZA 3F0NA 3MCSA 3TAMB 3QO9A 3SQOP 4N76A 3B6BA 1U6ZA 4O3NA 2DO4A 1L5UA 2DR5A 1LW0A 2DB1A 2GNKA 2OPPA 2ROGA 4NLOA 5C42A 2BW2A 5BR8J 4DR1F 4IFYB 4MIBA 3DRYA 2CQ1A 2CVIA 3SYZA 3DRSB 1S0VA 2YNHB 1S9FA 2BJ3A 5IOLA 3GIIA 2V68A 2DD8S 1IKXA 1H98A 2J0QD 4B3TJ 2IVYA 1G2EA 1N52B 4DG1A 4YOEA 4OZ2A 1I5OB 4WE1B 1W25A 1VQMS 2GW8A 2IRUA 5IT9Y 1GTEA 1N33F 3NMRA 1KBRA 4MFBA 1SQEA 4Y2AA 5A6WA 5A76A 1OJ4A 3M1VB 3ET6B 1N54B 3JB9k 1LWCB 4B3RF 3BBCA 2YBVA 4ILMA 3M8QB 3TYTA 5IT4A 4U67Q 4EK2A 1C0UB 2VJUA 2VH7A 2B56A 4OHVA 1UJ5A 1CQMA 1RU1A 4CLKA 2CPFA 4U6PA 3M2VA 4PWWA 1PIEA 2ZWPA 3KXDA 5KFYA 4C0BA 2R7XA 2MPUA 4K4XA 1Q8BA 3TUJC 2AKWB 4EGLA 4WKYA 4IOAQ 1M5PC 1I94F 1IBKF 3KJQB 4ZDNA 4DFMA 5L1LA 1PYTA 2VDHA 3V6HA 4DR4J 4O3OA 3E01B 4ETZA 1RYRA 2CFXA 3C16A 2J9CA 2KL8A 1XMQJ 1AXQA 1Q1KA 2Y1RI 5MAOA 4J5OA 5THWA 2YKAA 4C98A 2RDJA 2NPIA 2R2UA 2JL9A 1WC6A 4L73A 4B3MF 1VQYA 5HROB 5J2NB 3LGHA 4YY3F 5LJ3Y 2DNOA 2YH0A 3BO4A 2XMMA 3NWGA 1RU2A 4Q8FA 1N0UA 2BUNA 2FZKB 3LPEA 5KFGA 2FLLA 1GT8A 3R5JB 2R4FA 4DX8H 4QPXA 3MAHA 3RBEA 3LGMA 2D7SA 1RA7A 4OLPA 1RKJA 1X5OA 4URGA 2E5LJ 4LF7F 1MWZA 4PG7A 4C8KA 3QT7A 3KLEA 1GNKA 4PYDA 5KG5A 3CC4S 3OXGA 1UJ4A 1WEXA 3Q8PB 5EWGA 4WU2A 1WKJA 3M2UA 2AZ3A 4Q2MA 1UWAA 4BWJA 5B0BA 3R2CJ 2V63A 2R7UA 1HA1A 3C6UB 4A8SA 2EI5A 2U2FA 1NK0A 3PM9A 1ZA2B 2AEJA 2VQEF 2CQ0A 1RT2A 4ED0A 4FF4A 3WDOA 4ZVFA 2MKYA 1YIJS 1LK5A 1RHRB 2NUUG 5L1KA 2G1DA 3R5AA 1LW0B 1HQUA 4USTA 2JEGA 4NRUA 3MTJA 3KUEA 4FP9A 1ULRA 2DXFA 2XY5A 1P9YA 4PG5A 3KUGA 3IAM9 3G9CA 3VAIA 5F8LA 2DR8A 2VODA 3BQ0A 2DXEA 3QGGA 1BWEA 1EAYC 4YB6A 3PW7A 2GAHC 2Y9HA 1TVRA 4X65J 2NSCA 1UAWA 1YK9A 3DMJB 4G6VB 3H25A 3W2VB 2BM1A 2I5JB 2UP1A 4NCBA 1OQ3A 1R89A 3M1VA 1C1BB 2CZ9A 1LXJA 2V8VA 4OFZA 3A3NB 1RHMB 3A8EA 3D66A 4ZPBA 1UVLA 1GH8A 1SJ3P 1FE0A 2FTRA 2P8IA 4RPFA 3PX6A 1EP4A 1AZSB 2MQOA 2A10A 4DN9A 3G96A 2RRNA 5K8MA 3LP2A 4RU9A 1YJVA 2QC3A 4KE5A 4R8UA 3AY0A 2F9JA 1PKUA 1XMBA 2KH9A 3RBXA 4X4SA 1FEEA 4FF1A 4FF2A 4DX6A 1VQ5S 1TVRB 3MR5A 2CQHA 3MMAB 1JLQB 4ED3A 1H72C 4KV8A 1S6PB 4OYOA 4F0HA 4LFCF 5J2MA 2GHPA 1CS4B 1HI1A 5FLXU 2ZDPA 4ECYA 2KZMA 1MMDA 1F2HA 5U47A 2IIHA 4CYUB 1LQ9A 4QJVA 3TEHB 4DV3F 2FHKA 4NMXA 2KG0A 3IR5B 4ZMMA 2OJ3A 3TWZA 4YEAA 2Q3PA 4DR1J 1N5TA 1SJ1A 3I87A 1SC1B 2MLZA 4UQTA 3I82A 3VV2B 3B78A 4F3QA 4DF8A 2CQ4A 5GAHU 3PDNA 3TANA 1SL2A 2B8PA 1GMWA 3EJMA 2RB7A 4U7UK 4UF4A 2HQCA 4QIFA 3LUYA 3UD4P 1XEZA 2WONB 4OMFG 2NREA 2E29A 5KFHA 2AIRB 2B3TB 4J9OA 1UW4A 2D41A 5LM7E 3ICLA 4K5SA 2DNLA 3RRHA 2D9OA 4P2FA 3CC7S 2GFFA 1C1CB 1CULB 3GCXP 2F3JA 3CJ2A 2C2NA 2ZKUA 5J2QA 2B5JA 2NSBA 4LRBA 2LQBA 4NA1A 4O44A 4C8LA 4RW6A 3BO2A 2WB4A 4C8OA 2Z57B 1FWLA 2WSEC 4G65A 1VIXA 2GMLA 2XI2A 1JLGA 3W64A 1YJ7A 1RWNB 2YY3A 4KH1B 1P8GA 3CDUA 3I0RA 1UP1A 4JOUA 4J9RA 3RR8A 3OR2B 4Y2CA 3GFZA 2DHGA 2Z2ZA 3Q8UA 5C25B 5KOWA 5B7WA 1U02A 3DLGB 1MMNA 4GO5X 4C11A 4X62F 3NGTA 4K4WA 3QRQA 4HH1A 2WW8A 3CJ3A 4QPTA 1H73A 2DGQA 4JBCA 4KKOA 3BR9A 4DF4A 2GVDA 2YKMA 4OYAA 2W1BA 4DDFA 5CD4H 3MAQA 4JI3F 5M2RA 4KO0B 3QYYA 1YWXA 3CO9A 1B0PA 5D0GA 3BGUA 2EBEA 2NPFA 1JLBA 2ZHAA 1DJ0A 3FZBA 1QSSA 4OX7A 3SBMA 1NDPA 3M8WA 3PCOB 4F26A 1Q8IA 3K57A 4CLFA 2CJBA 4DR2F 4IUFA 4QCLA 2DO0A 1JNRB 5AE2A 1RB0A 2CNOB 3DI6A 1RWWB 1MROA 1JJ4A 3K7RA 3VZHA 3HVRA 4M5JA 1S57A 1S59A 2N3LA 2WZ1A 2NUHA 3DCAA 5LOQA 3NL0A 1HBMB 2IAJA 2H1YA 2YWWA 3BGRA 3GR1A 3GV7B 4OYWA 2EFQA 2C2EA 1URNA 4C8ZA 3MM6A 1FKPA 1JLBB 2XMKA 3N5FA 3G6VA 3VAJA 1IQTA 1M0SA 1S6PA 5K8OA 2F40A 3C14A 1OY6A 3DXSX 1NK7A 5CYMA 3ENVA 1B99A 1DURA 1HFEL 2PA3A 3AD8C 5D4OA 2BJEA 1DQ9A 1QTNB 3CDEA 5E0OA 5ETRA 2EVZA 4A8FA 1TKTA 1HL6A 4QYRA 4KT0C 2HQIA 3DI6B 3O1LA 2N3OA 1TTHB 2BV3A 3W8GA 4QU6A 2BDPA 1QUPA 4WFYA 3MFHA 4IDKB 3CSKA 3RW7A 4EU0A 4P74A 4DV2F 1APSA 2BRLA 3TO8A 3MM6B 2W9BB 3BYPA 2ZH8A 4RW9B 3MXHP 4LFAJ 2ASYA 4ZJLA 2W7OA 2J7KA 1RSCA 1CG2A 3AD9C 2JC0A 1WD6A 2I6WA 3TW0A 4JI1F 1OMSA 2MQ8A 4WTYA 4F2SA 3QT5A 1JNZB 1V9OA 3IM9A 4QQBA 1LXNA 4TKTA 2RRAA 1E6VB 2PEBA 3BKUA 4DN0A 3OJSA 4LF6F 4NXMJ 1VBZA 2HVIA 2BX6A 5EN1A 1M5KC 1KDNA 3FNNA 1U24A 1UA0A 1U2FA 3UCGA 2H4YB 1C4AA 2P2CB 2LEBA 4DL2A 3QZ7A 2ROPA 4Z7YA 2DEJA 5L46A 5GVQA 5HLFA 3LTOA 3MPVA 1PC5A 4G1QB 4LR7A 1DRZA 1XNRF 4HYKA 4LF4J 1BGXT 4WXOA 2IBOA 3UR3C 3UE2A 1CC8A 4WFXA 5L1JA 3CVKA 3V6KA 4DUYJ 2XLKA 2OI2A 3KK1A 1HW8A 4NA2A 4ZPWR 2LQ8A 5D15A 2BKPA 4A46A 4C7QA 5K8PA 4DV3J 1T0TV 4QWEA 3MR3A 4CH1A 3IGNA 2FGOA 1RWKB 2HNZB 3MEDA 1RKIA 1YHQS 2AYMA 2QGFB 4F02A 2IDLA 3N79A 4H4OA 3JYTA 5LMUJ 4GC7A 3DYAA 1NB2A 5KFSA 2H3EB 3TUIC 5LMNF 2A1BA 4WFBQ 2QG9B 5D0RA 4J7CA 5HN0A 1U2CA 2RQKA 1RTIA 3V4MA 1QAJA 2D74B 2RE1A 2CJ9A 5DZ6A 5RUBA 2QMWA 1Y9OA 1CPZA 1AROP 1OSCA 3JTPA 4WXWA 3WZ0A 1F3VA 2MKCA 2H51B 3T5JA 1NJYA 2UVVA 5A6PA 4DPYA 1HKAA 2CNNB 3SEOA 4ECZA 1GMWD 1JLCB 4JB8B 2DR6A 2V69A 1WOPA 4KB7A 2LU1A 2ZJQQ 1M1GA 3QRRA 3FUYA 2AJ0A 3PRDA 1RAEB 1NHVA 3AODA 4Y28C 5BJRA 2K06A 4F04B 4RUHA 6AT1B 2HVZA 2MHEA 3DOKA 2BQUA 3H8YA 2N4CA 2OO4A 4Q45A 1FKPB 2XZDB 4B3OB 1H74A 2AX0A 2LA4A 2JHEA 4WP8A 2V8GA 3G2XA 5AXMA 2QTWA 2O5DA 5CA5A 5KFPA 2MQQA 4A8YA 2ZBPA 1OS5A 3T5KA 1SV5A 1BQMB 2UUCJ 1X0PA 1YRTA 2C3OA 2F63A 4LREA 3VCDA 4EMDA 2F4VJ 1TKTB 1TP7A 2OPRA 4GKJJ 4DL6A 1PJ5A 2V6AA 4DPTA 5KG2A 1HBUA 2CQBA 5A0YB 3CJTA 1T02A 3KLIB 3DHXA 4X4RA 2UUBJ 2Y0SD 4OYXA 4PWDA 3JQMA 4ATNA 5T14A 3QLHA 1JLFB 4AXIA 3M6VA 1AZSA 5DQGA 3BSOA 4FYXB 1VRUA 3FJ2A 2R9LA 4F4WA 2N4DA 4ED8A 1TMMA 1JXVA 2MQNA 1JQGA 3LP2B 2ZH7A 1VQPS 3C3LA 3KLVA 2J5AA 2M3DA 4ZLJA 5HQMA 3GYXB 3FZ2A 1SUQA 3SQGA 4JI8F 4K59A 4O3QA 1KFDA 1UW9A 3QGPA 2RQ4A 3FRYA 5FDLB 2LECA 2C2DA 4B9NA 2HPUA 1HWUA 1KQSR 2PI5A 2CZVC 3G82B 2H65B 4LT6A 4EEYA 4X4OA 3ILJA 3GV8B 3T1HF 1HHQA 4C2MA 2AYBA 4OIXA 2ZVIA 4C48A 4XK8C 1FDAA 5KAKA 4X65F 1FKOB 2P9CA 3CCMS 3CDBA 5ETTA 4DS4A 1IJEB 2IY5B 4DX7A 5GADI 3POTB 4OHWA 4AUKA 5I3QA 1REVA 1HNIB 2VF3A 3MPUB 2OEMA 5IFMA 1ZA1B 1TV6A 1B7YB 1LV5A 3ONQA 2CQDA 2AZ1A 2RDIA 4Y2KA 4IKAA 1HIYA 1U0SA 1NPRA 3G82A 3TUPA 1VJQA 4RW7B 3H20A 4H4OB 1AB8A 1BXNA 1FRMA 1FTCA 3ZTQA 3JYTB 4ECVA 3EICA 2YNIA 4MJKA 1BD6A 3ETMA 2XMAA 2Z8QA 2MY8A 3W1YC 4DPOA 1S0OA 2K8GA 3L4BC 3SFGA 3ZTSA 4F8RA 2AJ2A 1RTJB 3EDRB 2QN6B 3F56A 2KT5A 2R7VA 3RGIA 4YHHJ 3I5CA 4WFNQ 3UVJA 4YS2A 3KHRA 1EX8A 1MWQA 2E1MC 4PEOA 1UWBB 2KHCA 1WUUA 3ENAA 3NOGA 5F0UA 2WVDA 4DEZA 3MOJB 1CQNA 5CZVA 2OLWA 2AW0A 1A7GE 4GKJF 3U1LA 4ZCIA 3GJQB 4ECQA 4DMZA 3S7RA 4E8UA 3DGVA 3QO9B 3DC2A 3DLGA 3FEYB 3KJVB 4P9SA 2W9CB 5F8MA 1SB6A 3EZOA 4LF6J 3SDEA 3WX4A 2HG4A 4OYBA 4B3OA 3M8PA 1H2UX 1RWUA 3PJWA 1VC6A 4YHHF 1TL3A 4RW8B 1TFWA 3C15A 4DOZA 2C3UA 1WSVA 2HQFA 1FA0A 3RG6A 2LDIA 4J9MA 1NMEB 3JSBA 2IJFA 1R8CA 3JTOA 3DXBA 3CPWR 3GFXA 4WE1A 5HAOA 2VBYA 5DDQC 2OD4A 1UCNA 4RW4B 3ULHA 4YFUA 1N0VC 3EMTA 1OO0B 1GXUA 5J2MB 4X62J 3CF5Q 2R8JA 5DO2A 4IR1A 4JV5J 2EFNA 3KG0A 1S48A 3I4PA 4PQUA 2MTLA 2VC0A 1YZ7A 4CZCA 2DNZA 3G6ES 3FSXA 3I0SB 2NYIA 3M8SA 1RAFB 2F8MA 2VPZB 2AYGA 3CCTA 4DLGA 2QEXS 4JI5J 3PKMA 1HBMA 5H9FK 2DNMA 5AJ3F 1CJKB 1IN0A 1LKZA 2DY9A 3GE9A 4OV1A 4XDDA 3CCLS 2YQ3A 1Q16B 2CPHA 2OSQA 4NZ7A 4CLSA 4OZJA 3G86A 1V5IB 2XHCA 1PJ7A 1G7CB 2WBRA 5F41A 3U1MA 2ZJRQ 1HNZJ 1NHKL 1FJ7A 2J0WA 3E01A 5GMKa 4JI4F 1FTRA 1LW2A 2WBMA 3I31A 4CLLA 1VQ8S 1N5VA 3QIDA 2W8LA 2WK4A 4OYIA 3RRKA 2W2QP 5B09A 1H7WA 2G2ZA 3I0SA 3KNGA 5I42B 4F4AA 1YX2A 2HHXA 3CGIA 3POTA 5D0HA 3Q22A 2IM3A 4HLBA 1PAUB 1IR2A 3QZ8A 3HPOA 2RJZA 1RT6B 1JB0C 3MPYA 4YB7A 3GYNA 1RQ0A 3GFHA 4B9VA 4P2MA 2YTCA 3PEHA 1U26A 4RX6A 5F8HA 1S0NA 1VIOA 4UT4A 1Y5LB 2W7PA 2FHMA 4KPYA 4PCQA 1VQ6S 1H2TZ 3KOAA 3OR2A 2BXJA 2HZAA 2LFVA 4GVBB 1PC4A 3W62A 5E5NA 2FJVA 4B9TA 3TQEA 2B9WA 3N6NA 4KPCA 1VQ9S 3AT1B 3IO1A 1N4LA 5C7PA 4B3MJ 2GAGC 2HFSA 1OPIA 1RBOB 2QT7A 3AA8A 1BLUA 1UMJA 4X4PA 4DSKA 1SC3B 2KYXA 3TZXA 3QGIA 4A8OA 2YWFA 3GIKA 3RB4A 4DSLA 4QYZJ 1RT6A 1WDTA 3PRBA 3QBCA 4RWWA 5HLFB 2W4DA 4NI2A 4USUA 3S1TA 2QO3A 2RQCA 4CLPA 1WEYA 1SKRA 3GWCA 1I94J 2JEIA 3KK1B 2MEWA 5HJXA 4K0KJ 2YKNA 2DIUA 3TJ8A 2KXFA 4F67A 2MGZB 4YR3A 1XQIA 3N4WA 5JVHQ 4HACA 3J7A1 3IP0A 4N47A 2LMIA 2E1CA 2YWKA 2XSJB 3CD7A 3CTRA 3R6GB 4X4TA 4I2QA 3UDLA 4KRWA 3RAQA 1ZM2A 5LSLA 4LRCA 4WFAQ 3HHKA 4PYAA 3BGRB 1FHTA 4B02A 2GX8A 1S1VA 3D9BA 2ZNZA 3BPSP 4MKVA 2CPEA 4FXVA 5KFIA 3PX4A 3DMJA 3MR7A 2MKJA 2W8KA 5D3GA 1QVGR 1B4SA 3H42A 4ID8A 4ZVRB 5HP1A 2VFTA 5D77A 1I51B 3I9V9 1M5HA 4FF3A 5DRKA 2L3MA 3OR1A 1R43A 2ZUGA 3CD5A 4DPWA 4B9LA 1Q53A 5DG7A 4IG0A 1N56A 4E0DA 1HBNB 2MKHA 2JNJA 2R42A 3BBFA 4NYZA 3R7NB 3IXQA 1UPMB 3TAMA 2MJNA 1H6KX 2JC1A 2OSRA 4LF2A 2B9YA 2EFVA 1LOUA 4BWMA 3TX8A 1XMOF 4FBTA 2Z2LA 3HFVA 2OPPB 2W9BA 1FI4A 1LFPA 3L9ZA 3MHYA 2HEKA 4L6V3 2LQ9A 2QLWA 1RABB 3FSYA 5L39A 4YMEA 3DRPB 5HQLA 3LWLA 1X4FA 4FYDA 4PUOB 1BQMA 2AX1A 1OY8A 4CT8A 4OYPA 2M70A 2LKZA 3BGOP 2ZC4A 2YNFA 4C6AA 2R7TA 2RS2A 4CYUA 1Q8KA 1N8RT 3BGLA 1IKWB 4FPIA 3TP2A 3EPGA 1QLNA 3NMAA 4X66J 3OXLA 1VQKS 3LW5C 2CPZA 2JZ5A 5DDPC 5L38A 1NJXA 1VISA 2BYCA 2GGPB 4Q7AA 2VONA 3LH2S 2DRBA 1AUSL 2KO1A 1J5EJ 1RAAB 4NLPA 3JS9A 3PO4A 1N5YB 1S9GA 3DLKB 4CQ1A 3GIMA 4ZJOA 3MUMP 1Q5YA 1U47A 1XMQF 3V6DA 2RKIB 4OZ3A 3W5YA 4CO2A 5ADZA 4LF9F 2WONA 4USKA 1NPPA 1UZDA 3KLFB 3AJ2A 5FDLA 3EYZA 1RACB 4DV7J 1KD1T 4NLTA 4X64F 2ZOFA 4I2PB 3NGSA 1X4GA 2DNYA 3MI7X 2CDRB 4M63A 4U7CA 1KP6A 3Q23A 1S76D 1FVQA 4FXDA 1S4EA 5EHHA 1YJUA 5H9FJ 1LWEB 1R6VA 2AWZA 5HK4A 2HVHA 1AFIA 2N82B 2DTJA 3VTIA 1CSJA 3FEXB 2B9EA 2VA3A 3EGWB 2Y8WA 3QT6A 3VAGA 1XJWB 1HNIA 2JX2A 4AL7A 2YKNB 3B8HA 4C3LA 5J2NA 4L3KA 4ANCA 4ZIVA 2E5LF 4JI0J 3A4TA 2BJ8A 4ALZA 3NS5A 4CNYA 3GILA 2D3ZA 2EG1A 1BY9A 3T1HJ 1FJGJ 4GKKF 3VR1A 3PW5A 3FCHA 2IJRA 3T1YF 2E9RX 3R7BB 4QWBA 1SI9A 3FFIB 5KTQA 1JXEA 2V67A 3DLLQ 4LFAF 3K59A 3LP1A 3R5GA 1R8HA 4YQWA 4ED7A 1VR6A 4FBUA 2DGWA 3OTDA 3MTKA 1YGYA 1QAYA 5LT5A 4I7FA 1IKXB 4LMZA 4NLVA 1FFGB 2CYYA 2XO7A 5F3ZA 1D3WA 3THTA 3BR8A 3NGDA 4V19J 1HBUB 5A0YA 2HWHA 5F8IA 1FO1A 2WOMB 3V5RA 2JFDA 3NWRA 1HWJA 4IYQA 2ZOMA 2QLFB 2YXLA 2JRSA 3D0GE 3MECA 1AT1B 2GJ2A 2JLGA 4B3SJ 1T9YA 3LP1B 1NJWA 1NDKA 1UKUA 2Y0BB 2H9ZA 4WZMA 2J9DA 1U1LA 4Q43A 4X66F 5HQ8A 3J81Y 1VQ4S 3B54A 1VHFA 3GONA 3P6YC 2NXEA 3PIPQ 2DHHA 4QW8A 4TY9A 4DFJA 4TYBA 3RZAA 3H5SA 3KFWX 1CEZA 3IRXB 1VBYA 2XNQA 3Q83A 3W2VA 3SXLA 3I55S 2QLJB 4K4YA 1KHVA 2DGTA 3CCWA 4KC5A 3OLBA 2XMWA 4R5PA 3Q86A 4RLEA 4JYAJ 3LAKA 1GTHA 3MECB 4WIQA 3CCQS 1EP4B 2W2MP 2UV8G 4B17A 4C3KA 2HW3A 1TUWA 1T9WA 2HNDB 4P73A 2ZM6J 1UVIA 4CO4A 2XY6A 1Q5VA 5LXRA 1WHVA 3CCVS 4R8UB 4K4UA 3NAIA 3V6DB 1NSPA 1QE1B 2FJEB 3QWPA 4CO3A 1WG1A 3DGPB 3O5TB 1Y4ZB 4CI0B 2MZJA 3P5BP 3MMAA 3KLFA 1SKUB 1AUDA 4DUTA 3KNAA 3MM8B 3EGZA 1TL7B 4DV4J 4H4KA 2IM0A 2XBPA 2PFFB 2YNIB 1DARA 1OSDA 1WTFA 3QJJA 4C8NA 5B0DA 4NL5A 3AQOA 1HQEA 1GK8A 3M6XA 3IRWP 4ERDA 3HKWA 3KLEB 1EQ0A 1D1UA 1XR6A 2RF2A 1HPZB 2RT3A 2VFSA 1RTHA 2YVSA 2DGVA 2OPSA 3ELHA 4ZLNA 3C6TB 1QVFR 1YJNS 4NA3A 2QE5A 3M2UB 1KR4A 4B3SF 1QE1A 2ZEJA 2YPZA 3D2WA 1TELA 4QOTA 3Q8RB 3JSMA 2BEFA 3C6UA 4O4GA 1VBXA 1IBLF 4DR7J 5F8JA 5HANA 4WBFA 1NH7A 1O6XA 1F0XA 4IG3A 3CJKB 2C22A 5ETNA 3DYAB 5IC4B 2QV6A 1N34J 4I64A 3TAQA 1DFDA 4EUVA 3GJTB 1XERA 2K7KA 4DUZJ 1HQUB 2NCKL 1NCLA 3U7JA 3T19A 4N56A 1RTHB 5FIIA 3C6TA 1AYEA 4D3GA 3I56S 5LSOA 3OSPA 1LFWA 1S1WA 2ZOGA 1FRHA 4I7FB 1EARA 4R25A 1FXDA 1HARA 3PACA 1WHYA 4H4KC 2CG8A 5J1EA 5KOXA 3GG1A 2UVUA 2I5JA 4DV0F 1M90T 2UU9F 1KWMA 2FGCA 3IMQJ 3QMQA 2MGZA 2KM8B 4PQUB 2IC3B 3I9ZA 4ANEA 2PDAA 3D0HE 2G0CA 2HNYB 1WC1A 4ECUA 2PE8A 1S4FA 4DSEA 1C0TA 3L09A 3NGRA 4IQXA 3RBZA 3H2LA 4HH0A 3GFYA 4KGVB 2W9AA 2XTJP 3M7VA 1R0AB 1ZYQA 3T6JA 4ECWA 4FYYB 3NNHA 1GMVA 2H5EA 4OX6A 2BQ3A 3CMAS 4DPXA 4R5PB 3VALA 4J91A 4LF5F 4KHPF 1IBMJ 4LSNA 3BREA 3RJMB 4KR0B 1IWAA 3UD3P 5DJBA 4BCAA 3QT8A 1TQLA 2ZE2A 5KG1A 2QZ8A 2PMWA 4DL4A 4X4NA 4DV6F 4UUXA 4ES1A 1RZMA 3J80U 2CQCA 4LF8J 1RBAA 5DDRC 3TVZA 3GTYX 2YX1A 1S79A 5BXIA 2XULA 2MKIA 2H5JB 3B4DA 3DRRA 5D78A 3RAXA 1I1GA 4RNFA 5IWAJ 2HHQA 1TKZB 2VG7A 4ECRA 5D6GA 2VJVA 3NY0A 4H4MB 3NLCA 2ADBA 2R8GA 2RUGA 2YNFB 2RHQB 3SCIE 1IKWA 4P72A 5GAEU 1HPZA 3LQVA 2MKKA 4NYPA 4CM0A 3G6YA 4GKKJ 1UVMA 1OIAA 2GV1A 3V2UC 1REVB 2OEJA 2NXUA 4M5IA 3JAMY 2XCAA 4F4YA 2FZCB 2VL1A 3A13A 4ZIWA 4NI2B 5DQIA 3DU5A 5A2QY 2CJQA 3QWUA 1KS2A 2B9XA 2HLUA 4NLRA 3OL7A 1I6JA 1F2GA 3J81U 1PCAA 2C1EB 2DH8A 5CABA 2VG7B 5KT7A 3OFGA 3IWLA 2FHJA 1E6VA 2R8KA 4USMA 5A8KA 4N5SA 2B0GA 3KK3B 1ICEB 1L3KA 2ZJPQ 4IH6A 2ROEA 4C9DA 3AA9A 2Z56B 4LR9A 2MMYA 3UQSA 5KT2A 4ES3A 2ZH9A 5BYSA 5ITHA 1UWBA 1LWXA 2BA9A 2GVZB 2WB1D 3HD2A 2QFJA 3CMES 2GQCA 1FDNA 1TL1B 4TY8A 4C4WA 4CO5A 5ETMA 2C3PA 3MEGB 3DDIA 2AQ4A 2YWGA 1Y5NB 2HHPA 2JH3A 2KVQE 4Z37A 4PG6A 3W7BA 1NSAA 5KT6A 3VAHA 3HJFA 1UL3A 2EFPA 3K0JA 2GIFA 3FK4A 2HNZA 2VU5A 3FRZA 1ZZFA 3KDOA 3MEDB 3SFUA 4RNMA 3CUNA 4IO9Q 4Y2IA 2RILA 4PXDA 1DQ8A 5DM6Q 3C15B 4K4ZA 2C42A 3BQ2A 1C0TB 1D09B 2GZOA 4HT5A 4KBIA 2HHHJ 4MYTA 5EGYA 2V9KA 4OI3A 2XG8A 1RTIB 1TMJA 1Q7YT 2FVCA 1QSLA 3P8BB 3OSNA 3RUBL 2D3UA 3C14B 2PMZD 4AQYJ 4LQ3A 1FERA 2RIJA 3F44A 2FC9A 2QYCA 3I5AA 4KYZA 5E3CA 1RT5A 1XN9A 2LU2A 2YKQA 5D4NA 5KG4A 2MQMA 3IN5A 2F1FA 2LA6A 2VKZG 2DNPA 1JMTA 3LF0A 3MCMA 3QNWB 3UW1A 1IKVA 4USVA 3FMBA 3OTOF 1O51A 2FVPA 1XNQF 3OUYB 1Y7PA 3AAWB 1JJ2R 3D6HB
chains in the Genus database with same CATH topology
4XIUA 3MD1A 4WK3A 2PA8D 4PQAA 3FGVA 5KFKA 2IMWP 1X5SA 4FVMA 1X9MA 2GMHA 3SZ2A 2AGOA 2UXDF 4NCGB 2D1CA 1YVFA 4Y00A 2EW9A 2EK6A 3K5NA 1RT7A 1VC5A 3NNAA 4ZP6A 5E7OB 3BDPA 4HL9A 4J9PA 4KJIA 1MSWD 2G13A 1RT3B 3H2UB 5KG6A 1SKWA 1KSPA 2WRMA 5CYQA 5FLXY 2W25A 4ES2A 5K8NA 1XWLA 1QSYA 2KT3A 1ZM9A 2I1RA 1KOHA 1VS3A 5T7LB 3EXYA 2FUG9 4RBUA 4JI7F 3IGVA 1S77D 2XI3A 1F5CA 1VQNS 3MURP 4A8KA 3NCRA 2ZITA 2R2TA 2O66A 2D9PA 4Y2MA 4AYBD 3MM7A 3LO3A 1QUVA 4P2SA 3GSDA 2E7WA 3J80Y 4R0JA 4UW2A 2JLEA 3V81A 2DNKA 3J7Z5 3M9MB 2E1RA 3TVYA 1IBKF 1D9DA 3I6PA 2MYFA 5T7LA 2AF6A 1MU2A 1HWKA 2GO9A 2HQ3A 3IFEA 2HGNA 2SXLA 5CCLA 4O23A 2NR0A 2V8HA 1T94A 5KG0A 4OHYA 3MM7B 2DH9A 4ZPVR 2G9OA 3NCQA 2VA2A 4I2QB 3CCRS 1WF2A 2CPJA 2L9WA 5IS2A 3RBDA 4DSJA 1V3SA 2O3DA 4I69A 5DG9A 1F5BA 4MMOA 1HD1A 1ZH5A 4Y0FA 2CDQA 3S6EA 2XGPA 1UFLA 3DHWC 2P5VA 2MDAA 3IBWA 5D8HB 2XC9A 1S6QA 2FJBB 2RMLA 3SSSA 1VQOS 2GQ2A 4ED5A 2PO4A 2FVRA 3OVAA 2OPRB 4IH5A 1YG0A 2KDOA 3IRXA 5J1EB 4NXNF 1TFYA 1TL5A 5EX3A 3DDKA 2FHJD 3LPYA 3KLIA 3OVBA 2AD9A 4BHQA 2W9CA 5LJ5Y 4OJ3A 1JLAA 4EYHB 1JLFA 3DLJA 3NKYA 4B08A 2DT9A 2JWNA 5HBMA 2DRAA 3D5MA 1M1KT 4USIA 4A8WA 4G3IA 1KTQA 4YR0A 2KXNB 3SCJE 4K5RA 5JUMA 2KFZA 2DHSA 4EZ6A 3DGPA 4IO1A 1IUJA 3M8RA 2EFOA 4Y34A 5AXNA 2X1AA 1RT3A 2MY7A 2BVZA 3MR6A 2UUWA 4I6YA 5J1NA 4PPDA 2BE2A 2PT0A 1U7LA 2ILZA 4P6QA 4ZVEA 1QY7A 2V8DA 3EXCX 2YWHA 4ILRA 5D4LA 3T6BA 1FKOA 2ZBIA 1S0NA 1JX4A 1GX5A 2RF2B 2VFVA 2ZE2B 7FD1A 1R8PA 3U27A 2MQPA 4MK7A 1C4CA 2KXHA 1F5AA 1UEVA 2VKRA 3IS9B 4JI0F 4YP3A 3MOJB 4K2XA 4EBCA 1U49A 5E3RA 1UFWA 1ZPWX 3DRRB 3CCJS 4RW7A 1NK9A 2RQMA 4JUZA 2L08A 7FDRA 3BSCA 2ZKTA 2R8HA 2B43A 4LSLB 2F4VF 4M94A 3MEKA 3UCZP 4HI1A 1FEHA 3LALA 5I42A 2J6SA 1SH2A 4QR0A 5KFOA 4NLSA 1N5QA 2ABYA 3M30A 2JOQA 2WTFA 1ZZNA 1OPZA 5KG7A 2PIIA 1XC9A 4B9UA 2C28A 5DLFA 4HDHA 3PXGa 3DNCA 3M4XA 1X5TA 4UY8T 1SIWB 4TN2A 3DLHA 4H54A 3KHHA 1HYSB 4W92B 3KJVA 1YJ9S 5KFCA 3FFIA 3AH6A 3KTQA 1J5EF 1HW9A 2L9DA 3VQSA 3KLHB 4UOCA 5KFAA 1MWYA 2JVRA 1YI2S 5F8GA 3K2YA 1P27B 1L3VA 4URQU 5HMYA 4O3RA 3OFHA 1FNMA 1VK8A 2AP6A 3TOQA 3H5YA 4K4VA 1IM4A 2FVQA 4J9SA 4RBVA 1JK9B 4DLEA 3T3FA 2GMJA 5HL7Q 1JLAB 1X4HA 3HT3A 2Z4PA 1K8AT 4X4UA 2ZZMA 2CQGA 2JLFA 4PRFA 1L3SA 3Q8SB 1S1VB 2L48A 3L95X 4WZQA 2VFRA 4I1TA 1HBOB 3O6QA 3RRGA 1U1NA 2FDNA 3GZ7A 5HP1B 2VBWA 1RTDB 3BSAA 1KFSA 3OFFA 2DNRA 2B51A 2U1AA 5CH7B 2VG6A 1N88A 2UXBF 1Z2LA 2EKYA 2EFGA 3K8WA 4K4TA 1YJRA 4IFVB 4C0OC 1UETA 3LGNA 1NKCA 5DS7A 5A8RA 3VQTA 3HVWA 1S10A 4LJMA 1NK5A 3H98A 3DM2B 3HVTB 5G4DA 4M5DB 2ZHBA 2E7XA 2FD2A 3FVYA 4OZLA 4B9MA 1CC7A 3N01A 3ZZUA 4ZP9A 4IRKA 1RTDA 2PN6A 3HM9A 4LSLA 5GAGI 1LK7A 1RT7B 2YKPA 2CVEA 2W24A 2AGQA 2GC8A 5L1IA 2ZD1A 2FLNA 3CCUS 1K0TA 4QWDA 5AE1A 3MM5B 1HI0P 4KFBB 3NG8A 1J2VA 4ZLPA 1N5SA 3I0RB 4IOCQ 4WKRA 3V4IB 2HFOA 3QAUA 2O01C 1Z2ZA 1URRA 3RW6A 1VC0A 1SH3A 3KMQA 4AL5A 3PY8A 2KN4A 2N7CA 2MQLA 2HGLA 2V9WA 2HFZA 4Y6IA 4JYAF 3G8SA 4QIEA 2LYVA 3MEEA 3SSQA 2QSFA 1EETB 4NMLA 2UZAA 1S6UA 1HHTP 5DQHA 4ZS6A 3HF5A 2FVSA 3HKZD 1JIHA 1DAXA 1MNEA 2RD5C 4ZPTR 1SJRA 2JDJA 1ZETA 2K3IA 2UVWA 5I3PA 2C3MA 2HHHF 3SV4A 1O8BA 4IG0B 2VD3A 5F0WA 2F7VA 5KFQA 3Q2TC 4LF8F 2IRXA 1WF1A 3OUYA 4ZPAA 1FRXA 2CIMA 1U1OA 3IC1A 2CJAA 1SJFA 2R2SA 3BGFA 1QM9A 5DETA 5H1SV 1R0AA 4CT9A 5F3TA 1HBOA 4JV2A 1P1LA 2LVWA 1R3NA 4M95A 3ENWA 4BC9A 4NCGA 2EC0A 5I4MA 1P1TA 2EK1A 1UA1A 4DSFA 4CCHA 4K4SA 3BO3A 1K0VA 1S99A 3UI3A 2YX7A 2JEFA 4NLWA 1JXLA 2VG5B 3G8QA 1KQKA 5KFEA 4Q5VA 3PX0A 4LF4F 1FJCA 4KHRA 1JLEB 3H5UA 3VZIA 3SI8A 1CVJA 3IWNC 3DM2A 3HVTA 5HBMB 5HMWA 2KT2A 1FCAA 4ZA1A 2ZDOA 2Q6BA 3JTNA 1TKZA 2XMTA 2DGOA 2KI2A 3DU6A 2X1FA 1S1UA 2DGSA 3HHLB 1J5OA 2HLTA 3X3UA 4DL3A 3D54A 5DM7Q 1ZBTA 4HKQA 2BBEA 2DBBA 4I2PA 2XLJA 3ZZ0A 2XB2D 5E2QA 2VQFF 2VBXA 3R5BA 2JFKA 4MYUA 1B0TA 2JVOA 2DGUA 4ZKAA 4XPCA 2R7RA 3V81B 3MOZA 1PGZA 3V6JA 3Q8QB 1HMVB 3ENQA 4JI6F 3CIZA 4OHXA 2ZH2A 2C2RA 4I67A 2J8AA 4RNHA 5B0GA 2DK2A 3N9UC 2JEJA 2JSXA 5B0AA 3OL6A 3Q2SC 2G4BA 1WI6A 3DFEA 4EO8A 4HTJA 3ISZA 1O5JA 2M5YA 2OTLS 4QZVB 2UUAF 3FDSA 2BACA 1TKXA 2B7CB 4D3HA 4J9KA 1P6TA 5KFDA 4KQZA 4RUCA 1T3NA 3ISNC 3AHPA 1KVJA 4ZOSA 1TL1A 3PIOQ 3M2RA 4MK9A 4DV1F 1RDRA 2KVIA 5K9FA 2ATLA 1N48A 3IR6B 2DPIA 3BSNA 4IH7A 4I68A 1S7HA 1M5OC 2I0XA 3O44A 4ITSA 2AYEA 4BBYA 1UEUA 3IWXA 2OIHA 2IVMA 1IKYA 4F4KA 2X3GA 2Q6CA 2EBGA 2WOMA 4A8XA 1VQLS 5FJ4A 2BR0A 4GMKA 5KFUA 4C97A 3BDEA 4DV5F 1VFJA 2J6UA 3P49B 4WU3A 5KFTA 3M2RB 2KJVA 3UNGC 1G1XA 2PMHA 4ZVHA 2AV5A 2ACYA 2OMLA 2HZCA 1RT5B 4RZRA 4HHJA 2BZ2A 2V4QA 1W2IA 3VAMA 3K8VA 2LDYA 5E3PA 5C24B 4Q0BA 2OH2A 1G6BA 4JV0A 1N6QA 1G3OA 1GX6A 2A3JA 2BJDA 5HMZA 4Q44A 1V3RA 2VB6A 1N34F 2Y1IA 1WEZA 1HHSA 1SJ4P 2HNDA 3KG4A 1Q78A 4W90B 2E5HA 2UUTA 1IBMF 3TVKA 1NKBA 3H5XA 1VRTA 3IG1B 4NPOA 1S97A 3H2VE 4PG4A 1R8AA 4M8LA 1UVNA 1S9EB 2BANA 4F4XA 1SL0A 2OAUA 3MM8A 3W2WA 5IM0B 2VBZA 3O8WA 4DL5A 3X1LB 3ITHA 2CKWA 4CIOA 4EZ9A 3M05A 3OBIA 3U1NA 4RU2A 5E33A 3MGJA 4ZPDA 4XPEA 2BOPA 1FNOA 3M30B 3ZZYA 4NCAA 4WF9Q 2WHOA 3I96A 3KHGA 1S1XA 1WELA 3J7YU 2IBKA 3R1LA 2IA6A 5CXTA 2ZFHA 2KZZA 4I6AA 2DNQA 1HWLA 3C8YA 5JXSA 3W2WB 1DTTB 4ICLB 3CCES 2PC6A 2ZM6F 2AJ4A 1KQSR 3OTBA 3CE8A 3ITHB 2VPYB 4CH0S 1VI7A 1T7PA 2XS5A 1HNWF 1Y3JA 4NLYA 4RW6B 3H4BA 2IMOA 4A8MP 1YITS 1T03B 1HD0A 2UVRA 3QGHA 3WC2A 5KFVA 3M9OB 2R2RA 3TA2A 5A8WA 3CXCR 1NJIT 1BQNA 1S1WB 4GKKF 2CQ3A 4ZP8A 2Q79A 5E3QA 2K1RB 4ZCLA 1SL1A 3RU0A 3BS9A 4ZK7M 3FEZA 4LQ9A 1D9AA 3OHBA 4YUDA 1RA6A 4KGKA 5KFMA 3OLAA 4M1KA 3OVSA 2QMXA 2KU7A 4DQIA 2KRRA 2XHWA 4KO0A 2F8HA 1H0HB 5IT0A 2V94A 5GAGU 1Q4RA 3ZZRA 4OI2A 1S1TB 3FQLA 2DR9A 2LXIA 2M8DB 1BC6A 2FLPA 3MDFA 3MEEB 1XR5A 4IQMA 2XLIA 1T95A 2W7AA 3PVXA 3M9NB 3QIPA 4TY8B 5IZHA 2IYGA 1FE4A 3ZZZA 3MEGA 4FS1A 1X4DA 2QRRA 4O3SA 1N6QB 6FD1A 4YR2A 3BM7A 2XGQA 4A4JA 2ILYA 5L9NA 2E5GA 2IFXA 1TR0A 5CYMB 1KOOA 1RT4A 3TNVA 2A18A 4PG8A 2ASJA 3MMBB 1QAXA 2Q1LA 1K1SA 3UDCA 4XAKA 1S9EA 3QIPB 4X4QA 5GAHI 2E44A 3O2IA 4IRDA 3QJLA 1VMBA 1W2BR 1NB7A 2UUBF 3BF4A 3UWTA 1VJWA 4KTQA 1D0EA 2BE2B 4H4MA 1A9NB 1LW2B 1WHWA 4IR9A 3DOLB 3LOUA 5BR8F 3UCUP 1WI8A 4NWBA 5KT4A 1ELOA 4USJC 3DOMA 2HWIA 1S1XB 3MMBA 1DLOB 5J2PA 3LP0B 3ISND 1NU4A 2WSFC 2Q43A 3TA0A 3KHLA 2KFYA 1KVIA 1WG4A 4HTIA 5J1PA 4ECXA 1TK5A 1S1UB 2QIFA 3HHLA 5KFFA 3K5PA 1RK8A 3D1HA 4DBQA 3GIJA 2PEHA 1SC6A 3O3LA 5CYQB 4CO0A 5A8WB 3K5MA 2XZWA 3SMZA 2HYIB 1E6YA 2COLA 1X4BA 3PEJA 1EETA 1R6YA 1T3OA 1K73T 1JKHB 2B4OA 3EGNA 5KFLA 1HNVA 1TZ0A 4V19X 2MZTA 3D28A 4LUBA 3B4MA 4NLDA 4ELUA 3G4SS 2KHDA 4DUYF 4DQRA 2W4CA 2ZHOA 4OX9F 2ASLA 1Q7LB 3CCZA 3OV7A 2A2CA 2Z2MA 2MB0B 3W3SA 1FD2A 2MHNA 4HT7A 3M6WA 3CCSS 5M2PA 2BM0A 1NK4A 1RAJA 1TUVA 4F50A 1DTQB 3E51A 4FNIA 5K14A 3HXMA 3RTVA 4J37A 2XMUA 1Y5IB 1RI7A 3G6XA 3OR1B 4C8YA 3CJ0A 4X84A 4ECSA 3NAHA 2AJQA 1WNEA 4IFYA 1IKYB 1M5SA 3EX7B 3HHEA 1U1MA 1RT4B 3R3TA 1SV5B 1HI8A 5B0EA 3MUTP 2XS7A 3CD6S 3NS6A 4EYIB 4C0HA 1B0VA 3I32A 3UFCX 1DTQA 5KFXA 1FRLA 1S6QB 3EUNA 5IXUA 4FS2A 4NZ6A 4PWDB 4DL7A 4PUOA 2O67A 3HHNB 2KJWA 4DV4F 4N8NA 1VQ7S 1J5OB 5SUHA 3D0IE 4TNOA 1ZAVA 3T9ZA 5DGAA 1VRUB 4OZ0A 4QIGA 1PO6A 4I6WA 2LEPA