2OMOA

Putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
NLYFQGHMYVTIVYASVKTDKTEAFKEATRMNHEQSIREPGNMRFDILQSADDPTRFVLYEAYKTRKDAAAHKETAHYLTWRDTVADWMAEPRKGVIYGGLYPTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DUF176
publication title X-ray structure of putative antibiotic biosynthesis monooxygenase from Nitrosomonas europaea.
rcsb
source organism Nitrosomonas europaea
molecule tags Oxidoreductase
total genus 22
structure length 105
sequence length 105
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2omoA01
3TNVA 3LGNA 2HQIA 1Y9OA 1OPZA 1TR0A 3BR8A 5B08A 1XBWA 2FIUA 1YG0A 2N7YA 4HL9A 2K2PA 2N4DA 5B0FA 4NPOA 3FMBA 4FNHA 2LXFA 3QGPA 2XMKA 4YEAA 1LQ9A 5T7LB 3DXSX 2AP6A 4Q2LA 2BJEA 3FGVA 2K7KA 5T7LA 1Y0HA 2ACYA 2BYCA 2RU9A 4OJGA 2OP5A 2OD6A 5B0AA 1SQEA 3KG0A 3KNGA 2LQ9A 2QLXA 2ROPA 1WD6A 2KT2A 1K0VA 3T9NA 1GXTA 3BF4A 2GGPB 2ASYA 3BM7A 3CJKB 5A6WA 4Y2MA 2Q3PA 2EW9A 2GGPA 5B0DA 1AFJA 2OKQA 2W4PA 1AFIA 2QIFA 1FVSA 2CRLA 2K7JA 2AJ1A 1YJRA 2L3MA 1Q4RA 2QYCA 2VV5A 2XMMA 2ZDPA 1CC8A 4HH1A 4OJ3A 3UDCA 1RJJA 2RSQA 2XMUA 3IWXA 3HDSA 4Y2IA 5F0WA 2ZDOA 2IYIA 1MWZA 1Q8LA 5B09A 3E8OA 2GCFA 1TUVA 2AW0A 2IYGA 3I9ZA 1JWWA 4ZOSA 5KAKA 2W4DA 3HHLD 2IFXA 4OJHA 3TOQA 3FRYA 5IXUA 1APSA 1JK9B 1IUJA 2BBEA 1N5VA 1KQKA 1YJTA 1YJUA 1N5QA 1SB6A 2JDJA 2KT3A 1TZ0A 1FE0A 2XMVA 3F44A 1SI9A 4FNIA 2PGCA 3HF5A 1FVQA 4HI2A 1TL5A 2VH7A 3HX9A 2KKHA 2XMJA 3DCAA 3GZ7A 5B0CA 1YRXA 2HLUA 2RILA 1U7LA 1ULRA 3HHLC 4OIXA 4F67A 2KYZA 2HFOA 1FEEA 2ROGA 3WDOA 4Q2MA 4U9RA 1KVJA 5A6PA 2LQBA 4HH0A 3MCSA 1N5TA 1Q53A 3BGUA 4DL0C 2OD4A 1N5SA 4DN9A 2HIQA 2OFHX 3BN7A 3HFKA 1OQ3A 2ROEA 4A47A 2RMLA 1CC7A 5K9FA 1OQ6A 1Q8BA 1R6YA 1OSDA 1Y3KA 1X0PA 2GA7A 1W2IA 3KG1A 1X7VA 1VQYA 3LGMA 3TRGA 2XMTA 4ZA1A 2GO8A 3K7RA 5F0UA 4A48A 1URRA 1S6UA 1MWYA 2G9OA 2BUNA 2OMOA 3BDEA 1YJVA 2W4CA 4HI1A 1P6TA 3LO3A 1FD8A 2QLWA 4OJ1A 1AW0A 4QOTA 1GXUA 1P8GA 2LDIA 4A4JA 2FTRA 3VTIA 2PD1A 3HHLB 5B0GA 2HLTA 2FB0A 3MZIA 3BB5A 2GV1A 3HHLA 1KVIA 2N4CA 1FESA 3QMQA 1V3ZA 1CPZA 2AJ0A 4A46A 2BJDA 1QUPA 2XMWA 1FE4A 2OFGX 5B0EA 4EFAC 4NL5A 2K1RB 3IWLA 5B0BA 1TL4A 2OAUA 3KKFA 1S6OA 2FHMA 2GFFA 1X8DA 4YDXA 4DPOA 1Y3JA 2K1RA 4Y2KA 3CJKA 2HFNA 1VQSA
chains in the Genus database with same CATH superfamily
2EXUA 4RW4B 2N7YA 1HHTP 3GG0A 5KFCA 5T7LB 1J5EJ 3P49B 3WIVA 3PCOB 4I6AA 2MY7A 4M5JA 2D9OA 1GQEA 2ILYA 3VVTA 3PX4A 1RJJA 1SJ1A 4HDHA 2OPRA 3PRVA 1YZ7A 1P27B 4ZHRA 2BM1A 4FN5A 1MMNA 1HWJA 1FJGF 2B4PA 2AEFA 2WW8A 4ZN1A 2E5HA 4IRCA 4LUBA 3UWTA 2HGMA 1HHSA 1HWKA 5A6PA 4B08A 3PEJA 3G82B 3AT1B 1B7FA 4DN9A 3BGFA 2JEFA 4I68A 4OHXA 3T1HJ 1S49A 2BUNA 2GJ2A 2GHWA 1SL1A 4USVA 2JZ5A 4KGZB 2MZRA 4A4JA 3VTIA 2V4JA 1NK8A 1KHVA 4DQQA 1LFWA 5IWAJ 3ET6B 3M9OB 1LWEB 2OPSB 3KKFA 1KQGB 5K14B 1UVNA 2PE8A 3GFZA 4YB5A 1VQOS 1UW4A 3PZPA 1X4CA 4BWJA 3FFIB 1FFWB 5DDOC 1UA1A 2VA3A 3NS6A 3R1HA 3D7SB 1TV6A 3K5PA 2V6AA 1HNXJ 3PXGa 4K4WA 4U6PA 1KTQA 2AJQA 2ZOMA 2GJIA 1RT2B 4UOHA 3O44A 1Q78A 1FKPA 2ZHOA 1DURA 2X7IA 4X64J 1U6BA 4OYXA 2HS0A 2B3TB 1ZM9A 1PILA 2EBGA 4QJVA 1UKUA 3ZO7A 1F9EB 1WG1A 5ETSA 3WDOA 3ETMA 4U8YA 1DHMA 2WONB 3J81U 4P52A 2DJWA 5F8HA 2I5JB 1RCXB 3CE8A 1IKXB 2R7TA 2AKWB 2CQ4A 2P9EA 4NLYA 1P1TA 1KSPA 2QLFB 3IM8A 3O2IA 2FC8A 3M8SA 1EJ7L 1LWCB 1Y9OA 7FD1A 5CQGA 1LW2A 3BKUA 4UW2A 4KHPJ 3B6BA 1YRTA 4DV5F 3C6UB 3B82A 1N0UA 2HFUA 2IM1A 3PX0A 2G13A 5KFWA 2HAIA 4KHMA 3IC1A 1CULA 3V81B 1RABB 3R5DA 1UZDA 3CDAA 4ECQA 4M5DA 5BYRA 3X3UA 1SIZA 1RUSA 1S1XB 2VBWA 1A9NB 1MMDA 1JLEB 4RUHA 3U27A 4NLPA 3NNAA 3G8QA 1K44A 4M5MA 5JXSA 4RU2A 2PMWA 1ULRA 1WEXA 1F60B 4QIEA 3CCUS 1Q53A 2E1PA 5K8PA 3UNGC 2E1MC 2DO0A 3MR5A 2HFZA 3NLCA 3I32A 4O4GB 2V2KA 2YX7A 4PG8A 4OX8A 4O3RA 1RBAA 3IAS9 4GC6A 4KO0A 1QAYA 4JV5J 5F8NA 4ZP8A 3BR8A 4RW6A 3QGPA 2VU5A 5J2PB 1XMOF 1SJ3P 2DXDA 3T3FA 3E2EA 4N7TA 2E5LF 1F3VA 5I3PA 2IM0A 4RUCA 3AD9C 1R43A 4B3SF 4HH1A 3OJSA 3TI0A 1MN7A 3FSXA 2OPRB 1HD1A 3M4XA 2FLPA 1ZTWA 1IBKJ 4DV3J 4DPXA 4DDFA 4CCHA 4H4KA 1WJ9A 3TVYA 3H2LA 2DH8A 4NE9C 3OHAA 4LF5F 3GQCA 3H2UB 1EQ0A 3L4BC 1HWUA 3TW0A 3I5BA 4M1KA 3KG1A 3H25A 2V4JB 1FX2A 3QGHA 3A3PB 1X5OA 5M2PA 5B0EA 1V9OA 1TL4A 3DC2A 1ZS6A 4GMKA 4ATNA 3H59A 2KXHA 2B43A 3FMBA 3EWGA 1S1WA 4USJC 3TVKA 3G6YA 1N5YA 3IA0A 2EWHA 5ETNA 3EZUA 1BWVA 3G4SS 2E5JA 4KRWA 4C2MA 1GTHA 3Q8SB 1IM4A 4DG1A 2W8KA 1UEUA 4C98A 1VK3A 2OKQA 1RT4A 2DIUA 2E5GA 4DCPB 1FVSA 3FBEA 3W9JA 1X4BA 4J7CA 1RXOB 4OYIA 1FKPB 2ZC3A 3M30A 2DY1A 1D0EA 5IM0A 3DLEA 4NCGA 2CJBA 3WC0A 4WWSA 1YRUA 2UXCJ 1N0VC 4CQ1A 3QJPA 4ZVPB 2W8LA 3NGRA 2FD2A 4C3MA 3CCJS 2WVDA 2W9BA 2MY8A 1S99A 1X7VA 3L09A 4DMZA 2I2YA 2LDIA 4ZIVA 2MZSA 1MG7A 4G1IA 1UEVA 3D5MA 4YY3F 3LP0B 2YKAA 1HYSA 4DPOA 5D4OA 2A0FB 1LW2B 3EUNA 3B4DA 2HHHF 1PJ7A 5CHCB 1TKXB 3CJRA 5KFIA 4ZJQA 1DLOB 3GJTB 4TN2A 2D9PA 5KFKA 1VC5A 2GGPA 4F4XA 4OI6A 3OVBA 4M5DB 2HBYB 4DPUA 1HBNA 1SL0A 1FJEB 2MQLA 2XG8A 3MOZA 2W9CA 4LFCJ 1WELA 1U2CA 5KOWA 4OQJA 3TEHB 3HF5A 4OI2A 4PPDA 3SI8A 3D1HA 2MQOA 2HLUA 4PQUA 1B7YB 4D3HA 1PGZA 2HMIA 1U02A 1N5SA 2V2VA 3POTA 3HFKA 1RAEB 3W9HA 3W61A 2DNOA 2KVIA 4XPEA 2MJNA 3D3BJ 3IXQA 3IR5B 1MNEA 2MKYA 1XWLA 2GV1A 4YS2A 3S8SA 2ZH4A 4ETZA 2HFVA 5LM7E 5J2NB 4HT5A 4RW6B 3MAHA 1WKJA 4FP9A 3K5MA 4OZ2A 4HHHA 1UJ5A 2OD6A 1VRUA 5CYQA 2R8IA 2HK3A 3PJXA 4DN0A 4LRAA 4KIAA 4MIWA 1OSCA 2WB1D 4Q8FA 2UXBF 5AT1B 1LXJA 4HTJA 2QLJB 5D4PA 2BRKA 2B7CB 1HQUA 2VBYA 2E7XA 1N33F 1N34J 3I56S 4B3TF 5CXTA 2PA3A 4IRDA 1SJ4P 2W7AA 4PRFA 3UR3C 5M2RA 1WEYA 3KJVA 3DN9A 4LRFA 1FEEA 1S6PA 3A1YG 4TYAA 4CLFA 4X2BA 1L5UA 1Q86T 1Q1KA 3H4DA 2HQDA 3PX6A 4WPAA 2HHSA 1B0TA 2ZZNA 4P6QA 2MQQA 2WVFA 1RAIB 2QFIA 1FD8A 4OI1A 1VMBA 2QX0A 4DSLA 1GNKA 4FBUA 4RBTA 4FXWA 3FRZA 3MAQA 4RLEA 1M5OC 3DOKB 2DEJA 1KLMB 1XBWA 5DG8A 4KGVB 3KDNA 2DKOB 3K17A 4MH8A 4C8YA 1VQ4S 2IAJB 4G1QB 4DG1B 3N6NA 4EI2A 4WFAQ 4M5GA 4AL7A 1CJTB 5LMUJ 1RT4B 4NEZA 1NK0A 5FIIA 3D1QA 3EM1A 1BY9A 1CC8A 3NGKA 4DQSA 1LFPA 5H9EK 3DLEB 4NCGB 4X4TA 2AZ1A 2MQPA 2XGQA 4JP8A 3LWLA 4Y65A 3BYPA 2RILA 3N79A 3G8SA 4IR1A 2XSJA 4K4TA 1TK0A 3BREA 3ZFVA 2I8EA 4PWUA 1RTZA 3LGMA 3MHYA 3QZ8A 4KY3A 2JC1A 3M6UA 5D6GA 5JJBA 1QUPA 3J81Y 1R6VA 1S6OA 4V19J 2CQ3A 2CQ1A 2F65A 3SCJE 1TL1A 4TY9A 1TK5A 1QD1A 1X4GA 5B08A 4K4XA 2ASLA 3DLLQ 1QAJA 4I2PA 3DNCA 4EZ6A 3JSRA 5DG9A 3BO4A 3HK2A 4K4SA 4FBTA 1S1TB 4UF4A 1RAOA 5EWFA 2FHKA 3KHRA 2GGPB 3PHEA 4MK9A 2YH1A 2VDHA 4CLWA 3DMJA 2IDLA 4WKRA 4DJBA 3M6WA 2M70A 1HBNB 1YJNS 4U7UK 3WQPA 3O8WA 2HIYA 4LBHA 5EGYA 1Y11A 3R8YA 1JLBA 5KFYA 2R7QA 2ZJPQ 3V4MA 2KT3A 3AJ1A 5HN0A 5G0RA 3R2DJ 4PQUB 1AT1B 3SSRA 3LF0A 2AIRB 3GIRA 3OTEA 2G0JA 3IBFB 2HMIB 1WSRA 3NBPA 2YNHB 4RR5A 3POTB 1XERA 2DR6A 2UU9F 4WZMA 1WORA 4ZCKA 2RU3A 2V8DA 3P4UB 2HS4A 2R8KA 4F0MA 2DNKA 3JSBA 1NK4A 1JQGA 3PTWA 1Q16B 4IG0A 5GVQA 1M1GA 1B0VA 2CG8A 3TQ1A 2XULA 2R2RA 3D0HE 2HFNA 2PSZA 2AMCB 4X4VA 2ADCA 4DX8H 4OHVA 5C7PA 2GHPA 3QO9A 4HVZA 2OH2A 1RTJA 1VRUB 2KYXA 1IKWA 4YQWA 4J9PA 2VFSA 4EBCA 2A2CA 1RK8A 3W5YA 1DJ0A 1NK5A 1RKIA 4XDCA 3TZXA 2MZJA 1HQUB 3IWXA 3RB0A 2RS8A 3W63A 1S0VA 4OHWA 1IR0A 3D2WA 3TAMA 4RX6A 3Q86A 3KJVB 2JNJA 5GAGU 1NB7A 3I6PA 2AGPA 3KFWX 1NSAA 2CPFA 2QT7A 5A8KA 3B54A 3H5YA 1XNQF 2VC1A 1ELOA 1HR0J 4NLUA 4C7QA 3C15A 2XMTA 3LANA 4PYAA 1RHJB 5F9LA 2ZH8A 6FDRA 2GQ2A 2YWFA 1RACB 2VQFF 2J0SD 1T9TA 1JLCA 2YWWA 3NCPA 3TEGA 5J1NA 4UZBA 3PW5A 4I4BA 3M7VA 4WU3A 3K89A 3VQSA 4EBEA 3RUBL 2C2DA 4NPOA 5K8NA 2YH0A 2ILZA 1VQMS 4NCAA 2V2ZA 4C8OA 1SPBP 1U0HA 4A8WA 1S72S 2J7UA 2QFJA 3GE9A 1ICEB 2LECA 1K73T 2V67A 3V6HA 3LALA 3W7BA 5AXLA 4FYYB 4NLWA 3HHLD 4Y6IA 4EZ9A 1T3OA 3NP5A 4F67A 3OXGA 1N6QA 4Q0BA 4TLRA 3ZZYA 2ZKUA 3M05A 1VOMA 2C3MA 3TA2A 1UVJA 1NJIT 3QT5A 5L38A 3MFIA 2FGCA 3MM7A 2RQ4A 1JXVA 3HHEA 4M8LA 1P6TA 3CEDA 5DLGA 3BGOP 2KL8A 3R5JB 3EGVA 5EWGA 4I69A 3MPWA 4LBPA 3CCES 1SKRA 1QSLA 1TL1B 2D69A 3CMAS 3ILOA 1UPMB 2ZUAA 4I2PB 1REGX 5K8MA 1JLGA 4ECXA 2BJEA 3U1MA 3MM8A 3QSIA 5AJ3J 4JI3J 1TKTA 4H4KC 1N4LA 1BC6A 2KT2A 3JXOA 3CJKB 3ZTSA 2KDOA 2CPHA 3H42A 3FC9A 4A8SA 3M8QA 3MEDA 1K9MT 1FRXA 3GR1A 2P6SA 3T19A 1Q8IA 2MKKA 1JLFB 3PYGA 3ZXWA 2XY7A 3MPYA 3NBPB 1SC3B 3VGUA 3CJ2A 4WFYA 4B02A 3OHBA 3GIIA 4U67Q 3G6ES 2FJEB 2JHEA 5GAGI 4DUZJ 3U1NA 3CD6S 3M2RA 1S1VB 3AXMA 4AQYJ 5HQMA 5KT4A 3NAHA 1R8CA 2LEPA 1FDNA 4DCOB 5DGBA 3DOMB 3VF0B 1D8YA 3D6MB 3QO9B 2Q1LA 4DV1J 1IKWB 3HJVA 3IO1A 2ZBQA 2VOOA 3J7Z5 2YY3A 1YGYA 4JBCA 4DOZA 1NHKL 1QSSA 4E0DA 2RQMA 1QAIA 3FQKA 4L76A 4DF4A 3RG6A 4A8YA 2ZHAA 2R4FA 4FKYA 4EU0A 2KHDA 3A13A 3UCZP 5A8KB 1R8AA 1HI8A 3SCLE 5D77A 4ILLA 3C15B 3AAWB 1AUSL 4TKTA 2KFZA 3RJMB 1PJ5A 3K5LA 2G1HA 2NXEA 4I7FA 2LEBA 2MPUA 1DAXA 3GILA 2XHCA 4L72B 3J80Y 2FHMA 1UZHA 2FZGB 5HMXA 1B0PA 4MYUA 4IFVA 3HVTA 1FRMA 4GKKJ 5IS2A 4DR2J 3CJ4A 1ZPVA 4YB7A 1IXKA 2AGOA 4D3GA 2RDIA 4TY8B 2Y8YA 2HVHA 4KQZA 1UCNA 4ECUA 1E6YA 2RHQB 1UMJA 3ILJA 3S7RA 2FY1A 4K0KF 2DHHA 4OX7A 4JV1A 1S9EA 2JRSA 5EX0A 4X66F 1ZM4A 4L73A 5JVGQ 2GS8A 2IRXA 3QLHA 1RDRA 2YWKA 1RB0A 1WOPA 3BH7B 4YUDA 3C6TA 1VK8A 1Q0NA 3PKMA 3PW4A 2BE2A 1N6QB 4Q0BB 3CDUA 3FCHA 3EXYA 2D3O1 1SV5A 3RTVA 1VJWA 4MK7A 4OI4A 4WXOA 1C0UA 2CNLB 3DDIA 3W60A 3ISZA 2DNRA 3AOCA 3OD2A 5C25A 4NLOA 3R9LA 1FJCA 5CAAA 2XLKA 1JLGB 1VHFA 4LQ9A 1FJ7A 2I0XA 4HEA9 4PXDA 5LXRA 3NGTA 2K7KA 3MM8B 3LWMA 4B9MA 2MKIA 4CM2A 3KNGA 3KYLA 1AZSB 5A76A 2J9DA 4AE5A 1K0VA 3M8QB 3E01A 1RE1B 5KFEA 3BYRA 2RRNA 2L08A 1PC5A 2AJ1A 1Z1ZA 1S1UA 5F0WA 2BMBA 1VRTB 3OFEA 2UUWA 3PYDA 3R6LB 4DPTA 5EHHA 4J9VA 2Z0GA 2KRBA 3K5NA 3T1HF 2UZAA 1U1RA 1NLKL 3TUJC 2VG6A 1KD1T 4BHQA 2VFVA 4M5NA 4ED6A 1A6LA 3ZTRA 4RUAA 3DDKA 5IWAF 2VG7B 3Q8RB 4Z37A 4O3NA 4WK1A 2PD1A 3SIPB 4DU7A 1HIYA 4AFFA 3AXKA 1LK7A 2AJ0A 4DQRA 1FX4A 2I1RA 4DV5J 3CT9A 4LF2A 1HNXF 3L9ZA 2BYCA 4L75A 2FHJA 2RE1A 4ZN3A 2MKJA 4X64F 2J0QD 1UW9A 2R7RA 4RKUC 3U1LA 2UVVA 2QJ3A 2HNYB 1S0MA 2MQNA 1SQGA 3SV3A 2QA2A 8ATCB 2CZ4A 3AQOA 3V6KA 2BBEA 2YX1A 4HI2A 2ATCB 5IOLA 2Y9HA 2B4VA 1RTDA 5H9EJ 3BS9A 1KVKA 3HZEA 2W2MP 3US5A 3NWRA 4EBDA 4QWDA 2GO8A 2BZ2A 1F5AA 3W1YC 4KR0B 3FEZA 4LSLA 2EEYA 1R31A 1V3ZA 4KHPF 3D66A 2M4MA 5DQHA 1S9GA 1RYSA 4CLUA 5KFJA 3ZZTA 4IFVB 5KOXA 3HVTB 1RT5A 3GYNA 2MJUA 3CWJA 4ZPCA 3VGTA 4M63A 3D68A 3CD0A 2FLLA 2DD8S 5JUMA 1RT6A 5HJYA 4J5OA 2XB2D 1WD6A 2H48B 2DRAA 3GONA 2FC9A 3CB4A 1E6YB 5B0DA 3LGNA 4QIGA 4ZVQB 4LF4J 4XO0A 2NR0A 2FVRA 1S9EB 3N6LA 1X9SA 2FY8A 3THTA 1FDAA 3R97A 3QPIA 4B9VA 3VCDA 3QLHB 4AXIA 1RISA 4J9OA 1KTVA 1QDUB 3GFXA 2PGCA 3C6TB 3NNHA 1AXQA 2BE2B 3QJLA 1SV5B 1B70B 4FPRA 4ECRA 1IWGA 1C0UB 3MEKA 4KV8A 3SSSA 3T6BA 5HLFA 1UVMA 2D3OR 3GSIA 5C25B 2JEGA 2F63A 4JV5F 2QYGA 1TMJA 1HNVA 4MFBA 4M5KA 2BJDA 2VUGA 3NGSA 1E6VB 1ZM3A 1B3TA 3DRPA 3HO1A 2GMJA 3MOJB 2IY5B 3FKBA 2QRRA 4K5SA 4E2FB 1KQSR 4KE5A 3MEGA 5HAOA 4UTGA 3ISND 3CCZA 1HD0A 3R2CJ 3EDQB 2FVCA 1UFLA 1IBKF 1AFIA 4DV3F 1S1UB 3MURP 3CCTA 3E8OA 4CNZA 4O3PA 2E5IA 2L9WA 2GAGC 3LAMA 2C2ZB 1NKCA 3B4MA 5KFSA 3FZ2A 2F40A 3JTNA 3ENQA 4R0JA 3DCAA 2C2EA 1KNZA 1U7LA 2GIFA 1GMWD 4JV0A 4KTQA 1D3WA 2VG6B 4ZCLA 3GFHA 2WTFA 3RB6A 2A1BA 4ZPVR 5DO2A 5FJ4A 4W98A 1JMTA 3MMJA 2COLA 2HK2A 2VFRA 3MR3A 5CYJA 1RZMA 3J7ZT 2HAFA 4ZVGA 1S12A 1YTYA 4YY3J 1VQ9S 1FKAF 3HHLA 4TVAB 3TWZA 1VQ5S 3M32A 4XDDA 5KG3A 5KG7A 3AFGA 2M7SA 1JXEA 4ZCIA 4U96A 3IGNA 2LFVA 2R9LA 2IM3A 3L7OA 2HRYA 2W1BA 5KG1A 2H65B 2NS1B 3WBZA 2RUSA 2UXCF 4DSJA 1U25A 1T03A 1OYEA 3KJQB 1QAXA 4FYVB 4DL6A 2AW0A 3BBFA 2P8IA 5L1JA 2BKOA 4F3MA 3T1YJ 2NPFA 4YOEA 4YN3B 1YRXA 3D6FB 3HSDA 2F9DA 2HFOA 2MQ8A 1CQMA 1IBMJ 5SZTA 4J37A 1RTDB 4H4MB 5HVHA 4JI5J 3H2VE 1RT7A 1UL3A 4QCLA 4RW9A 5AE3A 1XEZA 3TRGA 4DPWA 4DR3J 4ED0A 2R7WA 3KHGA 2ZNZA 1HL6A 1S57A 4MKVA 3F56A 3NS5A 1X0FA 1IJFB 1RT5B 5U47A 1AYEA 3UDVA 3C8YA 2DNLA 2ZOFA 3KDOA 4IO9Q 4CLPA 2O5DA 1RT6B 5CH7B 2XS5A 1VQNS 1FWPA 3R1LA 2WBRA 2GVZA 2ZWPA 2Y1JA 1FEHA 4LFCF 1N33J 4LR8A 2DNHA 2YKMB 1Y10A 3AY0A 4DFJA 3HD1A 3H5SA 3KK3B 1WF2A 1H73A 3PFOA 1GX6A 1PAUB 2QC3A 4H4OA 4UY85 3MFHA 3SCKE 1U1QA 1UJ4A 2EG1A 1Q8BA 3KLEB 3K8VA 3QJJA 4KV8B 3IWNC 3LTOA 1RWVB 5AE2A 2AGQA 3I55S 1HNVB 1O51A 4N77A 4F4WA 1RTIA 3R3TA 1L3VA 3DRPB 2DGSA 2NCKL 4DF8A 4I6YA 3L7UA 3OLAA 5EUHA 2FVQA 2DHAA 3MEGB 5J1PA 5CA5A 1EIYB 4ANEA 3PIPQ 1N34F 1MW7A 1NH7A 3Q24A 3MMBA 4LR9A 3NMRA 5A2QU 3MF5A 2XMUA 3CDBA 2EFVA 1YI2S 3UE2A 1GMVA 1QTMA 5CYMA 3SZ2A 2HYIB 5CCLA 4ENOA 4FDFA 1IQTA 5C42B 3EVOA 3MECA 3H5UA 3GCWP 2PT0A 4JV2A 2P6TA 4GO7X 1N56A 4DL0C 5IT9U 4NLXA 2BM0A 1P9QC 4ZVUB 2DNNA 5CCMA 1S79A 1SVDA 2V0NA 4PR6A 1NK9A 2XQCA 3HHLB 1UJ6A 4DU8A 5AE1A 5ETKA 2X1AA 3NRBA 4WK3A 3M6XA 1A0OB 2JWNA 1M90T 2Y3YA 3MM6A 2YKNB 4OJGA 2UUCJ 4F4ZA 2VBXA 2APOA 3VALA 4CI0B 1VR6A 2CZ9A 2CAJA 3NWGA 1ZM2A 1RT3A 5GAEU 1M5SA 2HQCA 2NXNA 3BO3A 3W65A 4EMDA 4JUZA 3BSNA 3JSYA 2LQ8A 4A8XA 2HRTA 4R8UA 3D67A 2J7WA 3CJQA 3GSDA 3W62A 1T3NA 8AT1B 4DQIA 3GG1A 3Q23A 2FYXA 3RU0A 4M5IA 4RNHA 2W2OP 1G4CA 2HWTA 4OYWA 3QIPB 1M5HA 2FB0A 3CDWA 1N8RT 3BKFA 4ZVTB 5DZ6A 7FDRA 3UN3A 2XO6A 5KFNA 2YVSA 3WX4A 3A12A 5CZVA 2DBBA 5ETVA 2B4OA 1MLAA 3QAEA 3PEHA 4NLSA 3QWPA 5DQIA 4ZLLA 2GVZB 2C2MB 4URSA 2KJWA 2FVSA 1NSKL 1U2RA 2YXLA 2QIFA 1VC6A 1WG4A 2KZMA 5EN1A 5BXIA 4WP9A 1Q8LA 3ZZRA 3MMCA 4L74A 1H6KX 3BV8A 4I56A 4DR4J 2N3OA 1EARA 4X4PA 1KQKA 3HZGA 4ZVEA 3K58A 1SI9A 5C2CA 2VPWB 4QPXA 1TL7A 3JSMA 1BQXA 4C0OC 5KFPA 4WFXA 2DGVA 2A2DA 3NCQA 1VIOA 4C8LA 3MCMA 3RBZA 4P75A 3MCOA 1VQPS 4ZIWA 2QTWA 4HI1A 4A8MP 3QT6A 1XJWB 3OL8A 3Q8YA 2OELA 2MLZA 2QGFB 1PIEA 3BR9A 3KXDA 2WVCA 4I2QA 3B8HA 3HFZB 5KG0A 2ZBPA 4K50A 4RO0A 3NAIA 2C3UA 1SH3A 2BQUA 4O0NA 4P73A 4H54A 2OPQA 3MMBB 2Z8QA 4DUYJ 4RW7B 4B9SA 3HXMA 3TJ9A 3BPSP 3GV8B 1WTFA 4MMOA 2L9DA 2M8HA 1FRKA 1Z2ZA 2KXFA 3PFEA 4HKQA 1FRHA 5KFHA 2WRMA 1RU2A 3OTDA 1SB6A 4PEOA 2XYGB 5HP1B 1KR4A 1H0HB 1R8HA 4OV6A 2QMUB 2EFQA 3MGJA 1LWXA 1XR5A 4JI7J 2Z2LA 3OT9A 3TUIC 1RLDA 1QM9A 5A0YB 3HP6A 4C11A 4ZP9A 2FJBB 1BD6A 3I31A 3PW7A 2MYFA 1T02A 3EX7B 3NGUA 2IMWP 3Q2TC 1DARA 4FF1A 3QBCA 1V6HA 3KK2A 3BSAA 1C0TA 1WKKA 5ETOA 2JLEA 5KT7A 3MM6B 2G2YA 5HJXA 1JLAA 4DCJB 2OEJA 2HQFA 3CULA 5KT6A 1S59A 2DHGA 2M2BA 2QL5B 3P96A 2CQDA 4RUBA 4KPCA 2NSBA 2PEHA 4EK2A 1FF2A 3EJMA 4M95A 2FQQB 3A8IA 3G82A 2GMLA 4P74A 3SDEB 3FRYA 4CO1A 1OWXA 2ZWOA 2DHXA 3UI3A 4MT1A 3FBFA 2W9AA 2PO4A 3H5XA 1G7CB 2CPZA 5KFRA 5I42A 4YDDB 3SMZA 5BR8J 1JNZB 1P1LA 2XTJP 1J5OA 1NJWA 1VQYA 4ZPBA 1S5ZA 1RU1A 2QLWA 2WZ1A 2IC3A 1AROP 1H3DA 2R8HA 4MAKA 3O5TB 2XMWA 1SC1B 4LFBJ 5KFBA 4X65F 4HR2A 2BABA 4X4SA 3CD5A 4Y2KA 3W5XA 1NDCA 5AJ3F 4JI3F 1UEKA 2HQIA 2C1EB 1GMWA 3TP2A 5D15A 3S1TA 2GNKA 3QSYB 1NZ8A 4OZ5A 2LQ9A 2NYIA 5HQLA 2BEFA 5ITHA 2MLYA 4UY8T 1JIHA 1F9HA 1S6QA 2XLJA 2NUHA 3MMCB 2R2UA 5HATA 5HVGA 1C1BA 2WONA 4MJKA 2FJXA 4OYPA 2G2ZA 4JI2J 2D3UA 2I5JA 2HZAA 1IKXA 2EG2A 3JSMB 2KKHA 3HHLC 4DUZF 1HNZJ 3VAIA 4A8KA 2KM8B 1X60A 3TVZA 2IVMA 2CQCA 4FYWB 3QZ7A 4AQYF 4EYIB 2C2OB 1H72C 1OSDA 4YP3A 3R7BB 4DSEA 1K0TA 1B99A 2DNPA 1H98A 4O4RA 3R7NB 2B4UA 3C6UA 3IAM9 5F9NA 1SJRA 4TXSA 5FLXU 4DV1F 2EFGA 2HNDB 1XMQJ 2OPPB 4ED8A 2N4DA 2CG4A 3KMSA 4P7TA 2BRLA 3V81A 1U24A 1SKWA 2E1CA 1VIXA 2E44A 4ELVA 4AUKA 3OVSA 1FNXH 2LA4A 3GJRB 2KG1A 4LSNB 1LW0A 1JLEA 2MDAA 4K2XA 4R5PA 3HVAA 3PO4A 1WHYA 1NMEB 2NSCA 2UUAJ 1O0PA 5CABA 2HZVA 3OUYB 3S01A 5F3TA 4KB7A 1F0XA 1H7XA 2DGXA 4ZCMA 1WF1A 3GYXB 2OFHX 3PYFA 3BQ2A 5DDRC 4C11B 2W2NP 4LF6J 4F2RA 2L9NA 2I38A 2WAQD 1KVIA 4CLYA 5J2PA 2B51A 1RWUA 5IT9Y 3KK2B 4GKKF 2XCAA 4DR2F 1C0TB 4CT9A 1DZ5A 2VG5A 2DH9A 4CO2A 2K2PA 1FXLA 5DQGA 1JLAB 4PWDA 1WC6A 3C46A 2XI2A 1FXDA 1ACMB 1TELA 5CZXA 1HPZA 3VQTA 3TANA 2Y8WA 5THWA 5B7WA 4NCBA 4X4RA 3W3SA 1TP7A 3CJ5A 2AHOB 2FGOA 1Y5LB 1XNRJ 2NREA 3IM9A 1WC4A 1QE1A 2BJ8A 1Q79A 2VB6A 4CO4A 5M2UA 2CIMA 5T14A 4F04B 5I42B 4ICLA 2BOPA 4U9RA 3MUMP 1N36J 3MCSA 1RI7A 1J5OB 3DXBA 2RAQA 4Q5VA 4K2JA 1W2IA 3QT7A 2C2NA 2OMOA 2IC3B 3J7A1 4USHA 3N4WA 5E5NA 1ZAVA 4IH7A 4CLSA 1HARA 2HQ3A 2OAUA 1FHTA 1GT8A 2V8PA 3J7AN 3RGIA 1M5PC 3Q8VA 1D9DA 1GEHA 1QLNA 1RADB 4NX9A 4ZPDA 4XPCA 3NMAA 3TJAA 2YKQA 3AA9A 4QYRA 1S6QB 1XR7A 8RUCA 1FRIA 2CWKA 1YSJA 1U0SA 1C1BB 1JWWA 4DZDA 4V1Ak 3CO9A 2QMXA 1YJTA 4QWCA 1FVQA 4B9LA 3GZ7A 2OMLA 1AB8A 1J27A 3CUNA 3OR2A 5H9FK 4HH0A 2CQGA 5J2QA 2E7VA 2M0GB 4CDIA 4GVLA 5KTQA 3TJ8A 2H5EA 3LP0A 4BWMA 1UVKA 3TO8A 1NK6A 4NLTA 4C3KA 4UOGA 1U6ZA 1I3OB 1TKXA 2CPEA 4C3LA 1MWQA 1DLOA 1VQ6S 3HSZA 2CJYB 2CPIA 4DI6A 4DL7A 1ZAXA 2CJQA 1C1CB 3HLUA 1MU2B 3NNCA 3JTPA 5E3QA 1LW0B 3K2YA 1PKUA 4R5PB 1WOSA 1L3UA 1GXTA 2B5JA 1KFSA 1T8EA 3RW6A 1EQMA 5D0RA 1OO0B 1WEZA 3ADAC 4M94A 1SQFA 5FDLA 3EPIA 4NXNF 4NASA 3GIKA 3EDRB 4OYOA 3V2UC 3FEYB 5B0CA 4DPYA 2DR8A 5BYQA 3KLVA 1EP4A 3KG4A 5D4NA 4ID5B 3D0IE 3M8PA 3ZC4A 5LL6d 3IR6B 2B9EA 1W7WA 4K4UA 1RWPB 3R5BA 3FSIA 5J2NA 4DV0J 3LH2S 2F4VJ 5LSRA 4OJ1A 2D1CA 3SFGA 4DFKA 3MEEA 1YBUA 2ZJQQ 4DR1J 2M9KA 4UT4A 3RW7A 2MZTA 4JI1J 4E98A 2VG5B 1PC4A 2OIHA 2UUBJ 2V9WA 1I94J 1WNEA 4PWDB 2ALYB 4FNHA 4DZ6A 1JJCB 4ECTA 4EEYA 2GX8A 4PPZA 3RB3A 3OSNA 3ZZZA 1HPZB 3KUHA 4LF4F 4IYQA 2OEMA 2C2RA 3T9NA 3OL9A 3T1AA 4Y00A 1R27B 3I82A 3HHNB 2FLNA 5ETQA 2XMMA 4NA2A 2GVDA 2KM8C 2N3LA 2QO3A 4MKBA 3FBBA 1QE1B 4PABA 1Y00A 4F3QA 1NJZA 5BYSA 1TFWA 4ECYA 4RNFA 4ICLB 4TU9A 2CPXA 4G1PA 1X5SA 1ROFA 2VJVA 3A3NB 1OQ3A 2ROEA 2DRBA 4B3RJ 5L46A 3DOKA 3OV7A 1KLMA 2Q43A 4QYZK 3M9NB 1QSYA 5B0GA 1WG5A 1UTAA 5KT3A 4DV4J 3CC4S 4WIQA 3L95X 2IAJA 4P9SA 4G1QA 3BO2A 1CJTA 4IUFA 4LIRA 4J9NA 4KHRA 2FZCB 1UVLA 3IRXA 5DJBA 2MQMA 3T5JA 1D9AA 1ZPWX 2UV8A 3OLBA 3TARA 5DDQC 4A8FA 4YR3A 2KB2A 3VGVA 1QVGR 4WE1A 1YJRA 4WIIA 2DIVA 1WSVA 3O3LA 3DI6A 3MD1A 4JI4J 3BZQA 3LOUA 2Y1RI 2DCUB 4HHUA 4Q45A 1KLNA 2B9WA 3OR2B 4OIXA 1QY7A 4G65A 5J2QB 2GZOA 3C3LA 3A4TA 1U6FA 3ZTQA 3PO5A 3DFEA 3OL6A 3KLGA 2KFNA 3R7SB 2PEBA 3VAFA 4N5SA 5IC4B 2A6MA 5F3ZA 5L1LA 3OVAA 4NEYA 3QMQA 1S1TA 5J2MB 2O67A 1TKZA 2FUG9 4WKYA 2MKHA 4BS2A 3W66A 5K20B 4FS2A 2BV3A 3HKZD 3CVKA 5KFGA 4F4YA 4WBFA 5DLFA 1LEOA 2B5JB 2HWIA 5FLXY 3LP2A 2PFFB 3SQOP 3I87A 5ETTA 2CRLA 3ISNC 5HROB 1EETA 3HDSA 3T1YF 5DM7Q 4KKOA 4Y0FA 1GK8A 4V19X 5FDLB 2YNHA 2Q6CA 3B78A 2NZ4A 2BXJA 1YDLA 1IBMF 2RH3A 2YNIB 4JI5F 3Q8PB 2MXYA 4XIUA 1EP4B 2WCXA 4DR3F 3M8PB 1SH2A 3C14A 2N82B 2Z2YB 2A3JA 1TVRA 1VI7A 3I0SA 2RD5C 4CRJA 4ECWA 1S77D 3DRYA 2KVQE 2Z2ZA 5ETPA 3K59A 3MEEB 3CCQS 1FESA 2VIHA 2J9DE 9ATCB 2R7VA 4YMEA 5I3UA 1NKBA 2NLWA 2E1RA 3ELHA 1FRLA 1OIAA 1V3RA 3DU5A 3VR1A 3IG1A 2RJZA 1T9UA 5HQ8A 1BMQB 4ECZA 1T0TV 1DTQA 2GVDB 4Q44A 1DRZA 3PRBA 4GVBB 1W2BR 3NG8A 1L3SA 1RHQB 3ZNJ1 3J80U 6FD1A 2AZ3A 4FNIA 2WSEC 4ZJLA 2IHR1 2CZVC 3I4PA 3D4JA 1BWEA 2HHUA 3NKYA 4ZLJA 2OD4A 4RW8B 4QW9A 1CC7A 3HHKA 1FD2A 3PKYA 4DR5F 5KG5A 1IKYA 5DM6Q 1N88A 3P5TL 2IA6A 3PHTA 2ABYA 2B0GA 1NPRA 4USKA 4ERDA 2IBOA 2VQEJ 4K4VA 2HHTA 5AXKA 3AH6A 3IRXB 1T94A 1G1XA 1UPPA 3W2VA 2K3KA 3OTCA 3T9ZA 4P10A 1WC3A 2KTQA 2MTLA 3MPVA 4P7VA 1N48A 3DGVA 1RHKB 3EGZA 3M2UA 4WE1B 2W4PA 5KFUA 2L3MA 3FCVA 3FK4A 2HNZA 2DITA 4GKJJ 3N0VA 3KHLA 4LF7J 3DI6B 1TTHB 3F41A 1L3TA 2ACMA 2MSSA 1RAFB 2GIRA 5LMNJ 2RDDA 1VGYA 2V50A 1SKUB 1NAQA 4CWBA 5G4DA 2QN6B 4RNOA 3KLGB 2RMLA 4ZVOB 1SUQA 1CS4B 3UD4P 4URGA 2AYBA 4CNYA 4OI3A 2ZEJA 2F7VA 2J0XA 2ASJA 4PWWA 1TKZB 1HBMA 4YB6A 1BE4A 1NPKA 2UUCF 4GC7A 3CJKA 5HVFA 2GHVC 3GTYX 2XZWA 2X1FA 2W01A 1C4AA 2F3JA 1UAWA 1DTTA 2YX4A 1NB2A 4C6AA 3R5GA 1NO8A 2LA6A 1DQ8A 3RYLA 3LP2B 5KFFA 1M0SA 3GYGA 1JLFA 5HI7A 3RAXA 1EETB 3KUGA 3DRSA 4PXBA 4KKOB 4DLGA 2DPIA 4KT0C 2KHCA 5B09A 3M8YA 1H2TZ 3G87A 2VOPA 2VFUA 2JFKA 1UWBB 1S1VA 2XMJA 1F6TA 2ZBCA 3P45B 2CPYA 1VQKS 4QQBA 1URNA 3C14B 4DSKA 4O44B 3RR8A 2HIQA 1TVRB 4F36A 3I0SB 3DOMA 3AOAA 4DUTA 4FKXA 4QBUA 3EVMA 1U1LA 4ETXA 1FRJA 3OSPA 2VZ9A 2VODA 2UVRA 2YQ3A 4TQSA 2F1FA 2AEJA 2FLOA 4F4KA 2J76E 4LF1A 4ES2A 1HQEB 3FUYA 2CQIA 1RWKB 2PIIA 5I3UB 2HURA 2WBMA 4ZVRB 1RSCA 1IJEB 5KFZA 4WCEQ 4HTIA 4OHYA 3IBCB 2OP5A 1M5KC 4DV6J 1IVZA 4DR7J 2O1PA 2J9EA 3IG1B 4DR6J 4HHJA 1DTQB 2JJ4D 3JQJA 4DR4F 3UDCA 1BQMA 1FT8A 3D3CJ 2V8GA 4N76A 3BQ0A 3RRKA 4ID8A 2LVWA 4OLPA 3OFFA 1U8WA 2W24A 2RS2A 1H2VZ 3MR2A 3RBDA 1CLFA 4ITSA 2RF2A 2YQ1A 4NRTA 5HBMA 2EVZA 2RB7A 2BVZA 4YR2A 2H9ZA 6AT1B 1U1MA 3EXCX 3NL0A 4PG5A 2HVDA 3C16B 1IKYB 3QGIA 1Q5YA 3ENVA 2RRAA 3E3XA 3K7RA 2F5GA 4NA3A 3T41A 1P8GA 3L7PA 4FF2A 2EPIA 3FJ2A 2DR7A 2AF6A 5H9FJ 2FJDB 4TY8A 5E3CA 2LU2A 4M5LA 1ZZNA 1HNWF 3KLHA 4LIWA 4DUYF 3W2VB 2CNNB 1KWMA 3MAAB 2XYPB 4S0MA 4ANDA 2CNOB 2M88A 2KH9A 3M2UB 4QPTA 3CCLS 1TFYA 2B6AA 2HNZB 3GB0A 1U48A 3KK1A 5IQ6A 3RB4A 1RWMB 2A18A 4WU2A 2IRUA 1ZBTA 1BUXA 4WFNQ 1M1HA 4OZ0A 3TZWA 3UCUP 2G0CA 4RBUA 1Y5IB 3P6YC 1T9VA 4JI7F 4LVNP 4OZ3A 1DFDA 2HHQA 1TUWA 2VONA 2HHPA 4NI2A 4BC9A 1YJ9S 3PM9A 1D8ZA 3HSJA 3G2XA 2XS7A 2GJFA 4WP8A 1SUQB 4CLKA 3HT3A 2ZE2A 2NXJA 5DRKA 4DX5A 2QEXS 1K47A 4Y34A 1VHIA 2MHNA 2VICA 4PZVA 4C8MA 4X65J 1JJ4A 1HBMB 2HBQB 5RUBA 1AZSA 1X8DA 1X4AA 1RQ0A 2C22A 1S0OA 4O3QA 3ZZUA 1DTTB 4B9TA 5L9XA 3VAGA 1SC4B 2ALZA 1U1KA 1I1GA 1VRTA 4XTTA 4C0HA 4NOHA 2CADA 2ZBIA 1SL2A 4B3OB 2CQ0A 3OR1A 3ITHA 1X9MA 5E7OB 1S4EA 3DRSB 1Q95G 1VQLS 1WF0A 2EC2A 5D78A 3BQ1A 1U26A 4LRCA 1KC8T 4P2MA 1SJQA 3CC7S 5IT0A 2M8DB 2O3DA 5BR8F 2Z58B 2VG7A 2LDYA 3DOLA 5D0HA 2PA8D 1PSDA 4BBYA 4WTYA 3R5AA 4LFBF 4CZCA 3ZNUA 2H3EB 2YQ0A 2XYHB 1R0AB 4DS5A 2DCLA 3LPYA 1OS5A 2YNGA 2Q66A 2XY6A 4A46A 4BCAA 2CQPA 1F2HA 2BJ7A 4IR9A 4B3MJ 4JI0J 2ATLA 1RGVA 1RT1A 3T5KA 5MLCV 2M5YA 4K8RA 1Y5NB 2LXFA 3UNYA 2XWYA 1N32J 2G2OA 4QYZJ 2ZM6J 1XMBA 2HNYA 4TLQA 4ED1A 1V3SA 4CP5A 2JVOA 2ZFHA 2WW4A 1BQMB 1S7HA 4JI2F 1KP6A 2HGNA 2ZH1A 4KGXB 4JOUA 1X4FA 2XM3A 1JJ2R 2ZITA 2ZH2A 2OTLS 2AEMA 1HNZF 4RZRA 2RF2B 3F73A 2WHOA 2JDJA 4UUWA 3CTRA 5HBMB 1Q5VA 1IN0A 3DU6A 3GU0A 3DYAA 2Z2MA 2KYZA 2DGTA 4EGLA 1FA0A 4RWXA 2XBPA 2LQBA 1U1OA 1TQLA 1PCAA 1UFWA 4UOFA 1MWYA 3TA0A 1GXUA 1XMQF 3D1OA 2I6WA 3ENAA 2DEIA 5C24A 1CJVA 1FTRA 4DEZA 1EAYC 3BH6B 4IRKA 1YWXA 2LYVA 3O6QA 2ZVIA 3M8RA 3KLHB 1F1BB 3KJFB 1NDPA 3A3OB 3HVRA 1U2FA 2V8VA 2R7UA 3KOAA 3MUTP 2UUAF 4KSEB 1S7IA 2HVIA 4RL1A 2XI3A 2B6AB 4JB8B 1NKEA 5D3GA 3KK1B 1BXNA 5CD4A 2BJ1A 4L3NA 2JLGA 3H7HB 4O3OA 1IBLJ 3P5BP 2MZ1A 2G1DA 1IQZA 3CNQP 2CJXB 4MIBA 3AA8A 1Q8KA 1WUUA 4RPFA 1JKHA 4XAKA 3PNIA 4NI2B 2MGZA 3BSOA 4LF6F 1TL3A 2E66A 2P2CB 1CBKA 4ZHRB 1YKWA 1WOOA 2VA2A 2NXCA 2ZE2B 3LPEA 3BSCA 1E6VA 3KLFA 2D41A 2I9SA 5JVHQ 4NMLA 2HVZA 4CTAA 2RQKA 4RNNA 4NXMJ 2BJ9A 2N4CA 4QIWD 5IT4A 2BKPA 1HLWA 2RNEA 2EBEA 2VKRA 1NBEB 2VC0A 2RKIA 5GAHU 2K3IA 3G86A 2EK1A 4J9KA 4WP3A 4F26A 2AQ4A 4ZJOA 2CKWA 2V2QA 3UVJA 1VBXA 1YZ6A 3OR1B 3S6EA 3ITHB 3TZYA 3K8WA 2PN6A 1XNRF 1ZA1B 2OI2A 1TMMA 3HVWA 3GIMA 1IR1A 3KWMA 2OJ3A 1YLXA 1TV6B 4J90A 4C8NA 3WX8A 1VBYA 1N36F 2VPYB 4P2XA 2R7SA 3DOLB 4EUVA 1VRQC 2H4YB 2E7WA 3V5RA 4UZCA 1VQ7S 5C2GA 3OPKA 3OFHA 3QWUA 4OYAA 2IDEA 1YJVA 2YNGB 1FTCA 1R0BG 3UO0A 5L39A 3THPA 1RKJA 5B0BA 5E3RA 2C2KB 4OX9J 4FYDA 1RT1B 3UN2A 1RA6A 2LCWA 3FGVA 3JB9k 5L9NA 3H4BA 1CVJA 1SQEA 2BR0A 2OGUA 4MKYA 1D09B 1KS2A 4DV7J 3UR0A 1PYSB 3BM7A 4URQU 4LJMA 4J91A 1GMUA 4B17A 2WK4A 1P9YA 3ZZ0A 1Y4ZB 4NXNJ 2QMWA 4J9SA 2IVYA 3CCMS 3RZAA 3C19A 4H4MA 2BDPA 2HPUA 2AV5A 2DHSA 2EFNA 3H20A 5ETRA 1CULB 3DYAB 2QA4S 4TNOA 4FYXB 4LRDA 4OI0A 3A8EA 4AT1B 5KFXA 2B9YA 3BN7A 2LXUA 4W92B 2FHOB 5KFQA 2CUYA 3WIUA 3BDEA 2QLBB 2BOAA 3Q0AA 2F8EX 3CXCR 2YTCA 3MDFA 5C24B 2N7CA 1CJVB 3EGWB 1XIQA 3C2PA 5IC6B 1WC0A 5K5MA 2DO4A 2BE9B 3FZBA 4DSIA 4C4WA 3CMQA 3DGPA 5K8OA 1HHQA 1RYRA 2VD3A 2LQ5A 2R42A 2UXDJ 2CJ9A 2YKMA 2W2PP 2RVJA 1TKDA 4U8VA 2JSXA 2NZCA 4KO0B 5DGAA 4G3IA 5GAHI 5D3GB 2EC0A 4HACA 3KK3A 5AXMA 2LKZA 1DQ9A 2IIHA 3HPOA 3OTOJ 1PYOB 3J7YU 1JKHB 3KLEA 5KG4A 2DK2A 2EKNA 4X62J 2MGZB 2VH7A 5A8WA 2VL1A 1TL3B 1RTHA 1RWWB 4DV0F 2F4VF 2RRBA 3SQGA 2H54B 4DFPA 3KLFB 5D8HB 2CA9A 4YFUA 3OL7A 4DR1F 2GA7A 2WSCC 2DH7A 1KDNA 1G3OA 2WB4A 1UETA 1RAJA 4JI1F 4CTAB 3BPDA 3EVWA 1S0NA 4DBQA 2UUBF 1I94F 2AYEA 1Q7LB 4IOCQ 2UP1A 3FDSA 4OL8A 2XY5A 4B9UA 2RKIB 3DHWC 2ZC4A 2K06A 3E51A 1W26A 2B7BB 3UVJB 1NJYA 1RAHB 4USWA 2EFOA 2H51B 1SCJB 4AXJA 4CLZA 3RAQA 2W2QP 3CGIA 2GQQA 2BX6A 1S1WB 2HGLA 1N5YB 2FVPA 5C42A 4LF9J 1HBUA 3W8GA 1S10A 1NHUA 2QL9B 5I4MA 2ZZTA 4IFYA 3W8PA 1DBDA 1NEEA 1S97A 4N41A 5LXYA 4B3RF 3M30B 2ZZMA 3D6TB 5IM0B 1RAGB 4NLQA 3I9V9 5HSPA 4ES3A 3K57A 1L3KA 5E2QA 4DV4F 3QYYA 4I64A 4WZQA 4KH1B 4ZA1A 1S6UA 1WTBA 1I5OB 4KAIA 4ED4A 2YKNA 2ZUGA 2W9BB 2FHJD 4F8RA 4IDKA 2K1RA 4MIAA 2ZJRQ 1D1UA 3CMES 2E9TA 2QSFA 2DGOA 5GMKa 5E0OA 1RCOB 4DXLA 2HSEB 3SEOA 1FNMA 3OFGA 1PG5B 5DS7A 3HI9A 3N01A 1ZA2B 3EZ5A 1HYSB 4WXWA 3D54A 4L6V3 2K8GA 1D9FA 4JI4F 5E41A 1RP5A 2NPIA 4LMZA 4JI8J 3FNNA 1SJFA 2RSQA 3QFWA 1X31C 2IYIA 2LU1A 2UVWA 2AU0A 4DV2F 2AJFE 4KC5A 3PIOQ 4E8UA 3VGSA 1IUJA 1FCAA 2R8GA 1CJUA 1UWAA 5C5JA 3MM5A 1JB0C 5LJ5Y 2BQ3A 3IBWA 1XK8A 1RHMB 3MM9A 3QIPA 3DKDA 4I6WA 4X4OA 1R8BA 2HHWA 2W9CB 3J7YI 1R6YA 3VAHA 4IH6A 3VHQA 4A48A 3HSGA 3WHIA 3O1LA 1IWAA 3LA0A 3UFCX 2B9XA 1V5VA 2CJKA 4LF8J 1U47A 3DGPB 3IWLA 1DQAA 1EKSA 2LLZA 1X4DA 3M9MB 2OTJS 1XQIA 3NS7B 1NH8A 1WHVA 1R7IA 1NNDA 2AP6A 4Z7YA 1RHUB 1KFDA 3AJDA 3GV7B 1KBRA 4HACB 4OZNA 3UDLA 1B64A 4AD6A 4YHHJ 3UD5A 1Q4RA 4CIOA 3ENWA 2DGQA 4AL5A 3ICLA 1YJWS 2U1AA 5CYQB 2A6OA 2DVIA 4U95A 4LVOP 2J6UA 2FPHX 3D6HB 1NDKA 3G71S 5A8WB 2JOQA 2YWHA 1RTHB 2E1AA 3SQGB 3OBIA 4DR5J 5L1KA 5KFVA 4IOAQ 1NCLA 4QU6A 4LT6A 1S48A 2DB1A 2NXUA 2V8HA 2ZVSA 2GIQA 1IKVA 3CDEA 1HQ2A 1S6PB 2MEWA 4ZLNA 2SXLA 3HMJG 3AD8C 4ED3A 3MI7X 2BACA 4ZLPA 3TR5A 1KOOA 4ZDNA 1TK8A 3MUVP 2FZKB 5A8RA 3KNAA 1APSA 2CQ2A 1H74A 4DQPA 4RW7A 4LFAJ 1T9YA 2RU9A 1HW9A 3TZZA 4KGMA 1B4SA 2J9CA 2BJ3A 2BA9A 5HO4A 2ROPA 4P72A 2XGPA 2C3OA 3AODA 5HP1A 3K5OA 2XLIA 4NLDA 3W9IA 1HBUB 1VCTA 1NRKA 3ILIA 4IFYB 4W4MA 2ZHBA 5A0YA 1OYDA 4EWTA 1YBTA 3KLIA 4P71A 3LW5C 3EE3A 4FS1A 2WVEA 2QA1A 2XC9A 4P2SA 5KFTA 3ETOA 3MMAA 3W64A 1O5JA 2LMIA 2VQEF 4JYAJ 3IP0A 5HMYA 3JQMA 2AWZA 1NK7A 3G6XA 2PMHA 4OV1A 3MXHP 2XSJB 3K0JA 4IDKB 2K1RB 3AD7C 3OTBA 2MLXA 1AUDA 2M52A 1OPZA 4ZVFA 3DM2A 4NYPA 3VAJA 1PBAA 2DNGA 3MWBA 4GKJF 1FWKA 3CJ0A 3SDEA 5KFOA 4LF7F 3DLBA 2C3YA 1T05A 4ZPAA 3WZ0A 4F0HA 4DLEA 2EK6A 5HK4A 5LMNF 2LQJA 3GCXP 4FF4A 1X5TA 1UP1A 3G9CA 2LEAA 2ZBRA 5KAKA 3IGVA 1CJUB 1K8AT 2AYMA 3MM5B 5GADU 3DMJB 3LP1A 1O8BA 4RBVA 5KFLA 2ADBA 3MM9B 2JC0A 2QSWA 3SFUA 3JS9A 1EKRA 1IM6A 1JLBB 1U4BA 3I5AA 3QATA 3MR6A 1JNRB 3DLGA 5G0RB 1R8PA 4ER8A 3AOBA 3NY0A 2EFPA 2X1BA 1KHWA 3MPDA 4TQRA 1LXNA 3CW2C 4YDXA 3CC2S 2OO4A 2V63A 2BW7A 4GO5X 3IMQJ 4IG0B 3GP9A 1YITS 7AT1B 4NYOA 3LQVA 2WOMA 3F0NA 4HLBA 4QR1A 4F2SA 4NRUA 1RTJB 3PYEA 1K1SA 2X3GA 2IRYA 1YBAA 1NUEA 3H90A 2VHGA 1EB0A 4CH7A 3HULA 2DYAA 3VV2B 4ZVSB 4HT7A 3DRRA 2IM2A 3R6GB 2DNQA 4JI6F 1N5TA 4OYMA 3TAMB 4RWWA 1QUVA 1FDDA 4UOCA 1IKVB 2HNDA 3P3DA 3DLJA 2XEXA 2OPPA 4QZVB 4QOTA 3MZIA 4O0IA 3MPUB 4LSNA 5A8RB 1HNWJ 2VJUA 2CQBA 2F8MA 4DV6F 2XNRA 1VQSA 4DR7F 5ADZA 4DR6F 4HL9A 2VF3A 1XC9A 1BLUA 1HW8A 1JLCB 3CCSS 5F41A 2KJVA 4UQGA 3OUYA 1HNIA 1H7WA 2F4FA 2CNKB 4QR0A 2KG0A 3CJSA 1AA1B 2J0WA 5E33A 2C28A 5F8LA 1U0HB 2VBZA 2GQCA 1DY3A 2OHDA 2W25A 3Q2SC 1XN9A 1YQHA 3KLIB 1YVFA 1Z2LA 4WFZA 1S4FA 3HX9A 1C2PA 2XZTB 1R89A 1FJGJ 3KTQA 2VDIA 3G96A 3MMAB 3NXZA 5GADI 3PG9A 3G8TA 3THVA 1F2GA 2HHXA 3WC2A 2G9OA 2ZH9A 2R7XA 2W4CA 1SXLA 3VWSA 4A8OA 4RNMA 4ZPWR 2WSFC 2XWXA 3V4IA 3IRWP 2UUTA 5KFAA 4YB1P 3MM7B 3DM2B 4PCQA 1TR0A 4QU7A 2Y1IA 1FKOA 2XMKA 4X84A 2BW2A 5KT2A 1CJKA 1ZETA 3V6JA 1T05B 1WI6A 1J5EF 2EI5A 1AFJA 1NU4A 3JAMU 4J9UE 1F5CA 2IVFB 2G4BA 1TKTB 3QT8A 3QRPA 1JK9B 1N5VA 3TAQA 4BC7A 1YJ7A 3M1VA 3LP1B 4QWEA 3MEDB 5D0EA 3BKTA 4N56A 5D0GA 2JVRA 1LOUA 2P9GA 4X4NA 3DLGB 4CM0A 1Y3KA 3VAKA 2JEJA 3JYTA 1EX8A 4Z2XA 2KFYA 2XMAA 2PI5A 4Q2MA 4FVMA 1OJ4A 1KEKA 2JX2A 3OXFA 5KFDA 3CSKA 4ALZA 2ZH3A 2CQHA 3BBBA 5IZHA 3NCRA 2DT9A 2ZKTA 3M2RB 4HYKA 4TU7A 3TNVA 5HMWA 1H38A 2FIUA 4PYDA 3D0GE 4USIA 4Q2LA 5I3QA 3H0PA 2VASA 1PJ6A 4OZLA 3GJQB 5HMZA 2WOMB 3RBXA 4USMA 1PO6A 4P2FA 4QWAA 3NOCA 4U7CA 1HA1A 4R25A 3ZTPA 4CO5A 1NSPA 2FDNA 1VJQA 2VV5A 4KPYA 1N52B 4LQ3A 3PV8A 2HG4A 2JL9A 5IXUA 3H98A 2HZCA 2AD9A 2KZZA 2ZD1A 5DETA 1TL5A 1F9FA 4N8OA 3DRRB 4C8KA 1VFJA 2J6SA 4KH0B 4DL2A 4Q7AA 2V34A 2DGWA 4Y28C 1X0PA 1I51B 1U49A 2YBVA 3VAMA 3VZIA 4F0KA 4JI0F 4B3MF 3QRQA 2MKSA 2PMZD 1C1CA 3TX0A 1RWNB 4PXCA 1MU2A 3UCGA 2H4WB 1OY9A 1K1QA 1S76D 1OY6A 2DGUA 1N32F 2AJ4A 2ZM6F 3IN5A 4MYTA 3TX8A 4C9DA 2V4RA 2JLFA 2VPXB 3MTKA 1Y7PA 1HBOA 2V9KA 1TUGB 1H2UX 3KJNB 1T11A 4I7FB 1LWFA 4ZKAA 4ELUA 5JMNA 4IO1A 4F7VA 1RWOB 1VYAA 1HNIB 3I5CA 1XMOJ 2DRDA 3OW2R 4ILRA 1X5PA 2E5LJ 2Y0BB 4ID5A 3QFHA 3G6VA 2MMYA 5ETMA 4B3SJ 4FZVA 4XK8C 4X4UA 4YR0A 3EYZA 3TUPA 2JFDA 2PFDA 4PUOA 1MN9A 3GPAA 2D3ZA 3M6VA 3PY8A 1N54B 2Q79A 1TAUA 4LF5J 4PXEA 1QTNB 2QA4G 2D7SA 2J5AA 1T9WA 3QIDA 4WYLA 2DXFA 3HT0A 2DISA 3V4IB 3SYZA 4WTOB 3OJUA 1XTZA 1FKOB 2KRRA 4LREA 2KT5A 4I67A 2UVUA 2RHSB 4O23A 2DPJA 1CJKB 3KG0A 1IBLF 1QVFR 4NA1A 1R3NA 3P8BB 5A6WA 3RRGA 4USTA 2A10A 5L1IA 2ERRA 2ZDPA 4OJ3A 3L3CA 4G6VB 2KO1A 4AYBD 4NLVA 3NOGA 2VFTA 1HI0P 3FVYA 2YPZA 3N9UC 4EO8A 2NYHA 3M1VB 2OUGA 4KFBA 4OYZA 1N5QA 3E01B 3Q89A 2XS2A 4WJBA 1ZOTA 2YWGA 5LSOA 2CVIA 3SV4A 3DHXA 2ROGA 3BGRA 2XCPA 2E29A 1KOHA 4CO3A 4ZPTR 4NXMF 3JQKA 3JYTB 1WKLA 4QIFA 2RDJA 1WDTA 1URRA 1UFKA 2J6TA 2DNYA 1BQNA 1HI1A 1FO1A 3U7JA 4K5RA 2JEIA 4UUXA 4ZS6A 4R0EA 5EDWA 1X4EA 3M2VA 3I4HX 4DWIA 2H5IB 1LQ9A 1Q82T 4ECVA 2ACYA 4ED7A 3RRHA 1CQNA 4ECSA 2HHHJ 5LSLA 1NSQA 2RUGA 4CT8A 3T5LA 5J1EA 2GC8A 4NZ6A 2K7JA 2QYCA 2HWHA 2GMHA 2Z56B 4RU9A 2CPJA 2AT1B 4J9RA 4WYWA 4J9QA 2IFXA 3QRRA 3EZOA 3TOQA 2AYGA 1KONA 5T41A 2ZD1B 3MD3A 4L3KA 1O6XA 5ETLA 2YKPA 2HQGA 3PR4A 1X4HA 4PG6A 3MCNA 2CVEA 2Z30B 2L41A 3W2WA 3PJ9A 1ZH5A 5J2MA 2Y1LB 4AL6A 4CLLA 3ONQA 2G0IA 3GMGA 1FK9A 1OQ6A 5KFMA 3U02A 2AJ2A 3LAKA 4QIVA 3PW2A 2XO7A 2GAHC 2YWEA 4OX9F 2PC6A 2WVBA 4KJIA 4I0WA 3VZHA 3JTOA 2LXIA 5L8RC 4NL5A 2C42A 3BBCA 3D9BA 4CYUA 1RBOB 1Y3JA 3I96A 2CYYA 3TUZC 5LT5A 4F50A 1HBOB 3GR0A 3AB2B 4DV7F 5B0FA 4IOBA 1X9WA 1T9XA 2QE5A 3DXSX 5HROA 3PDNA 1LWFB 3V6DA 4LSLB 1T95A 3GLJA 2IJRA 5B0AA 1LK5A 1S9GB 2R2TA 3R27A 3PR5B 2YNIA 5DDPC 4C48A 1MROA 3PACA 1TAQA 3LUYA 2J7KA 2V68A 1FFSB 4K7QA 2VKZG 4LSZB 1VBKA 2CFXA 1TU0B 4ELTA 2RQCA 2UXBJ 2HEKA 2BANA 3GJSB 4BLGA 1EHWA 3DRXA 2NQPA 4PUOB 3PVXA 2M3DA 3FCWA 4B3TJ 4QR2A 1PBUA 4CO0A 3AQPA 3BGUA 2B56A 4A47A 2PI4A 2X1GA 1GFWB 2ZOGA 2F9JA 4DL5A 4ZK7M 5CD4H 1REVA 3AB4B 4Q8EA 2L48A 1RLCL 2XNQA 4ZP6A 1Z4UA 2UXDF 1SKSA 4RJVA 3CCRS 2GFFA 3GV5B 1ITPA 3TAPA 5HLFB 2OSRA 1PAEX 1VBZA 1Q7YT 4MFBB 3DLKA 4GVBA 3FSYA 2V94A 3NEKA 2DXEA 3I0RA 1HWLA 3OTOF 4K4ZA 5FD1A 2W7PA 4Y2IA 4OX6A 4X62F 1U8SA 2B8PA 2QZ8A 2W4DA 1WHWA 4KFBB 4OJHA 4RW8A 2Q6BA 3EPGA 4TU8A 1SC6A 1LKZA 3SCIE 1IBCB 5GMEA 3BGRB 3JAMY 1VLYA 1ZZFA 5K9FA 1KQFB 4FVCA 3LGHA 3EGNA 2OLWA 1BGXT 1BQNB 3AJ2A 1FFGB 2Y0SD 1NJXA 2JH3A 1JLQA 1HMVA 1RWXB 3M2VB 1YIJS 3HFVA 5LJ3Y 2ZH7A 2IPOB 1MSWD 3X1LB 4C8ZA 2HW3A 1UVIA 4YEAA 2CJAA 2AX1A 3N28A 2HHVA 1YX2A 1YK9A 1BHNA 3RAMA 2ZH5A 4LF9F 1XR6A 3M32B 5DZ7A 1MMLA 3DDNA 2ASYA 2FJWA 5J1EB 2R3VA 2OEKA 4OHZA 4DSFA 4LBIA 3BDPA 3D28A 3KHHA 4DV2J 5IV3A 1VS3A 2XSFA 1OY8A 5LMUF 4HDGA 3I9ZA 4EO6A 2P9CA 3UN5A 1NHVA 3QGGA 2CPDA 3SXLA 3Q8UA 3Q8QB 3CIZA 1CS4A 4PQAA 1T03B 3Q22A 4ZP7A 3PRDA 3QQCD 1SH0A 1FERA 4MKAA 3W2WB 4K59A 4J9LA 3ILLA 2GO9A 4I1TA 2V4QA 1U1PA 1FK9B 2NUUG 5F8JA 5F8IA 2HRUA 4DL4A 2CDQA 2KI2A 4C97A 3CCVS 4OMFG 2POKA 2UU9J 2HS3A 1CPZA 3RR7A 3TQEA 1RT7B 1WHXA 2QG9B 2QV6A 2OFGX 4RW9B 4CYUB 3OXLA 1FWLA 3RBEA 4DX6A 2F8HA 4K4YA 1EZZB 2OSQA 3PJWA 3SSQA 3V6DB 4N8NA 1RBLA 2HKEA 5DG7A 2O66A 1Y0HA 4ED2A 3HKWA 3OQ2A 4JI8F 5LOQA 1G6BA 2QLXA 9RUBA 4ANCA 1MROB 4FF3A 2ZDOA 1UWBA 4TYBA 2ASDA 2V5HG 1NM2A 2IJNA 1MWZA 5E3PA 3KUEA 3VVUA 1WC1A 2YNFA 4O44A 1F5BA 2BANB 3QNWB 3T6JA 5GMDA 1TZ0A 1WACA 2MHEA 3M8ZA 5HANA 1RA7A 1I6JA 1WDDA 2KU7A 4IG3A 4ZVHA 2HBRB 2UV8G 4UQTA 1Q81T 3TA1A 1V5IB 4F25A 1GX5A 1JXLA 4W90B 2HBZB 1HQEA 2CWXA 4LF8F 1REVB 3LO3A 1SIWB 2MZQA 1XNQJ 2FTRA 4USUA 4H4OB 4PG7A 2AX0A 4J9MA 2CDRB 1U09A 3AHPA 3IFEA 3PW0A 2FJVA 2VQFJ 2MB0B 3BJYA 1R0CB 3MTJA 3C66A 3DLKB 3HJFA 1RTIB 3CD7A 3HD2A 4Y2AA 4YHHF 4DFMA 1JJHA 5IQQA 4CLTA 4MTPA 3BF4A 2J8SA 3I0RB 3ZZPA 2EW9A 3UDEA 4NYZA 3UQSA 4A8QA 1NPPA 4F4AA 3FBCA 3MR7A 5KG6A 2RT3A 3UW1A 3C16A 2DNZA 4C0BA 4M5HA 1JX4A 1S9FA 1J2VA 3CJ8A 1QJHA 4NZ7A 1CG2A 2XMVA 3BEGB 1ZTTA 1FE0A 4F02A 2YPYA 1UA0A 2C3PA 5SUHA 2X3DA 3IR7B 4LRBA 1YHQS 3M8WA 3GFYA 1PYTA 4F3OA 2IA0A 2U2FA 5CYMB 3HHDA 1CEZA 5HL7Q 1NZAA 5KG2A 3CIMA 1AW0A 1HR0F 3IS9A 3MECB 4OZJA 5GAEI 2Z57B 3BB5A 3J81j 3MAAA 1JLQB 1HMVB 4PAAA 4LFAF 2CXEA 1U1NA 4ILMA 3N5BA 4X4QA 1HWIA 3UD3P 1RAAB 2J8AA 1YG0A 4RW4A 2IJFA 5T7LA 4CH1A 4ZMMA 1M1KT 3ULHA 1A7GE 2IBKA 4NWBA 4NMXA 3FQLA 3ZZOA 5E3AA 1KRPA 2R7OA 2MSTA 4PKDB 5EX3A 4ZOSA 1C4CA 1HKAA 2E9RX 3W5ZA 4DS4A 3FEXB 2FJAB 1HFEL 1YJUA 2ZNYA 1VC0A 4OLOA 4JYAF 1RT3B 3A8KA 3CJTA 4DHVA 4OYBA 4ED5A 4R8UB 5H1SV 5KT5A 3CPWR 4WFBQ 4Q43A 4ES1A 4KYZA 1T7PA 2XZDB 3HCXA 2B8QA 1FDBA 1VLOA 1FE4A 3KMQA 4IQMA 4NLRA 4B3OA 2H1YA 3ET6A 3N5FA 1LWEA 2OPSA 2HVEA 5K14A 4OZ1A 2YKOA 2KN4A 1WWHA 4FXVA 2QL7B 3H8YA 1RHRB 3FFIA 1WC5A 2W7OA 1LNQA 4DL3A 2R8JA 2BQRA 3EMTA 4Y2MA 2P5VA 4FPIA 1ZAWA 4OFZA 1NXIA 5F8MA 4NZ0A 1RT2A 2DTJA 3Q83A 2DR9A 2PDAA 1TUVA 1NDLA 2IYGA 2X51A 2YNFB 3FMWA 3BGLA 3F44A 2VPZB 5IV4A 3A8JA 4B9NA 4JI6J 4IG3B 4KBIA 2Z4PA 1R0AA 4EYHB 2IMOA 2MKCA 3ZTOA 1M5VC 1IR2A 5EWEA 1F3FA 3CJ3A 3CF5Q 1GH8A 3CCWA 4O3SA 2RIJA 4FXDA 1OMSA 1TL7B 4Y2CA 1U45A 1VDHA 3T5HA 2HLTA 1G2EA 1VISA 4MK8A 1FI4A 4KGKA 4EFAC 1OPIA 2O01C 3GIJA 4ZITA 4IKAA 3HM9A 4LR7A 1LWCA 4Z7CA 4GRSA 5IFMA 1FXRA 2E9ZA 2XHWA 4WF9Q 5AXNA 2DY9A 2LP4A 4Y3CA 4I2QB 1GTEA 2Q3PA 2H5JB 2D74B 2DNMA 2BKNA 1CSJA 2DR5A 4CH0S 2V69A 3TYTA 1VQ8S 4IQXA 2GCFA 1S1XA 4QW8A 1FNOA 4PG4A 3QAUA 3NGDA 2HFSA 2OPQB 3EICA 1ZYQA 2ZH6A 3H40A 1W25A 4K0KJ 2KXNB 3R5CA 4X66J 3CO0P 1KKHA 3DLHA 3SBMA 1KVJA 4NLGA 1WI8A 2EKYA 5D4LA 3N6MA 5F8GA 5BJRA 2BE7D 2R2SA 5F0UA 3IS9B 3UPFA 1LV5A 4DX7A 3GWCA 5A2QY 4O4GA 4U7UD 5MAOA 1GAOA 4IH5A 1SBRA 1KN6A 3BN4A 4QWBA 4N47A 2GW8A 4BDPA 1GXLA
chains in the Genus database with same CATH topology
1AUDA 4IFVB 5KOXA 2M52A 1OPZA 4ZVFA 3HVTB 4RW4B 2N7YA 1HHTP 1RT5A 3DM2A 3GG0A 4FS2A 3GYNA 2BV3A 2MJUA 3CVKA 3HKZD 5KFCA 3CWJA 5KFGA 4ZPCA 5T7LB 4M63A 4NYPA 4F4YA 3VAJA 3CD0A 2FLLA 3P49B 2DD8S 5JUMA 1RT6A 2DNGA 5DLFA 4J5OA 3MWBA 4GKJF 4I6AA 3CJ0A 2MY7A 3SDEA 2B5JB 1WD6A 2HWIA 5KFOA 5FLXY 2XB2D 4LF7F 2DRAA 3LP2A 2PFFB 3DLBA 2D9OA 2C3YA 1T05A 2FC9A 3CB4A 1E6YB 1GQEA 4ZPAA 3WZ0A 5B0DA 4DLEA 2EK6A 2ILYA 3I87A 3LGNA 2CRLA 4QIGA 3ISNC 5HROB 1EETA 3PX4A 5LMNF 1RJJA 2LQJA 1SJ1A 3HDSA 4HDHA 4XO0A 3T1YF 5DM7Q 2NR0A 4KKOA 4Y0FA 2OPRA 2FVRA 1X5TA 4FF4A 1UP1A 1S9EB 1P27B 3N6LA 4V19X 2LEAA 5FDLB 4ZHRA 2YNHA 2BM1A 5KAKA 1X9SA 2Q6CA 3B78A 3THTA 4FN5A 1MMNA 3IGVA 2BXJA 2NZ4A 1HWJA 1FJGF 1FDAA 1IBMF 2B4PA 3QPIA 4B9VA 2WW8A 1K8AT 3VCDA 2E5HA 2RH3A 3QLHB 2AYMA 2YNIB 4JI5F 3Q8PB 4AXIA 1RISA 4J9OA 1KTVA 4IRCA 3GFXA 2PGCA 3MM5B 4LUBA 3DMJB 3LP1A 5GADU 2MXYA 4XIUA 3C6TB 3NNHA 3UWTA 1O8BA 1AXQA 2HGMA 4RBVA 1HHSA 5KFLA 2BE2B 1EP4B 3MM9B 2ADBA 2JC0A 2WCXA 1HWKA 2QSWA 5A6PA 4DR3F 3QJLA 4B08A 3PEJA 1SV5B 3M8PB 3SFUA 1SH2A 4FPRA 1B7FA 4ECRA 4DN9A 2N82B 3BGFA 2JEFA 2A3JA 1JLBB 1U4BA 3I5AA 1TVRA 1C0UB 3MR6A 1VI7A 3I0SA 1JNRB 2RD5C 4I68A 3DLGA 3MEKA 5G0RB 1R8PA 4ECWA 3DRYA 1S77D 4OHXA 1S49A 2BUNA 2GJ2A 2GHWA 4KV8A 1SL1A 3SSSA 3T6BA 5HLFA 1UVMA 2D3OR 5C25B 2JZ5A 4A4JA 2MZRA 3K59A 2JEGA 3VTIA 4JV5F 3MEEB 2V4JA 1NK8A 2EFPA 1HNVA 3CCQS 1KHVA 4MFBA 1FESA 2X1BA 4DQQA 2BJDA 2J9DE 1KHWA 2VUGA 1LFWA 4TQRA 1E6VB 1ZM3A 3DRPA 3M9OB 1LWEB 2OPSB 3KKFA 3HO1A 2GMJA 1LXNA 1KQGB 3MOJB 4YDXA 5K14B 1UVNA 2R7VA 3CC2S 2PE8A 4YMEA 3GFZA 4YB5A 5I3UA 1VQOS 2OO4A 1NKBA 1UW4A 3PZPA 2QRRA 1X4CA 4GO5X 2NLWA 3FFIB 4K5SA 4BWJA 2E1RA 1KQSR 4KE5A 5DDOC 1UA1A 3MEGA 1FRLA 1OIAA 2VA3A 4IG0B 1V3RA 3DU5A 3NS6A 3ISND 3R1HA 3CCZA 1YITS 4NYOA 3VR1A 1HD0A 1TV6A 3K5PA 3LQVA 3IG1A 2RJZA 2WOMA 5HQ8A 3PXGa 4HLBA 4K4WA 4U6PA 2FVCA 4ECZA 1UFLA 1IBKF 1KTQA 4QR1A 1DTQA 2AJQA 1AFIA 2ZOMA 2GJIA 4DV3F 1S1UB 1RT2B 4F2SA 4Q44A 3MURP 3O44A 4NRUA 3CCTA 1DRZA 1RTJB 3PRBA 1Q78A 1K1SA 2X3GA 3E8OA 1W2BR 3NG8A 4CNZA 1FKPA 2ZHOA 1DURA 2IRYA 4O3PA 1YBAA 1U6BA 2HS0A 2B3TB 1ZM9A 2E5IA 2L9WA 1L3SA 3LAMA 6FD1A 1PILA 2EBGA 4QJVA 1NKCA 1UKUA 3B4MA 5KFSA 4FNIA 3FZ2A 2F40A 2WSEC 3JTNA 4CH7A 3ENQA 4R0JA 3DCAA 2C2EA 2IHR1 2CZVC 1KNZA 1U7LA 3I4PA 4HT7A 3DRRA 1WG1A 4JV0A 2IM2A 1BWEA 2HHUA 4KTQA 1D3WA 2DNQA 3WDOA 2VG6B 4ZCLA 3GFHA 4JI6F 1N5TA 2WTFA 1DHMA 3NKYA 2WONB 3RB6A 2OD4A 2A1BA 4RW8B 4ZPVR 5DO2A 4QW9A 3TAMB 2DJWA 4RWWA 5FJ4A 1QUVA 5F8HA 2I5JB 1JMTA 3CE8A 3MMJA 1CC7A 1FDDA 3HHKA 1IKVB 1FD2A 4UOCA 2COLA 3PKYA 4DR5F 1IKXB 5KG5A 2HNDA 2VFRA 3MR3A 1IKYA 5DM6Q 2R7TA 3P3DA 5CYJA 3DLJA 1N88A 3J7ZT 2XEXA 2OPPA 3P5TL 2CQ4A 4QZVB 4ZVGA 2IA6A 1YTYA 4QOTA 1VQ9S 1FKAF 2ABYA 2B0GA 3MZIA 2P9EA 3HHLA 4ERDA 4NLYA 2IBOA 1P1TA 4O0IA 1KSPA 1VQ5S 4LSNA 3M32A 5A8RB 2CQBA 2F8MA 3O2IA 4K4VA 4XDDA 2FC8A 5KG3A 3M8SA 1VQSA 4DV6F 2XNRA 4DR7F 1LWCB 5ADZA 5KG7A 2M7SA 2HHTA 4DR6F 1JXEA 1Y9OA 5AXKA 4ZCIA 4HL9A 7FD1A 5CQGA 1LW2A 1XC9A 1BLUA 3IGNA 4UW2A 3AH6A 3IRXB 1YRTA 4DV5F 1HW8A 3C6UB 3B82A 1T94A 1N0UA 1G1XA 1JLCB 2R9LA 3W2VA 2IM1A 3CCSS 2K3KA 2IM3A 3OTCA 3L7OA 3PX0A 3T9ZA 5F41A 2G13A 2KJVA 5KFWA 2HAIA 2HRYA 5KG1A 2KTQA 3MPVA 2NS1B 4P7VA 1N48A 3EGZA 4KHMA 4UQGA 3M2UA 4WE1B 1HNIA 1H7WA 3WBZA 3OUYA 2W4PA 2UXCF 3IC1A 4DSJA 4QR0A 1U25A 2L3MA 5KFUA 2KG0A 3V81B 1T03A 3R5DA 3CDAA 2HNZA 2DITA 4ECQA 3N0VA 2J0WA 4M5DA 5E33A 5BYRA 3X3UA 3KHLA 1QAXA 1SIZA 1S1XB 4DL6A 2AW0A 2C28A 2VBWA 3DI6B 1A9NB 1MMDA 5F8LA 2VBZA 3F41A 2GQCA 1JLEB 1L3TA 4RUHA 5L1JA 3U27A 2MSSA 4NLPA 3NNAA 2W25A 3G8QA 2GIRA 3Q2SC 1VGYA 1XN9A 1YQHA 3KLIB 4F3MA 5JXSA 1YVFA 1Z2LA 4WFZA 2NPFA 4RU2A 1S4FA 3HX9A 4YOEA 1YRXA 1C2PA 1NAQA 1ULRA 1WEXA 2F9DA 1R89A 2HFOA 1F60B 4QIEA 1CQMA 5SZTA 3KTQA 4J37A 3CCUS 3G96A 1RTDB 4H4MB 5G4DA 1Q53A 5K8PA 3UNGC 3H2VE 4RNOA 1RT7A 1UL3A 3KLGB 3MMAB 4QCLA 2RMLA 4RW9A 5AE3A 5GADI 2E1MC 1XEZA 3G8TA 1SUQA 3THVA 3UD4P 1F2GA 2DO0A 2HHXA 3TRGA 4URGA 3WC2A 3MR5A 2HFZA 2AYBA 2G9OA 2ZH9A 3NLCA 4OI3A 4CNYA 2W4CA 4ED0A 2R7XA 3I32A 4O4GB 2F7VA 1SXLA 2V2KA 3KHGA 2R7WA 2ZNZA 3VWSA 1HL6A 2YX7A 2J0XA 2ASJA 4PG8A 4OX8A 4O3RA 4A8OA 1TKZB 4RNMA 3IAS9 4ZPWR 1HBMA 2WSFC 4YB6A 2XWXA 4GC6A 3V4IA 3IRWP 3F56A 3NS5A 2UUTA 4KO0A 1X0FA 4GC7A 2UUCF 5KFAA 3CJKA 1IJFB 3MM7B 1QAYA 4YB1P 5F8NA 4ZP8A 1RT5B 3DM2B 5U47A 4PCQA 2GHVC 1TR0A 3BR8A 4QU7A 2XZWA 2Y1IA 2X1FA 3C8YA 1FKOA 2DNLA 2ZOFA 4RW6A 1C4AA 2F3JA 3QGPA 2XMKA 1UAWA 1DTTA 4IO9Q 2YX4A 2O5DA 1RT6B 5CH7B 4X84A 2BW2A 5KT2A 5J2PB 1NO8A 1XMOF 2XS5A 2LA6A 1DQ8A 1SJ3P 3RYLA 3T3FA 1VQNS 1ZETA 3LP2B 5KFFA 3V6JA 1T05B 1WI6A 1M0SA 1J5EF 3E2EA 3R1LA 2WBRA 2E5LF 2EI5A 5I3PA 2IM0A 4RUCA 1JLFA 1AFJA 1NU4A 2Y1JA 1FEHA 5HI7A 3RAXA 4LFCF 1EETB 1R43A 4B3SF 4HH1A 2DNHA 3OJSA 3DRSA 4PXBA 2YKMB 3TI0A 3FSXA 4KKOB 2OPRB 4DLGA 2DPIA 1HD1A 4KT0C 2KHCA 3AY0A 3M4XA 1F5CA 5B09A 2IVFB 2G4BA 4DFJA 2FLPA 1TKTB 1H2TZ 1ZTWA 1JK9B 4DDFA 1N5VA 3H5SA 3TAQA 4H4KA 4BC7A 4CCHA 3M1VA 2VOPA 3LP1B 4QWEA 3KK3B 1WF2A 2VFUA 3TVYA 2JFKA 3MEDB 1UWBB 1S1VA 2DH8A 3H2LA 3PFOA 1GX6A 2XMJA 3OHAA 4LF5F 2ZBCA 4N56A 2CPYA 1VQKS 4QQBA 3GQCA 1URNA 3H2UB 4H4OA 2JVRA 1LOUA 2P9GA 4UY85 1HWUA 3MFHA 3SCKE 1U1QA 4DSKA 4O44B 3RR8A 4X4NA 2HIQA 1TVRB 3TW0A 3I0SB 1UJ4A 3DLGB 3DOMA 2EG1A 3I5BA 1Q8BA 3KLEB 1Y3KA 3K8VA 3QJJA 4M1KA 3KG1A 3VAKA 2JEJA 3JYTA 4KV8B 3IWNC 4QBUA 4Z2XA 2KFYA 1U1LA 2PI5A 4ETXA 4Q2MA 1FRJA 4FVMA 3OSPA 3H25A 2V4JB 2VZ9A 2VODA 5AE2A 2UVRA 1KEKA 2AGQA 3I55S 1HNVB 2YQ3A 2JX2A 4TQSA 3QGHA 3OXFA 2F1FA 5KFDA 1O51A 4N77A 2FLOA 1X5OA 4F4WA 1RTIA 3R3TA 1L3VA 3DRPB 4F4KA 2J76E 5M2PA 3CSKA 5B0EA 4ALZA 2DGSA 2ZH3A 2CQHA 1V9OA 4DF8A 4ES2A 1TL4A 4I6YA 1HQEB 3DC2A 5IZHA 3OLAA 3NCRA 5EUHA 2FVQA 2PIIA 2CQIA 2DT9A 2DHAA 2ZKTA 3M2RB 4GMKA 3TNVA 4ATNA 5I3UB 4TU7A 2WBMA 4HYKA 3H59A 5HMWA 1H38A 2FIUA 2KXHA 1IJEB 2B43A 3FMBA 5KFZA 1S1WA 3D0GE 3MEGB 4USJC 4WCEQ 3TVKA 4USIA 3G6YA 1N5YA 4Q2LA 4HTIA 3IA0A 4OHYA 5I3QA 2EWHA 2VASA 5J1PA 4OZLA 5CA5A 2OP5A 1M5KC 3EZUA 3G4SS 2O1PA 2J9EA 2E5JA 3IG1B 4KRWA 4C2MA 1GTHA 4HHJA 3Q8SB 5HMZA 1IM4A 2WOMB 4DG1A 2W8KA 3PIPQ 1PO6A 1UEUA 4QWAA 4U7CA 4C98A 1HA1A 1N34F 4R25A 1DTQB 1VK3A 1MW7A 1NH7A 2OKQA 2JJ4D 3Q24A 3MMBA 1RT4A 2DIUA 2E5GA 4CO5A 4DR4F 1FVSA 3NMRA 2FDNA 1X4BA 3UDCA 2VV5A 4KPYA 1BQMA 1FT8A 2XMUA 1N52B 3MF5A 2V8GA 4N76A 1FKPB 3CDBA 2ZC3A 3M30A 2EFVA 3BQ0A 1YI2S 4LQ3A 3PV8A 3RRKA 1D0EA 4ID8A 5IM0A 2HG4A 2LVWA 3DLEA 3OFFA 4NCGA 2W24A 2CJBA 1H2VZ 4OLPA 3UE2A 3WC0A 2RS2A 1YRUA 2JL9A 3MR2A 5IXUA 3RBDA 1CLFA 3H98A 4ITSA 1N0VC 4CQ1A 2HZCA 1QTMA 5CYMA 3SZ2A 2AD9A 3QJPA 2RF2A 4NRTA 2HYIB 2KZZA 2ZD1A 5DETA 1TL5A 1F9FA 4N8OA 5HBMA 5CCLA 3DRRB 2EVZA 4C8KA 1VFJA 1IQTA 2W8LA 5C42B 2RB7A 2J6SA 2BVZA 4YR2A 4DL2A 2H9ZA 3MECA 1U1MA 3EXCX 3H5UA 3NL0A 4Q7AA 2PT0A 2FD2A 4PG5A 4JV2A 2P6TA 4GO7X 1N56A 4DL0C 4C3MA 4NLXA 2BM0A 1P9QC 3CCJS 2DGWA 4Y28C 2DNNA 5CCMA 2W9BA 1S79A 2MY8A 1IKYB 1X0PA 3QGIA 1S99A 1U49A 1X7VA 3ENVA 3L09A 2RRAA 3VAMA 3E3XA 3K7RA 4DMZA 3VZIA 4NA3A 2V0NA 4PR6A 2I2YA 1NK9A 4JI0F 4B3MF 1P8GA 3L7PA 2LDIA 4FF2A 2EPIA 2MKSA