2OMUB

Crystal structure of inla g194s+s y369s/hec1 complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
GPLGSWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermodynamically reengineering the listerial invasion complex InlA/E-cadherin.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Cell invasion/cell adhesion
molecule keywords Internalin-A
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2omuB00
5CZRA 1Q1PA 1WYJA 4APXA 2A4EA 2OMTB 3LNEA 4NUPA 4ZMTA 1WUZA 1SUHA 3K5SA 5DZVA 2OMWB 3LNHA 3MVSA 4QD2E 4ZMZA 4AQ8C 2OMXB 3UBGA 5CO1A 4XXWA 4ZMWA 1L3WA 2EE0A 4AQAB 3QRBA 4APXB 4NUQA 4ZMVA 4ZMOA 4ZMYA 4ZMLA 2WHVA 4AQEA 1ZVNA 4ZT1A 3Q2WA 2YQGA 1O6SB 3LNDA 3UBHA 4NUMA 4AK1A 1NCGA 4ZMPA 1NCIA 3K5RA 3K6IA 2X2UA 1NCHA 3K6FA 3LNIA 2WBXA 3FF8A 1NCJA 5KJ4A 2O72A 2OMZB 3Q2LA 3LNGA 3FF7A 4AQEB 2WD0A 2WCPA 3LNFA 4ZMQA 1FF5A 2YSTA 4AXWB 2OMYB 2A4CA 2OMVB 3UBFA 3PPEA 1OP4A 4ZMXA 2V37A 3Q2NA 1ZXKA 1EDHA 4NQQA 3Q2VA 4AQ8A 2QVIA 3K6DA 2OMUB 4AXWA 4OY9A 4ZMNA 4ZTEA 5JYLA 2QVFB 4XXWC 5JYMA 4ZI8A 4AQAA
chains in the Genus database with same CATH superfamily
4NRXB 3F7LA 1KXHA 4ZUSA 3FFDB 4RWHA 5DGRA 1Q1PA 1UJ3C 1IAIL 2EYSB 3EOBA 1HHJB 1TITA 3DTDA 3GMQA 5CHNA 2DJUA 4P3DA 3VSUA 4PSPA 1YEFH 2X12A 3ZYIA 1JYWA 4AMWA 2WZ6A 1V55B 1NDMA 3U1PA 1KDIA 5JIIA 2P4AB 5LG1A 4G72B 3CH1B 5D5MA 3CSGA 4ERSH 3I2CH 2OR7A 7FABL 3LEVL 3RGVA 4A04A 4OLYH 5EUOE 1RIVL 2RH0A 4NNPH 1I3GH 3IDJB 3BKML 5AVVB 3PGFL 1HT6A 1ZS8B 1KPUB 1JNNL 2H1LM 3EGXA 3ZE0F 5C8JA 2OQJB 4OGXH 5LXVA 2J5WA 3BHBA 4HIEB 1JFQL 5INDB 4ENZA 2BOCA 5FECA 4BFEA 5IBLD 4G5ZH 5C0GA 4PS7A 1BQHB 1VACB 2A73A 2AK4A 2A38A 2AP2A 1OCOB 4HBCL 4UTBL 5FCUH 5C6TL 4JUSA 1TEGA 1MG3C 1GZHC 1UH2A 4FABH 4JW3A 4LSQH 4CVXB 5HYQB 3QUMB 4LSDA 3ABMB 3INUH 5F0LB 2XQYG 4AUJA 4Z7IA 3C2AH 4LNRB 5L88L 1GTNA 4KDTC 4HKJB 5ALBL 3SDAA 1E4KA 3OQRA 1JN6B 1RZJL 2GY5A 4HHAB 1MCRA 5DEGA 1EXHA 3BHBB 2PYEA 2YHGA 3EOAA 3FT2B 4YUEL 4EI6A 3BZFA 3RNKA 3FQWB 3NIFE 4UTAL 5HYSG 2O61A 1AGBB 1VACA 4N2KA 2AQRA 3JZ7A 2VM9A 3JWNG 3KLAA 3OMAB 3HE7C 5E00B 4U1SA 1NGXA 3JWNE 1CCZA 4H1LH 5GRXG 1SF5A 4KXCA 3D7PA 1S7WA 2JCCE 2NXYD 2V7NA 1C1EH 3D34A 5HHNB 4N9GB 4UWQB 2UUDH 1U91A 4KH2A 4YH6A 1FLRL 3VSQA 4HHAA 3WJLC 3GK8H 4QRPA 1FFOB 4CJ1A 3KH3A 3MRDA 1SYVB 1S4IA 3SJVA 2BIQA 4LKXA 1OAKH 4NPKA 4WU7A 4ZW7A 2AEQL 1INDH 4G71B 3U9UB 1PD0A 4HALA 1XVSA 1ZDQA 2X6AA 3OLDA 4OZIE 3HLKA 2I25N 5AYTA 2P47B 2DLFH 2JE8A 2OYLA 3O8XB 3QDHA 4JM2C 4UUJA 4M61B 5B21A 3BKMH 1NEPA 2WXHA 5A2IH 3V0AC 4HJIA 1ANUA 4QOKD 1F56A 3BI9X 4MRCA 1VFMA 3HBGA 2AEWA 3ZUCA 3F83A 1X5JA 4ZFOL 5HGBB 4QRPD 1WA2X 3AB0C 4D8OA 1B0WA 3GMPB 3KPNA 3NACH 4B9IA 1MHHB 2FJGA 4G11A 4Q2ZB 2DI8A 2EE9A 1KEMH 1GCFA 3DJ9A 3KXFD 3QDGA 2JH2A 1OCCB 3O2DL 3HKFA 2QGDA 4WFFD 4X4YA 4AKOA 2NY2C 1NFDF 1J1XL 4HKBB 3HB3B 5ID1A 2QKIA 5HYSA 2F7OA 1QO3B 1KGWA 1KIRA 5I66B 3U0TB 1SFDA 2NOYA 4W9ZA 2LVCA 4P46C 4X6DF 5C0NC 1E4WH 1SJHB 3UTZA 5I73B 5T3ZH 2O6CA 5F96H 4NQVB 2Y7OA 5CMAB 1V7NL 2VC2B 2Z9TA 3ABGA 1N7MH 4PGZA 3EJZD 4PY7A 4XPHH 4HLEA 3KLHC 1QPKA 4OF6A 2ZCKH 3UYPA 2WO2B 1INQA 2BP3A 3U1SH 4BXVA 4DQAA 1G87A 2VABB 1NINA 4G70B 2I9LB 3F00A 4JNXA 4ODTH 3QXDA 5JPNB 2OSWA 5E4EC 3FQRB 2C1OA 5FFGA 1IGCH 3DIFA 1XF2B 2Q8BH 4GKZA 1F2QA 4OAWA 2HKFL 4WEMB 3V6FA 3IJEB 4GRLA 3BVVA 1ADQL 3CQFA 4FTVA 4MRBA 3LHPH 4RDQG 1FIGH 3KPQB 3Q5OA 4MZRA 3WO4C 4OZIA 2FUQA 3LDBB 5DHVH 3SJVE 1LM8V 2F6AA 1QI5A 1DVFA 4RAVB 2NW2B 4TTDC 3B8YA 5DWUL 4TLUA 3QNZA 4XNQA 5CP3A 2YSTA 3N42B 1L9MA 3PAZA 1EVUA 3MBXL 1TCMA 4WCYL 3NIFB 1OSEA 1YHPA 4X6DA 3UZEA 2ZCHL 2EE2A 4JQXC 3NQIA 3ATDA 3WXWL 1IZKA 3D69A 4FP8H 4MS8D 4DZBB 1UEMA 3DBXB 4FL4B 4LEXL 2OJEA 2JJSC 1ZV2A 1PJWA 3D18B 1WBYB 3GKWL 4NKMA 4QTHB 3I85A 4UOW1 4KZEL 4G6AC 2PXYA 4G7VL 5ITBH 5C08E 3RNQA 2KQMA 2IV8A 3EH5B 4HJJL 2ZAGA 4FXKA 2WY3B 3QI9C 1T83A 2HX7A 2MMXA 1DQVA 4J2QA 4NXKA 5SWZB 3QUHA 3WTXA 4U1JB 4PJHF 5F9JB 4QCIB 3C5JB 1HSBB 2BP8B 4PRPB 1MCSA 4K71B 4N1CA 2MHAA 4U2YA 2J43A 4AL8L 1CXFA 3JV0A 3LS4H 3WFCL 5HGHB 4QYOB 3O6MH 4HUUA 2W38A 3BVDB 1KBGH 2HPOA 1J5IA 2IAMC 1CR9H 3IMBA 2VO5A 3KL5A 5TQ0H 2H26B 3BAIA 1WV7T 1YEHL 3KEHA 4XP9H 2A9DA 1M7DB 3WI9A 1BMZA 3MXWL 2OLDA 2WQAA 4XAWL 3UH8A 1SDDA 2UY7B 3FQUA 3MVSA 3AXLB 2AHIA 4Q9RL 4NQEA 3MRFB 1BQKA 5CO1A 5EUOA 2P49B 2Y36H 3ROOA 3B9EA 3CXDL 3IGUA 3GINA 3H7BB 1L3WA 4XI5C 43C9A 1HTYA 2JSFA 2XV2A 4P2QA 3PJSB 5I5RA 3N1MC 3TFKD 4HEPA 1O7SA 1TQCB 4FA6A 1U8NB 4H26A 5DJ6A 1ZA3B 3DXAD 4ODVL 5I1CL 5LHDA 4XMWA 4U2ZA 4GT0A 2B5IC 2E56A 4YDVA 3TL5A 4BDVB 3SPIA 3VFMB 2XN1A 4JL2A 2D7QA 1NGPH 1WRFA 2XWTB 4PUBL 5I19H 2GJ6B 2O5ZL 2JELH 3ECVA 2X44D 2V9QA 1B0RA 1S9XA 4X8JB 1UHVA 1QNZL 1CN4A 3K6IA 2XV0A 4PGEA 3G5XB 2YPVL 2NSMA 3QJUB 1T6VN 4FXTA 3CHQA 4GT7A 4PJFA 1JV5B 2DQTH 3GJFH 4HEPG 5IB2A 4ZFOA 1OAUH 3HIZA 4FQHA 4PI0A 2GBAA 4YE4H 3TA3C 2UWEA 1NCJA 3VFPB 4HKXB 3POHA 1DQLL 4GKSB 3WSQH 1T7ZA 1B3JA 4KNTA 5IFJB 1B2WL 1C5BH 1MZYA 4AV4A 4BDVA 4L3CA 4M6MH 3VG0L 4J28A 5E1AA 1UXWA 2ZCLH 4ALAL 4CW1B 1CDYA 4KAQL 1CTMA 3B34A 1J9TA 3KLQA 2G2PA 4J5VA 2F8OA 1IJNA 4IKLA 5EOTB 1CFNA 5G4NA 1MIML 1MCIA 1MLCA 4GKLA 4HCFA 5I76A 2EKSB 2AQ3A 4XVUD 2ESVE 4UT9H 2MRYA 3AU1B 3OR7B 5KVGH 1PVHA 1QG3A 4IRZA 1FVEB 3MRQA 4HKBA 1JZIA 2A74C 1SVBA 4CDGC 4NQQA 3TO2A 2F2HA 2MNJB 2R1WB 4MNGA 3H2PA 3MV9B 2BNRE 1WLHA 4UQIM 3G6JF 3TV3L 4UT6L 1Q9KA 4JO4H 5F71A 2PETA 3HE6B 2CLZA 1CLOL 3MLWL 3BPOC 5JYMA 2IDQA 3ARFD 3HCVB 4QHMA 5CILL 5A16B 3LY6A 4W9EC 2IBZX 2AZUA 4MB4A 5I6XB 3E6HA 1HYRC 3VA6A 3FO9B 5MI0B 1F00I 1LILA 3BSGA 3WMPA 1B2YA 4ACPA 4OGYL 1Z9OA 2JK5A 5KS9E 1LK3H 4ABUA 3RWJB 1DBJH 5EFIB 3V4VA 4LCWD 4WU5A 4N28A 1XGPA 3MRNA 3TO2B 4NN5B 4JFXB 4P5SA 1Q9OB 2AAVA 3II1A 3O9WD 2VLLB 3IRCA 1C8QA 3VDCA 3WG7B 3ILEA 2FLRT 3KWWA 4MB1A 4OGAC 3U0WL 1BW8A 1ACXA 3QORA 4ZMZA 3QG6B 2L7JA 5D7IE 5I24A 2WXJA 4J3WA 4LLVB 1JI1A 5DF0A 1KBVA 1WGVA 4S1DC 3VX1A 2BY0A 1E8ZA 3HHSA 3NG5A 1A02N 2H6UA 2WLIB 4NO3A 3SCMB 5AFAA 4AE0A 3PNWB 3PWPE 4WUKL 3V0WL 4B0MM 2WLLB 1H3TA 2WBJB 3CXHJ 4CL7A 3N42F 1OGAE 3GZPA 3BZDA 4KTDL 3QEQB 5ICZB 4Z0BH 3QQNA 3UTTE 3UAFA 1SN0A 1SYSB 4KH9A 1VGEL 3C8KB 1NCAH 4FKHA 5H8DA 1EJOL 3OAYK 3QDJE 3GHEL 3TYGH 4WNQB 3RKDD 2FX8H 4UZUA 4X5PA 3S35L 4NM4H 4NEHB 5CCKH 1JZ4A 3VDAA 2J21A 3T3ME 3FO0L 3CD4A 1KN2L 2CGRL 4G8IB 2C9RA 1CFQB 3NCYP 4AMXA 5FR3A 3FU3A 3KLKA 1CVSC 5HHME 3DYPA 3O3AA 3OBAA 32C2B 2DM7A 4ODHH 4CC4C 2DJSA 5GSRB 3HHRB 5FO7B 1MFAH 3H3PH 3KYKH 4P4KD 4I4WB 3EOTH 5EU7E 1GOFA 1E9PA 3DSFH 4OV5B 1EAOA 4DP0X 4QUOA 4X83A 3C8KA 1BYPA 2EICA 4X6BA 5GISL 5D6DC 2OBGA 2JIXB 3OF6A 2WZ5A 3F85A 4PRIE 4NCDA 4WNQA 3FFCA 3ZL4H 5KYWB 1MW2A 4XBEH 1A6PA 5IBTH 4NM4L 4XHQA 4YLCA 4EOWH 4BD4A 1FYTA 1EJOH 3F58L 4JR9H 1WVZA 4KQ4H 4JE4B 4Y4FB 4ZTPL 4Q0XL 5IHZA 4RFOH 4H0HB 1VGEH 2VJ8A 4ONHA 4ABQA 1T0OA 3ULVF 1M6OB 1N4XH 1I8MA 4LVNC 4Z7WB 3L4CA 2JB6A 2YD4A 4GAFB 4RQQA 3FYEB 2JIXA 1YZZA 1PKQA 2DDQH 3VYOA 4LCWA 5ID0B 1L6ZA 4XCFH 3V7MA 3ZOAA 3AITA 4R5TA 1ZT1A 4O51A 1X7QB 3VD5A 3DETD 1TMCB 1GS6X 3RTLA 4R2GB 4PH8A 1DUYB 1PYWB 2NZIA 2NY1C 3P02A 2W1NA 4N6RA 4X0NA 2FLBT 2YIHA 1RK7A 1P7QD 3N41B 3O6KL 4AKQA 1D3CA 1RIHH 4MD5B 3QJVB 3RDTC 4Y16A 1WBZA 1YC8A 4ZNEE 2D9QB 3TBVA 4DOHE 4F3FA 5KYYA 4J3UA 4Z7WA 4WK2B 1JK9B 6PAZA 5DLMH 5JNYA 1U4EA 4XP1L 4Z95L 2Q2EB 3FT4B 4MD0A 4NCC1 4RA0C 3FAWA 1Z9PA 4TNWF 3D2TA 4W6WB 3W3BA 5T3ZE 4NDMA 4L23A 4WI0A 1BA9A 4N2IA 3ARDD 5BRZE 3EH2A 5T5NF 2VZVA 1AY1H 3OZ9L 4MDIB 2BO0A 1JTTA 2UZXB 3L1GA 4NWUL 2ZYSA 3AS3A 1V54B 3LH8A 3QJTB 4LOVA 2AJZB 4Z7QF 1XB6A 1ZJAA 2BNRD 4NRXA 4G9FA 1FYTD 1SXZA 1WWWX 2GCYA 2Z65C 3K46A 3SHSA 4HJUA 4JFHD 3R0MA 2ZUYA 1HHJA 3HG1E 5CHNB 1E5CA 1R4XA 1DQQA 1E8XA 1ET8A 2ERJC 4PJCF 4EIGB 2JNZA 1IL1B 1NWOA 4FQLL 1D5BA 1I85C 4Z3FA 4G8EA 2EDYA 1MIMH 2HMIC 1B88A 3DGCR 2IF7A 4G6JL 4AZUA 1KJ2H 1PL3A 4AW4A 3CZSA 2BIPA 1RK1B 4J1UA 4O5LH 4IMKC 4U1NA 4HLZG 3MO1B 1UYWH 3DKHA 5I1LB 3VFWB 4HCRA 4JMNA 1I7ZA 4KOBA 3Q1EA 3ARQA 5CJOH 3SKJH 1A7QL 1DJZA 1GKEA 2AJ3A 3FRUB 1UXSB 3ML8A 4KZ0A 2XIDA 5PCYA 5C8JB 5GS2D 4AGMA 4K3EH 2EDOA 1DQLH 4X5QA 3WSQL 1KELL 1FO0B 4OD2B 3TVMD 2FEJA 4H13C 4K94C 5BRQA 3T8MA 4F7PA 2NZ1A 3QIBC 1V27A 4I48B 5IT2H 2HUHA 5ISZB 1P9MA 4Z3TA 1L6XA 2DIJA 1AE6H 3L9RA 3ULAB 4KNUA 3NIGB 3CFKB 3Q8BA 5DGQA 1ORQB 3TASA 3W2DL 2XZCL 2KQNA 5F7KC 4RMUA 3KPRA 1I9JL 4MWFB 3CX5K 2P24B 4GEIA 1XEUA 3IFOA 2OXGB 1T5XA 5EOCH 5CLWA 4XI5D 1IEHA 3VI3B 4G42A 3D87B 4YHYC 2B59B 4WDIA 1AYRA 1LYQA 1ZAGA 3RVTD 1IGFL 1OTUD 2VDOB 3AM8A 3FT0A 3N06B 4EIBA 1WFNA 2J88L 4LF3B 1XF4B 1EH9A 3LIZA 4AYEC 4EI5B 1ZPUA 5DD5H 4FS0A 3N85L 2ORBH 1IGIL 4NAJA 2RFXB 4S0TD 4PJXE 3SD2A 3ILDA 3QUZC 2VDKH 3H85A 4XP9L 5ETUB 5DD3L 4ZS7H 2JQZA 3ZO9A 1TJGL 3IDNA 1TZHA 1F86A 1ZXQA 2XG4A 1S7XA 1TQBB 4I5BA 4O2FA 3VXNA 1CK0H 3WFCH 4AVIA 3BMVA 1OHZA 5B38B 1QRNA 2VZUA 2W65B 5BZZA 4WU7B 4AEEA 4ZPTB 4EXPX 1P5VA 4JQIA 3ARDB 4PLOB 2ZOLB 4A55A 2HJKB 3QRBA 1U58A 1QD0A 4DAGH 1LP9F 3QFJD 4HJGB 3IK2A 1F1AA 4WGWB 1KC5H 3CFIC 3MRHA 4I77H 5C0AD 1ND0B 2PABA 2VDKL 1AZZC 3WFEL 2IPUK 1EEZA 2BWIA 4OCMC 4RFNC 1WO2A 1PQZA 1CLZL 4YSUA 5FA3B 4BH7B 2VR3A 1IARB 2R4RL 4MAYC 5DLLA 2NPLX 3OJ2C 3IB4A 3RZCA 3QZPA 5ENWB 5IMMA 2EDBA 1JZGA 3ZVVA 1NCIA 1ULVA 2WOBA 2UZIL 4OFKA 2W9DH 1LO4H 1U6AL 1T89C 1ZHKA 4OUUB 2YBGA 4YBLB 5HHPB 4MNQD 2ZOLA 3KXFB 1AANA 2MNUA 1QSFA 4YC2C 1FP5A 2NY4D 2P1YA 1ZLDA 1I1AD 2DW5A 1K3IA 1FA4A 2Y2TA 1EHAA 1IC5H 3ETTA 4ZOCA 2DOCA 3PHQA 2IQAB 2VR7A 2GAZB 4RWYL 1JNLL 1KJ2A 4KK9C 1PYWA 1ZGLP 2DWEA 2HRHA 3WENA 3I84A 4NFCA 1NIFA 3DWTA 1V8HA 3Q5TA 3TWCL 4TLTA 2YBRA 3OXRA 1FN4A 4MA7H 1JI2A 4ZOEA 1HHKA 2PCXA 3RDJA 4OF8A 3S34H 1BVNP 2AXFB 4IGBD 9CGTA 2WP3T 1R47A 1SHXA 4QOKB 2VM4A 3RVUD 2NY4B 1UURA 3UJTL 5GS0C 5JW4N 2OYPA 2Q9OA 1CT8A 3T2OA 1OANA 1VKXA 1QBMH 2BJMH 2FCBA 3CFBB 2C3HA 3OSVA 4KK5D 5HVHB 2GAZA 3CDYA 4Z7UF 4MDJA 1YEIH 4HPOH 1QO3A 1KEGH 4P2OC 2FJUB 2VITA 5T3ZL 4M6AA 2DD8H 3GGWB 3EGSB 4XN4A 3TIEB 2EYRB 3FB6B 3AG1B 2K9UA 4EUPB 1ZLSL 5CWSA 2ICCA 1E3ZA 4PJDB 1F6LL 4M7LH 3KPSA 3BWUC 3O3DB 5CGBA 2AEPH 4HUWB 1BP3B 5ITFA 4PWIA 1S7QB 1ZA6B 4J4PC 4JB9L 5PAZA 4AYSA 3LPPA 1VFAA 1XL6A 2PO6D 4FFYL 3CLFL 4GG8A 5FUOH 3UPRA 3MJWA 2XXFA 3BAXA 1CI3M 5ESVB 3M07A 4QRTB 4Y1SA 3L4VA 3WFZA 5J12B 3VFWA 2ZXAA 3OAZK 2UVEA 4I0KA 5ICYB 4NGHH 4QGTA 3LKQA 4NNXA 1NFDB 4EUPA 3U1QA 4H2CA 3OPZL 3TZVB 2CK2A 5J13B 4P5KB 1Z5YD 4TVPH 1W8NA 2Y69B 2WVSA 2YPLA 2ZD0A 3TH4T 2BSRA 4PJ5E 3O6KH 2CSPA 4PS3A 3DUUB 3FQNB 3GM8A 3WKPA 4U1SB 2XKUA 3ATEA 4EKXA 5D7JC 3UBHA 4F7TA 3EYSH 3SDXF 2XTJE 4MS6A 1WWBX 2WLZA 4ZMPA 1E28A 3VYPA 2HZHA 3VXOB 1OD7A 1HIMH 4UDTB 4JFYA 4QF1B 4G8FA 1HXKA 4XCFL 1LO3L 5B1BB 4XC1L 2X2JA 3BH8A 1JHLL 3MMEA 4IQHA 2IIJA 3D39D 4QRUB 3FU0A 5G5DA 3ZKXC 2E9WA 1QHQA 2YEZA 3M1OA 4HGWB 1RURL 4K3GA 4PJEE 4U1HB 5I30H 3BISA 4YXLL 5AVZB 5LN8A 4AM0Q 1O9VA 1HQ4A 1Z6JT 4ODSL 3ARRA 4MKTA 1MI5D 2IH1A 3GSOA 3WNIA 2ZYIA 4GSUA 3QCTL 4JKNA 1WZ1H 1FUNA 3F58H 4YUEH 2NY7H 2YZ1A 2FD6L 1OSYA 1U92A 3VFSA 3RFZC 1IQDB 4XBPA 5IBTL 3WTSA 4OFVA 3QPKA 2I60H 2SEBA 2A1WL 5E6IB 4YHNB 3ULUD 2GJ6A 2O5YL 2ODHA 2AJUL 2PR9A 2FIKB 4ELMF 4L05A 3OJDA 1G7MB 4GSDH 4XNYH 4D9LL 2GJPA 5AD0B 4KRPD 2LLLA 4KVPA 4PRAB 3I50L 4WWKC 1NCBL 1EHXA 1Q9LA 2D7MA 2ATAA 1K5NA 5GZNA 2WOYA 5KBDA 1QRKA 4KK8D 2WXIA 2BHZA 4KDVA 3MRFA 2CGRH 1KN2H 1AJ7H 1YN6B 5DO2D 3VFVA 4OCWL 2WZPD 3UYRH 3U7AA 3FQ2A 2D3VA 4JQVA 1CI5A 2RQ8A 4FTVD 4M6OH 3US1A 2YKLL 1ESOA 1QEWA 4XCCL 3BC9A 1CYWA 4DVBB 4XMLH 2WWMC 4EN3D 4Z0BL 1AKPA 5FM5O 1FRGL 3VTAA 1G0YR 3BMWA 4QJ3B 4UU9A 1MRDL 5J1SC 1G7LA 2HJLA 1DDHA 1YAIA 4LBAA 3AB0B 1J8HD 1SOXA 2YD6A 4AQ8C 1RV6X 1FFQA 1NPUA 4F20A 4XNZC 1G7IA 2J5LC 4M03A 4QNPF 4XP6L 4D0BA 2R0LL 1OP9A 1MF2L 3RHWF 3ZIYA 3H9YA 3WELA 4NXSA 4BFIB 2HJFA 5LWYH 3KYNA 3D9AH 3NA9L 3UL4A 1RZ8A 2Z7ZA 2HFEB 3QA3B 3QPQC 3L54A 2PCYA 4KKCC 5FB8B 5DFVC 2VDRB 5GPRA 5JHBA 2VZ3A 4GAGL 1EFQA 1F4YH 5C9JA 4TS6A 4DIXA 4IS6B 4DTGL 5BRZA 4B9KC 2LAGB 4NWTH 4PJCB 2CA4A 3UC0L 4LLYA 1ZWIA 3BQUB 1OE3A 2MQCA 3D4CA 4IRSB 4NZRH 1DANT 4OCXH 1ZIAA 2HKHL 5FYLL 1UWFA 2AV1A 3NSYA 4OFPA 4Y5XC 5EOTA 4D0DB 4QO1B 4Z7WE 2QT6A 3K6FA 3S36L 4M8QA 3NJLA 4GPVA 5EULV 3RUGF 4AIZA 4UNUA 4AYFB 3QXTA 2B39A 3DOSA 4DO5A 4FTDA 1E6OL 5LO7A 4TUOA 4U6HA 1U93A 5DWPA 3JWOH 2VDMB 4XB7A 4OM0L 4A37A 3LH2L 1SOSA 1U8CB 2CBTA 4FNLL 2X05A 4TNGA 3K0WA 1SBSH 1CXEA 3NCEB 5FHAH 4J6IA 1I9RH 4GW4A 2E46A 3VFUA 1TYJA 4P2OB 5TE4L 2R8SH 4HFWB 1TLMA 2P46B 3AREA 5KSUA 3GZOA 4DP9X 4U7SA 1SYSA 3LZFL 4KVCL 1BPLB 1FGNH 4OD1H 2X4NB 1AXTH 3SPGA 5E2VH 2CO7B 4GXFA 3ZO0A 1YEKH 4DK3A 2V37A 2LTQB 4P4KB 5EZLB 2WXGA 5I17A 4R7VA 5C9KA 4LBEB 3DUSA 3NH7H 1B4LA 2J1XA 4HF5L 1JV2B 4YVUA 1TETH 4AC4A 2PWGA 2UY7A 3GUFA 5C6WH 2HFTA 3JV4A 1OAUL 2W0LA 2XETA 5HYFA 4HLJA 5H4ZA 3MX0B 1I3UA 1CD8A 4MA3B 4L4VD 2H45A 2R0KL 2Q1EA 3ZSSA 3KG5A 4XXDB 5IG7A 3UTTD 4YSPA 1ES0A 3VXRD 4PS4H 1YPZA 5MEPA 3GI9H 5HYIA 3HC3H 4ANXA 1EZVY 1NGPL 1E5ZA 2FNBA 5KBMA 5C08B 2WBJD 3MRKA 4JPKH 2E7LA 2Q3AA 1A4JB 2P7TB 3VRIA 4HWBL 4P2RB 4QD2E 3CFJB 4PWHA 4HGWA 3NRQA 3NDYE 4RGND 3F5WB 4TULL 1T4KA 2PXYC 3BUYA 5EMYA 4ONGL 2GSGA 2J20A 2HVKB 3QHZL 5IG7B 2D9CA 2N3JA 3IF1B 4WTQA 2HRLA 1MCEA 4ZUVA 4OUOA 3QNFA 5IJKC 4JQIH 4P2AA 4PD4J 2H32A 3ATFA 2ITDB 4IBUA 3K6OA 4H20L 3MGTB 4GW1B 1YMMA 2O6DA 1T7XA 5DK2A 1O0VA 1J0HA 2EXTA 4Z3IA 2QFRA 2FIKA 5EU3B 3UAEA 4KX8A 3TVMA 3SO3B 4A63A 4R3SB 4YFLF 5JQ6H 1KTLA 4KI1A 1YEJL 3TBVB 4UQEA 3PJSA 1N5AB 3REVB 4YDLC 2CUHA 1L7TH 1LD9B 2OMZB 3FHQA 3FT4A 4LDEB 4MD0B 5FPIA 4KZEH 2WINA 3NH7L 4P2YA 2F18A 4PVLA 4XPTL 1TJXA 5DD1H 3PAYA 1BFVL 5AVQB 4M61A 4BH8A 3NSJA 1OHQA 3QYCA 1G5GA 4OFYA 1QMUA 3CQPA 2FNWA 1JGEB 4DK6A 3RPIB 3WTYA 2VISA 4AVHA 3LZFH 4KVCH 4J6RL 1XEDA 1CL7L 2VH5L 3HCVA 4IKIA 1DBAL 2H2PD 2ZYRA 1CMOA 5IMOA 1HK6A 3G5XA 4N2LA 1T2QH 4XRCB 4NZUH 2FGZA 2RJMA 4J23A 3VXMA 3GRBA 3CDCA 2QL1A 3CN1A 2GFBB 4LSTH 4OJDH 3K3QA 1RUAH 2B4CL 2WXNA 4ZG1A 1WAEA 4V2CB 5F93C 3X1BA 3AABA 4K7PL 4OZGE 2K8MA 4PG2C 3MLUH 2PPFA 1U8JB 4M1DL 3CN2A 1SN2A 2YD8A 3FB5B 3O6LL 3OB8A 1ZHLB 2O5NA 1TVHA 4AYGA 5GS2H 5J06A 4L8SC 2ETWA 1OZUA 1IUZA 1M05A 1WAAA 4NP4L 3MOBH 4NRZA 1LEIB 3MLTA 3X14B 1NSNH 4J3OD 1XMEB 2YRBA 1BQLL 3L08A 4QNPE 1YSOA 3ULUL 5D6DA 4HJ0D 3ETSA 2CJSA 3CPLA 5LKNA 3B5TA 3IFPB 4FL4C 5G4OA 5F3BA 2ODIA 1C9SA 1A47A 4K4KA 4WO4C 2LLGA 3D07A 4PCKA 5I1HH 5AW0B 2A6DA 3CSYA 3VG9B 3GBNH 2H2SD 5AAMC 1ZLUH 2EXYD 3GI9L 3WS3B 1UOKA 5E9DA 3MA9H 3SYPA 5IOPA 5KSBB 2EYTB 2E27H 4DP4X 2R2HB 1KJMA 2FX9H 4YHIB 4FLQA 3D3VB 5BOZG 1RUMH 3FTSA 3UGEA 3MACL 4GW4B 3S5LG 1C16A 1IGMH 5EZIL 3VMOA 3EKCA 1P7QA 3KH4A 1EEYA 1ZVNA 5CGYC 4AIOA 2X4UB 1F4WL 3C60B 3IKKA 4EZLA 3P9MA 5FK9B 1MCOH 4GRWE 3GI8H 2ATPA 5HYJB 3O8XC 3VXRE 1CL7I 3LVEA 3RWDB 3UYRL 4DGVH 1CXIA 3KL3A 4AQ1A 1UATA 2R69A 5ISZE 2OL3B 1SDAB 3D3VD 3HRPA 2B1AH 3L5XH 4P2CG 2QMJA 3KJ6L 3OG6B 2AEQH 3D1MC 3DX6A 4N0FA 3TT1H 1BYNA 2JKIS 4FNLH 2FYYB 1R5VB 4GW5A 4WI8A 4ZNCD 1CF1A 3WE6A 5C70A 3I6GA 1KPVB 1NA8A 3WY1A 4M7JH 4QLWA 4H1LG 3P4MB 2OMYB 2VMJA 2ZG1A 1RULH 4PW9A 1MRCH 2EXWD 3EDEA 1PZDA 2VW6A 1Y18B 4MMZA 3H6JA 1XF4A 3PPEA 1UD6A 4NOBA 3A22A 4OV6F 4W4OC 3G3LA 5F0PB 5C08A 2JQAA 3ZHDA 5IMMB 5AW4B 3WS6C 2CJ3A 1NEUA 5A6LA 4YK4C 3QQ4B 4PJ8D 3DTXB 4N0FB 4EI5D 1J5OL 2OCCB 4UZSA 4M7ZC 4G9FD 5T5FH 3GQFA 3I6GB 1AMXA 1S9VA 4X4XA 5IM7B 5K1VA 4FCHA 4X6DE 5B4MC 4AXWA 3FQWA 4K94L 4U0RB 4XMUA 1ZHBA 2UYLB 1LMKA 2F53A 2FO1A 5ECJE 4PB9L 1JAEA 3P4NB 5IY5B 2WWNA 1M3IA 3CFNA 1Y0LB 3VQ1C 3SZKC 3PWUB 1AD0B 3HRZC 3H42L 3FN0L 5DFWH 4JKKA 4AJWA 1GGCL 1DE4B 3B1TA 2CK0H 1XCTB 4G80B 2EVJA 3O41B 5CZKA 1ETJA 5D96B 1NBYB 5SWSA 1FRGH 1DBBH 2YBRB 3OXRB 4FTVE 2BC4B 4UV7H 4X7EC 1I4FA 4L9LB 5BOJA 4O2EB 5FOJA 1YQVH 3ZKMC 4X5XB 3UBGA 4HT1L 3TCLA 3WL9A 1QVOA 5AAPA 3E8VA 2WXLA 3S3PA 3U25A 2WINB 2YPVA 1U3YA 4XXCA 2XVGA 4HS6B 3RTQB 1NC4A 3PDDA 5C07B 4IBYA 4KHXH 2RGSA 3F2LA 2NUTB 5D1ZC 1AKJD 5EN3A 5KJRH 3ZHFA 3TXAA 5FO9B 1CD0A 5E6YA 1BM3H 5JW3L 2AEPL 2G0LA 3LRSB 5E94B 3TBYB 4NUMA 3PGDA 1BAWA 1I4FB 5KYXB 1NPNA 3HVDA 5CSZA 1CG9A 2BVPA 1EJ6A 3LMJH 1WTLA 4D2NA 2X4RB 4OKVA 4ENEC 1UZ6F 2VAAA 5E2UL 2F54A 4KI5D 4RMSA 5LAPA 2MKLC 5KJRL 4QKTA 2PF6A 1G9NL 2F53D 2VCOA 4L8DA 3H53A 1RK0A 1F3JB 3LKQB 2Q8AL 3KXFE 3EZJB 1BBDL 3IPBA 1K4CA 1HCFX 2PP8A 3PP3K 4XMPL 2DLIA 2DQMA 4IRJC 3N6YA 3IS1X 4XVSH 4P3CH 4Y5VA 1TYEB 2F15A 1SY6H 1ET5A 1KFAH 5H94A 3VA2C 2VSKB 2OX5A 2VXQL 1JHLH 5J5EA 2JK5B 3EYOA 1PDKB 2ZUQC 3KPOB 2E74C 4EI5A 3FUHA 3HR5A 2KDYA 4LESA 5FA4B 4RWYH 4LHJB 1AZCA 3QUMA 3IMTA 3WN5B 4ZD3H 1CQKA 1A0QH 1P1ZB 2P45B 1OALA 4BZ2H 3LVTA 5JIQA 1RAMA 2RFXA 3H42H 4QF1A 2XXCB 4JO1L 2VDQL 3L4ZA 3MDJA 3FS9A 3ZE2B 4DKTA 1XFPA 2EUZA 1UD2A 4X4ZA 3RY4A 5JLZB 4JLRB 1CF8H 1YA5A 4S1DD 2E59A 4C57C 4OCYL 1HZKA 3Q5YA 3EO0B 4B41A 1IGJA 3EYVA 4NT6B 4XB3A 2HJKA 2H0PA 2ICEA 4JKPL 4YBQD 2CLVA 2ZP9A 4GJTB 5CN1A 1DP0A 5E23A 4I48A 5F1IB 1D6VH 2Q7NA 3VXTB 2PYEE 5ABAA 5H4YA 2H1PL 4FFYH 1U8PB 4LCCA 1A1OB 2ZQKA 3MCLL 1HEZB 1XR9B 5E9AA 1DLHB 3S37X 3CZLA 3HE6D 4M6NH 1J86A 2C4XA 3QJQB 4WHCA 5GGTL 4MX7A 2XQBL 1T1XA 3VAEA 3NEOA 5F97E 1KNOB 1UOVA 1SMOA 2AK4E 1KPVA 4HPOL 4UIKL 4HU2A 1CU4L 4Z7UA 5CUSH 4TSAL 3VVWA 3L5XL 3W37A 2ZAIA 4JG0H 3B2MA 3SBPA 3RUGB 3NCMA 5D7LB 1UWYA 1BIIB 4FXGA 3MBWB 4ZAKB 4ELMA 1EBAA 1SJVA 2W5PA 4PJAA 1INEL 1DLHA 4MMYA 5K9OA 5EIIB 1AOZA 2B0SH 1KYFA 5AB9A 2Y7NA 3OKDB 4PAZA 3STLB 4FERA 4K55A 2D2OA 2ADIA 3WLWC 1I1AC 1D5XA 1D9KC 4W9CC 1X5MA 1TNMA 1ZSDB 2YPLD 4X9FA 3K8LA 4XO9A 3X3GH 1T21A 2JI1A 2X70B 3BQUD 4IRSD 2EIKB 3QEHB 1HQRA 1RUKH 2IOOA 4JPVH 5I74C 1PKOA 3VH8A 1HE7A 3N3EA 1QFOA 4NAQA 4M3JA 5TDNB 4HV8B 4ZFFA 5KSVB 4I0CC 2J3SA 4QDGA 2W59A 1FFNA 3BPLC 4MTMA 4H8PA 3OG4B 5D2LB 3V6BR 2CDEB 3H1ZA 4R96A 4TVPE 4OCRH 5IFAL 2VLJB 4Z3HA 4WO4B 3C09C 1DJGA 1W0VA 4BK5A 1WBZB 4KRNA 4Y1AA 4DP7X 4HUXA 5IB3B 4N2FA 2VZ1A 4L1SA 5DC2A 3VXPB 5GS1B 1P5UB 1GGBH 1HCZA 2GC7C 5CJOL 3SKJL 3WIFA 1QFHA 4XBMA 5LGJB 4M5ZH 4JZNA 2Z93A 1KC5L 1BYOA 2BSED 4LAQH 2W9EL 5TGBA 4N4YB 5FW8A 1BEXA 2Y3AA 1FNGA 4FHKA 1NCUA 2AJZA 2GPZA 3P2TA 4AYMC 2OMVA 3LKOA 1ECYA 3D05A 4XNQB 2GCYB 1KDJA 3M17A 5AB2A 5JMOC 4XCYA 4KKAC 2BSSB 5F7FA 5I8OL 2ZP8A 1D7CA 3IGLA 5D1QA 1J0KA 1IAKA 1S9YB 1IM3D 1TJGH 3ARXA 1MFNA 4R84A 4XNBA 2WIIB 4J6RH 2XZQL 3EF7A 4PN6A 2HLAA 2Z93B 3M7FB 5GZND 1Q4NX 4P4KA 4U7MA 3CFDB 3BJ91 4BA8A 3J07A 4W9LC 1NBZA 4HIJB 4GYBA 2EQDA 1MFDL 2J8OA 2WJ5A 3FC8A 3KW8A 3BN3B 1GL4B 3MCYA 1U8LA 5ERWA 5IHUL 1G9EA 2J1WA 1N12A 3I9GH 3S5ZA 3E1ZA 4NI6A 2AJVH 3QG7L 4PTUB 5ADOH 3MUHL 1XF3B 4R26L 1L7TL 1HCYA 1X4ZA 4E36A 3W5NA 2Y4SA 3HPJB 3S4SB 2QTEA 4QHMB 5IVXE 2QGBA 1OAQH 4TQIA 4GUQA 4NN7B 1ZA6A 4FZEH 5E5LA 3ULVE 4ETQB 1WZKA 1KBWA 3MRLA 3QJOA 2ICES 4KRPB 5E0QA 4Y2OA 1U8QB 3MREB 2I07B 4URKA 2BCKB 2Y1AA 2YD1A 3K5RA 4HK0B 2J8UB 3FTZA 3CFKA 5CJ8A 3OKYA 1D7FA 1JFHA 3E8UL 5LGHH 2R2EA 5D7JB 3U36A 2YWZA 3VGAB 3BAWA 1FFOA 2Y5EA 4X6FB 3HE7A 4BUHA 4XMPH 4NKMB 1N4XL 4RGMB 3QHZH 2X7LA 5MP6L 43C9B 3HS0A 1BBDH 2OTWB 2BWDA 4H8WL 4XOBA 3HI1A 4Q0XH 5BJTA 5ES4B 3TZVC 5J13C 4ETQA 3DYOA 4ZUSB 3IDXH 4R97C 1G6RB 3JV4B 4KQ0A 5IKCB 3SQOH 3EFDH 1LMIA 2YMXL 3QIBB 4YSDA 1HYSC 3VSVA 1GTFA 3IFLH 5DMYA 1FHNA 1EFXA 2XSKA 4X8JA 5E8EA 2C4FT 4HUUB 3HVNA 3RWGA 1Z5HA 5DEGB 3WJJA 4L1LA 3TJEH 1D9KA 3L4YA 2YGVA 3B2PA 1E7VA 3WIHL 3R4DA 3MUUA 4U1KB 4F24A 3RWCB 2FJHA 3JV6A 2V17H 4OBSA 3CDGB 3CHXA 3WJJC 1XH0A 3IKCA 3GLZA 5KUMA 1BOGB 3S5LB 2IALB 2IDSA 2YO3A 1JCVA 3U4EA 4C4KO 3P0VL 1KPRB 4GRWB 2G2RA 3AS2A 4HKZA 2KMWA 4PPTA 3FU7B 5GGQH 4KRLB 2TSAA 4XP1H 4Z95H 5FB8A 3C6LC 4JDEB 3EDKA 3ZE0B 2JKWA 4U1LB 2ZUXA 3ARFB 4L8CB 3R7RA 4N90E 4JPSA 5FGCE 1LDPL 4H8QA 3ZXAC 5I5IA 1DBBL 2WO3B 4NYLA 5E8PB 5T1KB 2PO6B 5CP7B 3K5SA 3QDMD 4WUKH 1X9UA 8FABA 3FN0H 5K59E 4HEMA 4LSVH 3D0LA 2X4TB 4O2CA 5KBLA 1I8IB 5GS0L 1FL3B 4TLKA 4OM0H 3HMXL 1QTSA 4DGYH 1CJYA 1K8IA 1W6WA 1NUFA 3AY4A 3OLEA 3E7JA 2DWTA 1DBJL 2DTSA 1LK3L 2RHEA 3JWOC 1F13A 1IFGA 3Q9QA 4ZT1A 2DWDB 5EU5B 3IETA 5I6KA 1XCQA 4A2LA 5DT1L 5E9NA 4ZTPH 4Y2DB 3QZOA 4ZW8A 3T08A 1J0IA 4TF4A 4NZRL 4JFZH 2X9WA 3X1NA 2E7BA 2O1AA 1Z3GH 1S7VB 3SDDB 1QTYT 4XMKH 4BSVA 2ZKMX 2B08A 3QFJB 1OQXA 2X0VA 1CT8B 1GSMA 1RSYA 3ZHNA 5GIRB 4U6XA 3K4ZA 2ZNXA 3PGCA 4JDTL 1DZBA 4OZHE 4XTRD 2TRHA 3GBEA 2UV3A 4EJ1C 2QVKA 2WLIA 5D4QA 1Q94A 3I75A 4HS8L 1LJMA 3OMZA 2WBJA 4HZ1A 4Y5YB 5D1XA 2BSSA 2BVUA 4BZ1A 4A7TA 4OLXL 4X6CE 4ABVA 2VLRB 4BKTC 3HHMA 5A16A 2WWOA 4DGVL 3TN0C 2PP7A 1QR1A 4BZ1H 1IKFL 3II3A 2EVHA 1IAII 4AEIH 1A14L 1WISA 2NY2B 1CBJA 1NCWL 3F64A 4HMCA 2ZXQA 1TTUA 1KIUB 4X9GA 1F4WH 1PG7L 2QDWA 5I1IL 2JV6A 4FFYA 5I2IA 3ALXA 1KB5A 2P8MA 2FBRA 4QXUL 1E7UA 3I6KA 4JHAH 1I85A 2FSEB 4PY7B 3X11B 5IQOA 3DURB 1BLNA 1ZLVK 1UENA 5AW9B 5KG9B 3W39B 4BGLA 3BSZA 2V17L 4OGAD 3Q6GL 1Q90A 2FX9L 2QADD 4PWEA 4OU3A 5JHDE 2BCMA 3D08A 1HE8A 4LRNL 2H2SC 4ODUB 1YJDH 4F80A 3PNWA 3P40A 3THMH 5DHYA 1CS6A 3U4KA 1S9KC 3BWSA 4KKPA 2NYZA 3OKEB 4DN3H 2DM4A 1KIPB 3AWGA 5D7EA 3T2LA 2BXZA 3QUZA 1IC7H 1QFPA 1GXEA 4G8FB 5EBMA 2A1WH 1P4UA 2XA8L 3DGDA 1SEBB 1ZPLA 2HSIA 3GSUB 3BD3A 4XZUB 2Q3ZA 3DGGB 3EFDL 4JFOA 2X89D 4LXFA 1FL6A 4G6FD 4QHKJ 3I9GL 4HZAA 4HUVB 4GG6B 4NQXA 4O58H 1GHFL 4XZ4A 3RGVC 1NSNL 2NCMA 4E9RA 4ZMWA 4BFNA 3TURA 4Q52A 5BW7A 4DERA 1P6WA 4N2HA 4X4ME 4PRPA 4PJHE 4JO4L 2GK0B 1KTCA 1NPJA 4GKSA 4QHLA 2H9GA 2TSBA 3CZKA 2O6FA 4ES9A 4WKXA 3R7QA 1WAAF 2J56A 5TH2B 4C83B 1R5VA 3NYKA 1X7QA 5J89A 3FT3B 3MROB 3SKMB 5FM4A 4OW6A 1H3VA 4WW2C 4EDXB 4KPHL 1P9MC 4IGBA 3R18A 1A4JA 4N25A 4PGDB 5E8EB 1JERA 1P4IH 3LV3B 1I8KB 3EJPA 4I18C 3SZ6A 1IMHC 1JHKL 4XNUH 2IXQB 2EP6A 2NY0C 2ZNWA 5L4FA 1RZQA 4XOCA 1Q9LB 1ADQA 3WTWA 4YWGH 1T20B 1YVLA 5EN2B 3S96B 5FX3A 3L45A 3IM1A 1YEWA 2NNFA 4G82A 5FYKE 2MOVA 5IHUH 3S8WA 4KXDA 4NGHL 4TVPD 2V3EA 1THCA 2R7EB 4M8VA 3KPSD 4A6YH 1GC1H 1S9VB 4NUJA 4X4XB 2UZXA 4B9CA 1AGDA 2BY2A 1CFSB 5JO5B 1I7TB 1ZHBB 3MYJA 1ASQA 2F7PA 1WCBA 3UBFA 3O9WB 4OCRL 2LOEA 5D2LF 3E6HB 4R7NB 1I3RA 2V3FA 5IB2B 1NCDL 2APTA 2YXMA 3HKZA 5I8OH 4HX1B 2XIBA 3KJ4B 5I19L 4PUBH 1L9PA 3HI5L 3PE9A 1JXGA 4HXBL 5DURD 4AQ1C 5C2BH 1H3GA 3BJLA 3QXUA 3WEOA 2JJTA 3CK0H 2LV4A 4NKDA 2DMHA 3CVBA 2CO6B 1NUGA 3QCUL 4LAQL 5FYLD 5HJBA 1MKFA 3IVKB 4ZX5A 4JPWL 4YDVB 1XR8A 3JTTA 1OCZB 3QUXD 3VD9A 2XWEA 3SE4C 4R2GD 2F5BH 4AE1A 4BRVA 3H9SD 5JXAH 1XCXA 4YZWA 4ESKA 2XPZA 3VB8A 1XF1A 1UACH 2X87A 4ODTL 4HAKA 4PM1A 2LGNA 2ZAHA 3FRPB 4UM8B 4HG4K 4XHJC 2DH3A 4DQOH 2VMCA 1E4XI 5IGXH 4DK5A 3X17A 3GMLA 2IPTH 1KXTB 1KBGL 1A21A 5F96L 1S9WA 2JI3A 4JRYB 4AY0A 4JM4L 3RVXD 2MWCA 2WQUA 2YGPA 4F1ZA 3UMNA 1WD8A 3GSWA 1UM6L 1N70A 2FIRT 2NW2A 4XBGB 2XU9A 4TVUA 3QYMA 2BZ7A 4JLRA 4NJAH 5IJVB 1CLYH 2O26U 3W1ZA 3D2UA 5C0BB 4K5PA 2UXGA 4A66A 1VGKB 3O45A 1MNUL 3EYFA 1VESA 1A6WL 5TE6H 3OZKA 3DK2A 3HG3A 5IQMA 2WNXA 3IN2A 2HXAA 3B7SA 5D7LD 4HIHB 4OD1L 3SGEH 4MZ3A 1CLZH 4JRYD 3D5OF 5A40E 3SB3A 2A74B 1N0LA 2J8UF 4K7PX 4K8RD 2ICWB 3PWJA 5A6MA 1U2YA 1I8UA 1LDSA 1I9RL 1UZ6E 2N7AA 3BD5A 1AGFB 2X4QB 3VU1A 1HILB 4B7IA 1G6VK 3IRPX 5LVEA 4JVWA 5IB5B 1RJCA 1HL5A 1ET7A 2ZWNA 5GGTH 1TDQA 3ULUE 4XXDA 5I15L 5BQ7B 1ICTA 2YPLB 1REIA 4AXWB 2FECL 4YDKH 3KYOA 1N0XL 1FZJB 4A38A 5EBWA 2VLKE 5T1LB 4H0IA 4P3CL 4PP1C 4F2FA 3NIDF 1KTBA 3X1FA 5C97A 1XGUA 3UTTB 4OCXL 3RX8A 1M56B 2P7TA 3GJFB 4PCYA 5E4AA 4TQ8A 4Q6IB 3EJRA 5GSRA 5DFVD 3IMRA 4AJVA 1JN6A 4JMXA 2YLKA 5C92A 3ROLA 1A9EA 2HTKD 1CF8L 1QSEE 1AR1D 1OVZA 2GITA 5F7DA 2AABH 3P4MA 4W81A 4XPHL 5ALBH 2D8KA 3HPLB 4YDJB 3UX9B 5LWYL 1E4WL 3MV7E 1PZUB 5I16B 1DJXA 3BDYL 4N22A 4JAMB 4QHUB 3CZFA 1XD0A 3P3TA 4PJBE 1MOEA 4Y2DC 3N43F 2LU5A 5F88B 4LRNH 4OF3A 5JDSA 3U4BL 2EDDA 4AGNA 1L9RA 2P52A 4HBCH 2JF1A 1JZ7A 2E86A 4FNSA 2DIEA 4AT6B 5F89B 5HGAA 5I1AA 4O02L 1M6OA 1NOAA 1DL7H 1PIFA 1R75A 5BUAA 5T3XL 2YC1A 1KELH 2IANE 5IMLA 2YKLH 1AG0A 4F2EA 3VQLA 2BS71 4GKNB 2QR0B 4XCNA 1SOQA 1Z9NA 2WN3A 3EOYG 1FG2A 4KK8C 1OWRM 5HDRA 3LEVH 4DSYA 4E5XG 2CJTA 2IC2A 4JRWA 4FDWA 4U3CA 5I1GH 5IEHB 1AJ7L 4ERSL 3P54A 5FXCH 4GS7C 1J1OL 3QRLA 4HXAL 2Y22A 4H4NA 5L7XL 4ZMLA 1CGTA 2MQ0A 3KCPB 4WFGE 3V55A 4WEBL 4MBRA 5HHOE 2F7RA 3C9NB 5ICXB 1A5FL 3FFDA 3UXFA 2GHWB 3SOBH 3MA7B 5DYOB 1S78D 3ECWA 5E70A 3VGDA 5JW5B 4U6TA 1Y7VA 3BDYH 3P3UA 3M6DA 4GRWH 3DPBA 1BM3L 4HIIB 4I2XE 5L2KA 1E4XH 4XOAA 5HI3D 3T6WA 1J05A 3BIKB 2I60L 3DXAB 1QWHA 3GSQA 5BVJB 5E08H 3IJHB 4HIPA 4J2XA 2X6UA 1OP3H 4XVJL 1J5OH 5FO8B 1EX0A 1PEWA 2WD0A 5DJDB 1HH6A 1AHMA 2GK2A 3BPCB 3MNVB 4UTAH 5DVNA 4FLOA 3BKJL 4ATWA 5HI3C 3NFPB 5I30L 1BFOB 3TU6A 3OVUB 4PG9B 3HB3D 1BQHG 5AALA 4IS6A 2QHLA 4P23B 5AZUA 1PNDA 2X4RA 4OKVB 5F9WC 1MRCL 1RIHL 2V3DA 1IC1A 4PJAF 5E8OA 3S3BB 3SIKA 3U9PL 1G4RA 1WICA 4HUWA 4ZQKA 5ITFB 3TO4A 3QORB 2PW1A 2WKGA 3PIQB 1D7BA 1BX2B 2OULB 3SQBA 5ETUA 3I6SA 4G5ZL 4PJHB 2W95A 3FQTA 4FFWC 2QZ5A 5E8NB 4TVPL 2DEYX 1ZLUK 1USZA 3UCQA 1Y1DA 5AAWC 1WDAA 2OX5B 3FFCD 4P2RE 3CX2A 1ZANH 3QEQA 1TSHA 1NC2B 1L9QA 1DJWA 2EC9U 4KKQA 4M5SA 3P4OA 5KVFL 4P9HL 1ORSA 1RMFL 2CH8A 5AW2B 1QI4A 3TIDB 4GMTH 3BW9A 3MFFA 4LARL 3HAEG 5A2BA 5C0DB 1P69B 5BZXA 1EEZB 3K74B 3CZUB 2UWEF 3ZL4L 3WN5C 4BK5C 3MACH 1HOEA 1BF5A 3ARSA 1R3KA 4UQ9A 4OFIA 5DMJB 1OLZA 2ICWA 3JUZA 3PWJB 1E28B 4BM7A 2VDNL 4P2OD 1AQ8A 3VI4E 3WNNA 1RLBA 4RNRB 4DF9A 1OWWA 2MOGA 3WIHH 3R06A 1T83C 3IWUA 4GQZA 4GG6F 4U3SA 1BXXA 3TJEL 5KYUB 3WHXA 4AYID 1YEIL 3GM0A 2BIIA 3GB7B 1UCBH 1HXMB 5AZ2L 1IKNC 3MRRB 5BQ7A 2OSYA 1CYGA 4QYAA 5IGXL 1NKOA 1QLRA 3AG3B 2GTZB 3IDGB 1TCRA 1GY1A 2BSTA 3A5VA 3CHOA 4OD3H 2LU3A 5DI8A 2D7OA 3VCLA 3DVNA 4XVUC 3NSCA 5HGHA 4LOUD 3AZUA 1CO1A 1FNSH 4PWGA 1F90H 4DVRH 5CEYB 2WUCL 4JRFA 4PJ8B 1NCAL 4NQDA 1NANH 1ILUA 2KUTA 5EO9B 4JREC 3TWCH 4WWKA 3MOBL 2DWSA 1DSFL 2Q86B 4TL5A 3UBXB 4N0UA 2QLVB 1A7NL 4RETB 5GGRB 2IH3A 3MI6A 2Z7WA 2EE6A 3QIWD 4M1DH 1AQKH 1OSZA 3UGUA 3H9ZA 4EVNA 2FT6A 2Z0UA 5DJ8B 4JFPB 4PJ5B 3E8UH 2V9RA 2BSTB 3OWRA 5CD5C 2X6CA 4LPYA 2UYLA 2BRRH 5HHQA 2HFGL 4I3RL 1MAKA 2VDLH 1ZGLA 3MA9L 4V11A 4R0LA 1AO7B 2C9VA 2ZICA 1FE8H 1DBAH 3B9KB 4UT7H 4C59B 3QISA 4YZFE 4M29A 5B1JC 3S8GB 4LL9A 4AZ8A 1LO4L 4AT6A 5I1AB 1QW9A 2UZIH 5K9QG 4OGYH 4ZFQA 3QDME 5GRVK 1ED3A 4P3DB 1BQLH 2W0FB 4EVNB 2E8YA 5HJDA 1AGBA 1KG0A 1JTPA 4FRWA 4NDMB 4WI0B 5KSAD 1QPXA 4MJHA 1MFBH 4IK6A 1YEEL 3FU9A 4JFSA 3V6OC 2J5LB 5T1KD 3S4SG 3P0GB 1P2CB 2WNWA 3T2PA 5KS9B 1AO7D 1I8IA 1NLDH 1UD3A 2HT2D 3KHQA 1U8LB 4PJGE 5ERWB 3VXMD 4PCSA 4E41D 3FSZA 1A6TB 2EO7A 4X7TB 1XH3A 1UA7A 1R3LA 3PCYA 5D96C 4HGKC 3PXLA 5DRNA 1AD9B 4K2UH 1DSYA 1AKJB 1JTOA 2HTLC 1RY7B 1WIOA 2X4PA 3OAUL 3KR3L 2I27N 3ZTEA 4HG4J 5EG6C 1X5GA 1YEEH 2ZIDA 2HT2C 4WHTB 1G5AA 3N85H 2AQNA 3LEXB 2NX5D 3CLEL 3D18A 3DI3B 5JORB 4L8DB 4U0RC 3R8QA 2VLME 1NDGA 1SXCA 1WE5A 1OZTG 2AQPA 2J88H 5FO8A 3DX1A 4WSKA 1B2WH 1C5BL 1UXSA 3MRGB 4Z18A 1HJCA 2N01B 3HE7B 3SGKA 4JZJA 1JXKA 2VL4A 3GMPA 3KPNB 3C5JA 5JMRA 2V4LA 2XI9A 5FW6A 4EI0A 3NAAH 4LASH 4KV5F 2NW3A 2W07A 5C86A 1GGTA 5KVEH 5IHBA 3ZDXE 5INCB 4I0PB 4BFGA 3ZL2A 4W4NA 3LKRA 3Q6GH 1M7DA 4H40A 4PP2A 1JPTH 1UGKA 3EO9L 4UIMA 3RL2B 4DO4A 3QNYA 4M7KL 2M8XA 4N2CA 1F8TL 4KY1H 3WDIA 2WLKA 2ENJA 3RUGE 3U30C 5I1CH 1DTUA 4NO0B 5EV7A 1JP5A 1GMEA 1ETB1 5C0GB 2B9BA 3QORD 5FDWB 3RWIB 3WAKA 4B27A 3WS6A 5IREA 2NW3B 2FJFA 2EYRA 2MEJB 2WUCH 3PQYE 3CLEH 3ARZA 4WLCA 3VFMA 1KJ2L 1M2VB 4NFDA 4LHQB 3K72A 3OAUH 3ZYZA 4DUWA 4JG0L 3DPDA 4UI2A 1GZHA 3HC3L 1O9WA 4TSAH 1NC2D 5IJCC 2QFPA 2BS9A 4WZ9A 3UFIA 2XG4B 3BEWA 4GBXA 1G84A 4HS8H 1J9QA 3D4GA 1EDQA 5IF0A 1BJ1H 3MSPA 1QSZA 1TU2B 3B2UD 4ZFOB 2R0KH 4FFTA 5JOPE 3L3OB 5E00A 1T1XB 2JJSA 4ISVA 3WY3A 3CFJA 1RPUA 5IFJA 2GEEA 2EDFA 1YYCA 1AY1L 2X4OA 3T0EA 3C5XA 2PN5A 3TEZA 3VWJC 4D8PA 5EDSA 2Y6SC 4ZOBA 4LARH 5EDXA 5DHMC 1YEGH 2DQEH 4P8QA 3VMPA 5KVFH 3DNKA 3M7OA 3RDTD 5DRZB 3MLPA 3JBG7 4Z3EA 4Z5RB 3MUZ1 2OP4L 3PRZA 1D9KB 2HA1A 2VERN 3OC5A 2A6JA 1DQML 1EWHA 4GI8A 1NMCC 1I53A 4L3EE 4OCYH 1FH5L 3CVIL 3DV6B 3IXTB 3TFBA 5J9PB 1FVEA 1TVBB 4H2AA 3U0PA 4OJFL 4ZSOB 4DCQB 1SBSL 3OKNA 1FDLH 3HI6H 1JK8A 4NBXB 4R3SA 2L7EA 4GP4B 4S2SB 4X4KA 2B9AA 2J55A 3UDWA 4BE5A 4AYFA 1BREA 4RZCA 4NI3A 2XFXA 4NHUB 1A0QL 4LLQB 4S0SD 4TL4A 4AM0A 2FB4L 1SQ2N 1CLCA 6CGTA 4Z7VA 1D5RA 4Q2ZA 4POUB 2I32A 3QUYD 2Y5QA 2Z8SA 4U6VL 5CNHA 3KS0H 5H37H 3G04A 1DYZA 2GTQA 4Y1AB 2QPDB 2Y7SA 3H54A 3WKNA 4WKZB 5CLXA 5E4OA 1MCKA 3MGAA 4WU5B 2YGOA 4ZUTA 2P5WA 1JMZA 1BG9A 3M8OL 3QK0A 4NKQB 5I8CA 4U6YB 4JRXA 4XVJH 1UZ8B 1UQSB 3PUUA 2HJFB 3FO1A 4KTEH 4Y5VC 5F8QC 4RAUA 2VN5A 4HIQA 1WBYA 3CV5A 4MD4A 5JQHC 3RLSA 4GQ9H 3VG9C 3LMJL 3O8XA 4UUJB 5DVLA 3WEBA 3WNOA 1DFBH 2ZX7A 4OSUH 4UQCA 4ODHL 2IBBA 2AQ1A 3SE9H 2YAOA 4DEWA 3G9AB 2D0GA 5JW3H 3LQAC 3HAEA 3STBA 4F5CA 1KEML 5LNDA 2YMXH 1FAIL 3EIFA 4I1NB 4OQTA 3BSZH 3RE0A 2Y0SA 5IHHA 1I1YA 3LD8B 2FX8L 3NACL 5CCKL 2BK8A 5J3HD 4R9HA 4W6XB 4ODXA 1CG9B 3K71B 3OKEA 2XTJB 1UADC 5ID1B 5T5NG 4CSPA 3HZMA 1ZXKA 3VI4F 4ELKB 3O11A 4P49A 2ZOOA 3QIUA 3VACA 3FQUB 4CW1A 2AXGB 3ATBA 3QA3A 4OY9A 4MNHB 4LRIC 4O02H 3TP4A 3HPJA 3L4UA 8CGTA 5LGHL 2XOTA 1IJ9A 1I1FB 2IFFH 2OXHA 3ZTDC 4ZW5A 4I0PD 3QXDB 1X5YA 1G4MA 3OKKB 5DO8A 3BAEL 5JOFA 3ML9A 3DIFB 2X89A 4ZMTA 2O5YH 4Y5XB 3MROA 4JKLA 1OAQL 1ZE3H 1X6NA 3MLXH 3ILPA 2WQVA 5F7HA 2H3NB 2NYYC 5J56B 2ZF9A 4ICWA 1MCBA 4R97B 3PNRB 3D85D 5MEND 2DQIH 1NAMH 3TVMB 1LP9B 4IW4C 1WEJL 3LZPA 2IMNA 4RMRA 3MTRA 5DRWA 1TJHL 3OKMB 2R29L 3QJHB 5C0AE 1CLOH 5DHVB 4XR8C 3BRGC 3SGKC 3D39B 4UT6H 4CN6A 4N1EA 2KT6A 1A7BA 4EIZC 4PJ8C 3L5IA 3RJQB 5C0BD 2C3GA 4AX3A 2V7NB 2XVKA 5D93B 4BHUI 2H26A 2J6EH 1T2XA 5C07D 4JANB 2P5WD 4Z77B 1KYAA 3H55A 3QP3A 4MNQE 1VZGA 3GBLA 1AIFA 1TSRA 1OGAB 3QG6A 1LP9A 1EJFA 5K69A 3AC0A 4FN0A 4QWWC 5F89A 1MPAH 3FPXA 2NQ3A 1J8HB 3IDMA 3MNZA 1YDPB 3TZVD 3DX4A 1AZNA 2NY1B 1V5JA 1SRDA 1YEDB 3UMTA 4TV3A 1MN4A 2GK0A 3NCBB 1C7SA 1M57B 1QSED 4JZJC 5DJZA 3GLDA 2P5EA 2K7QA 3QO1B 1NGZB 4OVVA 4IU2A 1H6EA 1GW0A 4M6ML 3S34L 1MJ8L 1KNOA 4HPHA 4OLYL 3KBEA 3ABLB 3VYNA 1RJLA 1A6WH 5TE6L 2GUOB 4IBVA 1O5DT 1AIFB 4LCWB 4HU8A 2G4EA 4A2HA 4JB9H 3H9SB 1QNZH 5HVGB 2GSIA 2WQWA 3IDIA 5D2NA 5GRUH 1CLYL 1LGVA 2K9FB 1T80A 3PY9A 4JPVL 2ZSWB 1TJIH 5JHLH 2Y7QA 1JHTB 3C08H 4PJ7F 4NBZB 4FXGC 4RGMC 2QQNL 2E9JA 5J7CC 3BPOB 3PWLB 3VU2A 4B5EA 3CN0A 1JZ3A 2XXMB 3KWWB 2YD9A 2AABL 3QW9A 4P9HC 2QVFB 4MVBD 2VL5B 1TLKA 3BN9D 1EA9C 3FFOA 5EC2A 4AQAA 5DA4A 4YHIA 4BK4A 1OT2A 1UEYA 3BVUA 3LEYH 1NFIA 3AQXA 1XAUA 2Z31A 2EDWA 4PJBF 5D1QD 3WUWG 4B3EA 5C07A 4HV8A 4OD2A 3PLYA 1MQKL 2XWXA 3FQRA 2VN3A 4XHJD 1B0RB 1S9XB 2JCWA 2Q7AA 3CUPB 4OIBA 3O6FA 1NMAH 1I82A 4XAWH 4F8OA 4KKZA 3O4OB 2K70A 4JPWH 1VA9A 2BMKA 3CCHA 1N0XH 4PJFB 3MFGB 2XLLA 1AP2A 5B8CA 4DKFL 4KI5E 4UIKH 3LHAA 3MLUL 3QZWB 5FYLE 4GMSH 1MCLA 4F9PC 3DO7B 1TJMA 2VL5A 2QLYA 5HY9B 4MNQA 3L3HB 1LEIA 2AI0L 1A3RL 5GRZA 4JY5L 3RAJL 4G83A 2EDMA 4MXWH 2YA2A 1HX0A 3IFPA 5F3BB 5KYNA 2HWZL 1O9ZA 3TJHD 5ITBL 3QDMB 1EUUA 1ZHNB 1WSST 2JKLA 5SWQA 4ANWA 3HG2A 1IGIH 2VLLA 4Z78A 4B97A 4JY6B 5AW8B 1FH2A 1GRWA 1WHPA 3BUIA 4LEXH 1GC1L 2R4RH 4NB7A 1GZQB 1ID2A 3WOVA 2LU4A 3D0VB 3QWRD 2H32H 4UZGA 3HA0A 4HP5A 4I77L 5I0XA 1A6AA 5ESVA 2CHDA 3MBXH 1AGEB 3ES6A 5KJ4A 4YWGL 3SGJC 5IJDC 5DC9B 4NJAL 4TNVF 1NGYA 1MWAA 3DURA 5KN5A 3HE6A 5IW3A 3RIFF 4JVUA 2VDQH 3P2BA 3US0A 5KYUA 4KJQD 5K39B 4FAAB 1DHKA 3TEXA 3CN3A 2QGCA 3EYQD 4GMSL 4QHNA 4YHZH 5E1IA 4BFKA 1BVLB 3C60D 1DQQB 1BQUA 3PV7A 4X7SL 2EC8A 3SODB 4TNEA 1FIGL 4NSKA 2VXQH 1PQZB 5ACZA 1NAMA 1SY6L 3EZ8A 5FFOA 4LMQE 2Q6WA 3PWNB 4MQ7A 3C12A 4Z3JA 1T04A 4EKJA 5FGCB 1MQKH 2X42A 3NESA 2F5BL 3O41A 3TOPA 4WIQA 5HBBA 2WVVB 3OHXC 2C7FA 1U8PA 4KKRA 5HGAB 5I0ZA 5DRWB 2FO4A 4PCTA 3VGHA 1LE5A 2DYPD 5DZNA 3CMOL 5HGGS 1G9NH 1K72A 5IROA 2WXRA 1KY7A 2R2BA 1BFSA 3U1SL 3BUQA 3VGBA 4YHOL 3VXNB 1FFRA 3CK0L 3MJ8A 5ANHA 3ZE1B 3SO3C 4S10A 1W72L 2NNCA 3ZKNC 4APQC 1DCLA 2KZWA 5TH2A 2DL2A 4C83A 6TAAA 3LIZL 4CA4A 3L7FA 3C08L 1SMAA 1WGOA 2R0ZH 5DK2B 2Z7UA 4PS4L 4NQCA 2ZZUT 3T77B 4PRHA 1CC3A 1XBDA 1X5ZA 2A2QT 2CDEA 1W0YT 3I3DA 3C9NA 5ICXA 3W57A 2O5XL 2QELA 3DVNB 1W0VB 3PFUA 1I8LA 4WJ5A 2NX5A 2H8PB 3WKQA 4Y8AA 1G9MH 1JV5A 2W91A 1X5FA 4Y5YC 4JRXE 2B8OT 4L37A 4XH2A 5F7DB 4AGLA 4G42B 2YAPA 1OAZL 2ZKYA 1JXDA 4KK6C 2NZ9D 4HF5H 5FWQA 3TYFA 1MJ8H 3NT0A 2WANA 2KDGA 2VKXA 3S88L 2XFGB 3APMA 2JJTC 4BUQA 4YSAA 4WUUD 2VITB 4Z7VE 5KVMC 2GT9B 2VR6A 4OCSL 4XN2A 1RZFH 3LKOB 1MPAL 4N26A 1WAPA 1CWVA 3V5KB 2ZG2A 4XN9A 1U3ZA 2MQ3A 2RCSL 2VDRL 2OMXA 3HUJE 1V3MA 4KPHH 4MJ6A 5GZOA 3LZOA 1E9OB 4CN1A 1TO4A 3QDGB 1HL4A 3MODL 1DDHB 3V6ZB 1FG9C 2Y1ZA 3I9PA 3C8DA 1P5UC 4XGZB 3WNPA 1U8MB 1URIA 2K3TA 1NM4A 4XMKL 3MRMA 2ED8A 5EBGA 4P46B 5T1JA 2CR0A 3UTSE 3EGXB 1TJHH 3RX9A 3T6XA 5C0CA 5DURB 4ONFL 4MSWA 1II4E 4O58L 1PBYA 4PWKA 2VLJE 2W92A 5I8KH 3VI3A 3FO9A 3NJHA 1TQSA 2G75A 3L7EB 4XBEL 2APFA 3T0EE 4CMMB 4NO5A 3SO5A 1IC7L 1F4YL 2CLVB 1U95A 4GAGH 2A6DB 1E30A 3CSYB 5A2CA 3LPGA 4Y19D 4QRQA 1GVIA 5HYJE 2WGNB 5D7KE 3THML 1F4HA 2ENQA 3NUKA 1A7PL 1MF2H 3OLGA 4POZD 3H3PL 4KKLD 4LSVL 5D7IF 5DJDA 3VW3L 3V9CA 1OT1A 1XWVA 2WO4A 2DDQL 1R3KB 3PFQA 5B1CA 2ALWA 3EOAB 4UAHA 4EI6B 1J7VR 5I75C 1T22A 3PDOA 1J9SA 5J57B 3QI9A 4FFZH 4H7VA 5EU6D 4RAVA 2W65A 4NQCD 1RPQA 4G7SB 1GH7A 2KL6A 1KYUA 4ZW3A 4HISA 1PG7H 4UF7C 3S35H 1GYUA 2MFNA 4G6MH 1XB3A 2DPKA 1XB8A 1E9QA 4APXA 1NCWH 4P2OA 4P5KA 3MHZA 4E9TA 3QZBA 1ECZA 4HQQL 2E7CA 2FWOB 3TJPA 1HHHA 3ZE1E 5TFSL 1JGUL 4Y4KA 3T04D 1DQKA 4KTDH 4NOFA 5HHMB 2OFQA 2IO5A 1ZT7B 3U2SA 2Y07L 2CR6A 5D8JH 5FYJL 4G43B 1U8HA 5AAMA 1R33A 4KMQA 3T0DA 2O61B 3OJVC 1KWGA 2P3YA 4QTHA 4H1LB 2CBMA 4UDTA 4JJHA 3MBEC 1TU2A 5H35A 4BBWA 1ZEAH 3DOHA 4GAYA 4NENB 3ZMRA 2FYYA 4YHLH 5FV1L 4U1HA 1K8DB 5FS5A 3LAFA 4PJDA 1FI8C 1B90A 4ZMOA 1VSCA 5C7XL 5EEVA 3CU1A 1DQJA 5A43C 1Z3GL 4XC3H 2D7PA 3SQOL 4WI3A 1MY5A 2XG5A 4PQXA 4O02B 4TQEL 4M1CC 1AO7A 4ONFH 1SOKA 2EXWC 5DJXA 5T1KA 5T3XD 3LNIA 1QLEB 3WNKA 4PV1C 4GAJH 3L16A 5IVOA 4MJJA 3BE1L 3U48A 1RHHA 2ESVB 1RURH 3T3PF 3AXLA 5JLZA 3DVGB 3WJMB 2GITB 3OKNB 5C2UB 2XZAL 4GS7B 4F33A 5LLIC 3QB7C 3MLRL 1HINL 3Q0HA 1Y6MR 3TCTA 2NNAA 2B4CH 1N19A 2X28A 3DLQR 3L3OA 5AKTA 1FWXA 3GSNA 4UTBA 3ARYA 3L7FB 5HHOB 1BOGA 4I2XB 2IOMA 5SWSD 2XJKA 3EBGA 2FE0A 3KAAA 3LJ3A 4YDNA 5J1TC 2WQXA 1CL7H 2Y06H 4WK4B 4HWNA 3D48R 3UJJH 4LSPH 4KAQH 2OP4H 4R26H 4UOW0 3OPZH 5ADOL 4YXHH 1HEZA 2YXVA 1KYOK 1XR9A 4WJKB 2ZCLL 4MGXA 3SY0A 2GJZB 4ALAH 3OGOE 3WFBL 2P42B 1BVKB 2WMPA 5CFHA 4V33A 1ZSDA 2L4OA 3KM2A 2QR0A 2WUBL 5J12C 2FYVA 1E4KC 4ZUWB 4DZ8B 4FI8A 5EN2A 5FHBH 5E03A 3LEXA 2KYIA 3S37H 3DX7B 3S96A 3PGCB 2QKIB 1JPGB 2VT0A 4PU2A 2DQDH 4MMZC 4PJIF 4ZJ9A 2EADA 5GZNC 3B9KA 4FEIA 2OI9C 4I9WD 3LQMA 1FNFA 4LQFL 1BXAA 1JDDA 1T89A 3A4DA 4ZAKA 4ELMB 4R5XA 1FN4B 2Q3XA 2YZ8A 5E94A 2X38A 1ML0A 2BSRB 4BYHA 3BVNA 5FYJU 1GOGA 1ZVSA 2CLRB 1TMQA 3IFLL 3RWEA 3CVCA 2M2DA 2VNCA 2X4NA 2W07B 5T33H 3KGTA 5I6LA 3U9UA 1JZDC 3BIKA 4N0UE 4Q8BA 2GFBA 1U8QA 3JWDL 3KGRA 4RMWA 1KGCE 1OAXL 1NGQH 1KIQB 3O2WL 4K3HA 2PXYB 4HUCA 3L3JA 1XH2A 2R39A 3FH7A 4W9IC 4E42B 2JJWA 3HNVL 3KPPB 4CAGA 3BXNA 3CDZA 5SX5H 4MBOA 4JPKL 4EZMA 1M05B 3RYMA 3LPFA 5KSVA 5BS0D 1MQ8A 5TQ0L 2YPVH 2L04A 5DZPA 3L3DA 5FLUA 3GT6A 4YHKL 1YN7B 3H2WA 3MRBA 1KGIA 5IB1B 4Y5YA 25C8H 5D1XB 1TZ8A 3O2DA 3FUDA 4YDZA 1OCWL 5BO1L 4I18A 3IAQA 3V79C 2N1KA 4LASL 1A9VA 4WWID 1F5WA 5F9AC 4CILA 5ABZA 5CZXC 3QHFL 1PG7W 4JZNB 5EWIH 3TZVA 2DS4A 4ODVH 2EYTA 4AWJC 2AV7B 2C5DC 3JT0A 4HPYH 1AS6A 3GSNH 4IBTA 2IVFC 3BUYB 4IM8A 4WTWA 3D3VA 3VB9A 3WLWD 5CZXD 4YLQT 1RZIB 4OJAA 1JXFA 3LKNA 5EU4A 3I6KB 1PSKH 3ZQXA 1DN0B 3GSRA 2VXVH 1SHMA 3L1EA 3WXWH 4LPCA 3MXWH 1MELA 4EUPH 4OB5H 2WQRA 5DVKA 1U42A 4MHHG 2XWTA 2YA1A 3V6FB 3P77B 4FMKA 1S7QA 1YEHH 4DP6X 3MOQA 4UANA 2GIXA 4M8QB 1CR9L 1DN2A 3MAWA 1CBVL 4JY5H 3RAJH 4D7PA 2M26A 4L4TB 5DR5L 4I7ZC 3TONA 3MC0A 3RB7A 5AG8A 4G59C 4XX1G 3SDDC 3IDMB 4PJBB 3SSGA 3VFNA 4BQBA 4RNRA 2CZNA 2JQMA 2QVTA 5EBLB 1NFDE 1RZJC 1CK0L 4M6NL 4JFOB 5FC9A 3WHXB 3V7AG 5CCGE 1MFBL 4HJGA 4JRYE 1OK8A 4KX7A 4FGMA 3NN8B 2FT7A 1A1NA 3H7BA 3PP4H 3QS3A 1GGBL 1D6VL 1MCQA 4M43H 1PTZA 1MZZA 3UTPE 2W80C 1NIAA 3ARGA 3MR9B 1I7RB 4JKPH 2I07A 4L4TA 4NRYB 4YOKA 2B1OA 2HG0A 2ZXEB 4NQDB 2FEEI 2ARWA 1E2VA 5DHXB 1NM9A 3S3JA 5D1QC 1QWUA 2UXFA 3HG1B 1HI6A 1CYXA 5I18L 1R9FA 4OZIF 3BN9C 3B7UX 5DK3A 2Q87A 4FKEA 3MKGA 3KBPA 4V1DA 4GRLD 2ARJQ 3LXBA 2R0LH 1QX1A 1LQBC 4J3TA 4XP6H 3RPKA 4DP5X 1NLBH 1UZ8A 1DBKH 4YPGB 1TJIL 5JHLL 5DS1A 1BF8A 1J1XH 1M42A 3QEHA 1AZBA 2R0WL 2HT4D 1XO8A 1MRDH 3HBZA 1WFMA 3O2DH 2MPVA 3PHSA 5GRUL 4XP4H 3KJ4C 5HHOA 4PJ6A 1GIGH 1BZQK 1ZT1B 3FUKA 5TD4A 3MLTB 3X14A 1OP5K 2BINA 2BVEA 4CSZA 4HULB 1JDCA 4OKDA 5IJKA 4XVSL 3W38A 3DVIA 4B0MB 3Q8CA 4KY2A 5FGBC 1CDJA 5FUCC 3E80A 3CVHB 3S3CB 1FC2D 2WSDA 3W9EB 4OLEA 4K23L 2ICWI 2YK1L 2Q8AH 3RL1B 3ROOB 1NCHA 4JJ5B 4D0BB 4ADIA 5T1MA 3H9SA 1N9PA 1UYWL 4ZXBC 1U36A 2QQQA 4NNYB 4O5LL 3QZWA 4LLVA 1CU4H 2WSPA 1F02I 5CUSL 1RZPA 1T1ZB 2COVD 3OR6B 1SHSA 5CR8A 5AVSB 4JO3L 5TDOB 4MMXA 5C0JB 2CU9A 1OPOA 2BVQB 3EYUL 1M3JA 3H9HB 4O9HL 1ACCA 5GQBA 4V1DE 3T8VA 5BPPA 1UOLA 4TN9A 2P80A 1XIWD 1A7RL 2B1HL 3VD3A 4BE6A 5SX4H 1C1EL 4OBRA 2ATKB 2H1PH 2PO6A 2NQCA 4GMTL 5JW5A 3OKKA 1T4WA 2IFGA 3COOA 1OQOA 2ZKHH 3AXHA 1I1AB 2XKNB 1WP6A 1NBCA 3NJGA 2Z1PA 1T1ZA 3A6CH 1Q9WA 1ILSA 4HT1H 1IRAY 2F5AL 5J6HB 1QLEL 3WIHA 1MCHA 1EO8H 2DQIL 2OZNA 2VE6B 3QAQA 1BDYA 3IEAA 1T66C 2DLFL 4LOFA 4MMXB 5J8OA 1CPUA 2XNAA 4JRYA 1UVQA 5AAWA 3ZKMD 3MLXL 3IAPA 3HAEB 3PQYB 2OI9B 5CBAB 4L4TD 4C4KT 3ZYJA 5DU7A 2FQFA 2R1YA 2YN5A 2BZDA 3MRLB 2COQA 4G8AC 1KCLA 2V5YA 2DEWX 4A7VA 5C6TH 5KVFE 5DXWA 5TK4A 3EJYD 1KGUA 3OB0H 4Y9CA 4CC0A 2NR6D 2NY1D 4DFIA 3SDCC 5AKVA 5F1NB 1LVEA 3P9MB 4BSVB 4E0RB 1KFAL 1TR7A 1JFQH 3QNYB 2AZAA 3L95B 4N87A 4LE8A 3F62A 3L3OC 3D30A 3QQ4A 1NWPA 3BGFB 1EO8L 4GB9A 3LQAL 2W0KA 2CXGA 1I3GL 2XC8A 4NNPL 2A74A 3UGXA 4WWPA 4RFOL 4BCXA 1UD5A 3ATAA 3BAYA 1YQ2A 1RVFH 4TQHA 2B20A 3SGDH 3ZL1A 3ZRFC 1M2OA 3LKNB 4OFDA 5EU4B 3W0WE 1N26A 2H4EA 4NC1C 4FJ6A 1LWRA 4HGMA 2ZJSH 3M46A 4LF3A 3P4NA 2FWLB 1X5IA 4EEEA 2XIIA 1SVCP 1E27A 1YRKA 3HOGA 1E4XL 1WH0A 5CINH 4NUJB 3NPZB 2Y72A 4M7LL 3FBKA 3SE9L 4LSQL 1YYML 4WI7A 4OSUL 4WNJA 4NQEB 5IW1B 4Z8FH 1FZJA 3EOTL 3SOBL 2DD8L 3L3IA 4F93B 2BSBA 3EDFA 3CFTA 1MDTA 2I7OA 2Q6WB 1O75A 3MRPB 2QSQA 1LEGB 2B1AL 4FCAA 1BV8A 1MCCA 1CICC 1J1OH 3D39A 4KHXL 2NDGA 4LOEA 5IHZB 2W88A 3BUPA 1SF3A 1U2HA 4PLKD 2PYFA 1J0YA 4K23H 5KVEE 3FAXA 1WJ3A 4MCZA 2OAAA 1DVYA 3GHEH 4ODUA 3SKNB 4OGZA 2IDFA 4ORGA 1MCOL 4CBZA 3VO0A 2ZCZA 1QW8A 3RKDC 4IU3B 3KHOA 4ZYKB 1TXKA 5IHLB 2EO9A 4I88A 4O51B 5DMIL 2ED7A 2MCPL 1TTCA 2JKTM 3CZFB 3ZZQA 2CK0L 3U4BH 4IOSA 2OL3A 4UTAA 1BZEA 3TBWA 3WXVL 4OIIH 1WPCA 3RIAK 1NLBL 2O4EA 4G8EB 1BD2E 3DJRA 2E27L 2DLTA 2AJXL 3SDYL 1ZK9A 3I9IA 5L2JB 2BC4A 4Z7NB 1G6RL 2JXMA 4KZCA 1JL8A 2G3ZA 2VQUA 4JG9A 3ZRCC 4EN2A 5IQ9B 1IO4C 1RK0B 3QVAA 1HXYB 2VQ1B 4FQXC 1I8AA 1T21B 5CIPA 1HH6B 3RP1A 1EIBA 1KGXA 2OW6A 3P73B 1SJEB 1IM9D 5F1KC 1AZRA 3UYOD 3P30H 3Q01A 5C6PB 4N8CL 4M43L 1KJ2B 1Q0EA 4MDIA 3ULUH 1E5UI 1FYTB 1T1YB 3BQUA 4IRSA 5HPOA 1LWJA 2NNXA 2A9MH 1CXHA 2YFNA 3DTXA 1P7QB 4HJ0C 1F3DH 5KSAA 1HHIA 3CH8A 2VDLB 3TEWA 4DAGL 1Z9LA 5CAYB 5JIKA 1T20A 3UIZA 1BZ7A 1HDMA 4JGUA 3JTSA 4Y1AD 1J87A 3D0VA 1FBIL 3ORJA 1A22B 5AVWB 2UXTA 4DPAX 3HN3A 5AG9A 1DO6A 1DUYA 4IBLT 3NZSA 2VXUL 2R51A 1N10A 2F68X 4WUUB 3JT2A 5DD3H 3KPTA 5LXGL 2VMFA 4A6YB 4E5XA 5BV7H 1XF5B 4OB5L 1WCBB 4LEBA 4ZO7A 1J18A 2NLJB 1CGUA 4B7LA 1I3RB 2RA1A 3GI8L 3WS3A 2EDNA 3GJEA 1FL5A 2DRUA 4LP8A 1AO7E 2SODB 2CHXA 4X80H 4OJCA 3UG5A 4L4VB 3WD5H 1H3UA 4KK9D 1XTMA 5T1LA 3P69A 3BWAB 4HC1A 1GYWA 1KWKA 3FTGB 5CLTA 1AR1B 3IFNH 1KSRA 4TOYL 4XVOA 1IFRA 2R1WA 4MNGB 1MW3A 4O2FB 5J6HA 5E6ID 5EOCL 3O4LA 4NO2B 2HH0L 4DWHA 2DLGA 4S0HA 4M7KH 4X42A 2XNAB 2NY0B 3QO0A 4WUUA 5DJYA 1NDGB 3EO9H 2AC0A 4GAYB 4FLRA 3W2DH 3UPCA 2LABA 4AIEA 4ZDHB 3LNFA 4NZFA 4HOMA 3UTOA 4BQ9A 4LU5H 3CLWA 1YECH 2XN9D 4I89A 2ENPA 4GLRH 4YHKH 2EILB 2MH4A 3B9KC 2YSSB 3DX3A 4Z0XA 2GYSA 1NC2A 3DC0A 4LKCB 4DQOL 5CJXC 3FYIB 4Z7OF 3DIVA 3FSVA 35C8L 4UDUA 1KLUB 1D5ZA 4FMVA 2D0HA 3LD8C 3HNVH 1VERA 3LH9A 3TJHC 4JKWA 1Q72H 4ONGH 1QFUL 3R19A 2EH7H 5GGUB 5LBSH 1R5IB 3KPLA 4TRPH 5KSBA 3B9VA 2EUXA 1NGQL 1XSKA 4F58H 3T0XA 3WE6B 2ZXDA 5LBSA 1P7HL 1D5XB 4A1RA 2BPBA 2XJLA 4JHUA 1WFUA 4PBWD 4YL9A 5T33L 3VVVA 4XCNB 1QZ1A 1CXLA 3AMLA 4QXGL 5C2BL 3FUNA 5DJCA 3VXUD 5D1XE 5BV7C 5EEYA 3FCTB 3BYYA 3IN0A 3VI3F 1KB5H 4MCMA 2D03H 1H9DA 5HYJA 3QZNA 4FQCL 1KCRH 1NLDL 2GJJA 1T2QL 2J8HA 4LQ1A 2DQDL 4CNIA 5HHMD 2CR3A 4LVEA 1E8WA 1ZOXA 4HUXB 4O00A 5IB3A 5BUGA 1PZAA 2C9XA 3D25B 4I8DA 3UAJC 2QPEB 3QIUC 3QI9D 4WFED 4G7VH 3HPLA 4TVSa 3N41F 3VI3E 2ROXA 5FKAA 4G6KL 4XPTH 1JPSH 5DD1L 4UB0L 2IGLA 4MCZB 2GI0A 3UTSA 2IH3B 4GLRI 2IG2L 1AXTL 2D4FA 4NUQA 1MSPA 1RJLB 2WLHA 1Z3RA 3AS0A 4LSPL 3TC9A 4UV4H 3UTQB 2ZCHH 4D8PB 3ZHLA 4IU3A 4L1BA 1ODUA 3ULVC 2BSDA 1VFUA 2EVIA 1WFTA 3O9WA 1OB1A 3D12B 3VH8B 3KPSB 5A2LH 2VDLL 3MNMA 4E41B 3GHPA 4OZGB 4WTZG 3B7TA 4UNTA 2C34A 2VW4A 2NY5C 3CMGA 4L4JA 3PDGA 1ZS2A 1N59B 3GC3A 4JFDE 1A65A 4I87A 3RFRA 1E6OH 1HKLH 1PZ2A 3ARDA 3CNKA 3DX9B 4TYUA 3SGEI 5FYKL 3SY0B 2VR8A 4KITB 5JORA 2EEAA 5H37A 1E8YA 2QSCH 3BE1H 4JEGB 4X9BA 5GRVL 5EZPA 1ZHLA 4XPBL 3A0OA 3EFFB 5ICYA