2OMUB

Crystal structure of inla g194s+s y369s/hec1 complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
GPLGSWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Internalin-A
publication title Thermodynamically reengineering the listerial invasion complex InlA/E-cadherin.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Cell invasion/cell adhesion
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2omuB00
2A4EA 3Q2LA 1Q1PA 1NCIA 4ZMYA 1NCJA 5JYLA 1ZXKA 2O72A 2EE0A 3FF7A 2QVIA 1NCHA 3LNEA 1NCGA 4NQQA 2YQGA 3UBFA 2WCPA 1O6SB 5JYMA 1WUZA 3LNGA 4ZMXA 3LNFA 4AK1A 4ZMOA 3Q2VA 4NUMA 5KJ4A 2OMZB 2YSTA 4XXWA 4ZMVA 1SUHA 3QRBA 2OMYB 2QVFB 4AQAA 1L3WA 3Q2NA 2WD0A 1ZVNA 4NUPA 4QD2E 3Q2WA 2OMVB 3K5RA 4AQEA 4AXWA 4ZMTA 2X2UA 4ZMNA 4NUQA 4AQ8C 1EDHA 2OMWB 1WYJA 1FF5A 2OMXB 4ZMZA 1OP4A 4ZMPA 3K6FA 4ZI8A 3MVSA 5CZRA 3LNIA 3PPEA 3K6DA 3UBHA 4APXB 2A4CA 3LNHA 4ZMLA 3K5SA 2OMUB 3LNDA 2V37A 4ZMWA 3UBGA 4ZTEA 2OMTB 3K6IA 4XXWC 5CO1A 4ZMQA 4AQAB 4APXA 2WHVA 5DZVA 4ZT1A 3FF8A 2WBXA 4AQ8A 4OY9A 4AQEB 4AXWB
chains in the Genus database with same CATH superfamily
2BOBA 1RFDL 1ITBB 3U7WH 5LLIC 1CGXA 3MODL 4PUBH 1MQKH 2RGSA 4NQED 2DIEA 3FO0L 1T0NB 2PP9A 3C2AL 2XG5A 3DMMB 3H6JA 1TU2A 3ARRA 4PGCA 3EOBA 1MOEA 1KGWA 3MFFA 4C58B 4DP2X 1MXGA 1NCGA 1L9SA 3RWEA 3UOAB 5IM7A 4JMNA 2W88A 1RUAH 4Y1SA 1N19A 3HC0A 3VSUA 1BV8A 3IDYC 4NN6B 4DOHE 1S7UB 3NT0A 1DLFH 1UQSB 1G7QA 2PLTA 4TUUA 1RUMH 1UZ8A 3KPLA 3L3DB 4P2CG 3MTXA 1P4IH 3E8VA 5FCSH 3VD7A 4YHML 2AXFA 1P6AB 3RNKA 3Q0HA 3HNTL 2NY1B 3BZ4B 3CCHB 3QUZC 4I5BA 4DVRH 4U6XB 4E9TA 4F8NA 4OZGE 1T1ZB 3ESUF 2KI6A 2HVBA 5GZNC 4DEWA 1KLFA 1OPGL 2XXFA 2OZ4L 5EHFA 3CDFA 4XN4A 2EDWA 4RFEA 2MH4A 1A7PH 1T1WA 1L3WA 1CDUA 2WQUA 1WWCA 2XZAL 2ZP0T 2ZXQA 5ISZA 4NUPA 5J3HD 4ONFL 1TLKA 1XD0A 1E5CA 2IH1B 4F1SA 4QXTA 1QNZH 4HFWB 5JHAA 5ERWB 4KHXL 4G70B 1OP5K 4YXLH 3H42H 3O8XA 5GSVA 4BWUA 1JWMA 2C9RA 1CTNA 2R2EA 2WLKA 3IRPX 3QFJE 3S36L 1F4WH 2GJ6D 1LWJA 2VDLL 5I1KH 4QKTA 3CHSA 4LZKA 4WNJA 4HCRA 4JDTH 4P06A 1H9DA 1LHZA 4JHBA 4ZW5A 3X14A 2XRAL 4ZAKA 4W9DC 2BXZA 3TA3C 3TM6A 1NJ9A 4K3DL 1HJCA 4TUKH 1F2QA 2WKOF 5F0PB 2OTPA 3K6OA 4Q2ZB 1QABA 1QATA 3ARZA 3QIUB 4G5ZL 5G5DA 2ADFL 4HJ0D 3NIGB 3T77B 2X4RA 3M88A 4N68A 3FO9B 3X1EA 2G9HB 3KCPB 1XIWC 4CVWA 1OGAD 1A1NA 4HWEL 4NUGH 5IUCA 3KLHD 1GL4B 2XWRA 1KIRA 3FB8B 1Z9OA 1RZKH 3H0TB 4MMXA 3AQDA 3I6KB 5KW9H 2YFNA 3B83A 2FT6A 3AG3B 3VFUA 3FHQA 3MLUH 4WW1B 5EC1A 2NY2C 4I3SL 2B3RA 4WW2C 1IGYB 4WI2A 3RL2B 1KY6A 2GEEA 1QFUL 2Y7MA 5CGYC 3DUSB 1ETA1 1U3HB 2GBTA 1SBSL 2DMGA 3RZCD 4MAYA 1E3XA 3MBWB 3ZDZF 4RWHA 3KDMB 2MOQA 3OZLA 4AM0B 3OG4B 2CUAA 3VFMB 1LTXA 3DPBB 3D85B 1DVYA 5EWIL 1FNGB 4GUPB 4IIQA 2E6JA 2XT1B 1AFVH 1T6BX 5D4HA 1D6VL 4F8LA 4XPAL 4WFFD 4NBZB 2BIQA 2FZ3A 4LHUA 4LCWB 3VRJA 3ZDWA 2ZSVB 4UZUA 4ZUWB 2MMXA 2CWRA 4GRWE 4Y4KD 3KS0H 5IMLA 3ZKNC 1RUPL 2F5BH 1ZJAA 5B1BB 3QWOB 3QYNA 2YD1A 4NN7C 5JZ7D 1MRFH 3P9MA 2K3HA 3U1PA 4X4YB 4HKJB 3W0WA 3BUPA 2Q1EA 5IHZB 1MFAL 3IU4L 4RA3A 1QFPA 3SKUD 1NIFA 5F6HJ 5A2KH 5HI3D 1NCAH 1SUHA 2H47C 4UV7H 3ZTEA 3S37X 1IL1B 4JFFD 4XNMA 5HI5C 3L3OA 2QQNH 4ORGB 4I7ZC 2JQMA 4M48L 3GBNH 1E43A 1FCGA 1MHHA 3TO2A 3EF7A 1X7SA 4OZFA 3VG9C 4TL4A 1M71B 3UCRA 1G1CA 5D1QE 3NRPA 5TF0A 4HEPG 4G83A 3MXWH 1T0NA 2J8OA 3FRPA 4YDKH 2YWYA 1N6QH 4PRPB 3ETSA 4FLOA 3GSQA 4WGWB 5I71B 3JV4A 2EYRA 4JUSA 3T3MB 2KL6A 3IMVA 1BVLB 1ZLVH 1BJ1J 1T2JA 1Y0LB 4A2HA 2EACA 1HEJC 1NLDH 3ZHNA 1CFMA 3JV5A 1TJIL 4FFZL 5CCJA 4DSYA 1J0ZA 4ZMLA 1JGUL 1MCDA 3Q44A 1RIUH 3L3DA 3UTSB 3ILQC 3CU7A 3O4LD 3ASOB 3DUHA 3CCHA 3O3AB 3BH4A 1T1ZA 4HETA 4ZW3A 4PJAF 5I1JL 1L9TA 1FVEA 4M5SA 5DT1H 2O5YH 2EDEA 3KPRD 4K55A 1X4ZA 5SWSD 1BHGA 4HT1L 2LFEA 2J7LA 4HS8H 3GGWB 2OLDA 3DDGA 5LWYL 1MCFA 4GW5B 2FO1A 1I9RH 2WXMA 3E8UH 2IH1A 4OZHB 1UWXK 2V2XB 4UAHA 4XNBA 5CJOH 4JRFA 2VCOA 3O6KH 4HFWA 3PS6A 1BD2E 5C8JA 1HNYA 1CBVH 3FN0L 2WZ5A 3O0RH 4K9JA 1EEYB 1RZIB 2OCJA 5FUCE 1ZK9A 2VDQB 2R1YB 4FQ2H 2DQJH 2XU9A 1KYOJ 4WI5A 1CVRA 3WKQA 3A24A 4P4KB 4B9YA 5EEVA 1E4XL 1IAOA 4HLEA 4AGPA 3EBAA 1TTRA 2E3VA 4ZOEA 2W0LA 5A2AA 5HYQB 1FFOB 1F2XK 2DYPD 4K0OA 1H3PH 2HB0A 2NR6C 3QIUA 4FD0A 4PCYA 4ECNA 3IE9A 3T77A 4GEIA 2MQCA 4IRSB 3DWTA 1JHTB 2BIPA 3KCPA 2OXHB 4XVSH 3ARVA 1KXVC 1MN4A 4K2UH 5T3ZL 5ICYB 3FQ2A 3KL3A 3LHAA 4OFKA 2P44B 3FB8A 5GSRA 5CBEB 1OL0A 4N5EC 3ZYOA 3IGKA 2YA1A 3QZLA 5I5JA 3EJYD 3ES6B 3BYTA 4K3HA 2ERJC 4JFUA 1ZLDA 3EYSH 4MAUH 5KSBB 2WBWB 1LO4H 1E5BA 3KPPB 3K80A 4BXSV 1QTYT 4U0QB 3RL2A 3PV7A 1IGYA 2GI0A 1U58B 4I3RH 1H3WM 1DJWA 1GVIA 3V4PH 2ZOWA 3DUSA 4BSWB 1KCSL 1U3HA 4GBXD 3P30H 1BVZA 2R59A 3COOA 3KDMA 3NZ8A 5FXCH 4AM0A 3VFMA 3D85A 1MAKA 1ZE3H 1FNGA 4GUPA 2P3YA 1U8NB 1QACA 3S34L 4X42A 4LCWA 3U82B 1GH7A 3U6RA 3EGXA 2BRRL 4WI9A 2Z64C 3IFLH 2Z9TA 4ZUWA 4EIUA 4XGZB 1WQVT 1MCPL 2EAEA 3CSYB 3PL6C 2P9RA 5EUKB 4E9WA 3O11B 2AV1B 5DK0A 2YRLA 3QWOA 5T5FL 3U9WA 3I6LE 3SKJL 5FC9A 1QWUA 1XHHA 4UBDC 1MCSA 2VISB 4F7TB 2AQ1A 2R9HD 1FGVL 3HS0C 4V1DE 2IWEA 5IHZA 3L4YA 4AQZA 5ABDE 1SMDA 3AJ7A 2NX5E 1G94A 2XN9D 4Y4FC 1XF5B 3BFOA 2R29A 1PLCA 4ENZA 1RUKH 1WA2X 1URZA 3VGAC 3UTTE 1IL1A 4QRFA 2B3IA 4PRBA 5I8KH 3IRZA 4LRIA 1Z6JT 4WZ9A 5AB1A 2ZX9A 1PLAA 2IBGA 1M71A 4TRPH 1JGVL 3TBTB 2NRDA 4G7VL 4LCYB 3V8CA 4B7LA 3WJJC 4M7LT 3REVA 3SGEI 2KH2B 3LMJL 4PRPA 1U91B 4KDTC 5GGTH 4EKXA 3WE6B 4S1DD 1S4IA 3RVXD 1BVLA 4MBOA 5H35B 4KKRA 2XQYK 4P5TA 1VADB 3P77B 1X5IA 4DPCX 4F57H 2CLZB 4PJHB 1MAJA 2K6YA 4XO5A 3HC4H 4QHNB 1Z9SB 4G8GE 4G9DA 5JW5B 3GRWL 4K3JH 5SWQB 3UTSA 2NY3C 1WBXA 4NZTL 1IV8A 4HJSA 4LPVA 1VCAA 4QJ5B 3O3AA 4GT0A 4FA6A 3NJNA 3RJQB 1THAA 4PG2A 2AITA 1CICA 1EZSA 2BMKB 1YZZA 2QHRL 1MNUH 4FFVD 5C0AB 3GGWA 1YECL 1A8JH 1XR8A 3FUEA 4QEGA 3NPSB 3T3PF 5MEPB 2VL4A 3HMWL 4RESB 5HJGA 1H3TA 3QJFB 3R19A 2V2XA 3LIZL 4DVBB 2VERN 1TFPA 3MACL 4HQQH 4HVBA 2VSDA 4DPBX 5KJ7E 4IRZA 4HCFA 5JA9A 3HUJE 3VXRB 5DD5H 3BVNB 5BO0D 1JZ8A 1EEYA 1FGNH 1Q9LB 1M1XB 1E4XI 5GRVK 4Y1AD 3BGMB 3QQNA 4P4KA 5B1KA 1DQKA 3MX0A 3I2CL 4E5XG 3ARQA 4UINL 1AGBB 2P4AB 3MNDA 1HNFA 2IDTA 4KI5D 3AXIA 4JKPL 2X09A 3QUMH 2NW3B 2FCBA 4JE4B 3TJEL 5JMOC 1A0QH 5HYQA 2YD5A 1FFOA 2VR4A 4J12A 3N1FC 5EG6C 2XA8L 2NY4C 3TEZA 2VUKA 4IRSA 4I9XA 1BFSA 1OALA 1PIGA 3EKCA 1JHTA 1S9VB 5AOMA 3QRLA 2RAMA 2OXHA 2EVIA 3A4DA 1DQDH 3MCLH 4YZWA 3V5DB 4DHLA 1CFQB 1WZKA 3NFSH 3JSSA 3MYZA 4H8WC 1PZ3A 4FXKB 3ES6A 1JZFA 5EA0H 5L4JA 4A7GA 2IAMB 1R6VA 3GLEA 4PY8I 2WM0A 2B5IC 2COQA 2EDKA 3MI6A 4PJIB 5I17A 3CZFB 4KZEL 1N6UA 4NB7A 1I3GL 4MMZA 1U58A 4WNQB 3BX7C 4BSWA 1I7RB 4FNLH 1CQYA 2UY7B 5JHLH 1L9PA 4J3BA 1E9PB 1HCYA 1KJ3H 1IGCH 1Y18B 5ALCL 3SD2A 1OAQL 3WELA 4L5FL 3RJDA 2YHGA 1RZFH 4YS4A 5C0RH 1W0VB 5HHOE 1W2KT 4FI8A 4UNUA 3LZQA 4AV4A 3M1BB 4J6RH 4OQTL 2B77A 2NDFA 4XGZA 4DO6A 1UENA 1A3QA 5E6YA 3CSYA 5EUKA 3OWRA 1U33A 3O11A 1QTPA 1J0YA 1JZ4A 1F3RB 1UWFA 3VFVB 4OM1L 3D52A 2CSPA 1U8HB 4KK9D 4ZOBA 4F20A 1IEAB 1GYVA 3N85L 3HPJB 2ZPKH 2VISA 4FXGB 3NK4A 1M7IB 4BINA 3O8XD 5FM4A 1NIDA 1H8NA 1P5VB 4HKZA 3D3VB 5KBNC 1HHIB 1FJ1A 1KTKE 4CSTA 1U92B 3MCKA 4AYSA 1XF5A 2BCMA 1MXDA 3KWTA 1Q4NX 2PYFB 2W59A 1DL7L 1MFVA 2Q3XA 4H13C 2EIJB 4H2AA 4XOCA 5CEZE 1PTZA 3AADB 4ZAKD 1F45A 1JV2A 4OIIH 1ET8A 1ZHKB 2FEJA 1EHLL 4BGDA 3SDAA 3D4GA 3TYGH 2OMVB 2XN0A 3TBTA 1OARH 2JTYA 1R3IH 2I9LB 3MOBL 1TPXC 3MNVB 4LCYA 3V4PB 2XDHA 5CZXD 2H32A 1QLEH 4PJFF 2OR8A 5F96L 3T8XB 4P2QE 4OW6A 3CHPA 5DHXB 1J10A 4LVHB 3AXHA 4TYUA 1TMCB 2AI0H 4JE0A 4NQCA 5H35A 2XZQL 4Y5YB 5ESQB 1A8ZA 3P77A 3L9YA 5IVOA 3FONA 3UZEA 1O9VA 2CLZA 3HZKB 4PJHA 4QHNA 5JW5A 1Z9SA 3BZFB 5FYKH 4Q4IA 3SY6A 3CQFA 4P2YA 2BY2A 4JY6A 5FOBB 1WTGT 3QXDA 3ARBA 4N3UA 3HAEG 1YEFL 3CMOL 4HXAL 2NW2A 2W60B 2BJML 2YKLH 1YYMH 2BMKA 2N7AA 4ODVL 3BKJL 1AQKL 5EF3A 3UAJA 4DQAA 2KT6A 4K15A 4LHUD 3VRLF 5LG6A 1L6XA 3SQRA 2HH0L 3ZDYF 3QJFA 2MCG1 3EJJX 1S9XA 1I1AA 1DJZA 4FKKA 5EF1A 4EDXB 3CBKB 5TE7L 3R1GH 4ZYKB 4E9QA 1FPTL 5GGQH 3DX9B 3BVNA 3VXRA 4JPVH 4PJ7B 3BIKA 5CFAA 1ZANH 1SJMA 3DVGB 2PXYC 3MGOB 3W0WD 4K3EH 3CFDA 4PJ9B 4QNPF 3W1ZA 4CKVX 3BGMA 2WLHA 1TVDA 2D3VA 5I5IA 2AQSA 5C0FB 5IEHA 2JF1A 1AGBA 3VA6A 3UJTH 5HI4D 1PY9A 2CO7A 2X44D 3KXFB 3M46A 3OHXA 2NW3A 4EN3B 1IFGA 5IHBA 4JFYA 1F56A 1RUQH 4MJ5A 1KB9K 3OB0K 3BUDA 4XAWH 3LQAL 3VFPA 4E9SA 2MIZA 5C6TL 5K9KB 4GMSL 2GITB 3ZN6A 4DAGL 1LDPL 1WUZA 4X99B 1S9VA 1EGJL 2P8PB 2O5XH 2QZQA 3H2QA 4LSRH 3H2PA 4X9YA 2G3MA 3V5DA 1CFQA 3VWKB 4PREB 1OV8A 3TWCL 3WOVA 3GTTA 1Q8MA 3LV3B 3NCCB 1UGNA 2FEEI 4CN4A 2PN5A 3GT6A 3QDJB 3FFCB 2IAMA 3W37A 4PJIA 3EIFA 4HIJB 1BQSA 3HE6B 5C08E 3T4AB 3TJHD 3BH9A 3WLWC 4F8TA 1ACZA 4OIBA 2QVMA 4WNQA 5SV4A 4P2AA 5DJ8B 5MEQA 5JPNA 4H5SB 3V4UH 4MZIA 1I9IL 3NTCH 3D05A 3Q7JA 2YK1H 1Y18A 2YMOA 4ANUA 1TZGL 1QSFE 3FTSA 4O58L 2WIIB 4GINA 1T22B 3GJFH 1UD2A 2ICWB 3FU5A 3VWJB 1W0VA 4FHBD 1QSEB 4TNWF 2GJZA 2PW2A 3TJPA 2X12A 4L1BA 2VZTA 4KTEL 5C0EB 3M1BA 1C16B 7TAAA 1FVCB 2X3AA 1ZHBB 4RRPM 4UDUA 2P80A 4M8UA 1OCWL 3MUGB 4FQQB 5AW4B 2CHXA 3BSZH 3VFVA 3QUMB 1XBRA 1U8HA 4YHYC 5KVDH 2FJUB 1IEAA 3RA7L 5HXMA 5IF0A 3EOTH 3QPKA 4RGMC 4FXGA 3QI9B 3BVXA 1E7VA 1IO4C 2AJXH 1P5VA 2NT0A 4FX5A 1RK7A 5DD6A 3HI6H 2E86A 5HD8D 1TZOA 2ITDB 3W5MA 4Z23A 5FO7A 5TK2A 4EDWL 4IOIB 4NKDA 2E9JA 1H8OA 4YE4L 5I74B 1R33A 3U0TA 1CDBA 2VKWA 4JGUA 2X2IA 5IJDC 1ZHKA 1GC1C 2AEPH 1EO7A 1B3JA 2MCPH 3MV7B 3ZW3A 4BWWA 2A9AA 2OMVA 3QIUD 3OQ3B 4OCRL 3ZPDA 1UB6B 1VAHA 2I9LA 1TYJA 4JG1H 1GGCH 1X5YA 2BWQA 4HISA 4TSBL 1EHNA 1B0IA 1NCJA 5ESVA 1UA7A 4X6DE 3F7QA 1QW8A 2YAEA 2HMID 3MXVL 4YHZL 3NP4A 1KSRA 1ZV5A 1NBZA 1RFDH 1NGQL 1CG9B 1ZWIB 4Z77B 3MODH 5CINH 1RP9A 3N44B 3TZVC 3C2AH 5ANMB 1KTCA 2K4WA 2ED8A 2GJRA 3CN0A 2EICA 3B43A 4Y5YA 5D7IF 5ESQA 1P7HL 1CK0H 3ORJA 3QNFA 4PY7B 3HZKA 3QQDB 4NC1C 4RIRB 5FGRA 2I9TB 5FKAB 3BZFA 1UWEL 2NY0B 1DVSA 1PBYA 5FOBA 4YDJB 2HWZL 5T1KB 2Q7AA 3OAZH 4OFVA 2IPKB 5IBLD 4QHMB 3D85D 4WWKC 2IBZY 3B7TA 5E4AA 4B53A 1H19A 2EUVA 4YHMH 1MY7A 5F0JB 2H6PB 2MOGA 3HNTH 3SDDC 2WSKA 3X17A 4N85A 4LCWD 3TTYA 1ES0B 1MVFA 3STZB 3UTPD 4LPYA 3S6CA 5D7JC 1QI4A 3K8KA 4OJFL 2WD0A 5KBPA 2Y25A 5MEOB 1OPGH 1BSIA 2KQMA 4WV1B 2UVEA 1H3UA 3M1OA 2RHEA 3VFNB 4ZYKA 3LRGA 2XWTA 2XZAH 2DBJA 3SPVB 4C54A 1AXTL 4ONFH 1KV3A 2WQXA 1IGML 2XN2A 1COBA 3DVGA 3FSWA 1MVUB 4KHXH 1CURA 4G9FE 5GGVL 1WS7A 4ODSL 1R5IB 4HBQA 3K2UL 2B9BA 3BFQG 1ZV9A 3ARGC 1QLEB 3SE6A 5C0FA 1BFVL 1GSKA 3S36H 1O5PA 5F70A 4PRDA 4Z3TA 4EN3A 3EYQD 5GGTA 4QUOA 3B3IA 3RX5A 4OAWA 4YXKL 4LP4A 1R24B 5EOCL 2XRAH 3SKNB 5K9KA 4HF5L 3S2CA 3H6AA 4K3DH 4X99A 3UIYA 5JNYB 3OKOB 3R8BB 4BCZA 1X5XA 4G5ZH 4GEJA 1G6RA 3D07A 2ADFH 3V7AE 1B9KA 4I2XE 3VWKA 5KEZA 4HWZB 4PRPD 4B0MM 3DTDA 1UKSA 3QDJA 1ZIAA 4GFTB 2A6DB 4Y9CA 3RTQA 4HWEH 3U0PA 4I48B 4PTTB 5EBWB 5C6PB 2VN6A 4HIJA 3DXAE 5J6SA 3T4AA 4KUCD 2XVKA 4P5TD 4OLZL 1KPRA 5DJ8A 4FRWA 4P57B 2FT7A 4H5SA 3STBA 4AQ8A 3PY9A 4I3SH 4M61B 4OF6A 4AZ8B 3UTSD 1NGYB 4PP2B 3B4NA 4MNGB 2WIIA 4S1SL 3IVKA 4PVBA 4FF9A 5I73B 4ZPVB 1THCA 3B2PA 3IFOA 4HS3B 5F7EL 4XB8A 2O72A 3CFNA 3NGBB 1QSEA 1SNRA 1IFRA 1CICD 3LNEA 4HCIA 4MJIE 5EWIH 1C16A 5C0EA 1U8LA 2X1QA 5BRZE 1ZHBA 3ZYZA 1D6VH 4XPAH 2IMMA 3D06A 3MUGA 4FQQA 1WS8A 1UYWL 2R39A 2JQZA 5E94A 3ZE0B 3QUMA 3TA4D 2DM3A 3AG1B 3OC5A 4R3SB 4PV1C 1XQ4A 4K71C 2WP3O 4L3EE 2F53B 4NT6B 4Y9BA 4KKBC 5ADPL 1ZTXE 3QI9A 4Z76B 2FRGP 4HUVB 1RUPH 2ZG3A 1MFNA 4NX0A 1JTTA 3FYEB 1M7UA 3EZ8A 3KBHE 2WKGA 2R1XB 2PO6C 3V9EA 4ETYA 3VA2C 1RZ7L 1LP9E 4YXHL 3ATBA 4ZFGL 1N7ML 4IOIA 5KG9B 1MFAH 1ZLUK 3IU4H 1RIHL 2DLHA 2AXGB 4GJTB 2YZ8A 4AGNA 3FQ4A 4Q58C 1UB6A 3FAWA 4BEIA 2OSXA 3QPXL 4IRSD 1R34A 4M48H 4ZPTB 5C0JB 4JO1L 5E6IC 2P48B 2WCSA 3N04A 4YSDA 2X0WA 1NBVH 3PWJA 1TVBB 4XCCL 3AREB 2Q76B 2QT6A 1ZWIA 1BX2B 2CGRL 3KYNB 3VXSB 3GJFB 2DLFL 3NSDA 5BQDA 1CXKA 1JYWA 5ANMA 2Q7YB 3V7AG 4E9YA 4H26B 3WE1A 5CWSA 4XBMA 4YN3A 4EBQL 3IJHA 5C1MB 1H8LA 4PY7A 5CLWA 3QQDA 4JAMB 2I9TA 4P2RB 2Y5TA 4QRUB 2GTWA 2H1LM 2WN3A 4U6TA 4YDJA 2V7NB 5F3HB 4FFZH 3O2WL 4HEMA 4JKMA 1GC1L 3S48A 5LHDA 4PYGA 4MVBD 2ZUTA 4LNVA 1RL1A 4ODXB 1JGUH 5KVGE 4BGLA 4JFHE 3ZL2A 3ME0A 3P73A 4PRNB 3LRSB 2JKLA 3KPSB 3IJ7A 2UUDH 1ES0A 1UD8A 3RX8A 3STZA 1BYNA 4WTZG 3U2JA 5I1JH 4AQAB 4QGYA 4APQB 4LEOB 5MEOA 4OZIB 3R0NA 4WV1A 3TFKD 3ULUE 1U2CA 4Y4HC 4HT1H 3VFNA 2KDGA 3WIHL 3ECBA 4DK3A 5E1HB 2OMUA 5LWYH 3SPVA 1H6FA 1WBZA 5DCCA 4B9ZA 3MKGA 2GBVA 3UAEA 1MVUA 3QBTB 5LBSL 2DH3A 4HUCA 5FKPB 2L7QA 3FN0H 1R5IA 3MRCB 2CK2A 1CIUA 3TBCA 3IJ9A 4IDJL 2DV6A 4NQQA 5DJXB 4Q7DA 1IKNA 1INDL 4W4NA 5JW4M 5KVFE 4PJXB 1V54B 2NQDA 2TSAA 5DFTA 2IC2A 3MBEC 3SKNA 2AQPA 3C8DA 4MXQC 5HYSG 5I15L 5JNYA 3SDAD 4LK4A 3NIFE 5B39B 2JELH 2VXQL 1NM4A 2A73B 4GQQA 3CNKA 4U6YB 5JHBA 4CJ0A 2GC4C 4M1GL 4XE5B 4XHJC 1YEEL 2HXAA 1OHQA 2G4EA 4HWZA 4ELMA 1A6AB 2Y2TA 5C0GB 2A6DA 2JXMA 3E1ZA 5T3ZH 4I48A 4PTTA 3WI9A 1BFOB 5EBWA 1GIGH 5K59F 2AANA 2DD8L 2Y72A 5AYTA 1U2HA 1VPOL 4NQCD 5EN3A 3I02B 3WLBB 1A4AA 4P57A 3E0GA 5JIMA 4IKLA 3MA9L 2AV7B 3VXUE 5F1IB 3D6GA 5DGRA 1BJMA 2JMRA 4AZ8A 1ZIBA 4PP2A 3UPCA 4MNGA 1FF5A 4Y5XB 3EH2A 1U4EA 1KCSH 3ARBD 4U4BA 3LD8C 5LNEA 4HS3A 1T7VA 3SBRA 1FLTX 4JUTA 3NCYS 3O2VL 1D7FA 5JUEL 1DVZA 4XN8A 3EF4A 4KOBA 4WRLA 4JFDA 2NXZD 3P40A 4QHUA 4DP5X 3KG5A 2AQ3A 3UAJD 4O2EB 1TTGA 4ADGA 1K8DB 4NOFA 4PRHE 3ZT7A 5HJDA 5C3LD 1QRNE 3TOPA 3EJZC 3KEHA 3W5NA 2BRRH 2IGFL 1I1AD 2QSTA 3GKWL 2F53A 3KLDA 2HZHA 1MCPH 4NT6A 1IAMA 4UZSA 4QRPE 3W11C 4Z76A 5HHME 3VXRD 5T5FH 3QYMA 3SKJH 1WT5C 2KPWA 2R1XA 1CGTA 3POCA 3MRLB 4BWTA 5CJQL 1FGVH 3ZQWA 1IEBB 3GQFA 1MCEA 3B7SA 4CUCA 1SXCA 5KG9A 4LEXL 4X5RA 1WCQA 1K3IA 3QJSB 4XOAA 3PGCA 3IMUA 2VE6B 4TLKA 2AXGA 1I53A 2MQ3A 3UIZA 2BVPB 1E8ZA 1TQCB 1JZIA 3LX9A 2XTJE 4LLVB 4W9HC 1ICTA 1LO3L 1JMXA 1U6AL 2ZE0A 4LMQI 3LZLA 4N25A 4ZPTA 4AYBA 3KWWB 4ZQKB 4A1RA 5HYJB 4AC4A 4AUJA 3N9GL 3IJSA 5D1QC 3UTOA 1TVBA 1JGVH 3AREA 3N41F 3TO4D 4G7VH 5KSVA 5TQ2L 1FYTE 1BX2A 3VXSA 3KYNA 2B1OA 4V2CB 4JPKL 1TKWB 2VDRL 3PDOB 5DO2C 4U2YA 5GRZA 3ZUCA 5IGXL 4FTVB 2IAMD 3O9WA 3LMJH 3ULAB 5IVZB 1OAKL 2WLMA 3WJLC 3BDBA 1Q9OB 2WCPA 3VD9A 5GS2H 4CL7A 2NXYC 4X80L 5J7CC 4JAMA 3H9SE 1I9JL 2E7LA 2YGVA 4QRUA 3SDXA 2EZ0C 4HOMA 2DW5A 2WP3T 5HGBA 2V7NA 3MRBB 5F3HA 4ENED 5GS0D 2X6CA 3G3LA 3RVWD 1KFAL 2YXVA 3VX1A 4MQTB 2JV6A 3GRWH 4ODXA 1BQHB 2G2NA 4M29A 4DIXA 4TTDD 1I8MB 5E2JA 3ZRSA 4NZTH 4D2NA 5J12B 2N1KA 2NYZA 3KPSA 3LRSA 3CSPA 2UXGA 4AQAA 4MXVF 4CDGC 2OFQA 4APQA 3BWUC 3GDCA 4LEOA 4M6NL 4OZIA 1DO5A 2QHRH 3SDYL 2OJZL 4KXZH 1HNGA 1MIML 1GW0A 5CEXB 1HXMB 2HUEA 2A0LD 4UT9L 1EUUA 1LXMA 1YECH 4XXCC 1B6DA 4KDWA 3S0PA 1J88A 5DJ2B 3HMWH 3MLWL 4ABQA 4KTDL 4LPTA 3MACH 5SWZA 4WI4A 5BW7C 3CZSA 5FDWB 5FKPA 3KE0A 3EO0B 5FUCC 3BIBX 3BPCB 3FAXA 3MRCA 2Y06L 5A2FA 4PJ8B 1QUPA 1AS6A 2A6IB 4LLAA 3QZOA 5DHVH 3MRRB 1BAGA 1MIEL 1PKQB 1QHOA 4PJXA 2XFXB 3I2CH 3EYVB 8PAZA 1QWNA 4HBCL 3R18A 4OCMC 4A63A 2WCGA 4UINH 2VLKB 3EDDA 3LKSB 1MW3A 4JKPH 4JZJA 3TJEH 3RUGB 5IW3A 2DYSB 2A73A 4Y0GA 2XA8H 4U6YA 3IGAB 4TVPE 3SO5A 2YRPA 4KI5F 3VO0A 4K4KA 3C6SB 4I18B 3RY4A 1A6AA 1SOSA 1AZZC 3QJHB 4GOSA 3T1WA 3OAYK 3S35X 3DLQR 4BQ8A 4DKFL 1BFOA 3KW7A 4FG2A 4FG0A 4M7JL 1QW9A 1T66D 2V5TA 2ESVE 3RI5F 1G0YR 1RJLB 1I3RB 4UOJA 3S98A 3WLBA 1JZ7A 4XPHL 1EAPB 3QRFM 1DUZA 4GYBA 1MZZA 4KZEH 1HQRA 5F1IA 1PYWB 2NNXA 1I3GH 2YR3A 3OAUL 4EMZA 5I0YA 4QCIA 4XPTL 3F12B 4DP8X 1OAJA 1OP3K 5EU3B 2AXWA 4Y5XA 4XI5D 3EH1A 5E6UB 4HXBL 3PXJA 5F1NB 4AMKH 2W0KA 1PD6A 5HYFA 2DKMA 3CU1A 5ALCH 1OAQH 1FL5B 4P9HL 2F19L 4UV4L 3VB8A 3VE0B 2BVYA 3IDYB 1DP0A 1K3ZA 1K8DA 4K7FB 4YZFF 4EQ3A 3TESA 2X9XA 2D0GA 4NDMB 4KTYA 4AIXA 3MJ6A 4OQTH 4WI8A 3QUZB 2ZUQC 1XWVA 4Z7VE 2FHCA 1Q38A 1AZBA 3QDGB 2YPVL 3N85H 4MHHG 3V5HB 2OTWB 3SPJA 1IEBA 2A9NL 3RU8L 5AVXB 3SHSA 2IQ9L 1G7JB 4PJEB 2W5PA 1MI5B 4Q9RL 4W9GC 2VE6A 4XBEL 1RCYA 2K6WA 2BVPA 1CL7I 3HC3L 4LLVA 1DL7H 4PRIA 3VFWA 3MRPA 4D8OA 3BJLA 1WFOA 4ZQKA 1EHLH 5HYJA 1P0SE 3DJSA 3LPOA 2X4QB 4YNYB 4NOBA 2YAPA 2VLMD 3MOBH 3PFUA 3X3FL 3VWKD 1S7RB 43CAB 3TA3B 1J9RA 1TKWA 3PDOA 5E9DB 3QDJD 4FTVA 3RTQD 5F96H 4U33A 2DBLL 5IEKB 2Y1AA 4BE5A 1S7XB 1OVZA 2CBOA 4ISVB 5F6HI 2G3ZA 4I89A 4U1NB 2PUQT 4F24A 1X5HA 1IC4H 1XIWB 2DKSA 2FO8A 4IK7A 1N9PA 2XZQH 4B9JA 1G87A 3HJEA 1XTLA 2J25A 2YGPA 3MRBA 2D7MA 1U8KB 4DP7X 4YVUA 3F62A 3KM1A 3B5TA 1H5BA 3V0EA 1N6VA 1I8MA 5GRVL 2PWHA 1XT5A 2FIKB 3AGWA 1D9KC 4YLQT 2LQRA 2NY2B 4CADB 1I3UA 1QEXA 1YEFH 2PYEE 3CMOH 4HXAH 4YC2C 1SUJA 2BJMH 4DZ8B 4XC1L 3D2UB 5C09E 4ODVH 2BNRB 4X6CA 1AQKH 1JF1A 1LMIA 5CEXA 5AOZA 1HXMA 1FHNA 3MNWA 4R83A 1FVDB 2YLKA 3VX0A 1WO2A 5DJ2A 5FB8B 2HH0H 4QRRB 2VW6A 4LT7A 4XNQB 1C1EL 4IM8A 1J05A 4Z3GA 4TMPA 2WLIB 3E80A 4BQBA 5TE7H 2WZAA 5FDWA 1FPTH 2NY6D 3BPCA 2F0CA 4NJ9L 4PJ8A 4HUUB 1R3LA 4Z3FA 2ITCB 4NIYE 5CGTA 3BUYB 3CDGB 1KB3A 3I85A 3OJMB 2RD0A 3BH8B 1ZMYA 3MRRA 3MA7B 4LEBA 5LBGA 1PKQA 4AJYV 2XFXA 4NN7B 3EYVA 4Z7QB 4M8VA 4FFYL 4PTUB 1GYWA 1RKRA 2VLKA 3LKSA 4C83B 5JDSB 2H1PL 4F80A 4AG4H 1CQKA 4PP1C 2VLRB 5L2KB 3N3EA 1N59B 4EZJA 3VTTA 1DEDA 4MJ4A 5C6TH 2MNJB 4GMSH 4DAGH 4FFZA 3UEZA 4L8SA 1EGJH 1WZLA 2DJ4A 1HFUA 2H0JA 4I18A 4PM1A 2APXA 2PTVA 1EAOA 5KSAB 4EPSA 4C56E 2KZBA 2W0FB 3OSKA 3FQ1A 1X5MA 3VG9B 1UCBL 3O6FC 4FZ8L 1EAPA 2FVNA 3WUWG 1PYWA 2EIMB 2NY0D 4NRZB 5HDRA 4MNQA 5EU3A 2WIMA 4KQ0A 4XCEA 4L1SA 1I9IH 1B90A 3NJLA 2MFNA 2QBWA 3L8QA 1R0AL 2KS0A 4O58H 3HR6A 4ZI8A 1EK3A 3VE0A 4K7FA 2EXWC 2G5RA 3PWLA 4TLSA 1HH9A 2BSSA 2D8KA 1ETZB 4KTEH 5DHVB 3AW5A 3KGUA 2VQ1B 2ZX8A 4CU6A 3OXSB 3QUZA 1OCWH 3CHRA 2CKBL 3LN4B 4KKAD 3ZSTA 4K5NA 2J6EA 1ZA3B 4IQHA 4K8RL 1SEBB 3ASWA 4LEEA 5EBGA 4ZBJA 5GZNA 4OM0L 3RA7H 2EE6A 3GFUA 1YEDB 4JO4L 5EFIB 4UYQA 3QZWG 5HVGB 2VXSH 1MFEH 1Z32X 3PYCA 2P5EA 1MI5A 4FQHA 6PCYA 4N2NA 1AKPA 1INQB 4EDWH 1MCWM 3TH4T 2UZYB 4YE4H 1MFBL 2N7SA 4HS6B 4OIAA 5AW0B 2EEBA 2DKUA 1DBML 3MLYL 4NZRL 3AFLA 1D7CA 4HV8B 2X4QA 4KO9A 4YNYA 3NRQA 4FJYA 2VAAB 1UT1A 4LFHD 3B5HA 4OCRH 3RE0A 1BMZA 2ARJA 5DMGD 1EX0A 2Q20A 4L4VA 5E56A 2EVFA 1A5FL 2CBMA 3TA3A 2EQDA 5E9DA 2WOYA 4P3WA 4ZO9A 4OSUL 12E8L 5I8CA 5IEKA 3MXVH 1JAEA 1SYSB 4YHZH 3B5GA 3NIGF 1NGQH 3T1FB 4HAKA 3D39E 4ISVA 3ULVF 3WMSA 4U1NA 4AEEA 1M6OB 1XIWA 1UZ6F 2E7CA 3BVDB 1FQ9C 1WITA 1VF5C 4ZMOA 1MHEB 4L2LA 1U8KA 1WAEA 4OFQA 1AIFB 2H1XA 2ADJB 2ERJB 5T5FA 2FUQA 2FIKA 3LB6D 2DLEA 2HWZH 1SN2A 1FNAA 4W9ZA 4M02A 1T1XA 3ZJAA 3QUYC 1NFAA 4WW2A 5J56B 1OF0A 4GW1A 3ZHDA 4CADA 5IQ9B 4N87A 3CBRA 5I1LA 4JFDD 3OBAA 1EXGA 4ZOCA 2BNRA 1OAXL 1B4LA 1R3KB 2YJLA 3RP1A 2CRIA 4HIIB 4NAJA 1FVDA 4H1LA 5FB8A 4OJFH 2F53D 3MLTB 1W9XA 1G9EA 3PGDB 2X1OA 2MQ0A 2WLIA 5L4FA 4EUPA 3HRZC 1SZNA 4HK0B 2JVUA 2ALAA 3LKQA 3IPFA 3O6LL 3M6DA 1FFTB 1AXTH 2E7DA 2NUPB 2W9DL 3HZYB 3FQXB 4HUUA 2ITCA 1IGMH 1P7KA 3BUYA 2P5WD 2WLNA 4BFEA 3BH8A 2IGLA 5FF6A 5D5ME 5GGVH 3MA7A 1MCKA 1ZVYA 5TE4L 1DBJL 1CUOA 4ODSH 2JB5L 3K2UH 3WUZA 4G6AC 3VQMA 4DN3H 3P9LB 1BFVH 3ZGHA 1UXWA 2R1WA 4F15C 5JDSA 3HS0B 4NQDD 2CR0A 2VLRA 3VH8A 1UD3A 3JQOB 2LLNA 4YXKH 1DVFC 5EOCH 1N59A 4CBZA 3X13B 4HF5H 2YD6A 4Y4FB 2P8LB 3IMWA 3VGAB 4HALA 3ARED 3F3HA 3RAJL 3WIAA 1WUNT 1DUYB 3VXSD 4G43A 4ELDA 5A3ID 2M2DA 3CDYA 2W0FA 3DX6A 5CEYB 3CFKA 2CUIA 2XIDA 3NUKA 3O9WD 1JVOA 2VYRE 1NZRA 1W16A 5JXEC 1KTLB 3NN8A 1YRKA 5EUOA 1XSKA 3JWOL 2SEBB 1HT6A 5I18L 3ZZQA 1AXSB 3O3UN 3CSGA 1R17A 3MLVL 4MJHA 3MRJB 4N0CD 4OLZH 5L0QC 4DF9A 1S8DB 4I3GA 4YSUA 5I66B 1LO5B 3JV0A 4GG6E 1P4UA 2CLVB 4XVOA 3T3MF 4OVVA 5IHHA 3L4TA 1JZ6A 4KMTH 3M7OA 1NKRA 4PRAB 5IB1B 4N8UA 2VKXA 4KUCF 5MENE 3FF7A 3N55A 2BSDA 5D7LB 4AEFA 1HEZB 1ZSDB 3DGDA 3UPRB 3QNYB 4N1HB 4BDVB 4S1SH 3KPSD 4PB0L 2OYPA 3ZE1B 2YBRA 1KB5L 4L4TE 4W93A 5F7EH 4P0DA 5F7BA 4AV5A 3S3DB 5CBAB 2EE2A 1JPEA 1EAJA 1NMBL 3GM0A 4APQD 1ETZA 3VNYA 4D7BA 2NY3B 3EXLA 3EOAA 2VQ1A 1YEHL 1SJXA 4GPVA 3OXSA 4XX1G 1RZJC 3CVBA 5AW9B 1T5KA 3LN4A 3WS6C 4IHOA 3G5XB 1GZQA 1ZA3A 1SEBA 2JK5B 4G6FB 4XTRD 3KEDA 3FT4B 4WTXA 5T8IA 4WLCA 5SWZD 1EDYA 4M62L 1E5UI 5L4IA 5ADPH 3SE4C 3A21A 4XWGL 1IM3B 3RWJB 1N18A 1YEDA 5EFIA 2XVLA 2LU3A 1V3LA 1FHGA 3IXAA 4FMVA 4H7VA 5SX4I 4CC1A 1F18A 4FYSA 4G82A 4OZHF 4U1MB 1M6UA 1RZ7H 4XMZA 4OD3L 1K4DA 4YXHH 5E1QA 1WWWX 2DJMA 1E6JL 1QUNA 4QD2E 4ZFGH 4ZZFA 1N7MH 2VH5L 4LLDA 4JBSA 5IP4A 4JO3L 5LAPA 1RIHH 1R9FA 2UZYA 1X44A 2OV0A 4HS6A 3C9NB 2O61B 1YN7B 2V9TA 5LAXA 4EI6B 4PR5B 5ID0A 2Y69B 4O2CA 4ZODA 4J3UA 2DQUL 4WO4D 1QFHA 1CU4L 3QO0B 4Z7WE 2DM4A 3QPXH 4N90D 1VKXB 4JO1H 4TS6A 1JP5A 3OHMB 2L3BA 3RVVD 1TDQA 1F8TL 1WFIA 4XCCH 4NQXB 1SYSA 3MVSA 5HPMB 2NR6A 1E5ZA 2NY4B 4I1NB 4R9HA 2CGRH 3BYYA 5KBLA 2DLFH 2AKRB 3UMNA 3T0VA 3K72B 1C08B 5C0CA 2IOMA 4EBQH 4KGJA 1F6AA 4X50A 1GJIA 2WGNB 3KJ4C 3E3QE 1MHEA 2DI8A 4HWBL 4N4YB 2WJ7A 5CEZL 1LILA 1TQSA 1OXYA 3GB7A 4J2QA 3BVUA 4ONHB 2Y23A 2ADJA 5TPWL 5KSBF 4WFED 1VGEL 2HAZA 5DJAB 3FUFA 1OP5H 2B5IB 3O2WH 3LS5L 1GGYA 1GC1H 1P7BA 1WHOA 1I8AA 2JTDA 4G5AA 3JTTA 5FYJH 2G5BA 4KJWD 3SJVB 4XNAA 2NZ9C 3B9KC 4IJ3C 3OF6A 3ETBF 1JI1A 4K9EL 4RNRB 1HZKA 2AQ2A 5A7BA 4I9WE 3WY4A 3MLTA 3APCA 3GI8L 1X6LA 3PGDA 3UZVB 1Z0NA 3BP4B 2FATL 3WIHH 4HK0A 3ZIMA 4OGXL 4DNLA 3P4LA 2FHFA 4QAWA 2NUPA 2YZ1A 3HZYA 3DRQB 2ZYIA 2EEDA 4JFZL 3KYMB 3PL6A 2V9UA 3C6LC 2VR9A 4RFNB 5LBSH 3WMQA 2Z93A 1BFTA 2E27L 3NZUA 4LARL 2LU4A 3L3GB 4KRNA 1J8HB 1GGUA 4R26L 4IDJH 3GMMB 3HS0A 4P99A 3V0VB 3CZUB 1INDH 3VMNA 5FCUH 5LN8A 4PRID 1WH0A 4P46C 1CLCA 3NCFB 4AIZB 4J3OG 3X13A 4KHTL 4KROC 4X0NA 5I15H 4Y4FA 3RWFB 5HYJD 3KNBB 1XGUB 2P8LA 4LCCC 5JO5B 4Z7IA 1RHFA 1DUYA 1EZVY 4ADIA 5AB0A 2ZCLL 4Q6KA 1DJGA 2FH6A 2WXOA 3L5IA 4M1GH 2OMYB 4N2HA 5CEYA 1YEEH 3A6CL 4FTVD 1SDYA 4CW1B 3K1KC 1ZDQA 4QHKJ 3CZLA 2Q86B 4GT7A 4MZ2A 4WFHE 1SYVB 1TPXB 1C5DB 1S5HB 2SEBA 2WWMC 4OLUL 1AXSA 3IB4A 2DD8H 3I9PA 3WJJA 1XAUA 1VPOH 3P0GB 2YOCA 4BQ9A 2Y5EA 1FG9C 1YPZF 3MRJA 3UC2A 1GY1A 2DWDA 1LO5A 4NQEE 1X5AA 3VVWA 1A4JA 3MA9H 4KDTA 2CLVA 2P42B 3D18A 3QHTC 3DVIA 1BZDA 1GMEA 3MGTB 5BUAA 4PRAA 5IB1A 4AK2A 5CMAB 4D9QD 3SKOB 2N01B 5D7LA 1EFXA 1ZCRA 1HEZA 1ZSDA 3R4RA 5E5RB 3UPRA 3EBGA 1IUZA 4B5ZA 3KM2A 4PJHF 4U3HA 3SBWC 1UKTA 3KYKL 4ONOA 4WUUA 2EC9U 3O2VH 5JUEH 5EO0B 5BMFH 1N5AB 5CD5D 2JFCA 3VB9A 3ZLQC 4MDJB 3IGLA 4BFFA 1R5WB 2DQMA 5D96C 3O4OC 4JK0D 3QZPA 4Z8FL 4NHUA 4KK8D 3F05A 3QC5X 4JO8A 4R5VA 2JK5A 1AZRA 2IGFH 2R51A 1AHMA 3GKWH 5J8OA 5TJWK 2WO3B 5IBUB 2J1ZA 3RWJA 2P5PA 3SZ6A 3DBXB 3FK3A 1EUTA 4DGIL 3CZGA 4U1MA 5LGHL 1QVOA 4TM9A 3BRFA 3QJUB 2FSDA 1BMWA 1RPQA 5CJQH 4EI5C 3WNMA 4BQCA 4JHVA 3THML 4BXVA 4LEXH 3UX9B 5D71L 1FYHB 1LQBC 2WBXA 3WKYA 3EUDA 3I6GB 3ZKMD 3C9NA 3GMQB 2O61A 1I75A 1M9SA 3BUIA 2PXYB 1BXVA 4EI6A 4UOW0 1KCWA 4PR5A 4N2KA 1F4AA 3HG3A 2EILB 4NNPL 1E4KC 1XZ0B 2GJ6E 3Q6FA 4X5XA 1LO3H 2Y7OA 1U6AH 2J8UE 4YBQD 1ZVSA 4J5VA 3AM8C 1VFAA 1A7OL 3Q01A 1YN6B 3N9GH 5DEGB 1ORSB 3GK8H 1S7VB 4NQXA 1HL4A 5HPMA 5TQ2H 4GAFB 4QWWD 2Y6SD 3GDBA 3ZGIA 4JPKH 2VDRH 2AAAA 4KKLD 1KG0A 2JKSA 3GMOA 5IGXH 1OAKH 4BSVB 2CHDA 1OGAE 3GSOB 3PHQB 4X80H 1R75A 2WVUA 3U0WL 2V9QA 1JGDA 3C8HA 4MNQD 1HXKA 3L7FA 2WWKO 3DROA 4ONHA 3U2SB 1KBPA 2C9UA 4PJIF 5T5NG 3B1TA 1CXEA 3PWVA 5DUPL 1KFAH 4GQRA 3H8NA 5J11C 1NBYB 3DUUB 3ZYJA 3SJVA 3TCTA 4X7CC 4H8QA 4RNRA 3ESNA 3JXAA 3AUVA 4HLZH 5F1SA 1L9QA 1NSNL 3ARTA 3GRGA 2W9LA 2DQFB 1T6VN 2VGLM 3SDYH 15C8L 2OJZH 2BHFA 3UZVA 4IIZA 3BP4A 1MIMH 4UT9H 4WEUD 4FLHA 3R7QA 5GZND 3IM1A 3MGAA 4WFFE 3DC0A 2OMXB 4FP8H 4L9DA 3MLWH 4KTDH 3DRQA 3QPQD 3KYMA 3PPSA 2Z8VC 2F7PA 5H37H 4EF3A 4ERSL 2H6OA 3LTVA 3LIUA 4MA3B 2P5ED 1BDYA 1MI5D 1W91A 2Y06H 2J1XA 3D34A 2DRUA 4K7PY 1QD0A 4OVUA 4QJ4B 3AY2A 3L3GA 1J8HA 4O02A 4XNZC 3RBGA 5IKCB 3GMMA 5I0VA 2ZUYA 3EH3B 5IQLA 5HBBA 1MIEH 2JKJA 2EC9T 4HBCH 4AIZA 3VI3B 5DJCB 4JKKA 2XBTA 2FNWA 2ZX5A 1XGUA 4PVLA 4MZ3A 3TTSA 5JO5A 1UA6L 5AW6B 4YO0B 4L4VD 2FJFA 5AZ2L 4CBPA 3TA3D 3BDYL 4DK5A 2YGQA 4JFFE 4CW1A 2WXFA 4YDLC 1AO7A 5J06A 2BRQA 1ODUA 4DKFH 4LAQL 5JIKA 4M7JH 2X6MA 4W9FC 1C5DA 1DQVA 1PCSA 1S5HA 3C5ZC 4MCYB 5DQJB 5AZEL 5TTRA 1NLBH 1A4KB 1XIWD 2HA1A 4B50A 4U0RC 3HE7A 4XPHH 5HDWA 1BEXA 1FSKC 5A43C 1HH6A 2F74B 4HWUA 3QORB 1UH3A 2YIHA 2OK0L 3OAUH 1L6PA 5D4QA 5DR5L 1OF2B 1T0MA 2IDSA 3IJYB 1R19A 1B6UA 4OCSL 4R4BB 3HC2A 4XPTH 3TZVB 2IXQB 3PWPB 2CBQA 4HXBH 5EU5B 2NY2D 2B1AL 3WHE1 3BW9B 5CGYD 4YSPA 2YD8A 5EO0A 5AG8A 3KLAA 4ODBD 3TT3L 2E8YA 1D2OA 4P9HH 2F19H 3BAJA 2BNRD 4LPUA 2PWEA 4MDJA 4UV4H 4Y5VC 3U4EB 3C60D 1T7ZA 4AV0A 4JPWL 3O4LE 4WWKB 4IBZA 3VD3A 5G4MA 1HYSC 3SDDB 4YHPA 3MJ9A 3VXMA 4QMEA 1P5UC 3KPRE 4KITB 5SWSE 4LPXA 5D7JB 2YPVH 3QE5A 1M2VB 4HU2A 3ZKND 2A9NH 3RU8H 2IQ9H 4ZQTA 3BFWA 2CCWA 4PJ7F 4M00A 4Q9RH 4PJBB 4DH2A 4XBEH 3K0YA 1V3KA 2VLRD 3FHEA 1FFQA 1K8IB 1S7TB 3BN9D 3HC3H 3V0IA 1NEZB 3A22A 3ARGB 1FC1A 2H5UA 3DV6B 4MGXA 2CA3A 4HIHB 3WN5C 4M56A 4PS7A 4GRWH 3GWJA 5IREA 3V6OC 3II3A 1ORSA 1ZTXL 1S7VA 3QUXC 5HI5D 2X70B 4LCIL 1VACB 3NJVA 3E1F1 3GSUA 4RX4D 3X3FH 5FV2A 4MS8D 5K1JA 5A2IH 3JT2A 3WMPA 4CRPA 2CDFB 5T5NF 2DBLH 3S7GA 4BSVA 1WIPA 2CD0A 3GSOA 3IYLW 2K70A 3PHQA 4EEEA 4XP1L 1CD1B 3RIFF 2E46A 1PL3A 4A2EA 3U2SA 2V6HA 4N5UA 3T0WA 2G9KA 4OCWL 1JFQL 2C3XA 1OE1A 1OAZL 2P26A 1DN0A 4HW6A 3A6OA 3QRGL 3T0DA 1NGZB 4PI2A 1N12A 1NBYA 2QQKL 3DUUA 3CVHL 2XN1A 4FL4C 2E8ZA 35C8L 3DO4A 4UWQB 4X98B 4NN6C 2X3BA 3RVUC 4R8WL 1I82A 4XC1H 1LVEA 2BLFA 4YDIL 2F8OA 1BZ7B 2PABA 2VR5A 1SJEB 4KMLB 1ZJBA 2BW4A 3B7YA 2NY1C 4HK3J 2RH0A 2WYIA 1FLRL 3HHSB 4JS7A 2NCEA 1JD7A 1C1EH 1JCVA 1AMXA 3ISWA 1DR9A 2ZKXA 1AKJB 3QAQA 4QOKB 1JK8B 3OKDB 4MDIB 3I3EA 1DBKL 2JJWA 3D0LB 4IGBD 5B1JC 3HZ3A 3MDJA 1Q90A 5DUBB 1KXQA 3L13A 4NJ9H 4K71B 3AABA 5C07A 3UJJL 1HQ4B 5EBLA 5KVGL 2MQGA 3BP5B 3PFQA 5CCKL 3HFML 2CR6A 4AQOA 2IV8A 2VDRB 2BWDA 2QGEA 4JM2C 4QRSB 4FFYH 5TDOB 5DJCA 2PO6B 4N2BA 2H1PH 1CDJA 2VJ0A 2WWKT 5JOPD 3ULUL 3CH8A 3Q8EA 2XN9E 4YO0A 4AVKA 4ONGL 4PJDB 5FO9A 1QBAA 3VI4B 2EIBA 4FDWA 1GYAA 3T5WA 4A68A 4UB0L 3P9WB 4BFOA 1KMGA 2R23A 4MCYA 5DQJA 5LN4A 3ZIYA 2OZNA 2VT0A 5KS9B 1A4KA 4H88L 4PB9L 5I24A 3OKLB 1JPTL 2AEQL 2PMZA 5C0CD 1HSBB 3LJ3A 1UCBH 3RWGB 3ULVC 4FZ8H 3X2QB 4FYQA 4WNSA 5KVFL 2F74A 1G6VK 4N5ED 2IFFL 1BF5A 3N44F 1VGKA 3L1EA 4LIQE 1CD8A 5KBKA 3IJYA 3TZVA 5AVWB 4N28A 2IXQA 2WWNA 2EH7H 3PWPA 4Z7UE 1ZPUA 1D5XB 5CR1A 2EDMA 4NKIL 1AP2B 3CXFA 3BW9A 2E6QA 5CZVL 1R0AH 4DOHB 3A5VA 4I0KA 4X4XB 3V0GA 1GYCA 3BEWB 2PKDA 1Z0MA 4FKEA 2Y5QA 1UB5B 4Z3EA 4WWKA 4KRLB 5CSZB 2ZZUT 3WFEL 2BFGA 1KBVA 5JOFA 3DPDA 3C5SB 4OZGB 2XWBB 3SDDA 2CKBH 4DGYL 2D2CC 4OCXL 4WI0A 1R3JB 2QPDB 5HGGS 4K8RH 1A3RL 5I26A 3SGDH 4OM0H 4X9GA 1E65A 1AR1C 1M2VA 3JV6A 3PL6D 4Y4HB 5CUSL 5ALBH 5TDPB 3RPIA 3QEHA 1A1OB 4JO4H 4L1HA 5DVKA 3DKHA 4IOFC 5LUMA 2VMJA 4AVIA 2Z91B 2Q5BA 4WWPA 1EMTL 2VQTA 4UBDD 3D7PA 3QQ3B 4N2GA 1HAUA 5B3JF 1UGKA 2NUTB 3DOIA 2X1PA 1K8IA 1Q1PA 1S7TA 4IRJA 1SJVA 3NFNB 3KVDD 1NEZA 1TZ8A 3NJFA 3ARGA 4Y1AE 1RZPA 4YPJA 1MLCA 4AC2A 1MFBH 3DV6A 4Y4FD 1RURL 4LASL 3EJTA 4YL9A 4KX8A 1DBMH 1UG9A 3MLYH 4NZRH 1PIFA 3TBSB 4J7RA 4DP4X 3W39B 2ZG1A 3CUPB 3T6ZA 5AVSB 1ECZA 2X70A 3AAZB 2CJSA 3FS9A 1VACA 4MJJA 1UJ3A 3MBEB 5F7KC 1A5FH 2HSIA 2XKSA 3U7YL 4BKSC 1A9VA 3QA3B 3NJMA 3MUY1 4CMHC 4JFTA 3QR1A 5ICZB 2W38A 1BGXL 1QA9B 12E8H 4OSUH 2FBRA 3F58L 4QKXB 4HFUL 5I6KA 4FLSA 3IS0X 3BZEB 4NENA 5E8EB 5LVEA 1J5DA 4DJMA 4AQ1B 2EDTA 3VD0A 5HPOA 5B39G 4LSVL 3S5LG 3O2DL 3LZNA 5KANG 4JFPB 4LLUA 2OL3L 2J3SA 3BC9A 4NP9A 4AYDC 5D7LD 1EFXD 3AUWB 4DZBB 4NC0B 1AANA 4D8PB 4WUUD 4Z7OE 3AMKA 1PFOA 1YG9A 1KIUB 4LLYB 1XEDA 4OUOA 5KWYC 2BX5A 5DWUL 4ZMNA 2I25N 1O6VA 2EECA 1OAXH 1U3ZA 2DDQL 1KIQA 1SJEA 2VDKL 2TSBA 2H7WA 3RRQA 4NZ8A 1MPAL 4M6ML 1TZAA 1CGWA 4E41A 3LH8A 4ZMZA 4CMMA 1OP4A 3ZE0F 3BAIA 4ZFFB 1JK8A 3OKDA 4MDIA 2Z8RA 1JWSB 5I1EL 4GRWB 3O6LH 4JM0A 4WSGA 3PHSA 3C5XA 2W9DH 3QCVL 4UMSA 1HQ4A 3BP5A 5B8CA 4A7QA 3C2SA 2WBJD 2KZKA 1DBJH 1NDMB 5TE4H 4J28A 3IEAA 2KUTA 5FO8B 5L9DL 4QRSA 5E99L 2AQTA 2PO6A 2YD2A 4B7IA 3US9A 3QR0A 3F84A 2XETA 3PP3K 3L4ZA 3K4AA 1DDTA 2VITA 4LHJB 2WK2A 1PLGL 4PJDA 1F90H 2CCVA 1N8ZB 1UEYA 5FW6A 3VI4A 2PR4L 3HR5B 5AVVB 3SYCA 3WTUA 1IAKB 1DJXA 3RAJH 2C3GA 1IFHL 4BH8B 1DQTA 5TGBA 4RISL 3FF8A 2XXMB 4R4FL 5E6IA 3CV5A 2NSXA 5KS9A 4LNRB 2KC0A 2ZYHA 1HSBA 2BZ7A 1ILUA 5D1QB 3RWGA 3NIDE 2Z6FA 1N2RB 2WVTA 5I18H 5I1GL 1RI8A 4OV6F 3MLVH 2B16A 1QLRB 4UIKL 2OMTA 3N06B 5AENA 3UTQB 4UT9A 3DETD 3PAZA 2GJPA 3R0MA 1D5XA 5JIQA 2UV3A 3CFJB 2NXYB 1AP2A 4I0CC 4KKPA 4LOUC 4TVPL 2E74C 5I1AA 3HHRB 5DJ0B 6CGTA 1XCXA 2NCMA 5C0IB 1E28B 2CHNA 3BZDA 1DQML 4PB0H 4X4XA 1KB5H 3BEWA 1RMFL 1YSOA 2ITFA 1MJ7L 1VHPA 4CN6A 1UB5A 1I7UB 4RETB 3QAZC 5EZOH 1YEHH 2G30A 1OTTC 2EC8A 2VABB 2I5YL 3P11L 4WUKL 1MW1A 5C0ND 4OZIF 1J5IA 1M05B 4Y7MA 1T2QL 3RFZC 1BQHG 3IKCA 4M62H 3T0BA 5B7FA 4Y4HA 4L8CB 3FO2B 1SMOA 5TDPA 4XWGH 4MNHB 5DK2B 2BDNL 2BVOB 2CK0L 2VDOH 2X42A 5GZOD 5GGSB 4POZC 4KU1A 5K93A 5CKGA 3IPEA 1BD2B 1QO3B 2FJGA 3QQ3A 1NIAA 3HVDA 4OD3H 3ARFC 4NS0A 1E6JH 2WYZA 2VH5H 3NFNA 1UXLA 3STLB 2DI7A 4POYA 3MRGB 4F1ZA 3TBSA 1PDKB 4PJXF 2HFEB 3RDTD 2DQUH 1CU4H 3AAZA 5E70A 3WL9B 3MBEA 1RZKC 4GP5B 2GK0B 3QA3A 4HEPA 4QRAA 5ICZA 1AO7D 2H8PA 2EH8L 1GGIL 1FZOB 1F8TH 5BS0D 3I50H 3PWUB 3AS0A 2IQAB 1J87A 1YC8A 2X4NB 2KKQA 5E8EA 1JGLL 5KVMC 1NFDB 4O51B 3HE7D 2AJ3B 4JR9L 1NFIA 1J9SA 4BUHA 4GRLD 3ZT5A 1MWAL 5EIQA 1KCKA 4HWBH 5CEZH 2VC2L 4JFPA 2CKBB 2FIRT 2ZKMX 5TPWH 5A6MA 1FE8L 1VGEH 5HVHC 3ESOA 3DGGB 3U9PL 5I28A 2BHUA 2YPVA 3LS5H 5AYQA 1PD0A 4BZ1A 4M6OL 4Z3JA 5CJ5A 1G4MA 3FT2A 1JSYA 1P2CB 1RV6X 3MHZA 2OYLA 2CJUL 1UD5A 3X1NA 1MVYA 2FWLB 4NAMA 1PPIA 2H3KA 3A0OA 1N26A 4K9EH 3S37L 5GHWL 1T20B 4TLUA 4KH9A 4PV9A 2FQDA 4N2MA 2ATPA 1GZPB 3CIQA 3PV6B 3GI8H 3P4NB 5HGDB 3VXMD 5HHNB 2QVTA 2FATH 4JANA 4ZFFA 5K9OA 1JWSA 4OGXH 4F91B 1IC5L 2MTAA 3NPSC 4JFZH 5EU7E 4DO4A 2N0KA 5TK4A 2ZUQB 1II4E 1WGOA 1UM6L 1CJYA 1L9RA 1NDMA 2E27H 4LARH 1WT5A 1MW0A 2JLPA 3V79C 4E5XB 2F1EA 4JDEB 4V1DB 4R26H 4X6FB 3QIBC 4XBPB 2OMZB 1FV1B 5FPIA 3CFCL 1G7LB 2GTZB 3MROB 1CGVA 4UQ3B 1PMYA 2NX5B 4F7PA 4F9LC 4KHTH 3CN4A 1N8ZA 2L0DA 3QRBA 3IF1B 4YHNB 3IT8D 4YQXL 4YX2L 3UTTB 4NCC1 3RL1B 4BQ6A 5DZJA 1PSKL 2AF2A 4UTAA 1IAKA 1X9QA 2ZXBA 4BH8A 2XPZA 4GG8B 2ZCLH 4PW9A 1GSMA 2YUVA 3NABL 1KTDA 3TL5A 4UNVA 3A6CH 4LNRA 5D1QA 1QBML 1EDHA 2VLLB 4JQXC 4LU5L 5GIRB 4Q8BA 1KBGL 1JERA 5DVOA 1JZHA 4OLUH 2ED7A 4O2FB 2QGBA 4ODWB 4OFYA 3HN5A 2MWCA 2XKNB 5JIHA 4I1RA 4CILA 3WJLA 2AABH 4WK4B 1OCZB 1ZOXA 3CFJA 4A7TA 1XSIA 3WLWD 3P4OA 3ZKQD 2Y07L 4L3CA 1EAQA 5DJ0A 2ATKB 2BPBA 3CFEA 3L3IB 1VJSA 1A22B 3EO9L 3KYKH 4G8GB 3B9EA 4JFQA 1ZLUH 4K5LA 3RHWK 4JQVA 2CU9A 4P5MA 1X5JA 1IJNA 1KLUA 3EH5B 3V0HA 3DRTA 4KBPA 4HHWA 1D9KB 3HB3C 2V0AA 2VABA 3C09C 1KGUA 3Q13A 5DHEA 4Z8FH 2FSEA 2BSEA 1ETJA 1NGWA 4LCWE 4YC2B 3UTPE 1M05A 5K9QI 3VGFA 2C1PB 4L8CA 3FO2A 5ID1B 4MNHA 1U41A 4ZDHB 2BVOA 4HUKB 4DGIH 4QXGL 5C07D 4J3OC 1SVZA 1QO3A 3KPTA 4OY9A 4PVMA 5LGHH 4D0DB 2BSRB 5E00B 5BW7A 3HUJB 3T0AA 2WYHA 5D71H 2FGWL 1NCTA 3STLA 1C9SA 1HE8A 3QS3A 3MRGA 1IBZA 3MV9A 2RFXB 1PDKA 1G7HB 2HFEA 4NNPH 2VZOA 4IMLA 5HDBE 3VDBA 2ADYA 1OOAA 3WL9A 3WCYA 2VRKA 2GK0A 4R4ND 1A7OH 4Q89A 4QO1A 3RUGF 2OULB 1KDJA 3OR7B 3T71A 2IDUA 1T03L 1BVKB 5FYJD 3PWUA 4OD2B 4KVNL 2IQAA 1U4FA 2X4NA 2EUWA 2YMTA 3D33A 4PY8J 1NFDA 1KB5B 3TONA 1NFKA 1FCCA 3F04A 2E59A 3RWHB 4PRPE 3KZ8A 1E9QA 5C70A 1AOZA 4L05A 2HT3D 5FGBC 3U0WH 2AAVA 2TRHA 2CKBA 1CGSL 4QIRA 5EV7A 1E9OB 1W8OA 3PWPD 3O6FB 3L9RB 4Q52A 5CZKA 3DGGA 2Y7QB 1P1ZB 2HRGA 5LNGA 5DUPH 3S8WA 2HLAA 7FABL 1GJWA 1XR9B 2W0PA 5EZJA 1P2CA 5KVEE 5FFLA 1TCRB 4XVTL 2VDOB 3UTSE 4AW4A 3GSVA 2CO6A 1T20A 3DX4A 4WWKD 4X8JB 5HYIA 1F13A 1HYRC 1NSNH 3WTXA 4L8BB 3DO3A 3QNZB 3PV6A 5HHOB 5C7ZA 5HGDA 15C8H 1N70A 2FGZA 4MD4A 5EEUA 3MBXL 4AYFA 1PAZA 1V8HA 2J73A 4UDTB 4H0GA 3DHPA 3T0EC 2QMJA 3TFBA 3ATDA 2D0HA 1C7SA 1WAAE 2ITEA 4XP4L 4ERSH 4ZS6D 2DTSA 4JFXB 5EN2A 3B6SB 3BRGC 1HHGA 3VJ6B 3W3BA 2ENSA 4F58L 4E5XA 1NPUA 4JRYD 3N6YA 2EABA 2NOYA 2FL5B 2OMZA 1G7PA 4IRJD 4X2UA 2ZOKA 4PJEF 1G7LA 2GTZA 3ARGD 4PJ9C 1CI5A 3O81A 1T4WA 1YCSA 2NX5A 5EF2A 2WQAA 4R7NB 1IGTA 1UASA 1WGVA 2WLLB 2CXGA 1M53A 3IF1A 3NZHL 4YHNA 3UTTA 1OE2A 2VSMB 3RL1A 1UA6H 4FI6A 3MNZB 5AZ2H 4GG8A 5DVLA 3BDYH 4PCTA 4MFHA 3CBJB 2A74A 4IBVA 1XCTB 4B9FA 4LXFA 2CGZA 3LQZB 4TUJB 3MR9B 2VLLA 4Z0XB 5GIRA 4LAQH 4A39A 5AZEH 1NCIA 2AJVL 2MHAB 2ZAHA 5D2LF 4ODWA 3U4AA 4P2QB 2XKNA 3MRIB 2RCSL 3DSFL 3IAPA 1FFPB 3MUUA 4G80B 5AALA 1KDIA 2QJDA 3K2MC 5GPRA 3TASA 4FADA 4YHOL 1NBQA 3IDNA 2OK0H 5DR5H 5T1LD 3PIQB 3BEVA 3HE6C 2ATKA 2XIIA 4QAMB 1BXAA 1ADWA 3L16A 3JBG7 2MNWA 2B1AH 4G8GA 4U3SB 1D5MB 3DYPA 3S5ZA 1W6WA 4JVUA 4G6KH 2G2PA 1WD8A 3TT3H 1HU8A 4N2OA 2B14A 4HH8A 5E9NA 1D9KA 1X3DA 2YSTA 3JUYA 4OT1L 3QUYB 1PNCA 2GVYA 2R56L 4JPWH 3BISA 2GC7C 4NO0B 2X10A 3L4VA 3BZ5A 3T6XA 4WQOA 4E41D 3ETTA 4HKBB 4BFRA 5H2BB 4N6QA 4QDGA 5FA4B 1WIOA 1WCBA 1XGYH 2CO4A 3L95B 3RB5A 4G8FB 1MHCA 3Q6GL 3CZNA 5LB1A 2AJSL 4D0DA 2BSRA 2VR3A 5E00A 3HRZB 1YMMD 1MFMA 1IGFL 2D7NA 1WYJA 2E47A 1UZGA 3ROOB 1L6ZA 5EEWA 3QG6B 1I3VA 4ICWA 1RU9L 1NC4A 2I24N 2F9BT 3NSYA 4Z7QF 4K07A 4NO5B 4F15B 2YAFA 5EO9B 3MRNB 4JHZA 3FPXA 4H20L 1I8UA 2FNBA 2AK1L 1BVKA 4LCIH 2DF3A 1DVFB 4OD2A 3HG0A 2Z4QA 3FT9A 1ESOA 5E6ID 1A47A 2GYSA 1KB5A 1LK3L 5EZPA 1WE5A 2IVFC 2Z35B 5DA4A 3RWHA 4PWGA 3CC5B 3EDKA 4P3DB 4XP1H 2RIKA 2VQ4A 1WC7B 1E9OA 2YEZB 3O6FA 2XPGB 4NQCE 4OCWH 2Y7QA 4P59L 1JFQH 1P1ZA 1DE4A 5C08B 2DB8A 1OAZH 3EYUL 3QRGH 5F9OL 4YSSA 4PJHE 5D7IA 3HAEA 2FLRT 3SO3C 5L0QB 4MWFB 1TCRA 2QQKH 3CVHH 3F65A 4WGVB 5CF3A 35C8H 5HHXH 1G9ML 1IEHA 3GO1L 2D7QA 4JB9L 3RZCC 3NCEB 1G9HA 2O6FA 4LL4A 4X8JA 1JG9A 3UYPB 4R8WH 1ZXKA 2X05A 5HHOA 1J8RA 1VA9A 2Y2YA 4YDIH 1GMIA 4RLDA 2X40A 1C12B 1FLRH 3LRKA 4UDTA 4U6HB 1W15A 2DPKA 5AAWC 3LYRA 4Y4HD 3OAYH 1AAJA 3LOWA 4TUOB 5FK9B 1DBKH 2JJSC 1XAKA 4JFXA 4TULL 3BO8B 2YRBA 4HCGA 3VJ6A 4TNFA 1BG9A 2DY2A 3VXRE 1YY9C 3UJJH 5KVGH 3DI3B 3KWVA 2FL5A 1CF8L 2P28B 5CCKH 4DP1X 3AS3A 1JXGA 3FQTA 3HFMH 3RPKA 3ATEA 1MELA 1SXSA 5E9AA 4R7NA 1S7WB 5JDJA 3BXNB 1OP3H 1ED3B 4HWBA 1GZHC 1JRHI 1OZUA 5FOJA 5BQ7B 4MXQD 1JPST 3HCVB 5FA3A 2GSGB 2WY3B 2RA1A 2AK4B 5B4MC 4UB0H 3ALXA 2K8MA 4TUJA 4DPAX 4Z0XA 2FECI 4AZUA 2HJFB 2AQQA 5HTSA 3MPCA 4M1CC 5I0WA 3UZQB 1LE9A 2MHAA 4H88H 4KZDL 4PB9H 1JPTH 2AEQH 3MRIA 5D8JL 5PAZA 3TCLB 4H2CA 4MTMA 1FFPA 1SGKA 2QKIC 5KVFH 2OJEB 2IFFH 2L8AA 3BT0A 3RG1C 3QISA 4WDIB 5CZRA 4KNUA 4B97A 3HKFA 3G5YB 4MYWB 2A6KB 2HP4A 5AW5B 3KJ4B 5GRXG 4BSJA 5EZIL 5IW6A 3ETBJ 4J3TA 4NKIH 3KMDA 3WDIA 1T7YA 4QT5A 5CZVH 3KH4A 4QHKI 4FFTA 5K39A 2GJJA 3F7VB 1OSZB 2V5SA 4FQJL 1OQXA 2Y3AA 4LPCA 5JORB 4NO0A 4XP9L 2BOLA 3WFEH 1PEWA 3TIEB 3B9KB 4IJ3B 3QDMA 5H2BA 5AL0A 4NI6A 3L3KA 2QZ5A 4DGYH 2OMBA 3IXTB 3LRMA 5FA4A 4APXA 4QRTB 1KIPB 1WFJA 2JI3A 3L95A 3LHPL 3CLEL 3ERXA 1VZGA 1Y1DA 4G8FA 5E2UL 1XSJA 2XSKA 4B3VA 3U1QA 3VRIB 3W11D 5CUSH 3MJ7B 3HRZA 4FN0A 1MFCH 4OUUA 3ROOA 3HKZA 2BSTB 1G84A 1A9EA 1A6VL 2GI7A 3QG6A 1EMTH 3J07A 3QXAA 4WY7L 1H8SA 1HVXA 2M26A 1OB1B 4GAYB 4PGEB 3C6LB 1XF3A 4R97B 3RLSA 3W2DL 1AY1L 1NUFA 4E2OA 1LWHA 1GYUA 1D3CA 3V6BR 2EUZA 2QADD 3FB6B 4NO5A 1JNLL 1RURH 4LASH 3E6HA 3MRNA 1TR7A 1IBHA 2BZDA 2D3JA 4P46B 1DVFA 3CDCA 4L29B 4PSPA 3MLSL 3GM8A 4X6EA 3U7YH 4ATTA 4KUZL 3ESMA 1TJHL 4KO7A 1SFDA 2IANB 2EP6A 4LCCB 1OPOA 4ZS7L 4HA1A 1BGXH 4KGLA 3F58H 2DQ6A 2Z35A 1UOVA 4HFUH 1HCVA 2FEDD 1A9BB 1BZ8A 5FM8A 5T1MB 4ODTL 1G4RA 4UTBL 4XNDA 3BSHA 2GIMA 1JIBA 4YFDB 3EJYC 4OF5A 1CDCA 5IR1B 3QJTB 4KQ4L 3ZR5A 1IJ9A 2CJTA 2EVHA 4BK5C 3FC8A 3HMXA 1JK9B 4LSVH 4XN9A 2P43B 3DXAB 3O2DH 4HGKC 5IFAH 2VDNL 1VFOA 3KS0J 2OL3H 1RZGB 4WKZB 2EZ0D 3CPLA 2N7BA 4PSRA 4MWFA 3QO1B 1D6EB 1LYQA 5I1CL 1KENL 1NCOA 3GKZA 3HBQA 3UYPA 1SXNA 1RY7B 3RGVD 5DWUH 3PAVA 3ZE1F 5JMRA 4U1GC 2ZYSA 5JLZA 3L08A 3N91A 4NO3B 4AIOA 2DDQH 2NZ1A 2BSED 4NPYA 4MJIB 3ZMEA 1MPAH 5C3IA 2J21A 3SOTA 5BRZB 3L5WB 4MB5A 4U6HA 3H7LA 2PWFA 2M8XA 4HUNB 3DYMA 3O4OB 3WS6A 3S2AA 2NTFB 2B7DT 4L8DB 4S2SA 5DRWB 5I1EH 4YWGL 1NCWL 4L3EB 5IUSA 1A25A 3NEXA 3QCVH 3WO4C 5HP5A 2KZWA 4P23C 4PBWD 4H25B 2ED6A 2R9HC 3SE4A 1JPGB 3TCXA 3EYOB 2IBZX 4PJ5B 4PLNC 3K81A 4ZXBC 2NMSA 3NZSA 3W57A 5E99H 1S7WA 1D5ZB 2CBPA 3BXNA 3MV9D 2R4RL 4EI5B 3QNXB 2AZAA 2NZIA 1IAII 4LMQE 4X7EC 1PLGH 3NJGA 3DURB 4F2MB 2EO9A 5KSUB 5JHDD 2GSGA 2VRQA 3S96B 1R1CA 2PR4H 2AK4A 4R96B 2PETA 1IFHH 2YAHA 1U8JB 2HRHA 2HJFA 3N1PC 3W82A 4RISH 1XF2B 3CVHB 2VLME 1MCNA 5FM5O 4R4FH 5B1CA 3T6QC 1QP1A 2VN4A 4XH2B 4RSVA 3BQUD 5ACZB 2OCCB 3QDJE 1B9ZA 1F3DJ 2HTKD 3ASNB 5D72L 3ULSB 3ESVF 4BA0A 2OJEA 1XVSA 4UOZA 5I1GH 4F7CB 4S1DC 4WDIA 3RVXC 4UIKH 2NSQA 3FH5A 3HHMA 3G5YA 4LP5A 5F7FA 1SF3A 4ZRGA 5EU4B 2A6KA 3D5OF 1OK8A 3WTWA 2RMNA 4RSYA 3V0JA 3BWSA 3HLAB 4TVPH 3SEPA 1WFUA 3UBXG 5J89A 1YNTB 5I1HL 5JW3L 4OKDA 2NTSP 1O7DE 1AYOA 2JKIS 4WTWA 1DQMH 4K94C 2LLGA 1RMFH 1MJ7H 1OSZA 2NQCA 3IDIB 5FW8A 1J0IA 2BNQB 5JORA 1QAWA 5J11B 1E2WA 1DQIA 1TEYA 4YSEA 3TIEA 1W0YT 3LKNB 4FQIH 2JCWA 3B1UA 4EZLA 2I5YH 3IXTA 3U36A 3MV01 3P11H 3HI1B 1HTYA 3Q2NA 1KIPA 4MAZA 4QRTA 1QFWI 4WUKH 3VVVA 1FZKA 1S7SB 5BUPA 1T2QH 4NJAL 3VRIA 3Q2CA 3WO3B 3LY6A 3FQYA 5IHUL 5IV2A 2DMKA 3KPMB 2BDNH 2CK0H 3VXNB 4X4KA 1T0PB 4ZUTB 1XX9C 2AZUA 3VYNA 1CXHA 1ACYL 4PLKD 1XDTT 4X0KB 1NAML 1FH2A 4Z0BL 1OB1A 4HPYL 4EZMA 4XP5L 4PGEA 2W65A 2ZAIA 4C55A 5C7XH 3ZHLA 1RIVL 1M4KA 3O3EB 5E0FA 5DSCB 3DO7B 2OR7A 3MUZ1 4GXUN 1DTUA 3CLFL 4XNZB 1CE1L 4IK6A 4P3CH 4JGNA 3ZYIA 1TVHB 3UCQA 4P46A 4L29A 2XG4A 4Y19D 4YSOA 4R7DB 2OQJB 3NIFB 5T33L 5D1ZC 3WXWL 1UFUA 2IANA 1IBDA 4LCCA 3TPUA 1B0RB 2EH8H 2KERA 1GGIH 2C9AA 1KGYE 1MCJA 1LK2B 2XZZA 2WQRA 1A9BA 3D25B 3N5AA 1JGLH 2E7HA 5T1MA 1J5OH 3QXVA 5E2VL 3TF4A 3K6IA 1KJVB 4JR9H 5BZZA 3IMSA 1JTOA 4NQSB 5IR1A 5IQMA 5DZOA 1MWAH 5ANME 3GMNA 1EH9A 1OLZA 4B27A 1JK9A 3K46A 1BZOA 3C5ZB 1LEKB 2OTUA 4PJGB 1JYXA 2VC2H 1RZGA 4WKZA 3CN2A 4U0RB 4P8QA 2PTUA 1FE8H 3VXUB 3V9FA 1FSKB 3QO1A 1CFNB 3U9PH 1X4XA 3FNKA 5IB2B 2RBLA 4M6OH 4HEME 4N0UA 3MKKA 4WTZA 4HPOL 3BKML 2CJUH 5DJDB 1D9KD 4ZSOB 1T6WA 2C9XA 2IGTA 3HNSH 3EW3B 5LGKA 5KZCB 4AX3A 1NCHA 3S37H 5GHWH 5J12C 4MJIA 3NSFA 2LT9A 4PU2A 1F41A 1WFMA 6TAAA 3QIWD 1B0GB 5BO1L 5D55A 4PRHB 2GT9A 2O5ZL 4ZO8A 2XQ0A 1OZTG 3EGSB 1QRNB 4TVSa 4F33B 1KN2L 1MCIA 2QHLA 4MD0B 4NRXB 3S3CB 4L8DA 1LNUB 2B8OT 4L3EA 2EJ1A 1IC5H 5GRYA 4KK9C 3RY6C 4QRPB 5A6LA 1RD6A 4ANVA 2FE0A 2V4LA 4HD9A 4H25A 4XO8A 1RHHB 1JPGA 1P5UB 1UM6H 3EYOA 4GKZA 4PJ5A 1P6WA 3V4VL 1A3LL 5AW8B 1VEPA 1IT9L 1D5ZA 1NC4D 1NINA 3SKMB 5HYSA 4UILH 1G1KA 1OP9A 5AL8A 4EI5A 3IS1X 1SFHA 1E8XA 3CFCH 3TN0B 5D1XC 1JVKA 2F61A 4F2MA 4AMXA 5KN5B 3C08L 2R0KH 4U1JB 3O3BB 2WXKA 5KSUA 3UPAA 4PP1D 4YQXH 5DURB 4CKQA 2XTJB 4CNIB 3N1MC 1LDSA 4J1UA 4YX2H 2OL3B 1E4KA 2K9UA 2AQNA 4ZX5A 4TL5A 4BKLB 4AYGA 3N1GC 5AWNL 2QFRA 1CLVA 1XF2A 3CVHA 3NABH 5L2JA 3NJKA 3WN5B 5CJBA 4NKOB 4PS8A 4IHBA 3T4YA 4URKA 4ELME 5ACZA 3QUXB 3VFGL 4LU5H 4LVOC 1EA9C 1KBGH 3ULSA 2EUXA 4F7CA 2X7LB 3OTTA 2CXKA 4ZX4A 3O6FD 3NOIA 3JYCA 2A4CA 3IBEA 3II1A 5EU4A 2CG9X 3H9SB 4AEHL 1MREL 2BHZA 5EIVA 5GXBB 3HLAA 2Y07H 5E03A 1E3FA 5K1VA 4RMRA 1UOKA 2X9WA 3HNVL 4LSSL 4I87A 5DFVC 4MNGE 3EO9H 2UWEF 4WU5B 4CVXB 4NCDA 5I16B 3IDIA 5EZLB 1YA5A 2QGDA 2ROYA 2BNQA 3LXUX 4NERA 4FXTA 5INCA 1EEZB 3NACL 1OGSA 2BSBA 4FL4B 3RNQB 1AQ8A 1QHQA 4JFDE 1DBBL 2EXWD 4MYPA 4JKNA 3HI1A 3ZE0E 4H8PA 3F7PC 1S7SA 4LIQL 3ZDXE 1FA4A 2V3EA 1V3MA 1K72A 4FYTA 5I76B 2F53E 3PWNA 1B2WL 3KPMA 4NI3A 1FO0L 4X5WB 3VD5A 1SY6L 4ZUTA 5KUKA 2IO5A 4QXGH 1JDDA 3QQ4A 3G9AB 3OD3A 4X0KA 3P02A 2HX8A 2B59A 5I30L 2P5WE 3W9EA 2FGWH 4K94L 3O3EA 3BCDA 5DSCA 3DO7A 2NNFA 1PG7L 5IJVB 5HI4C 4U1KB 4HSCX 2ZUVA 4PH8A 4S0HA 4NQDE 3MMEB 3VI3F 4JM2B 4PGZA 4R7DA 4DGVL 2OQJA 2J2ZB 1T1YB 1A4CA 1S9WA 2H0EA 5IB4B 4DQOL 5IB5B 1JXKA 4N9GB 5EOQL 2IMNA 1T03H 1LK2A 1BQLL 3A4FA 1FFNB 2YN5A 4KVNH 4NUJB 3D25A 3S8GB 2LV4A 2XPYA 3VXSE 1IZKA 3U83A 3BWAA 4NQSA 4YBHA 3ZE2E 1CFSA 3C5ZA 2P7TA 4PJGA 3GSRB 1LEKA 1XZWA 1CGSH 2YAQA 1BZ9A 2LHAA 3VXUA 3F6JA 3SDXE 3ATAA 2DQCL 4A66A 5FYLD 2J12B 1AGDB 4UM9A 2IBBA 4AE0A 4ZUSA 2VXTL 5AUMB 3PJSB 4LB8A 5HJBA 3EXJA 4MZRA 2C3WA 1WPCA 7FABH 3SN6N 3UYRL 3KAAA 4XVTH 4ZSOA 5DJDA 5DUJA 1MCHA 4UIMB 1L7IH 4HLZG 1NM9A 2CDEA 2HFFB 2VMCA 2GB2A 2LVEA 1QEWB 3OQRA 4L0YA 1J86A 3KPSE 4NO0D 1R5VB 1KYAA 2Z3FA 4RDQF 2EKJA 2WXJA 5CN2A 1B0GA 3QDMD 1S3KL 4PRHA 4Y5VA 4W9LC 4XN1A 5B38G 4OZIE 4BFIB 4F33A 4NRXA 2QSVA 2YAOA 4GKSB 3MBXH 4MD0A 1HHKA 5F0MB 3L9BA 3TP4A 4PJCE 1F58L 1SEQL 1HILB 5H37G 5IMMA 4QRPA 4Z7VB 3S88L 3ZTDC 3PP4L 1EDQA 4XP4H 1RHHA 3FB5B 5SWZE 2APBA 4N8VG 3L1GA 4RAHA 1MDTA 4K5PA 4LBAA 1U8MA 2AEIT 4NBYB 1J0JA 4PWKA 4M1DL 1AR1B 3SKMA 4F37K 2QQLL 1PZSA 4OB5L 1KZQA 1MY5A 4G6AD 2BERA 3PHOA 3UGEA 4PJBF 3BDXA 3KCWA 4RGNC 5KN5A 1MWAB 3MCYA 3HW7A 4U1JA 2BY0A 4UYPA 2F54A 4ZW8A 1USZA 2OL3A 1FIEA 4NLHA 4X5QA 1DVFD 4Y2DA 4BKLA 1QPKA 5DEFA 2Y0SA 5C0BA 4KXAA 3WGVB 1Z3GH 3SYAA 3GMPB 5CU9A 3WN5A 1P7QB 4JDZA 3BPLB 3IFPB 4NKOA 4N90E 4LP8A 3V6OA 2FJHB 3ENEA 3HG1A 4FS0A 1DN2A 8FABB 2QVIA 4YSAA 1L3NA 2VL5A 1DQLL 4AJWA 3FO1A 2AJVH 3HG2A 3WUWB 5KSAC 4YSTA 2X7LA 2RALA 3GBML 4CMHB 3FN9A 3EYFB 2DI9A 5FIEA 1CT8B 2RCSH 3DSFH 4HAGA 4ANKA 1UM5L 2CBTA 4ZFOB 2LU7A 3IGFA 4KKNA 4YHOH 2J44A 2ZKYA 5D9SA 2VLJD 4UM8B 5EOTB 3VXPB 2C7UB 3DJZA 1ROCA 1JZ2A 1XD1A