2OMUB

Crystal structure of inla g194s+s y369s/hec1 complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
GPLGSWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermodynamically reengineering the listerial invasion complex InlA/E-cadherin.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Cell invasion/cell adhesion
molecule keywords Internalin-A
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2omuB00
2OMWB 4ZMOA 2OMVB 3UBFA 3K6FA 5CZRA 1FF5A 2YSTA 3LNFA 1OP4A 2OMZB 4ZMZA 3K6IA 2OMTB 3PPEA 4OY9A 3UBHA 2QVIA 4ZMVA 4ZMNA 3QRBA 5KJ4A 2WBXA 2WD0A 1ZVNA 4ZMYA 4ZI8A 2YQGA 4AQEB 1NCGA 3K5RA 1WYJA 1EDHA 2A4EA 4XXWA 4ZTEA 4ZT1A 4AQAA 3LNGA 3Q2WA 4AK1A 1ZXKA 4AQ8C 4ZMTA 1NCHA 2X2UA 1L3WA 3K5SA 3Q2NA 4NUMA 4APXA 3Q2VA 4AQEA 4ZMWA 4AQ8A 2WHVA 2V37A 1WUZA 1NCJA 1NCIA 1SUHA 3LNEA 3UBGA 4NUPA 5JYMA 5DZVA 3LNIA 3LNDA 4AXWB 1Q1PA 2OMYB 4QD2E 3FF8A 3Q2LA 3K6DA 4AXWA 4ZMLA 1O6SB 2A4CA 4ZMXA 2EE0A 2QVFB 4NQQA 5CO1A 3MVSA 5JYLA 2OMUB 4NUQA 4ZMPA 4ZMQA 4APXB 2O72A 4XXWC 3FF7A 3LNHA 2WCPA 4AQAB 2OMXB
chains in the Genus database with same CATH superfamily
4H44C 1XIWC 3BKCH 1Q1JH 5DVNA 3WNKA 1KTJA 2Q76B 5JLZA 2A74B 4XVJL 1FYTB 1XF2B 1IM3B 2X42A 1NCCL 2OMZB 1WD8A 2Y7QA 1RD6A 2O6FA 4G72B 5DMIH 2ZUXA 5AOKA 2Q8AL 4HBCL 2JWYA 4K3JH 4WGKA 1P2CA 5ERWA 2BNQE 3QXAB 5KVGL 5HYQA 4FQLL 2VSCA 4LSQL 1MLCB 1KACB 3VQMA 2MOGA 4WCYH 4JHAL 4YMPA 3LIUA 4K8RC 4QWWC 4YSQA 3WUZA 1UUSA 2J5LC 1IQDB 5AG9A 3VXME 4J1UA 3OKMA 1YEWA 1HWHB 1V3JA 1ACXA 1BFVL 1MHCB 1TCMA 2F53A 4GW1A 1DVFA 4G8GE 4K3EH 3MV7B 4HDIA 5D7JD 1WBZA 5IHUL 1K4DA 2R15A 1UXSB 4JFQA 3N40P 4UAOC 1I1FA 3LKPA 4HWZA 2VMCA 1E7VA 4Y4HB 1NUNB 4AENA 1D6EB 2NSXA 2KS0A 3DX7B 2APWA 4MA3A 5C09E 3I6KA 2XHNA 3JYCA 3MUZ1 3QZBA 1QNIA 3V9FA 4HK0B 3LHAA 4YXHH 1HH9B 4W6YB 3FU6A 2UYLA 4K5NA 4OZFB 5HXMA 3M1BA 2YUWA 2XUWA 1J86A 3K4DA 2WLLA 4QRRD 3FO9B 3WEAA 1P0SE 2ZKWA 5KVDE 2O93L 2BY1A 4OFKA 2CPUA 5J6SA 4OTXL 2G3NA 4JFDA 1H3PL 3NUKA 2Y9RT 5DA0B 5T1MB 4YE4L 4BWTA 4LCIL 3QRLA 4HJIA 5I71B 2IPKA 3QJXA 4NQDD 3S7GA 4K07A 3CFBB 3T65A 1P1ZB 3QIUB 1MN4A 4IDLA 5DC9B 5J0BA 4I0KA 5I26A 2GHWB 1VJSA 3INOA 1AHKA 3RIAF 1SEBB 1MJ7H 3O3EA 5MI0B 3UBXG 4HVBA 5F97E 1FNEA 2GAZB 3ILQD 4KAQL 4X7SH 1ZE3C 4PGJA 1TJGL 1MFEH 1T0PB 1J8RA 1OF2B 4RMRA 4QIRA 4FXKA 1NFDE 1UJ3B 3S96B 3RDJA 1UA3A 5CHNA 3L7FA 5TFSH 1QWUA 1OWRM 4WJKB 3MUGA 3D50A 3QDJB 3LVEA 3MO1A 3PV6B 5I1EH 3QUMH 4JZJA 3SBWA 2OP4L 1V3MA 1F4XH 3TESA 1LK2A 5IF0A 2DH3A 1Z9NA 4U05A 2XU9A 4F5CE 4KFZC 5CIPB 3L9EA 4HFUH 2BVUA 4C57C 2XOTA 1QPPA 4RMWA 4JFFE 1MHHA 4PB0L 1W2KT 4GSDL 1AS6A 5FAAA 2FBJH 1I9IH 2MIZA 2WVVB 5LAXA 4B50A 1U8KB 4XTRC 4LKCA 4LNVA 1FRGH 2YRLA 3IDXL 2CHNA 3VXSD 4XMKL 4P5TC 1JTPA 1BD2A 5MENE 5SWQA 4UBDC 3IRCA 3QFDA 4PTTB 1MOEA 1MSPA 1QBBA 2J21A 4LOFA 4AEEA 2I85A 1CTOA 2E27L 5I8KH 1ZTMA 3PAVA 1YEFH 5DD1H 3K6SB 4Q2ZB 4DP6X 2FWSA 3HB3C 4HJSA 2H0PA 4LASL 4NKMA 2EP6A 1H15B 1T83A 3K0YA 2F0CA 4JO3H 4O5LH 1TZIA 5SWZA 1ETZB 3FRUB 3H4HA 3J2PA 3F01A 1KBWA 3DOHA 1ILUA 3TBSA 3ECBB 3HI6H 4GAAA 5IY5B 5LGHL 1RZ8B 3DOSA 3US9A 4K0OA 5LGJB 4UQ3B 5DEFA 3VM7A 1MF2H 1WA2X 2QSCH 4J39A 4K3DL 4JRYB 1H9DA 2WN2A 5BS0B 1WCQA 3SDAD 4JN2A 4FXGA 5E4EC 3FTZA 5AVXB 3RNQA 3VFPA 2WC7A 3BWUF 5AD0A 1N0XH 1UM6L 3FFOA 3OVUB 2JK5B 1X44A 3OLEA 1IC4H 2JCCB 4GRWF 1S7XB 5C0NC 1G0YR 4BK5C 4JKMA 3K2IA 3U36B 2C1PA 3FQTA 3M1OA 3JWNG 2Y5TA 4ZUSB 6FABH 4XN2A 1HQRB 1MFCL 5E7BA 3QIBD 3II3A 4G7RB 2IH3A 2H32B 3RX9A 5L2JB 3FSWA 1XGUA 3FU5A 1A14H 2WB1A 4X4XB 2LU5A 2UY7A 4GW5B 1J1XH 3K46A 3PHAA 1SF5A 4RDQF 4W4OA 2VR9A 2DZEA 4PRAA 1B4RA 1ZLVH 4AZ8A 2IEPA 3TPKA 3ZZLA 2MJWA 4RRPM 4QCIA 2FB4H 3FPYA 1ND0B 5EHFA 1HNGA 2BFVL 4M61B 4Y7OC 4N20A 5HI3C 1MCSA 1ZLUK 2C3XA 4UIKL 4AIZA 5GS0L 1XR8A 2UWEF 1AO7B 4PUBL 3IDMB 1MDAA 3IFLH 3MNWB 4N2LA 4U1HA 4KI1A 1NOLA 3LN5A 2ZZUT 4N8CL 2UV3A 4JFFA 1G9NL 2X70B 4FRWA 4R26H 3H4FA 3MROA 2BHYA 4IIQB 5B3NA 1LO0H 1S2EA 1XGQB 5JW4R 4L48A 1U8JA 1WAAE 3ZE1E 3BPLB 4UQAA 1REIA 5ACLA 1SOXA 3ARRA 5G5DA 4O58L 4D94A 5KANG 1MREH 1AOZA 5KSBB 3HR5B 4BFNA 2ZAGA 5ESQB 1B88A 1D9KB 4NZ8A 4ZNCD 2O5ZH 2BJMH 4LLVB 3OKLB 1VGKA 3BXNB 1VENA 5LN8A 1WUNT 4FLOA 4S0HA 6CGTA 1WGOA 2O6PA 4ZMNA 1VZIA 3H9ZA 1OAZL 2HWZL 3RA7L 3HG2A 4IBZA 5E2TH 1E2VA 3FSAA 1DCEA 5SWZE 4OZHE 1IV8A 3ZRSA 4JW3A 2ZTBA 2CDEB 3H7LA 2RJMA 4URKA 3LPPA 4TYUA 3INUL 1KELL 3FCUB 3WFCL 3ZQXA 2Z8RA 3F7QA 4OLWH 4GO6B 3EKCA 3G5YA 5CM1A 1BVKB 1JGEA 1HWWA 3NCYP 3ZTDC 1D2PA 3QZWA 4OCMC 4PJ9B 2V9TA 2ARWA 4IRSA 1OP5H 1QWNA 2Y2WA 3EO0B 5CCKH 4GQZA 2FH8A 3ORJA 5KG9A 1XIWA 3GLEA 3MLSH 4WEBH 3BUYB 3C5ZD 4YDKL 2JIXD 2NDFA 3LB6C 1CL7I 3E6FA 1F8TL 1CT8A 2YPLD 2VJ8A 2WNGA 4XB7A 1MI5B 3C60C 5B1BB 2O5ZL 5I6XC 1S78C 4JKWA 4TLUA 2C5DC 1AP2A 1AO7D 2V3FA 3ARFD 5TTRA 2K8QA 1B90A 4D9RD 1U3ZA 3VFRB 1DEDA 2WYIA 5EA0L 3C8KA 4D8PA 4F20A 5ACZA 1JIBA 3EGSA 3CLEH 4YXLL 1JOIA 2Z8VC 1PG7X 1TSRA 1I3UA 4MD4A 3EDEA 5C0GA 5DSCB 1A2YB 4XCEB 1YVLA 3PWUB 2DQJL 1QFUL 2P8PB 1OGSA 2VSKB 2WZPA 1NFIB 2XV2A 2AEIT 2CALA 4WI6A 1TITA 4Y4KB 1E6OL 1A4AA 4OGYL 4PJHB 4TNVF 5IW1B 5A43C 1T7VA 4APXB 3KDPB 4P3DA 2BFVH 3NJVA 4N87A 1NDGB 5C0CE 3WSQL 5D4QA 5GXBB 1WZAA 1I1YB 1DE4A 4RMTA 1EHKB 3O4LD 1SOQA 4TTDC 5IQ9A 1F2XK 1MUJA 1BF5A 3D85B 4H13C 1RIVL 3NIFB 3CLFL 4GXUM 2M2DA 3VI3F 3BN9D 1S78D 1S9WB 2WLYA 3GRWH 3MRMA 3ZE2E 3VI4A 4ZS7H 1M3IA 4XVUC 3O8XB 1Z9SA 4MCYA 4PJDA 5CP7A 1DVXA 4AX3A 5F7KC 4Y2OB 1HVXA 1UM6H 1DFBL 3BO8A 2XV3A 1MIEH 2CNYA 4QI3A 1SBSH 3D3VB 4HHWA 4RA3A 1QFPA 5JIPA 1WVZA 1KTBA 2J3SA 2MNJB 3P11H 4LKXA 4NZTL 1CLZL 4PP2A 4YO0A 3W56A 2G5BB 2QVMA 3JYBA 2XZCL 5GPRA 3QDME 1UWEH 3E38A 5F88B 5EIIA 5FGSA 1IM9B 5C0DB 3DGGB 5FHAL 1ZDQA 4W9KC 5CU5A 1BBDL 3H3BC 1U8OA 3EXJA 1KDIA 3NDYE 5DJDB 3D08A 5ETUB 1VFAB 2FQFA 1TTAA 3ZK0A 3UO1H 1KEML 2CLVB 2E9BA 4O5LL 5D6DA 4PRHB 3D33A 5BZWA 3UADA 4TULL 4ISVA 3BSZA 5IM7B 3QJFA 1YEEH 3X13B 2D31B 2Y1VA 3UTTB 3RVVC 3B9VA 5F96L 2QVTA 5AVSB 3V0JA 3VXOA 4GAJH 2CDFA 1L5GA 4M1GH 5FKPA 2IAAC 2CLRA 1TU2B 5B1JC 5ANME 4WWKB 4YL9A 3TIDA 5I1JH 4W68A 3VFOB 4LHUB 2X3BA 4EQ2A 3VQLA 4C4BA 4FFVC 2W1NA 1GH7A 2ZX7A 3PG2A 4RIRB 3T6XA 5CNHA 2GY5A 1YMMA 3ELQA 5HHNB 3N2JA 3T3ME 1DSYA 2WWMC 3UTSE 4UT6A 1YDPA 2B7DT 3X1NA 3WXWH 5CIPH 1ZS2A 4M48H 3CNKA 3TH2T 4LU5H 3KLHC 3DHUA 5LBSL 5C08A 2XYCA 3D52A 4JQIL 3R18A 5D5MF 2A83A 4HUMB 4HZAA 5B3SB 2ZWYA 3TJEH 1YPZF 4EN3A 5E99H 4UNTA 1E4JA 5EORH 1D6VL 2ZUYA 2WWMD 3WUWA 1AE6H 3NN8B 3SKUD 4XXWC 3RBSA 1VCBC 4ETYA 2NW3B 4ACPA 2CRMA 5HHMB 4KQ4H 3UTPE 4R90L 5HGAB 4KV5E 1CFSB 4R3SA 4OUOA 3TEWA 4PJDF 1I1AD 1NGQH 3JBG7 1S7UB 4QRRB 1HAWA 3TV3H 1G7HA 1A0QH 3GM8A 4KAQH 4X7SL 4NFCA 5HVFB 1AQHA 2D9QB 4AG4H 4G5ZH 2VN5A 5IK3A 4MNGA 1YY8B 3KDMA 1DVTA 4KK5D 3BWAA 2HMID 3WIHL 5EEWA 5E9NA 3BEWA 4C47A 1XMEB 2VDNB 2BNUA 1T2QL 2VB5A 3NJIA 3VXSB 2VXTL 2YJQA 5FYJE 3NCWA 4UZSA 3QCUL 1MPAH 4NRXB 4LCIH 2YPLE 2WQSA 4KRPB 3RGHA 1AQ8A 4I3SL 1PEZA 3BLKA 4K7PX 2G0KA 4Z0BL 4X8JA 3EYQD 2X1XR 4M5TA 5HHNA 4X8JB 3SY0A 1YNTA 4MA8L 3PHOB 5L7XL 5IHHA 3S98A 2VDPL 4NO2B 4J3VA 4AGLA 2W0FB 4P2QD 4JFOA 5FR3A 2N7SA 2W81C 4H26A 4HCGA 4U7KA 5EZIH 3ZT5A 4JFFD 1MY7A 1NCGA 3DURA 4F7PA 5T5FA 5B39B 3RILA 4JFEB 4H1LH 2X41A 3DO7A 3X13A 2CKBB 3HB3D 3V55A 3EJCA 4HLEA 3CHXA 1G1YA 4B27A 4X4KA 4BRJA 1LWHA 5D7LB 2Q3AA 3BQUD 1A6PA 3DX0A 3KW8A 2VXUH 1T5XB 3ARDC 4X0KB 3HG4A 1LK2B 3MLVH 4Y16C 5GS0C 3FTGB 3C8HA 3EFFB 3ZZSA 2YIHA 4P5TD 3DRQA 2VLLA 4LSQH 5EBGA 4Y1AA 5KVGH 3HAEB 4K94C 4X6CB 1QQDB 1IGYB 3GMNA 2CHWA 3ZTJG 3FB6A 4HBCH 4K3JL 4YDLC 3MLPA 3WTWA 2Y36L 4FKKA 3RGVC 1SZNA 5ESVA 4RGOL 4PWGA 1HE7A 4KXZH 3G6JF 2R69H 2R8SL 5CILL 5C08E 2E9JA 1OCWH 1Y6NR 1X7QA 2G9HB 3NSJA 1SHMA 1OAJA 4FEIA 3W0WE 1RP8A 4OLZH 2XPGA 3QEHA 4BQ6A 3ULVC 1JMXA 4KNQA 3R06B 4PTUA 3AJ7A 4OCRL 4KZEL 1FDLL 5DQ9A 2YZ1A 5I1HL 1D5BB 1PG7L 4JFXA 3F65A 4K8RL 4A7TA 4CA4A 2ITDA 3AAZA 5ANMB 1H5BB 1SY6L 1G9EA 2AV1A 1F4YH 3FO9A 4XP5L 1QFWI 3P0VH 3HUJB 3D12B 1CC3A 4E9RA 5M94B 2PYFB 1AMYA 4QGTA 3MRFB 4XXDB 1A6WH 5DRWB 5E1IA 1NCAL 3I6KB 3W11C 4XAWH 1PEWA 2K4WA 3D51A 1OK8A 4HYTB 3VB9A 3ILEA 3UAFA 3H56A 1UENA 1CD1A 4F8TA 2Y7NA 5I15H 5J1SC 3S37X 4AT6A 3DSFH 3LAFA 3QHZH 4J23A 2FL5B 5C8JB 4PP2B 3KYKL 2K70A 1R3LB 4PJ5E 4AT6B 4ODHL 2BINA 4L37A 5FYKD 4NO3B 2C7UA 1EXUB 1I1CA 3K91A 4GRWE 4JM4H 5I16B 5HYQB 5H37H 4PRIE 2GBVA 4OIFA 3RHWF 1XV8A 5ERWB 1M42A 4XO5A 4DW2H 3QXTA 3DNKA 5KBMA 4IU2A 2WTRB 4KTDH 4IIZA 3R8QA 2HFGL 1HHKA 3FQXA 4WGWB 4ZOEA 3RWIB 1WAEA 2C3GA 3BH4A 3PV7A 3QUGA 3SQOH 4DP2X 5GS3A 4RFOL 1XAUA 4PS4H 3L17A 5GGVH 4IOSD 5KG9B 4HKBB 4ZSOE 5BJTA 1KZYA 3DV4B 1Y1UA 2B1OA 3NBNA 1WBXB 2WVUA 3K72B 3K8LA 4ATTA 4DOHB 2WLNA 3O0LA 4TSAH 4KVCH 1XZWA 1I1AB 1T4KA 3GMOA 1JDCA 5EH1A 3WFDL 1VZHA 2ZOOA 4HGMA 4WO4D 5T8IA 1O9VA 3CLWA 1E9OA 5GHWL 4XAKE 4AUYA 2P80A 2PPAA 1KBBA 1DHKA 3TCXA 3T77B 3H9SA 1VPOL 1XIWD 3BAWA 1R9FA 1T2JA 2EYRB 4MD4B 1CU4H 3HZVB 3MHZA 2HKAA 5K5YA 1JVLA 3D0AA 3MUJA 1WFMA 1VSCA 1I82A 5HI5D 3OHXB 4EMZA 4NZRH 4TN9A 5CN2A 5IQLA 4ELMB 2WQAA 4TUJA 1PS3A 1DVZA 2ERJB 1N59A 1AS7A 1YJDL 4TVPD 5FFGA 5FO7A 1IT9L 3JZYA 3TZVD 4WWOA 5F7NC 4PW4A 3O2WH 4IKIA 4JM2A 4XXDA 2QKIA 5FW6A 3WS6A 4CVZB 3FCTB 2AHIA 4HSCX 5LB1A 4MNQA 4QLRA 3WLBB 3CZSA 1RIHL 3QWQB 4AL8L 4BGDA 5JA9A 5DC0A 1B0IA 5I19L 4G6ML 1E2WA 1IILE 1C16B 4IMKC 2MHAA 3GXFA 2J1KA 4FTDA 1THAA 2D2OA 3LRMA 1AGBA 4G43A 1R5IA 2NY5H 4ANWA 1E90A 4Z3GA 4UTBL 3P3TA 3R1GL 1OM9A 4A6YL 3QEHB 3AGVA 2AK1L 5E0FA 2NY4C 4QXUL 2LOEA 3UP6A 2JKXA 3SPIA 3QUYD 3HHRB 5DWUH 2FK9A 1NBQA 5C0CD 3MLUH 2WTPA 3X12A 1CFVL 1NLBL 1PLGH 4MXVF 2DQDH 4WZ9A 5IB4A 5IGXL 1B2YA 4PRIA 1OM3H 3F7YA 5IUSA 2FR4B 1A65A 2WD0A 4Z77B 1PFOA 1CDYA 2PPDA 3S88H 1NIBA 2J6EL 1AFVH 2OTPA 2VR7A 2IANE 1VKXA 4YFDB 4F93B 2Q7YA 4YBLB 1G4MA 1TJHH 2ODHA 2FIKA 4XPGL 1G6RA 4L8BA 4XXWA 1S46A 4JGNA 1E8ZA 1R33A 4MB4A 3VE0A 3V8OA 3U6RB 4CC1A 2CGRL 1I8IA 1LO5B 1BZ7B 1K4CA 1IO4C 1B0WA 1M6UA 1T89C 3CAFA 1QUNB 2KH2B 3VFTB 5BUGA 1TVDA 4K7PL 4W9FC 1YY9D 1MFDH 4PY8J 3IKKA 3MNVA 2YD7A 3GHPA 3J8F7 1VAHA 5HJGA 1KCRL 4LDOB 5EG6C 4YDZA 3RWCA 4TL4A 3DURB 5EV7A 4F7PB 4V33A 1NCJA 1LD9A 4UIMA 3AVEA 4KK5C 5D7SH 2HMIC 4LDCA 3RI5F 2NTFA 5GRWA 3HG1A 3LNIA 1WLHA 1ZANL 5DHYA 1W15A 2MOQA 4OGXL 3MCKA 3SYPA 2Y7SA 1KXTA 1F3DJ 2WGXA 3E3QE 4KKQA 5AFAA 1NUGA 1QNZH 3QO1B 4KKPA 5HJ3A 2NQDA 5IJKA 1P7BA 3IXTB 4HCIA 1KN2L 2CLRB 2HJLB 5EU7C 1S9YA 3IJ7A 3HPJB 3KYNA 5BMFH 4BH7A 9CGTA 3WEBA 4CSTA 3WFBH 4YHLH 3RKPA 4KXZI 2F5BH 3N41F 3O3DA 3U30C 1GW6A 5ACMA 3D4ZA 3MRBA 1X9QA 3I50H 2NR6C 4GP8B 1I8IB 1LO5A 2P7TB 2IWGA 3C75A 3ETBF 4OAWB 5HGAA 4AI7A 4LRIC 4ES8A 3VE0B 4BQ8A 2X4OB 3ARUA 1RUPH 1XH3A 4M9PA 2XBTA 4E41B 4PY7B 5AAMC 4N0UE 1OTTC 5IT2L 4RBPK 2CR6A 2OL3H 3A67L 1E5YA 3MGOB 3PGCA 1EZUA 3GBLA 4EI5A 9PCYA 2WKOA 3O6KL 3B37A 4FG4A 2EIDA 3GMMA 5IB5A 4LKXB 1INEL 1U91A 2DM3A 3DDGA 3G5ZA 4BFOA 4FTVA 1YQVH 4JVPA 1T0MA 4FG0A 5KS9F 3C60A 5E8OB 3F05A 2CUIA 3SE8L 4NQSA 4QKXB 3EZJB 3K6SA 4RAUA 1K85A 2X6CA 3SYAA 3O8XA 2CIKA 3MJ7B 3Q8BA 3ZX1A 4G7YL 4A04A 4ZOAA 4GI8A 4BZ1A 5JNYB 3TVMB 3BN3B 2MOVA 1FZJA 3HBQA 1A7OL 3I6GB 1JGIA 4R4FL 4U1MA 5JQ6L 3BJ91 2MHAB 5C0AD 3DV4A 4DN3L 2EEXA 5D7LE 2WSKA 1L9TA 4XMXA 2IOOA 4JQXA 1H3XA 3CN0A 3E9TA 3SPCA 4H8WC 1ZS8A 5DK3A 3RY6A 4BFJA 5JQHC 4M6NH 1CB4A 5D70L 4G59C 4IU2B 2YEQA 4HQQL 3N1GC 4LLYB 1CD8A 4JO4H 2WZPD 1IKNA 4JZJB 2A99A 1CE6A 3CZNA 1RZGA 5CEZH 5IWLA 4MMZA 2V6HA 1D5ZA 1JFQL 2NSQA 3QPXH 3HNSL 1UOWA 3K6OA 2VXQH 3BE1L 2VTFA 3TN0B 4J1UB 2VR6A 2MTAA 2DLEA 4LCCC 1MRCL 4NNPL 1CJYA 1A6AB 4OZFG 5D2NA 4HJGA 3RY4A 2F7RA 2OAAA 2H2PC 4KK8C 1BLNA 4A55A 1KYUA 2NY0C 2A3TA 3DI2B 3CSYA 4L8DA 2E0PA 2PYEA 4YC2C 1O7VA 5MEOA 4FZ8H 3HCVB 4IQHA 3BPCB 5A2AA 3HOGA 4DP7X 2QVFB 3NZ8B 3QIWD 1CUOA 4BZ2A 4X80H 1P69B 3KLLA 2EXSA 3SGJA 3LPGA 4AKQA 5I76B 3B1UA 5LHDA 4FKEA 2DKMA 4P59H 1KB9K 1IIKA 1LP9B 2CUHA 1H6TA 3F8UB 3FN9A 5CBEB 2O72A 3LHPL 2XKNA 1IAIH 2NX5B 4OLXH 5TE6H 1SM3H 1JGDB 4GUPB 3WDJA 1TKWB 4N0UA 4JHWH 3VO0A 3UCRA 1NH6A 3C2SA 5JDSA 1LEKB 1UCBL 1U8NB 2EKSA 2ZYRA 3ZTCC 4F7CB 5IMMA 3GRWA 3DTXA 4NKDB 5IW6B 5IQMA 5I1CH 4X8CA 4YX2L 5JXED 5GRVK 4GOSA 4H25A 3U2IA 4TNVK 4WI8A 1BG9A 4OM1H 2AQNA 4DJMA 2BNQD 5GS1B 2Y07H 2BOCB 5GS0D 3W5MA 2OMNA 1MWAA 3IXAA 4TPRL 2P8LB 3MJ8A 4TVPL 3NPZB 1F2QA 4H88H 5FYJU 2WQWA 3QSKB 5GZNC 3T71A 3UTZA 1UH3A 3QXVA 1IGJA 1LWJA 1JTOA 2F53B 5BO1H 5FGCE 4R5XA 3OKLA 2RR3A 2LVCA 3I3EA 4QF1B 1UZ8B 5JPNB 2ZCKL 3F6IA 3V52L 1AHWB 2GJZA 3NEXA 2YR3A 4JLRB 43C9A 4PVBA 3D5OF 1OCRB 2E46A 4OJCA 5ADPL 5IVXA 3FTGA 2ZONA 4HLZG 1U8JB 4HALA 4WHYH 5D7IF 4F7TA 3K5RA 3VI3E 5LXGH 2YAFA 4O51A 1Q72H 4P49A 1BMZA 3P40A 3WEMA 3IMUA 3TM6A 2X4NA 3MLWH 2H0JA 2AQTA 3QJUB 1FYTE 1R3KB 3RWEB 4CADA 2VDKL 2CBMA 2ZOWA 1HL4A 5SV4A 2Y3AA 4JFEA 3QRGH 3OZ9L 4PJ9A 5FHBH 4Y5VB 1NAKH 1OANA 5JUEH 2R59A 1MLBB 3JWOH 3LKOB 4ONGH 5C0FB 1L7IH 1YO4A 3BH8A 4PRAB 3VFVA 4L0YA 4M62H 1I1AC 1WUZA 2CO1A 3TYFB 5TE4H 3TYGL 1J9QA 4POYA 4XN5A 2GSIA 5IVXF 1PAZA 4XR8C 3WN5A 5DQJA 3G04A 3KGSA 1FHGA 1TVBA 4RISL 4OLYL 1IFHL 1TYEB 3RFZC 4JG0L 4WTWA 5ENWB 4ALAL 1M6OA 5EZJB 1M1SA 4CVXA 4JDTH 1A6VL 1LO2L 3FB7B 4F9PC 4FOMA 1KGYE 4F8NA 1I9RL 3PWLA 3ZKXB 5EU6E 5T5FL 2AC0A 3VA6A 4M7JH 5DEGA 1OGAA 1DBJH 5LNEA 1B2WH 2PCPA 1QPKA 1A3ZA 4QRSB 1FH2A 2HN7A 5C71A 1ZA3A 2GQHA 1YUKB 5FYLH 5E9DB 1ZK5A 3RL1A 5DURB 1AZRA 3PRZA 5G4MA 5H4ZA 1LYQA 3WKML 3WD5L 1XH2A 2CQVA 4G11A 4O2EA 1ROCA 1F00I 2HVJB 1PLAA 1QO3B 2H3NA 5I30H 3RPBA 3FTVA 3OAUL 4I48B 1EZVY 1DVUA 5CGTA 3ZTJH 3N1PC 3VVWA 3LIZL 3AABA 4GB9A 5KYNA 1H8OA 3O6LH 1U95A 3CVIH 4J3SA 3H55A 5CBAA 3BEVB 2YSTA 4LRIA 4AGNA 1JF5A 3Q6FA 4QYAA 3NFPA 5ID1A 2J8OA 5I66B 3MRLA 3HNVL 5L0QC 1NC4A 4GS7C 3S37H 3ZN6A 1IVTA 1JJUA 3FPXA 1A6ZA 1AJ7H 1TZOA 4NBYB 1PKOA 4WI0B 3UJJL 1FZOB 3GNML 5I1DB 3O6FC 2AVGA 5F7WC 5BRPA 2RALA 3CPUA 1L5GB 4ZI8A 3L1FA 3QCVH 3BWAB 3DMMB 3OF6D 2OLDA 4RZCA 5HHPB 5BZXA 1ZHNB 1A6UH 1KB9J 2QPEB 4FYTA 1H9VA 4K4KA 3GJFK 5EPMB 4Q9RH 1HHHA 4M1CC 4NT6A 5IF0B 4RFNC 1JE6A 5AVVB 5DJDA 5HI4D 2C9VA 2NXYD 4BZYA 1KV3A 2GI7A 4X7CC 4XI5C 1TLKA 4AJVA 1GY2A 2FATL 1AYOA 2LFGA 4LP4A 1ZPLA 4HV8A 3WIIL 1Q0YH 3SYCA 3Q2VA 2XZAL 5DJCB 3TCLB 2YQ2A 5BNXD 3EJUA 4GYBA 5DT1L 2PXYA 2PCFB 1NGZB 3QHFH 4JANB 3ZZQA 2YXVA 4X6BA 4WV1B 1KFAL 3SCMA 4GH7B 3FT1A 2HJFB 3TBBA 3GK8H 3LKNA 3NQKA 3UZVA 1P9MC 1YDPB 4LLMA 3ET9F 3E7JA 4DKDC 4XVTH 4XPAL 2NUTA 3VFSB 4RIRA 2G2NA 3ULVF 2OK0H 3QIUC 4D3CL 1ZEAH 4HSQA 2FLMA 4LCWB 4NAQA 4BKLA 5M7QA 3MRCA 3WENA 4KHXL 5B3JE 4NQEA 3FJTA 2XETA 3IMWA 5CO1A 2A6DB 1MUJB 2RHEA 1A7PH 3IMRA 5IR1A 2P5WA 4L1TA 3NJJA 3KLHD 3UAJA 4YZWA 2ED6A 4CN1A 1WIUA 3MKGA 1U0QA 2JB5L 3APDA 4FMVA 1FGVH 2GB2A 5E8PB 1KBGL 1A9BB 5DRXB 3OMNB 1IE5A 5F21B 1PF3A 4OV5A 1DBBH 5E6ZA 3TWYA 5EFIA 2XA8L 3BESR 4DP0X 7FABH 5HGDB 2MRYA 2X3AA 3LVTA 5FECA 1OF0A 1YECL 1HQ4B 2YSSB 4PJ7F 4RGND 2GK0B 3SJVB 5CHNB 4YSSA 4KDVA 3P4LA 1QACA 3G9AB 3LEXB 3QT2A 1MHCA 3L08A 3N41B 5IV2B 5TPWH 4FXKB 2WIIB 3FQRA 3W38A 3HS9A 4HS3A 3QUXC 1OGTB 3LJ3A 1RUMH 5JXAL 2XTJC 2ITCB 4Y5XB 3OQ3B 5DYOA 1GOFA 3EH5B 3PPEA 1ERNA 3GKZA 2YQBA 2CCWA 4MYPA 1I85A 1Z9PA 2DEYX 4C83A 1P2CB 3Q6GL 3ZMRA 3QCVL 1HKLH 1JWUA 1KUMA 3FCSA 4IRJA 5D1QC 3SOBL 2MKWA 5HD8C 5ICYA 2O30A 3OGOE 2VITB 2EH8L 1N12A 4XE0A 4J27A 4BGLA 1FIGH 3HE6B 4ZYKB 4NP9A 1O75A 4LVNC 3H3PH 3SGEH 1NDMA 5I2IB 1EJ8A 4N9GB 1KBKA 3F5WB 5KVFL 1CDGA 1V7ML 4PS8A 4UM9D 1R3HB 1HXYB 1SBBA 5JW3H 1XD1A 4FERA 4PJ8C 4TUKH 3BVNA 2VSMB 3QEUB 4XRCA 4LRNL 2C8NA 1Y07A 2QSQA 4N90D 2BM3A 4XMLH 4FFWD 3EYSH 4M8QA 2WQXA 3DX2A 3H9SD 3DK0A 1NDGA 3WNJA 2P42B 4N8PA 3WN6A 2Y7MA 4WI5A 4HGKC 4PJHA 5AW6B 5D1ZC 4MRBA 5DUJA 1XGZA 2OPCA 3VNZA 3ZL4L 5I30L 1FNSL 1WTLA 3RUGA 1EO7A 5HDRA 3TFKC 1C5BH 2X4UA 3WKMH 2D2CC 1FNHA 4UT9L 3PXJA 3T2PA 3JVGC 5KUMA 3MOQA 3UBXI 3WIFA 1NUDA 1VGKB 3RYMA 4Q4EA 1BQ5A 1IQDA 5FYKH 3T3PE 2GCYB 4AEIH 43CAA 5AYUL 4DN4H 1GMEA 5KW9L 4NWUH 3B2PA 2Y5EA 3DKHA 4M6OH 3WOVA 4F24A 2Y25A 1D5IH 2O5YH 4GIOA 4N2BA 4LOVA 4YHYC 3LZFL 3PGDA 1LO2H 2FWOA 4Z7OF 3AS1A 3N50A 3RIFF 3PGFL 5EOTA 1R0AL 1MFBH 4BFIB 2D03L 4HXAH 4RNRA 3TT1L 3M88A 1OAKL 1T3FB 5FXCH 1ODUA 1HZLA 4JRXA 3HTLX 3B2UD 4R8WH 2X4UB 4X6DF 2R27A 3LN5B 4J3XA 3VM5A 4L4TB 4QDGA 2NY0D 1CFQA 1GS8A 4G8FB 4U1HB 2AV1B 1YAZA 5EU4A 3EO0A 2R9HC 5HI5C 3L3KB 5LAPA 1TIUA 3EG9A 4PRID 3TF4A 5GS2H 4PJCB 3P3UA 3BZ4B 4HKXA 4P46C 1KPRA 4ZQKA 1VF5C 1IGTB 1NIEA 3VRJA 1LDPH 5G4OA 4UT9A 5KVGE 4XMWA 3ZSTA 2ENQA 1HI6B 1QHQA 3KXFB 4ANUA 2NX5D 4A66A 1O7DE 1JTTA 1NANH 1JGVL 4F8LA 1QABA 2I07A 4JRFA 1ET5A 3HE6A 3ZLQC 4WO0A 4BA8A 1DSFL 4EZLA 1Q72L 4NPYA 5GRZA 4ABWA 4B53A 5A6LA 2JI2A 4AY0A 1AZCA 1FORH 4FNLL 1F58L 4OZHB 2VRAA 4LLVA 3FQUA 4WKZB 3G6DH 2ZXGA 2IQAA 4KITB 3EJJX 4L4VA 2JELL 5FF6B 4HK3N 3ARBC 1DDHB 5L4FA 5FLVA 3CFEB 3NCEB 5T1LB 4FXGB 3TIEA 4X9HA 1TTBA 4AYSA 2BIIA 3SGDH 3MRJB 5BO1L 4HWEL 4TLTA 5CKAA 5BRQA 2WJ7A 2FHCA 3ARTA 4NGHH 4HKZB 1DQQB 4F5CA 3KD4A 5CLZA 4AK1A 3VD0A 4YQXH 1CF1A 4PGDB 3P3RA 3K5SA 1L3WA 3Q5YA 4X6CF 5DYFA 4YX2H 4TNGA 1CF8L 5D93B 1RI8A 2V2XA 4PJ9C 3T0EE 3CFDA 4NERA 3RX5A 4PH8A 1UCBH 5F9OL 4DQOL 3SKMA 1XF4A 2NY4B 3KNBA 3QR0A 2DI7A 1UA6H 3W11D 1DQJA 4ENED 1E8YA 4Q9CA 2AABL 1Q1PA 2VDQH 4XPBH 5MENB 3CHRA 2PN5A 4A2HA 1BIIB 4EKJA 4PWHA 4F9LC 1AH1A 4GEIA 4CC0A 1NICA 4PJEB 3QCTL 4JPVL 3QNXA 2E3VA 1VGEL 4DESA 3V5DA 4LKCB 4QJ4B 1T83C 3ZMNA 3UJTL 2WXIA 1P7KB 4K73A 4FZ8L 1ESOA 5EOQH 5H94A 5AW1B 3MV8E 4YHZH 5CINH 3GTVA 3U9PH 4KKAD 4OZGA 3LD8C 4HWNA 3CV5A 5AVYB 3WJLC 2NZIA 3BE1H 2VXQL 3ZKXC 1NGYA 3HC0A 3TS8A 5MEPB 1MW1A 3KCPA 5DI8B 3POHA 1HJCA 2O6DA 3RWGA 1X5AA 1ZTXH 4HUUB 4R7DA 3S5YA 3CC1A 4WW2B 3ARZA 1A8JH 4DQAA 3AT9A 4OD1H 4F3FA 4W9EC 4JRYE 4J3UA 2VUYA 2WY3B 2RQ8A 1A1OA 4KUCF 3S96A 3V6OE 3FRUA 1L9OA 2VM9A 4IBVA 3MFGB 4PJ7B 1XGTB 4U31A 2VZUA 4M6NL 5IBLC 4B0MB 4V1DA 2X4SA 4RWYH 5AAWC 2IWKA 5JZ7D 4E5XB 3UJIL 4OQTH 1M7DA 4ZPTB 1GGBH 1MCJA 3E8UH 4PJDE 5DFAA 5KJRL 1EGJH 4W93A 1WH0A 2VMDA 4N26A 1DQLH 1EO8H 1P7QA 2OMTB 1BGXH 5F8RC 3U4EB 5IB3B 3NRPA 2IWFA 3QJHB 3NIGB 5IOKA 2GJJA 3HG1E 4OM0H 4XO8A 1BYOA 3G6JA 2YD9A 4XBMA 1BIIA 1V5JA 1UEMA 4LSSL 4ZMVA 3G6JB 2AV7A 4YBHA 1AZVA 3FQ4A 4NI3A 5CJ5A 4Z3JA 3RAJH 1I8LC 4XN8A 3KBFA 3ES6A 5ID1B 4M7ZC 5JPMC 4HUVB 2H6OA 2W07A 1LEIA 3TPUA 1AZZC 3B9KD 3Q9QA 3CFDB 5FCUL 4N2CA 5HDBB 2YKKA 3AWFA 1HTYA 3FSOA 4ODWB 1HN1A 1ZA6A 2DRUA 4OBSA 2NY4D 1AKPA 3DX3A 3KPSB 4S0TD 2J8UE 1K5NA 3HUJE 1W80A 1ZLVK 1KCWA 3VD2A 1HEHC 1CIDA 4P3CH 2CPCA 1ACYH 2Z92B 1CLYL 2VZSA 5E1GA 3LPWA 2WHVA 3DRTB 1VFOA 2UVEA 3ROOA 5C7ZA 3VWKA 3D1MC 1ZTXL 2ENJA 1RZJC 4Y5YA 4XOBA 3EXLA 3QJZA 3ASNB 4F8OA 5IP4A 3RKDC 1PMYA 3OBAA 5DQDH 1KENH 3MOAL 5H94B 1JYVA 1WD9A 5DJZA 1CPUA 3GYRA 5E2WL 3U4AA 3IM1A 3LH2L 3GS4A 3NSCA 2NY2D 1U93A 3TZVC 2R1WA 5EOQL 4ZUUB 4A7GF 3MBXL 2K78A 2YOCA 2JXMA 1HDMA 3RIKA 3W9DB 3S3JA 4PLJC 1DUZB 2HX9A 5JIDA 4DP8X 2AQQA 3BIBX 1PIFA 4ERSH 5I8CA 3EDDA 2VLJD 1FE8L 3V8CA 1P4BH 5KAQF 5DK0B 1F4WH 4XBPB 2OZ4A 3ULUD 3SDYH 3IFNH 4HIPA 4BIKA 1G7LB 1QLRA 1JERA 1JWMA 2ED9A 2UUDH 4MMYB 3EOYG 4MMXC 4F57L 4HKXB 2EIJB 2R4SL 5DHVA 1NCOA 3QDGA 1NM9A 3OQRA 2HRHA 3U1PA 5IW1A 3BWUC 2ZAHA 5E2UH 2VR5A 3C5JA 2V7NB 4R4BB 2NY6B 3D7PA 1O9ZA 1S7SA 3LMJL 3IAQA 5DGRA 1P5VA 3FOMA 4V2CB 5C0AE 3WNOA 4Y4FC 2N3JA 1R19A 4OF0A 2IAMA 3QFGA 1T6BX 3WIHA 4RGNE 4FFVD 5DSCA 4GW1B 4P2RA 5D1ZI 3SQRA 4LCCB 5IUCA 4L8SA 1CICB 5DCCA 3CBKB 3KVDD 3QQXA 5JIHA 4PP1C 5ABAA 5E5MA 3M8OH 3ZIYA 1S7VA 5AOLA 4GIAA 4XPGH 1E6JH 2CIIA 1H6EA 3IFPB 1EZSA 1FPTH 5GGTH 1F3JB 3VXRE 1Z66A 1U3HC 4WTZG 2VUKA 2C3VB 3O4LE 1F45A 2EJ1A 3CE1A 3PL6B 4BCZA 4NIKB 4MASA 3NP3A 1QI5A 3AMLA 1ORSA 1IEAB 2DQDL 3L9RB 1ZCRA 3IGFA 4WHTA 5KYYA 3QUYA 3PP4L 1P6WA 4HW6A 4BK8A 4UNUA 3IE4A 2NW2B 2PMZA 4JFDD 1CR9H 4JPKH 4M7KH 5F3FA 5F7DA 4MJ5A 1E5CA 2ZKYA 4NHUB 3ATDA 5KSBE 3N91A 4P5TA 4UT6L 4O2CA 3R1GH 4C56E 3QDGB 3F7RA 1J5OH 2MSPA 4JRLA 4JFWA 1TJIL 5AOZA 1M9WA 1QEWB 2O61A 2CDEA 1ILSA 1WEJH 2A1WL 4NJ9L 3DLQR 1HEJC 1QLEH 1K3IA 1QR4A 4EXKA 5EN2A 3BZEA 2ZKHH 4CJ1A 2VQ1A 3ZE2F 3QUYB 3U7YH 1ZIAA 2ZUQC 4KKLD 1UZ6E 2DICA 3NCJL 5T3ZD 2R1WB 1IT9H 4MLSA 2D7PA 1GW0A 5AZ2H 3BPCA 3UEZA 1Z6JT 1OAKH 2VZ3A 2BNQA 1OSYA 3DPBB 4NZRL 2P80D 3Q7JA 3MZTA 4IU3A 4D7BA 2WMPA 3E8VA 3FTXA 3L3DB 1JCVA 3X3FL 4Y2DD 3P4MA 1SJXA 2HFTA 3LQZB 2WIIA 4HIXL 3T2OA 3D39A 1XDTT 3Q43A 1N8ZA 1PIGA 4TMPA 3KZ8A 2E4TA 2H8PB 3BOVA 1KNOA 4R2GD 5E4AA 3WO3B 1G94A 3CMOL 3MNWA 1VESA 5GHWH 1YN6B 4Z18A 2RCSH 3RGVD 2AKRA 2AXHA 1OTSC 1L6XA 4AIZB 1II4E 2Q1EA 4KX9A 2CO7A 3QYMA 5D7EA 3GSWA 4U6HA 1GZHC 5KSBF 3SB3A 1SJHA 2IPTL 4B96A 1ZS8B 2AJ3B 1SVZA 3A6BH 4M8QB 2HP4A 5DVMA 4MDJA 5I1IL 2YD5A 1ZT4B 4PRPE 3RPKA 4PVNA 5FW8A 3FMGL 2ARJQ 3NCXA 1SYSA 4HOMA 3ARDD 3MMEA 1DFXA 2BSSB 3CFNA 1NDMB 4EDXA 4Z7IA 2WM0A 4CN6A 2ZF8A 1B3JA 2L7UA 1L9RA 4J8RA 1MJUL 2JXMB 3VH8B 2DTMH 1CG9A 4BKLB 3O4LA 3QISA 3ZTNH 3H3PL 3F7VA 2XWTB 4HMDA 2IAND 5IBTH 3ECWA 1EAJA 2JJWA 1TQBB 2BWIA 3OAYH 4XNZB 3LQAL 3E6HA 4AIEA 4XBEH 2RGSA 2P24A 4ZMYA 3B5TA 5F3HA 3Q6GH 2X4TB 3TBVB 3QI9D 4ODHH 4WJ5B 4AGOA 5CSBA 4LCUB 2ODIA 5BVPL 2AP2A 2Y6SC 1MCCA 1LEGB 3FT3A 5DGQA 1NUFA 4X98B 4O4YL 4BZ1L 4CDHA 2R2BA 3HZYA 2BCKA 1JGUL 3HJEA 4JE4B 4PR5B 3TA3B 5I15L 3UAJC 2WXQA 4N1HB 1JD7A 3ECBA 5DFVD 1OP5K 4XNUL 3TA3A 4FQCH 1JN6A 2R2BB 3HZYB 5TPWL 3T0EB 3K8KA 1FNFA 1NEZB 5JHLA 2X6BA 2YD2A 5E1AA 5EZPA 3THMH 5L8KB 5PAZA 3GLDA 3VGBA 4NAJA 1QWHA 3L5HA 5EPMA 3F7KA 4I13B 4PWFA 1A25A 3V4VB 4Z3FA 4P2QE 3O8XC 5IHWA 4HUVA 4FFYA 4LOEA 1W8OA 3G6AA 1NGWB 1AD9A 5L2KE 2YPLA 4Q56A 5EZOH 2HT3C 2J2ZA 1E5AA 3TO4D 3VH8A 3A0OA 4AVIA 4E9WA 2WP3O 5I24A 4X8GA 1WBYB 3FMGH 2GIMA 4GRLD 4WI0A 5KS9B 2YWYA 4OCRH 5MENA 3IGLA 2BP0A 1A6ZB 2JKRM 3CGTA 1WFJA 4OB5L 1SY6A 1DLHA 2E7LA 1BPLB 5LAXB 3CFQA 2YHGA 5I28A 2HVBA 4U3SA 5E6IC 3KNBB 3FB5A 5CILH 4AIOA 5BUPA 3GKWH 4P9HL 3UZVB 2GBUA 5DZAA 4H8WL 3HG5A 3SCMB 2NXZB 4RFNB 4YHNB 1JZ7A 1FO0L 3DYPA 1JHTB 4HS6A 3MJ9L 2EEBA 3GK8L 1OCOB 5IBUB 4LDLB 4R7NA 1EUTA 3A4EA 2HVJA 2LU4A 4HAKA 3MA7B 4YIQB 4JY4A 2R0WH 1WCBB 4WU5B 5HJDA 2AEWA 5IJKC 3QXDA 1PU0A 3CH1A 3WIIH 2Y2YA 3I6LD 1LJMA 3EYOA 4X6DE 4CILA 3ML9A 2XSKA 2Y1ZA 1SPDA 3QR1A 3AQDA 3TONA 1KJMB 1SEBA 4ZMZA 3U4BL 1K2DB 4HFWB 2AQ3A 5CN3A 1ZDSA 3NRFA 1S3KL 4H8PA 5GZOA 2BVQA 1P4UA 1BQRA 1PPIA 5DJYA 5T3ZE 1HXKA 2A1WH 1B4JH 1KB5L 4NJ9H 1N9PA 1BYPA 1TJIH 2D3JA 4ZUTB 3N1QC 3ETTA 4RGMC 5D7LD 3SBPA 2B0SH 3JWNH 3OPZL 2L0DA 1S7WA 3AB0B 3BH8B 3BMWA 2P43B 4M3KB 1CR9L 3NTCH 1PX3A 3PP4H 4XCNA 2A6JB 3ETSA 1IBBA 2KZ1B 5CJ8A 2F54B 1I8UA 4P2QB 1VACB 4G8FA 4Y4FA 4ZFZA 1BEXA 4Y2DB 4C58B 1DVFB 3IFOA 3TV3L 4A2FA 3PWNA 2WPGA 2ROXA 1E6JL 4LOUD 4Y5XC 4IKLA 1SXCA 5ICXA 2XVGA 4K7FA 3VFGH 1NDTA 3WJJA 4I1NB 3SZKC 1OGAB 1C9SA 4PJFB 3FC8A 5GSVA 3AZUA 5FYLL 4UDTB 3DPBA 4WK4B 3ZDWA 2XNAA 3BCFA 3TJEL 1N6VA 4YAQB 4NOBA 3ULUF 2CBOA 1WHOA 3DX6B 5LBVA 4IRJD 3EFOA 2WLZA 4KDTA 1NCTA 1RY7B 2D4DA 3X2QB 1AR1C 1A6VH 2DI9A 3LMJH 5D7KD 4PJ6A 4G83A 3EHBB 3U9UA 5TE7L 4LQFL 2EIEA 3D34A 2C9AA 1ZHLB 4BUGA 4F2ME 2YARA 4NN5C 3JV6B 3QEQD 3HBGA 2L7EA 4U1JA 5F9JA 5C0JA 4IBUA 2EXTA 4RDQG 4WEEA 3IFNL 3SDYL 1EANA 1HKFA 4MA7H 4YBQD 4IEFB 3DTXB 5FV1L 2J5LB 2VDLL 1JWMB 5JXEA 4H0GA 4UAHA 1I1AA 3VFMA 1QBLH 3H42H 2WCPA 4G8IB 4U1GC 1L7IL 3HAEH 3ARFC 2ATPA 1HEZA 3FT0A 2NLJB 2EDHA 2NTSP 5IIEB 2RB8A 4LSRH 3C60D 4W9CC 2M8XA 1W72A 1NAKL 3QDMB 4A2EA 1AR2A 4KH9A 1DUZA 2X0UA 1YRKA 3SBWC 3TNNB 5E2WH 3C5ZC 1U8LB 2D3NA 3CDFA 4ONHA 3KVQA 1KGIA 4K7PY 4UZUA 5K33A 5DQDL 4Z3TA 2V3EA 3FL7A 1XL6A 2WN3A 4OD2A 4BSWA 5EOTB 2FE0A 4I5BA 1F3JA 4XAKD 1F42A 4DGIH 4UDTA 4DO6A 4R0LB 2D7MA 3PQYB 2ITCA 1F11A 1T0OA 4Y5XA 2N0KA 3L81A 1CLYH 3UERA 5FO8A 4IJ3C 1TQSA 4NIYE 3QIWB 3RWFA 4IGBC 1QSFB 3UZQA 4M3JA 4X4YA 1VCAA 2DYPB 2FL5A 3L1EA 3VXSE 1U3HB 5F2FA 4DUWA 3U0WH 5DWPA 3IJEA 4HCRL 4OCSL 3WHXA 4Y2DA 4JREC 1VACA 1FC1A 1X5GA 4CBZA 2J55A 3O2DL 2CM6A 4Z7NE 4UQ2A 3ALPA 2J4WL 4Y9FA 5MI0C 4H88L 2VLJB 3ZL1A 4QRQA 2X12A 2JKTM 4F7CA 5EIQA 3ZDZB 1YMMD 2PTTB 4GFTB 1T1WA 1YPZA 3ZXAC 1JV5A 5JIKA 2HCZX 2CR3A 2KL6A 4G42A 3V4UH 3SDCB 1R5WB 4ZFOL 1ZGLA 1KEGH 4XX1E 4M93C 1XH1A 2YGPA 4OM0L 4KROD 4A7SA 5TH2B 3MX0B 1MFAL 4M6MH 4ZXBA 2P47B 3L4VA 2APBA 4JGJA 1DQLL 1EO8L 1SM3L 4JZOA 2YAMA 1HDMB 2BVQB 4FG6D 5JHLH 3EOTH 2RFXB 5CFHA 5KN5A 1EGJL 3LKRA 4OF5A 3TEYA 1RU9H 3QWRD 1GGBL 4WTZA 2EDTA 4P59L 2YEZB 3D2UD 4X99A 4QHMA 2A7BA 4KJPC 4FYSA 3IJ8A 3UYOD 2G3MA 3LH8A 2VWEC 5MEOB 3HBZA 1M7DB 4ZPTA 3E1F1 3D85D 5KWYC 4HGWA 3BAYA 1JWSA 2GSMB 1SVBA 3V6ZB 1UB5B 5DVOA 4UTCA 4YC2B 3DVGA 4YXLH 2GJRA 5JYLA 4CU8A 3JWNC 1S7QA 2WV3A 4M8RA 5A2LH 2Z64C 4V11A 3GMQB 4X0NA 3GZOA 4LLQB 1QQDA 5DTFB 1MRCH 3UFIA 5TF0A 4YSUA 1S8DB 4ZD3H 5JO5A 1KWKA 4KOBA 4PRNA 3S8WA 1JNHA 2BRQA 2MWCA 2VKWA 4Y4KD 3RTQA 1WWBX 1MJJB 5PCYA 1CFBA 3BCDA 4NT6B 2FJSA 4Q8BA 2OMWB 1MCPL 3DWTA 5LDUA 1LEIB 3TNMA 2ENPA 3CDCA 3PDOA 1RQ5A 2J6WA 2N1KA 5FPIA 1CDIA 1F97A 4ODSH 2EZ0C 2YAOA 5TDOA 4H0LC 1RU9L 1S9YB 4U7SA 4UOW0 5I5JA 4ZFOA 5JHLL 4HIHB 1N8OE 4W9LC 3IN0A 1ZOXA 5EU6B 3GSRB 4NBZB 1JHLH 1FZMB 1YC7A 3MLXL 2GTWB 2HG5B 4I85A 2A6KB 1PY0A 5EBMA 4LVHB 3L13A 1CN4A 3K7UA 3V4UL 1G7JA 3AG2B 1CF8H 2FSEB 4KPHL 1NOAA 1BBJA 2FWLB 3BD5A 4LLMB 5DHYB 3UTSA 4ABQA 2NTFB 1BQHA 4JFYB 5DRZB 5HTSA 2LU7A 5IOPA 2XN1A 1X4YA 4PJ7E 1PSKH 1U21A 2JKWA 2BNRA 1XEDA 1CK0H 5AOMA 5FA4B 3GZQA 4FLHA 3JV0A 4FC3E 1CFTA 4FGMA 3HHMA 4GAYB 4GY4A 4NM4H 3OMAB 5HPMB 2YPKA 4HX1A 5DI8A 3O6KH 3DX9A 3MV8D 2ICEC 2R7EA 3IJ9A 2EYTA 2VDPB 3L3HA 3Q2NA 4HA1A 4OZIF 2A77H 3EJZC 2H47C 4N0CC 2NW3A 4UOJA 1U3YA 2GIXA 2MPVA 1RUPL 3NN8A 5I6NA 2EECA 4IBWA 4JS7A 3F3HA 4XCCH 5EU3B 4V1DE 2FCBA 4NLHA 4S11A 5FLUA 1JGVH 1NBYB 4YLCA 1QOKA 5GGQH 4PJEA 2AJYH 2V2WA 4J6IA 5DDHA 3RX7A 1TVBB 2VABB 2DJSA 1C8PA 4EAEA 3B7SA 2C1OB 1OOWA 1LDPL 5EUKA 1I7UB 4PW9A 5FO9B 2EVFA 3MGTB 4M7ZB 5L6YL 1BZOA 1T1YB 3OKEA 4B9KC 5E6YA 1YMMB 3MCYA 3DTUB 4MDJB 1HCYA 2ZPKH 5ANHA 1HCZA 4KKRA 1D9KC 4DK6A 2B5IB 4G9FD 3U0TB 2VDLH 4H8UA 4F58L 1IFGA 1M71A 3DA0A 3DJ9A 2GJ6E 4JQIA 4MA7L 1AI1H 3C6SA 3H6JA 4IHOA 1J0IA 4NKQB 5AB0A 1SXBA 3GD1C 1JDAA 5F8QC 4LEOB 1DN0B 3QAZB 2NXZC 2X6UA 1NTDA 4WFEE 2L3BA 2FECI 4HKZA 3RWEA 2VLRD 5EIVA 4DWHA 5IM7A 2D03H 2OR8A 3PGFH 1R0AH 3SDXE 4IRZL 1TZGH 4B9YA 1GGUA 1MFDL 1EWHA 1NGXA 1G1KA 3VYPA 2EO9A 4K7PH 3ULAB 4GKZB 3NPSB 4Z9KB 5T1LA 3SDDD 2IALA 5FYKL 4IU3B 4AEIL 2CGRH 3GMRB 1DDHA 3WAJA 3MUY1 3VXMB 1V27A 2FEDD 3HI6L 2JQMA 3LRSB 5LGHH 5KUKA 4UT9H 3VI4E 2WAHA 4L1SA 3RB7A 2G5BA 1L3NA 3VDAA 1OSZB 3JTBA 3HZVA 1PDKB 2QVIA 2K4AA 5CP3H 4DPBX 4JO3L 3OR7B 1AFVL 1IFRA 2VQ1B 2F8IA 2EDJA 3UGEA 3WKQA 3QXUA 3RVTD 1RJZA 5D7JC 3EF4A 3RI5K 3RZCA 1IRAY 3S2CA 3EYSL 4JO8A 4H2CA 5I0YA 4E2OA 2OCJA 5ABDE 3CX5J 1K8DA 5J9PA 1UKSA 3UC0L 5DMJB 2DMBA 2W9DH 3ABLB 4MNHA 3SKOB 2B14A 4B9JA 5HHXH 3PHQA 1OB1A 2JJVA 4IGBD 3OPZH 3MRPA 3QZMA 3QUKA 5FA3B 2EH8H 4TL5A 2NY5L 2A73B 2CO4A 3GBML 1T21B 5IB1A 1HKLL 4JQVC 1OTUC 2AXFB 2DIAA 5DEJA 3WCYA 1TQUA 1TCRA 4KVPA 4TNFA 3GXTA 1N4XH 4A2MA 1NIFA 1S3KH 3FCSB 1F4XL 1OGPA 3PJSB 4IRJB 1IMHC 4FI7A 3ALWA 4ORGB 4PJEE 1FG9C 2ZSWB 4ELMA 4BHUI 4MNQD 3BIKA 4MZRA 2WBJA 4YNYB 2CIIB 2DQCL 4JY6A 4KY2A 3MCLL 4PJGA 5H8DA 1BXUA 1YJDH 2XXMB 5CSZB 3W9EB 2NY3D 3VFUA 2P52A 1U8PB 4OGAC 2ADIA 2N01B 3NCFB 4S1QL 3QQ4A 3STLB 3TVMC 3KYAA 4NQEE 4LESA 2BZDA 2HB0A 2ZE0A 5IVXE 2VE6A 3TN0A 1MFEL 1IGJB 1ASPA 3SPVB 4AV0A 4XPFH 4YFLF 1AS8A 1CD1B 1RZGB 3BSHA 2NNAA 3MPCA 2C4FT 5EF2A 3Q5OA 2APVA 5KYUA 4NZUL 1S4IA 2ZXDA 3UTSD 4ZX3A 5FDYA 2JB5H 32C2A 1N18A 3FHAA 1W8EA 2WSDA 5DHVB 4NN5B 4JFEE 1E8WA 3OZKA 1CT8B 4HD9A 3VXPB 4HIJB 5LDSA 2P8MA 1QLRB 3IKCA 3ZYZA 4JJOA 4GIPD 3TEUA 1TNNA 1RLBA 1X5IA 1TZHB 1BJ8A 4U3CA 1Q4NX 4MAYB 2NX5A 2R0KH 2P5WB 1J8HB 3ILPA 4ZJ9A 5AQ0A 1ZEAL 1LP9A 3ZKMD 4DVBB 1BVKA 1JGEB 5FCSH 1ZV2A 1LP9F 1EFXA 4NC1C 1LXMA 1ETB1 3QORD 3VWJB 1ZVHA 4RFOH 3P02A 4X9BA 1J5IA 3UTPD 1ADQL 2K8MA 4BZ2H 1KIPB 2OMYA 5DJZB 4WRLA 2PXYD 4TTGA 2HJFA 4JDVB 3ASWA 4L8DB 1I7TB 3S5LB 5IHUH 2Q5BA 3KLAB 1O5PA 5DT1H 1EZVX 4K3EL 1SDDB 3G9VA 3SJVD 5B8CC 4HUXA 3GSXB 3H2QA 3G5WA 5HDQH 3TO2A 4GJTB 4LPWA 4HF5L 5EBWB 1XF5A 2O6EA 1CXEA 3U2SA 2DN7A 4O2FA 3OAZH 2DPKA 4WCYL 1HC1A 1HQ4A 3FH7A 4KNSA 4L4VD 4N3UA 3SJVA 2VDRH 3AXLA 3QHZL 1FI8C 4PGZA 3HHSA 3O11A 3V5HB 3ZDZE 4BCYA 4YS4A 3HE6C 3FO1A 5DMIL 4LVNB 5J6HA 2K3TA 1SUJA 4ADJA 5FFLA 4J3OD 4OAWA 4FD0A 1LE9B 1HK6A 4XVJH 3S3CB 4XAWL 4WUKH 1JK9B 1Z7JA 1WITA 4PJGF 2OFQA 4QOKB 4ODXB 4XCFL 3LQAH 1BG1A 3RY6C 4AQEA 2P28B 2ZYIA 4LCWD 4Y9EA 3UJJH 5BOZG 1N0LA 2HFFA 5CEXB 4WFED 4H4NA 2OMBA 3VJ6A 5IR1B 1NKGA 3MNDA 1MJUH 4H26B 3HNVH 3Q06A 1H6UA 4M93B 2B77A 4N1EA 3C8DA 4HZLA 4O9HH 4D9LH 3QNYA 2ZCHH 2O5XL 4PGCB 3D0VB 3UBXA 2XPGB 2WYZA 3PP3K 4W4OC 4L4JA 2A4CA 3T6VA 4E5XA 4UDUA 1TOXA 2VRKA 2OI9B 3GSNH 3OAUH 3O6FA 1R4XA 1TETL 3DROA 2C1PB 1ANUA 3GXNA 2R69L 3NH7H 4YHYB 2ZKMX 4FLSA 3C09C 5D4JA 4RGOH 1MI5E 2GHZA 3LYRA 4HCRA 4X5XB 5EU3A 5LKNA 2F1EA 3DC0A 4X6CA 4PREA 3NYKA 4FDWA 4FQJL 3VGEA 3FUMA 4Y5VC 4KJPD 1G9MC 5D8JL 3BP4B 5DK2A 5EOCJ 4EUPB 2W95A 3DMMD 3H9HA 4AQ1A 1HHHB 5DEGB 3DK2A 4GRLC 3UC2A 4KJYA 3LZQA 3MLVL 4WSGA 4XNYL 4EDWH 4JKPH 4LMQI 3LQMA 4JG0H 4PFEA 3ATEA 3RVXD 1X3DA 3QIBA 4EIZC 1IBGL 5E00B 3COOA 2WUCL 2DWTA 1QSED 5A16B 3GSQB 4EI5D 2EYSA 2XQYK 4LT7A 5J5EA 3GUTA 1UURA 5SWZB 3IXTA 4LF3B 4Z78B 4JFOB 2W0FA 2BVTA 3W2DL 3KXFE 4MA1B 4N24A 2DV6A 4ONGL 1ED3B 2V8MA 1SLXA 2IDCA 4MXWL 5JUEL 3RTQD 1OHZA 2VDPH 1J12A 4JFUA 1ED3A 2PP7A 4N3TA 4UI2A 2VZTA 4JM2F 1SOSA 4Z1PA 4E36A 4NAMA 3OZ9H 3Q2CA 1RMFL 3QRGL 2P5EB 1X5KA 1N10A 3MCG1 2OW7A 4NQED 2VDKH 5CP3A 5CS7A 5DURD 2B8OT 5KYXA 3GSQA 1KJ3L 5TDOB 2HFFB 4Y19E 4I48A 1ZV9A 1F4HA 4JPKL 4M7KL 5JOPD 1Y0LA 4NFDA 1DQQA 2CKBH 2X7LA 2CWRA 3EH1A 3ZW3A 4MJIA 2X4NB 2GUOB 4L8SC 4AYEC 4NM8H 3D9AH 1FZKB 1BFTA 3PIQA 3HI1B 1WISA 4GINA 4DCQB 4B95C 4QHNA 1GJIA 2WXJA 4LLDB 1FP5A 1KB3A 1SF3A 4HWBA 4LPXA 1NGQL 4WFHD 4ZTPL 4L8BB 3QPQD 5BQDA 5IFAL 2ADYA 3L3IA 4XO4A 5E8NA 5JA8B 4RX4A 5JO5B 4EI5C 1MQKL 4YR6B 1MIMH 2PW2A 4X5XA 5EWIH 5EORL 5E99L 3NJNA 1A22B 2EDQA 2Y07L 3O6FB 4Q6YA 3D3VA 3RQ3A 4M00A 4QHUB 2VXSH 4Z7WE 1FNLA 3H9SE 1H0DA 3HKZA 3KLKA 5DU7A 4GQ9L 2NY2B 1E4HA 5ALBL 2R4SH 4FFZA 4XXCC 1U8NA 2EKSB 3QDGD 1ET7A 1ZLSL 4OLXL 2IPKB 4Z7AA 3D69B 2A9NL 1KXQA 2YRPA 1XCQB 1PKQB 4JFDB 3UYRH 4Y2DC 1RAMA 5I9QC 3CSBA 2XKNB 1FL6A 1NAMH 1JZ6A 3ABZA 3QJFB 5L9DH 1TO4A 4ZW8A 4X80L 1ADQA 3S5LG 3UABA 2VL5B 5AUMB 4QXTB 4H8HA 3VFNA 4UT7H 4OVUA 3RUGE 4ZMOA 1YEEL 3OKKB 3FFCD 4IBYA 5E8DH 4OLVH 2XN2A 4UMGA 5FO7B 2X9YA 5IVXB 1FF5A 5C6PB 5IV2A 4KX7A 3HFMH 4TQEH 1DQDL 2CGZA 5I16A 3ULUL 1XB8A 3IF1A 3UO1L 3ESVF 5BVJA 3D4GA 3QZOA 4ODVH 1QRNB 4G7VH 3HFFA 5KBPA 5EUOB 4KI5D 2BW4A 4PIRF 1OTUD 2FEJA 3IMBA 4GMSH 1XF5B 4G3YL 4CKQA 3WY3A 2X1OA 3UTZB 1JVOA 5JDJA 4OBRA 1J5DA 3QRBA 2XZCH 1RVFH 3FUFA 4ACTA 3KPQA 2VLRE 4P3CL 1CLZH 4YK4C 3LRGA 3P11L 2NY6D 4NN7B 4FQQB 4NZTH 1MVUA 4XMTA 4JN1H 2XWBA 1T0NB 5DF0A 5ESAA 4P48A 5DRWA 2OSLA 1MAKA 4HAFA 4HC1L 3EUDA 5CJQH 5IMMB 3EAKA 5FCUH 4DN3H 2W9EL 3LH9A 4NDMA 1T4KB 5AOJA 3OLIA 3HUJA 4EOWL 4F2FA 3W57A 5JPMB 3ZDYF 1M56B 4R4FH 3ZKNC 1MCDA 3WXVH 1A7OH 3WE6A 4YZFF 5T1DL 1MI5D 1G5GA 4MAYA 4WK2B 4XXCA 4IRSB 3CHOA 4E68A 1RV6X 3WE6B 5I2IA 2I32A 3I6GA 4ZFQA 4ZYKA 3IDNB 1AKJA 4JFXB 3WY4A 4LSSH 5DJXA 4EUPH 3TVMA 3KPLA 2DF3A 2DMGA 1AZUA 4M8UA 4QLWA 5GJTL 4JZNA 2BVEA 1I85C 5FM5M 3RIAK 2H2SC 2OSYA 1RK0A 4Y4KA 1YQVL 3HLAA 5IMKA 3V7AE 1Q9OB 2JCCE 4OQTL 1TMQA 2AZUA 4GMTH 5D1QB 1E6OH 2SEBB 2CUAA 4X7DC 1KCUH 4AXWA 2CO6B 2W5PA 4NQUA 1QFUH 3VXRB 1KGCD 4MHHG 2DQJH 4Y9BA 1IGFL 3SSGA 3MODH 3EFOB 1JK8A 1Q9KA 2DL9A 1QAWA 2PETA 5ESQA 3FO0L 1KCLA 3HR5A 1RFDL 1CE6B 1N7MH 4DERA 3CLEL 3EJYC 1FHNA 4PRBB 2YGQA 1XSIA 2WBJB 2CMRL 1SQMA 5T1JA 3HKFA 4XP1H 4K7FB 5A3IC 3PNRB 1T5XA 2EAEA 2Q87A 1EVUA 3VD7A 2P7TA 5EU7E 1G7MA 4MXQC 1N3NB 4IIQA 1LE5A 4YHLL 3WFBL 4JCWA 4JPIB 3ULSA 3ZDXE 1BXVA 1TTUA 1URLA 1AGEB 4PV8A 4CW1A 2PPEA 4MMXB 3UJTH 4E9QA 1CD0A 5KYXB 2BXZA 4MBOA 1QNZL 4P2RE 3DHMA 5B39A 1YPZE 3RKDD 4DZBA 4Z8FL 1H3WM 4OGXH 4MAYC 1HESA 2AABH 1ZANH 1YAIA 5HY9A 1BECA 4ETQB 3HS0C 3D4CA 2XQYA 4OLWL 3QG7L 3F7LA 3ULVL 4XPHL 1CICC 3UBHA 4FTVE 2B59B 2W80C 1DVYA 3FT2B 3OB8A 2EO7A 5JHDB 1JPTL 3UEQA 4GKNA 4N25A 4NQVA 1GL4B 1U8QA 1SDAB 3BXNA 1XQ4A 4F8PA 2ZWLT 3MNVB 3P0YH 5DJCA 3QIBB 2YAHA 1IGYA 2BSED 3OWRA 1ETJA 3WMPA 2O26U 5E08L 2A5UA 3FAXA 5KSBA 3VB8A 3RDTA 3MDJA 4CMHB 1KPUA 4NS0A 2IALB 2FD6L 3AC0A 3H7BA 1BSIA 3BP6A 4L05A 5DZNA 2BC4B 1G1CA 3EYOB 2JKJA 3RVTC 3BP6B 4JFPA 1LMKA 1RL1A 1ASOA 4JRYA 5D7LA 1G6RB 1UT9A 4JHZA 4O58H 3VACA 4X6EB 2WO2B 1U8IB 3ZDZF 2X2UA 3DUUB 3BUIA 1MRDH 1UJ3C 1A1MA 3V0DA 1CFTB 1LO0L 3CQFA 5EOCH 4R7NB 1AGDA 3KHOA 4G9DA 2VDMH 3MRIB 4BH7B 4R4NC 1G9NH 1CFVH 5LQBH 4N8CH 2BRRL 2XFGB 4WVRA 3GC3A 5C08B 1W8NA 4PRIB 1IJ9A 4PWEA 4G8EB 3VMNA 2FDBP 2W0LA 4Y0GA 5KYWB 3QO1A 3JV4B 5HJ3B 3DETD 1IAKA 5GS0H 5GSRA 3LNDA 5C6TL 4YHOL 2F68X 3NEOA 5I66A 5LJYH 2WBJD 2DKUA 3HG1B 5BCAA 3GHBH 2BVPB 2OULB 4WAFA 2YXFA 3BEVA 1MG2C 1G0DA 3FUKA 3HRZB 1E8XA 1NKOA 1I9JH 1HH6B 4G6MH 2X4QB 3WHE0 1NBCA 2P5PA 4NC0B 1PVHA 3MACH 1OD9A 1HZHH 4PV8B 2Z4QA 4Q52A 3U48A 1TEFA 1QO3A 2H3NB 3HMWH 1EJOL 4OF7A 4Y2LA 5D6DC 3VAEA 3S34H 4ZMQA 4WW2F 1YNTF 1N6UA 3MLTA 1IEBB 4YHPA 3C09B 3MBEA 1X4ZA 1NA8A 5DLMH 1BEYL 2ZX9A 1N59B 5J6HB 1VFAA 2VLKD 5DK2B 1UZ6F 3SHSA 3LZRA 4ELDA 5ECGA 1P1VA 4PVMA 3NIDB 5K59E 3UBFA 4ENEC 5HHQA 1D5IL 3BVXA 1JSYA 2YMXL 4G1EA 5IW3A 1F13A 3HMXL 1QSEE 3AACA 5EBWA 1TTCA 3CXFA 2GSGB 2KZKA 3BLPX 2P26A 4KROC 1OK0A 3O0RL 5CGYC 1OAUH 1H15A 3K71B 1U58B 3KLQA 2P24B 3KXFD 3TT3H 5D71H 4K2UH 1FVDA 2E56A 2GC7C 5I18L 1KIPA 2LT9A 4P23C 1ZXQA 3D0VA 2E6JA 5EBMB 3NCMA 4V1DD 1JXFA 3VI4B 4BA0A 2APXA 3FDWA 2YN3A 3T65B 4EXPX 3TN0C 4JPWL 3O45B 3ARFA 5GGVL 5BOPA 1X9LA 1Z2KA 4LRNH 1KGCE 3GRGA 4RSVA 3VJ6B 5JW3L 1CDJA 4QY8A 2WVVA 5EDSA 1V7MH 2VJXA 1TZHA 2QHRL 3ZT7A 4N5ED 5KVFH 1EHAA 3J27A 2H6PB 1BM3H 1FRGL 3R4DA 5DO2C 2VAAA 2BMKB 4PJFF 4PP1D 5BRZD 2W65B 4N9OB 2FHFA 1IUZA 1G7MB 4NO0B 4S0SD 3VXUE 5BV7L 1LNUB 1MKFA 3T0EC 2KLTA 1MVUB 4HFUL 3RTQB 1WFOA 3ZKMC 1RSYA 5E5LA 1AGCB 2UWEB 2Y06L 4QO1B 5AW5B 1KCSH 2OP4H 5EIIG 3KEHA 1EEUA 1XR9A 3CCHB 1MHEB 3BW9A 3IU3B 3QUML 3VDCA 4S1RH 3GMQA 3HN8A 2BXYA 5AVWB 4OZHF 2P1YA 3VXRA 2OS7A 5TFSL 3EGSB 4AJ0A 2WOYA 3SD5A 1YA5A 3VXQB 1CDUA 3X11B 4LSPH 4PI2A 3MRDA 4AUUA 3T77A 4P5MA 1ES0B 3OXSB 2H32H 3ULUC 2VZVA 1PQZB 5IMOA 2HLAB 1IBFA 4G6KL 5SX4I 3N40F 2R9HD 2COVD 4BSWB 2PO6A 3CVHH 3N43B 3MRFA 3DVFA 4DAGH 2G2PA 1GZHA 1KBGH 1GJWA 2HRGA 4KGLA 3BKML 4O02L 2G3ZA 4EZKA 3X3GL 3MFFA 5KZCD 1ZT7B 3F12B 5ITFB 3RJOA 2N0MA 5J12B 1NFKA 2EDNA 4TS6A 1FGNH 4KZEH 4HKBA 3JTTA 2Z7YA 2XIIA 1RJYB 4JPQA 4LIQL 5F7FA 1WTGT 2ITDB 5LGKA 5E6IA 3NIFE 2X6AA 1I1YA 2XXCB 4CMMA 3JSSA 3ZRFC 2G5UA 4I77L 2XWCA 4OKDA 1FUNA 1OCWL 1ZLDA 4F91B 2R8SH 1T7YA 5T5NF 32C2B 2OK0L 1C7SA 4YXHL 4XVTL 2XN0A 3FHEA 4PCKA 1UT1A 5F7YC 2MCG1 1EXUA 1K8IB 5K9JL 4B9PA 1AG6A 3SPVA 2VMJA 2F19L 2APFA 1J0HA 3HG3A 3E80A 4ELME 4OV6F 2VQ4A 3DYMA 3K2MC 1G9MH 3NJLA 3BW9B 2ZT9C 1G7QB 4LB8A 2WUBH 4MMZB 5ITBL 4Y1AB 2ENSA 3KPNB 2VQTA 4G1MB 4PJBF 1PD0A 2KDYA 3EO1B 1F6FB 5EBLB 2H0EA 4JHAH 4LLDA 2MQ3A 4GKZA 3BD3A 1VFBB 2HX7A 4KKCC 4BINA 3CBJB 1XGQA 4LSDA 2YLHA 2EEAA 4LNRB 1CXHA 4J12A 4PAZA 3GB7A 4QRUA 3GSUB 3RFZB 1R3JB 3KM1A 2VDNL 2NY6C 1A6UL 4OLUL 4PLOB 2F7IA 1GHFL 2EIBA 4LEOA 3HZ3A 5FA3A 1GGIH 2X88A 4K71C 1H5BA 3KYMA 4ANVA 2HPTA 3GNMH 3HZMA 5C09D 4F9PA 5L7XH 1D5BA 3QK0A 4D9QD 4ZG1A 4GUQA 1VEOA 2XQ0A 2YC1B 2BP5M 1AJ7L 3B7UX 3BH9A 3O9WB 2E6QA 4IRSC 5IBLD 4J4PC 1YNTB 3CN3A 2VLKE 4LIQH 3ZKQD 3GS7A 2UY7B 4GW5A 4FNUA 5JTWA 3S3SA 1XZ0B 5BZZA 2DWEA 3JTSB 2G9HA 4L3CA 4DVRH 4KMTH 4EI0A 2CXGA 2ARJA 2K7PA 2BZCA 3F6LA 2R2EB 1EEYB 2H9GB 5CJOH 4G5ZL 4DAGL 3CQPA 4S1SH 4Z3IA 3IRPX 2E7DA 1J8HD 4OF6A 2FO8A 5D96C 3PGCB 1JZDC 2TSBA 4X8XA 3RY5A 2ATKB 3BLBA 2A9ML 4KK6D 4JKLA 2DY2A 5DJAB 4CSSA 2Y69B 1AE6L 4JN2B 1L9NA 3O4OB 4M02A 1B2WL 5KZCB 4KVNL 3OHMB 4KUZH 3REWA 3FQWA 5E94B 5DD0L 2K1MA 4JQIH 3S4SA 1E5BA 1I9RH 3TL5A 2ESVB 4HH9A 5HJBA 5E8EA 1JZ5A 2FUQA 4NB7A 2AXJA 3B34A 3UP1A 3GGWA 2JKNA 4P2QA 2BNRB 4ALAH 1UYWL 4WHCA 5KTEL 1I53A 2QDVA 3TO4C 4M61A 5GZOC 1X5HA 2V8LA 1M7XA 3U46B 1PW3A 4P99A 1DR9A 2E74C 2W59A 1NFDF 1FJ1B 4PLKC 2JE8A 4MFHA 3VXUD 4AYID 1MCLA 1UB6A 2W07B 2ZXAA 1G7JB 1QFWM 1YSOA 2QHRH 3I3DA 1T1YA 4XH2A 4JRWA 4M62L 4YEFA 1XGUB 4X4XA 3JVFC 3N5AA 1TPXC 4GG6E 2EYSB 3MYJB 1WWAX 5A16A 5E51A 2J2ZB 1N0LB 3T2NH 4DNLA 3MC0A 2YQGA 3IAGC 2BERA 2XLLA 5IK3B 4L2LA 3B83A 1MHHB 3TT3L 1KEMH 1NFAA 2Y6SD 3B3IB 1UD8A 2YLKA 3PREA 4WWID 2B1AL 2WQUA 1IC1A 2GC4C 5AENA 4Q89A 2OMXA 4OUUB 4FABH 3D2TA 1SFHA 3OC8A 3H9HB 2G2RA 3H7BB 3ESMA 3F64A 3KEDA 2P45B 1L7TL 2XDHA 3S4SG 1SHSA 3OL2A 1OKEA 3QG6B 4XVSL 3X14B 4ZZKA 2V17H 4KX8A 4Z7NF 4U6VH 1NCNA 1TSHA 4MAYD 2VLKA 3VFWA 2IOIA 1UJ3A 1U8QB 2ZX8A 3EJQA 1MNNA 4OGQC 3OJ2C 4H1LB 4M7LH 4E9XA 3CUPA 1TZIB 1UG9A 1SHXA 2IXQA 2R0ZH 2OX5A 3UBGA 3DYOA 2DQ6A 3E6HB 4TVPH 1TQBC 3UTSB 2BY2A 3GRWL 4M6AA 4Z7QB 2JI1A 2YMOA 2I24N 2YEZA 4WY7H 1QLEB 4AGMA 1WFNA 2PWHA 1KV7A 4CN4A 5JHAA 1RZFL 4WWNA 4Z7UB 1OZUA 3DGDA 3S6CA 4JO1L 4LPVA 2FYYA 3QS2A 1WBYA 4MX7A 5TH2A 3VGHA 5KS9A 2A9DA 3GHBL 1Q0XH 2MPAH 3E1ZA 5CEXA 4DEWA 4G7SB 3STZA 3VXOB 1AGEA 1FG2A 1M2OA 2JV6A 1NCBL 3EYUL 1DE4B 3RGVA 4DZ8A 1C08A 3LN4A 5IEHA 4AVHA 3IGAB 1GSMA 4LL9A 3CVBA 1UOKA 3GF8A 4Y19A 1SRDA 1IKFL 3T4AC 1IM9D 2BRRH 4J7RA 5E1AB 1OHQA 2AEPH 1JNJA 3GIZH 5LQBL 1MJJA 5ETUA 5G4NA 5TGBA 2VDML 1I1FB 1SN2A 5EOCL 4JFQB 5JOPE 4QTFA 4URTB 1AG0A 3T4YA 3P4NB 1ZVSA 1DBAL 3AADB 4Z7VB 5I5IA 3U2SB 1U3HA 5EA0H 3D39B 2AJXH 5CMAA 1S7QB 4UV7L 4YO0B 3IBOA 5F1SA 3T08A 2BS71 2OR9H 5MP6L 4P57B 1VB9A 5EEYA 1XXFC 7PAZA 1WZ1L 2DMKA 3N06B 3MRNB 1E9PB 5C08D 5CEZL 4MD5A 1T04B 2BNQB 1RK0B 4W6WB 2JLPA 3X1BA 3VSTA 1FBIL 4JO4L 3CH8A 2AAVA 2HYMA 4WKZA 4EN3D 5T1KD 5DFVC 3MRMB 1R24A 2JI3A 4QRBA 2BNRE 4FKHA 1Q8MA 3WNMA 5I0WA 4NFBA 5D1QD 2FX7L 5HHVL 3BDYH 4E9LA 1CURA 5H2BA 3ULVH 2WQVA 1XF1A 2WO3B 2Z35B 2AQRA 3WFCH 2ATPB 2DEXX 2VDRB 3CFKA 5F7EL 3WJMB 4HZ1A 4Z23A 3DDFA 4IBTA 4FQXB 3B3BA 3TOPA 2N1TE 5FX3A 3S8FB 3FZUD 3SDDB 1Q94B 3GSOB 1E2ZA 3P54A 3MUHL 4K9EH 4M29A 3IS0X 2OSLB 1PZAA 2VLJA 5ESAB 4DETA 1NEPA 3SDXB 4AQ8A 5L4JA 3AXIA 3CVHB 3H2PA 4JFHD 4RGNC 2VLRB 3RPIA 1X7SA 5C0AA 1AYRA 3SE8H 5DMGC 1YEDA 4L4TA 2CJSA 2ICWJ 1FVCA 4MCZA 2ZOLA 3GRBA 1IL1B 1RJLA 3PL6A 5DD6B 1CGWA 3OAWA 1XCWA 3C6LD 1CQKA 2R29L 3FFCE 1J7VR 1WZKA 1BQUA 2OYMA 4CRPA 4LSUH 5IHZA 4XGZB 3MNZB 4RGMB 3A67H 1WGVA 3DI3B 5GSVB 2ZUUA 2JH2A 4N2HA 4Z76A 2R4RH 3EJPA 1ICTA 1S7VB 1OAQL 4XGZA 5JW5B 1CLOH 2IWEA 4BV1A 1P53A 2OMVA 3LX9A 4GW4B 3MROB 3G5VA 5F3BA 2PCYA 5DJ8B 1XF3B 2W38A 1GPOL 2X70A 4IOFD 3WL9A 3D87B 1EMTH 3OB0K 3RU8L 1LLAA 4UIKH 2BK8A 1XGPB 2A73A 4BWWA 5I0ZA 1DN0A 3IDMA 3QUKB 5EF3A 2F8XC 2L7QA 3QZWB 5BMFL 1NBVL 2PTVA 3QUZB 5IBUG 2GITB 3AWEA 1D5MB 1KN2H 3Q1SL 5ELIA 1J1XL 3TVMD 2ZXEB 2GVYA 3BAJA 3KAAA 3QI9A 2IG2H 1SXAA 4MMYA 5D55A 1FFRA 1LTXA 4FQXA 4A7VA 4WUUE 1QLFB 4F1SA 6FABL 1P84K 4NYLB 4JM0A 4KKLC 4AEHH 5AALA 2TRYA 3IU4H 3N9GL 5CZVH 3D06A 3QEQA 2ZXQA 4A2LA 4EOWH 3OR7A 2F1BA 2NXYC 4ZXBD 4NSKB 1P5UB 3HS8A 1AR1B 2FJFA 4PJXB 4TLKA 1N0XL 2JCCA 5F7BA 3IETA 5FYJH 1P4LA 5F89B 1YZZA 1ZWIA 1NJ9B 2JK5A 3MV01 5I82A 1IKNC 4OU3A 1RVFL 2FZ3B 3KS0H 3L4CA 4UUJA 1WC7A 1MF2L 2QSCL 3NSDA 5E5MB 4B9GA 4D2NA 2BY0A 4X0KA 4G3YH 2EYTB 2AEQL 1XBDA 5D2NC 4CC4A 5CFAA 1NCWH 2J6EA 4U1GB 1HSBA 4PBXA 5KSAC 2V9UA 2VRQA 3KVPA 3SE9H 5CLWA 4UTAL 2I25N 2DM4A 3NA9L 4I3RL 4YWGH 1AQKH 4F37K 3FCBA 2WWKO 3B2VH 1YEFL 3CDZB 4BSJA 2ERJC 5I8KL 2WXKA 5FWQA 2EABA 3EJRA 3MLUL 4OIIH 3N1FC 3QQNA 3UTQA 2G5RA 1X5ZA 5AW7B 4Q0XL 3LZOA 3ES6B 4QXUH 5BO0D 3S5ZA 4MJ4A 1F41A 5JIQA 4U0RB 1DJGA 4WK0B 1XHHA 4WW2C 3U7AA 1SVCP 3IDXH 5TQ2H 1ZRUA 3VGAC 1DQTA 3CD4A 3AWGA 5ID0B 3OD3A 4UTBH 3K6DA 2HTLD 4PB0H 3LZNA 3AY2A 3OJVC 3BC9A 4YPGA 2XICA 3VFSA 4MNGB 2Z7UA 2B4CH 5AB2A 1MFMA 2QQLL 5I19H 2PCXA 2FUTA 3ZSSA 2HFEA 4OCLC 2QLVB 4AL8H 2OMUB 1NL0L 3MXWL 3VD5A 3KLDA 2FYVA 5I1EL 4JMNA 4R97B 4X6BB 3JT0A 4APQD 3CH1B 4XNXL 1IIIA 2A74C 3RVWC 3QUMB 1Z5HA 3L3JB 4WO4B 2DWDA 4OD3H 3WUWB 5KSUA 2NX5E 1D7FA 1NIAA 3CK0H 3D18B 4LHJB 4LLQA 5DTFA 4YGVA 1UM4H 2DWDB 2ZIDA 1TJGH 2XY1A 3DBXB 3I84A 1HAUA 1Z5LB 4PBVC 4YBLC 5I8OL 3KBHE 1OF2A 3DVGB 3DROB 2BHUA 1K6QL 4DKEH 4GXVL 3GS0A 3JT2A 3N6YA 3KBEA 5BZDA 4QAMB 4R9HA 3ARWA 2HJKA 4OJEH 4HETA 2CKBL 3FUHA 4X5WA 5DMKB 4LXFA 3UBXB 2B39A 1YEIL 2QLYA 3TGXA 3JQOB 1J5HA 5CLTA 1M9SA 4YE4H 4UQBA 4UAOB 2WNKA 3WFDH 1IAOA 4ZPVB 3PAYA 4OT1H 2VXQA 3DJSA 2XWZA 4EDXB 1NC2D 2F18A 3WELA 2VW6A 4MXWH 5MHSE 1XGYL 5I1LA 2Q10A 1X5LA 4PS4L 4XH2B 1W0WB 2X89A 2QT6A 3T0WA 1SJEA 5FB8B 1J9TA 3SQOL 2ZWKA 3GXIA 2OMWA 1F5WA 3QJRB 1T7ZA 2Y24A 3TZVB 2NNXA 2CO7B 2EE2A 2DQIH 3U7WL 4BFRA 3DX7A 2FBOJ 4MA3B 3IGKA 3IDIB 4HWZB 3T1FB 2AEOA 4KY1H 1PTZA 2FJHB 2UZIH 5I6MA 4C56A 3DVNA 5D1XE 4EDWL 3RWGB 3FU0A 3L3JA 4X98A 1JDDA 3ABKB 5JXEC 3P4OB 4K94H 3TJHC 1UWXH 3DSFL 5LXVA 2E7CA 3VRIA 2B4CC 4G2AA 5F3HB 1CBJA 3BDBA 5SWZD 3LSOA 4NQDB 2CCVA 5H37A 4UINL 4Z7UE 3I85A 2Y7LA 3US0A 4QD2E 1DJIA 4L4VB 1YHPA 2UX6A 4JGMA 2F58H 1BOYA 3NH7L 2WO4A 3MJWA