2OMWB

Crystal structure of inla s192n y369s/mec1 complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
GPLGSWVIPPISCPENEKGEFPKNLVQIKSNRDKETKVFYSITGQGADKPPVGVFIIERETGWLKVTQPLDREAIAKYILYSHAVSSNGNAVEDPMEIVITVTDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Extending the host range of Listeria monocytogenes by rational protein design.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Cell invasion/cell adhesion
molecule keywords Internalin-A
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2omwB00
1FF5A 1WUZA 4ZMZA 3K6DA 2O72A 2X2UA 1OP4A 1ZVNA 4ZT1A 3QRBA 2WHVA 5JYLA 4AQAB 1SUHA 1NCHA 3LNHA 4ZMVA 4ZMPA 4AQAA 4ZMYA 4NUPA 5KJ4A 2OMZB 3K6IA 1NCJA 4ZMWA 2WBXA 3K6FA 1ZXKA 4AQEA 2OMXB 2OMVB 2V37A 4AK1A 4ZI8A 4APXB 3UBFA 2QVIA 3Q2VA 4AXWA 4ZMXA 4NQQA 3LNGA 4ZMTA 2OMWB 1L3WA 2WD0A 2YQGA 2YSTA 1O6SB 3FF7A 5CZRA 3MVSA 2WCPA 1WYJA 3FF8A 1Q1PA 4ZMOA 5CO1A 4AQEB 3Q2WA 2OMTB 5JYMA 4APXA 3LNFA 2QVFB 1EDHA 4XXWC 4XXWA 4AXWB 3PPEA 4ZMQA 2OMUB 4NUQA 4QD2E 2OMYB 5DZVA 4AQ8A 1NCIA 3LNDA 2A4EA 2EE0A 4AQ8C 3Q2NA 3K5SA 4ZMLA 1NCGA 4NUMA 3Q2LA 4ZTEA 2A4CA 3UBHA 3LNIA 4ZMNA 3LNEA 3K5RA 3UBGA 4OY9A
chains in the Genus database with same CATH superfamily
4Y4FC 3X3GL 4DP9X 1DL7H 1ACCA 2VDPH 4ZUUB 5IWLA 2JJSC 5TE7H 4UT7H 1P9MC 3RYMA 1TSRA 4PRDB 1IKFL 2ZXDA 3PUCA 1C08A 2OMWA 2LTQB 1WQVT 1NJ9B 2APSA 5FCSH 2VDQH 4RQQB 5D2NB 4JCWA 5EZLA 3ZDWA 4ALAC 1FHNA 4TN9A 1XB8A 4JFEA 5E9DD 1L9SA 2XZCH 2BS9A 5T3ZL 1FC2D 3OKDA 2ITCA 5I1JH 3VI4B 3QJQB 2A74C 3NIFB 9CGTA 2IPTH 5G4OA 5FGBC 1A7QL 3H2WA 1V7MH 3ISYA 5ICZA 3MA9L 4ABVA 1G6RA 1QBLH 2IANE 3S36H 4ODTL 2IGTA 2R0LH 3L17A 3TP4A 4U31A 2EXTA 2XA8L 1PG7X 3JTSA 3BEWA 4V1DE 1BFTA 1PS3A 1NMBL 3FCSB 3MLTA 5DS8A 4KWUA 1AXTL 1KSRA 3OQRA 2YD0A 1CBJA 1GAFL 4JM0A 2P9RA 3KYOA 5D7SH 1BJMA 5F7HA 3C6LA 3B2VH 3ENEA 5FCUH 1C12A 1MJ8H 3BHBB 1BQHB 5B3SB 4ZUSB 3CVHA 2XZZA 1MFAL 3ZX1A 4HFWA 2GBVA 5EFIB 4NZTH 4PGEA 3GLZA 1XHHA 4YBHA 1H15A 5IHZA 4GIAA 2W65A 1LDSA 4B5EA 5SX5H 2B16A 2O5XL 1DBBH 3D50A 2VLLA 2MCMA 1IAOA 3PFQA 1G7LB 3FT1A 1U8NB 3N9GH 4ZODA 3L4XA 2VMFA 3KL3A 1EGJL 2WKLA 3WN5A 4U3CA 2W8CA 4WNJA 3IK2A 2VMDA 3PUUA 3JWOL 4U1SB 2BSBA 5GS1B 3RDTC 2J8UF 3SKMA 3MRLA 4XXWA 4C47A 4NZUH 2GIYA 2ATKA 3U82B 1OSYA 4ODVH 1NLDH 2HTKD 2K0RA 1EJOL 1IBHA 2OL3B 1RK0B 4JKKA 1VERA 2QGCA 4M1CD 1QSFB 1SUJA 3ROLB 5L7XH 4M48H 5DQ9A 2SODB 3U6RA 3VX1A 1T5WB 5A2BA 1VZHA 2CD0A 2WSDA 4GXUN 4QHUB 4QRTB 3KEHA 1AR1D 4IHBA 4ZD3H 1QRNE 1HQRB 4AZ8A 5LJYH 1MZZA 3HC3L 1BFOB 4RWYL 1ZSHA 2EDTA 3UGUA 5HHMD 2H6OA 4OLUL 3WXVL 3OKYA 3OKEA 4ZW6A 4AMKH 3VTTA 4O2FA 5FF6A 1A64A 3DI2B 3MRMB 3QPKA 4KY2A 3QUYD 3P77B 3SDAC 4J3OG 2G5RA 5EMYA 3UZQA 2CGZA 3SKMB 5B22A 5HHVH 2XJKA 5JMRA 4QUOA 5AOLA 5ICXA 4HK0B 2O72A 2DJMA 2HX9A 1ZTXE 2AQNA 3HUJE 3BKMH 3VDCA 3PWVA 3VGBA 2X4NA 5JHBA 4CMHC 4H44C 3WY4A 3V79C 2HT2D 1PQZA 1JGVH 5C07A 1CFMA 1TLMA 1LWRA 2R29H 1QWUA 2VDOH 1RIHL 2BFVH 3GSQB 5DZLA 3W39B 5EEWA 5HJDA 3GSQA 4U3SA 5IBUG 1XT5A 1G7MA 3C75A 3ZR5A 4IKIA 4GUPA 1PL3A 2CIIA 4WEMB 4KI5D 4QEGA 3GXTA 5FKAA 4JDZB 5CN1A 1NGYA 2YXMA 3UAFA 5I9QC 3UG5A 2KC0A 4JO5A 1KB5H 5I26A 4F91B 2O5YL 2NTFB 2X42A 4MBRA 5KBNC 1ORQB 1ET8A 3QYCA 4LCWE 1J5OL 3CFCL 4JFOB 3VFVA 1K8DB 2JIXB 1YPZB 2NXYD 4X6FA 2JJWA 1A3LL 1UWEL 2X4QA 1J0JA 4E9YA 5I0WA 2ENSA 2Z4QA 5C9JB 4JY5H 3VGDA 1G9HA 3P0YL 2WUCL 2J1YA 4NENB 3N1QC 1GMIA 4OCSH 1XSJA 2P8LB 1FAKT 2Q7AA 4HUKB 4ODSL 4R4BA 3UTSD 1OT2A 3ALPA 1P7QB 3FQ2A 1HILB 1N2RA 4CMMA 3R1GL 5IM7B 2VLJA 1KJMA 4XWOC 1Z9NA 1DO6A 3PQYA 2BRRL 5E95B 1IL1A 3QUXA 3BHBA 3CFCH 4Q8BA 4ZUUA 3QIUB 1TIUA 2NW3A 1BYNA 2IH1B 1UA3A 2XWTB 3QUZC 2N59A 4GKLA 4DN3L 4Z7NE 1E8WA 3MKGA 1IKNC 1C5CH 4OCRH 4EDXB 1OCCB 3MLWH 1KULA 2ZCLL 2EVIA 4U2YA 4TNGA 5EUKB 1UXSB 3D25A 1JDDA 1WCQA 3V4VB 5FUOL 4AJWA 1XCWA 1YNTF 4NQDA 5GIRB 4Z76A 3HLAA 1G9MC 3FU7B 1DUYB 5GRJL 3B9DA 3M17B 2YPKB 3EXJA 3EGSB 4TVPL 1H9DA 2Z1PA 3II1A 3FULA 2PR9A 2QSTA 3B5HA 1IC4L 3BUYB 1ZHKB 4XN8A 3NABL 3D9AL 2QPUA 4PJGF 1NGXB 2P4AB 4QAWA 4YZWA 3SPJA 3F01A 2NYYD 4JBSA 5JQ6L 4HIIA 4A6YL 1WIUA 2YUWA 4AGLA 5GRXG 3ZTJH 4YPJA 5T1DH 3WTUA 3D69A 1VF5C 1YEKL 4YSOA 3NJGA 3ARFC 1COBA 1YEEH 3A6CL 3LRSB 3PWLA 4AKQA 4E0RB 3T6QC 1Y6NR 1JWSB 4LT7A 5GZNC 4P5TB 2J88H 4Y4KB 3HS0C 5INCA 5TFSL 1KYOK 1IGFL 4U6HB 4OM1H 3VI4A 1DBJL 3H3PH 4ORZC 3B7YA 1QTPA 1T3FA 2I60H 5ESAA 5F7EL 1BVKA 5ABAA 1BQ5A 3MLPA 1A6VL 4P57B 2AI0H 5T3ZD 3C2AH 5EIQA 2OZ4L 1FLTX 3C60A 2VERN 5K1JA 5DD5H 3CN4A 5B39A 4Q9BA 1AQDB 2JI3A 1U3HA 3IKCA 5LAXB 5IY5B 4GQZA 3HC4H 5AW5B 1UA7A 3H8NA 4J39A 1PG7H 5B4MC 2DH3A 2WLMA 5DC2A 3V4PA 4ZXBB 4IKNA 2ZOKB 5LNGA 1S9YB 2Y25A 4KQ4L 3LN5A 4O5LH 5ILTL 5F8QC 2V5RA 3U7WH 4ZYKB 2NUPB 4GINA 4NQCE 5HVHB 1BG9A 1FPTL 2AEWA 3H3BC 4KK5C 5KJRL 3JUYA 2OTWB 2HUEA 1SHXA 3BPOC 4G70B 4NWUH 4TLKA 1A9BA 2CCLA 2X1WL 3UERA 4WW2B 15C8H 5KZCD 2FRGP 2DWYA 1W15A 1AYRA 2F5BH 1GOFA 4OSUL 1MFAH 4HWBA 3ABMB 3L6FB 5E5UB 4BGLA 1ERNA 1ZHBB 2IWEA 3IFPB 1R75A 4YDLC 4UT9H 3V4VA 1UXMA 2A0LD 3KHOA 1XGTB 2ROYA 1IM9A 1GGCH 4MYPA 2Y06L 3SDXB 4RAVB 3WLBB 2AGJL 4ODXB 1VCBC 2OR8A 2UV3A 2ZUQC 2YD8A 3B2UC 1SJHA 3B9KB 4L8BB 4LCYA 4PGBB 5FYJH 3S7GA 3SCMC 4AJVA 3CZGA 4TSBL 1F1AA 1DJSA 1G9NL 3SOBL 2NY7H 2EE6A 4WWID 2YPLD 3HG1B 3CHPA 1JPFA 1XCQB 1WVZA 1A7PH 4CNIB 4KKZA 1CD1A 4OAWB 4YHKL 4JKNA 1DO5A 3NIGB 4GBXA 3T4YB 1LEGA 2PCPB 2XZCL 1WZLA 4NWTH 4PY7B 7PCYA 1C5BL 4NN7C 2DI8A 3KGUA 3ARBC 1HHHB 2ZSVB 2NY5H 4NUJA 4YVUA 2EDHA 4NPYA 3WIFA 4LQFL 2XPGB 2DWSA 1WDAA 2XZAL 1KXQE 2ZUXA 3DJSA 3HVNA 4M6MH 4QHPA 3SD5A 3HMXA 4AM0B 3MXWL 1L9NA 1ZDSA 3LZLA 3ETBF 3EYOA 1A6ZB 5TD4A 1K8DA 4MASA 3FU6A 2AXFA 3P40A 1JZIA 4L9LA 3KLKA 4QOKB 1UT1A 5KBMA 1FYHB 4DF9A 1EFXA 5CLZA 6TAAA 3D85D 3MLRH 2G30A 3DKHA 5JR1L 4LSRH 4M1GH 4ZOAA 5DZ9A 4QR7A 4H8HA 2HAZA 3OF6A 2DWTA 3WSQH 4K7FB 1N10A 2A0LC 4OCWL 4JQIL 1QHOA 2CIIB 2DF3A 3OZ9L 2ZYHA 5I0XA 3VQ1C 3UIYA 1ACYH 3P3SA 2TSAA 2YGNA 5A2AA 2Z7YA 4Y1TA 4TXVB 4UV4H 4PN6A 4WTWA 5T1KD 1N5AA 5GS1C 1G7PB 4PLKC 3QE5A 4LDEB 4U1MA 4GQQA 4HUXA 3SKOA 4Q97A 2X4SA 3ZL4L 1OL0A 2ZUVA 3MRDB 4JFTA 5HYJB 1M42A 2YKLH 3FSOA 4G8GB 2QELA 4Y9BA 2NW3B 3VFVB 4YMPA 3FQTB 5BPPA 1FGVL 1YAZA 1GL4B 4G8GA 1FZJB 2O5YH 1R1CA 4J8RA 4POZD 4FG2A 2EP6A 3N44F 2WXPA 4LLDA 3HCVB 4JGJA 5CD3B 1NMCC 3CDZB 4NQQA 3VD9A 3FH5A 5HI3D 3RWEB 5TE4L 5HDOA 1FNGA 1MFCL 4PMFA 1ZLWH 2P8LA 4QCIA 1EXUB 1BJ1H 4G6JH 5JNYB 3LN4B 2GBAA 1FNGB 1W16A 4MNHA 4OLEA 2BSDA 4KZEH 4P3CL 3IJEA 3PAYA 2QQNL 1JF5A 2Y7QA 3UZVA 3X1GA 2VDLH 3LVEA 2OMNA 2CMRL 3FF8A 4ZQKA 3U0PA 5CGBA 5I17A 1MCIA 4R2GD 4K94H 1AP2A 5AOKA 5D7JA 2VMJA 4DKFL 2YPVH 3MJ9H 2ZUYA 1NIFA 5DQJB 3R1GH 5FUCE 3M7OA 3LNFA 3OXRA 4DW2H 2FQFA 1AD0B 3AXIA 3ECBB 4MMZA 3PXLA 4JFWA 1F4WH 3ETBJ 1GGCL 4DTGH 5D93C 2JE8A 3BAKA 1DSYA 4M6AA 1YEJH 4ODWA 1Z3GH 1IE5A 3G6JB 2GJ6D 2PCFA 5FGCE 3ZL2A 1GW0A 4P2RE 4N2NA 4MD5B 4ICXA 4AIOA 2YN5A 4BFGA 3IDUA 5JW4R 2V2WB 4YO0A 4JFPB 3ZRFC 1DSWA 4I9WE 3UAEA 5T5NG 4Z7AA 4HT1L 2P46B 1HEHC 1LD9B 2BNRA 3NZHH 3ASOB 3BIKB 3QEQB 4P0DA 4TYUA 2MH4A 5E9DB 5B21A 1DVFC 4WY7H 2TRYA 2GIMA 4Y4HB 2VQ4A 4GFXA 5JPMA 1N6VA 1WUZA 2W81C 4KHTL 4D7PA 1MH5A 3F12B 4JHWL 4WO4A 2G75B 4P9ML 3TCLA 4DH2A 1TJGH 4G8GD 1MFBL 1NL0L 3CN2A 4HEMA 4OKVA 5EU4B 1KXVA 1XGQA 4HUVA 3WJMA 4HG4K 1PZUB 1OCOB 1H6EA 3SDAA 4JFFD 1H6FA 3MROA 1HXMA 1I9RH 3NCYS 3RB5A 1FAIH 3FO0H 3E38A 5IVZB 2EDFA 4A2MA 5HI5C 3VB8A 1IAOB 4Z7WB 4GO9A 3GBNH 1IIKA 2BOCA 2IQ9L 3BC9A 1TYJA 2FHFA 5IW6A 2GHWB 3S8GB 3H3PL 1QFWI 5BXFA 4WCYL 3IDYB 1EDYA 1LEIA 1OD9A 3W38A 4YR6B 1YEDA 3OZ9H 3S36X 1Q9OA 2DD8L 2WXLA 4FCAA 1P53A 1OWRM 5BVJB 3DROB 5GGSY 2IALB 3WLBA 5JUEH 1CF1A 4LCUB 4GG6B 2Q2LA 3TYGH 5IBTL 2W1NA 3FCSA 3UG4A 4JVUA 1F58L 4JM2F 1K5WA 1CDGA 2EDYA 5I1DA 1TYEB 2NSXA 2XKNA 3NIGF 6PCYA 5D2NC 4WW2A 4ZFGH 2VZSA 1MZYA 4QRTA 3JT2A 5A2CA 3TIDA 1XGRA 2D73A 2W0PA 3DSNB 5HDBF 3QH3B 4BINA 3NIDB 4MJ2A 2YUZA 1ADQA 4HH9A 5J1SC 4NO5B 2WXKA 2X9WA 1OCWH 3FF7A 1GH7A 1WWAX 2BIIA 3EHBC 3LKQA 4IDLA 5C0FB 4JLRA 1H15B 5DFVC 4FI7A 2HRLA 3BUTA 4E5XA 1Z5HA 1R9FA 2WTPA 3U0WH 2WO2B 4WI6A 5DYOA 4FXGB 5LN4A 4GSDH 1E6OL 5F96H 1CFNB 3J27A 1PCSA 3QYMA 3IDGB 4N2LA 5B39B 2E3VA 4P2RD 3WN5B 2NUTA 5CZVL 1T66D 2HVJA 3C8DA 3K71A 4WV1B 3V0DA 5K1VA 5CEYA 3X12A 1Z3RA 3T0BA 5AVZB 3BN3B 3T3PB 4Z3FA 5IMOA 1F90H 2I7SA 3NIFE 1IX2A 3O9WD 3NCEB 4S1SL 2OMBA 3B3BA 5ADPL 2DH2A 3KYNB 3ISWA 1XF1A 3D30A 4G3YL 1QR4A 3CZFB 1NC2A 3P3RA 2QKSA 4JFHD 2Z8WC 2I60L 5EDXA 4YDVA 4FQJH 4NXSA 4BFBD 2VLRD 3UABA 1F6AB 2KHAA 1E6JH 5EZLB 2YGOA 1XH2A 2RGSA 1RIUL 5I1LB 1E67A 2CPUA 4Z3HA 3D39D 1XEUA 4X5PA 5DA4A 3KLAA 5I76A 1N0XL 3UPAA 5J6HA 5IQLA 5TGBB 3EKCA 2WQWA 5LGHH 5BRPA 3E2HC 1SBBA 1ORSA 3VI3A 4KO9A 5FWQA 2QPDB 4JHAH 4OI9A 4G9DB 3L3JB 4AKOA 1EGJA 2NNAB 3DDGA 5AVYB 1TYRA 4IBSA 5JIMA 1IC1A 2H2PC 3BPNC 1P5UA 3C87A 5LQBL 4TNWK 4BQ8A 3BH4A 2CO7B 5GJTL 5DHYA 2L7QA 5DI8B 1I3RB 4KNQA 2VXVL 4F15C 4XPBL 4ZNEA 3GSVA 4GXUM 1ZANH 3WTVA 1HOCB 5KVGL 2BFVL 4RX4A 3ULSA 2WXQA 1FI8C 2Q86A 3R8BB 1NCCL 1XV8A 5JHDB 2VIRA 2DL2A 2FDBP 1K72A 2CO2A 3UBXG 4BDVB 4GT0A 3WUWG 5ICUA 3MNDA 1OY3B 3SDDA 1WAAE 5C0NC 5IMKB 1HXYB 2PYFA 4P2CG 4W9IC 5IB3B 3L1GA 2H2PD 1FVDB 1TQTA 3QYNA 4PY8I 1F6LL 3AGVA 3BD3A 5ACMA 4N0UB 2VDKH 5BXFB 1LEIB 2YGQA 2P44B 3DVNA 3PWPE 4TOYH 3C12A 3O4OB 4BUGA 4RRPA 1A7RL 5DUMH 5K9OA 1L3WA 1QP1A 1U0QA 2QSQA 2R0KL 4RRPM 3H1ZA 4LBEA 3DXAB 3M1CA 4CSTA 1E90A 3SYPA 5IHHA 4JO4H 4FXTA 4K2UL 4QXTB 1UJTA 2WVTA 1NC2D 4KTYA 3P9LA 1YLBB 3QZWA 2N3JA 4M4RB 3BH8B 3FQWA 3ZYOA 4C4UA 4MA3B 2WK2A 4BE5A 4NRYA 3RWJA 1HZHL 2UUDH 3O9WA 1G9ML 5BMFH 3ZTEA 2XWBB 2AQRA 2E9WA 4XCCH 5JOPE 2Y1VA 1QLFA 2AJYL 2V3DA 2JTYA 4Z7UA 4YC2B 4P2RA 2O4EA 2H6UA 2WYIA 4LIQE 1HXMB 3EAKA 2QQKH 4DN4L 4XMPH 4FA7B 5CEXB 2EDJA 1T2QH 4XN9A 3BO8B 2YXWA 1PKQE 1EEZA 3HE6D 1CFTA 5C0EB 3QO0B 2XWEA 1EK3A 1Y7VA 4LLYB 4E42B 4YHYC 4KROC 3WIIL 3GI9L 3MV8A 3EJZD 3VWKC 5I75C 4CKQA 2G3ZA 2JH2A 3C6EA 2EDMA 4PCKA 4X5XB 1TG8A 2HFFA 4GMTH 3HFMH 4ZMNA 3GLDA 4Y4HA 1IE4A 4EUPA 2K9FB 4WU5A 2X0UA 1WFJA 4JPVH 2E7BA 3BEWB 1YEHH 4JFZL 3TBWB 1PD0A 2CSPA 4LNVA 4AH2B 4EE2A 1MFMA 3D4ZA 4P06A 5KVEE 4R5VA 5CP7A 1CS6A 5T3ZE 1RSFA 3ZL1A 2UXTA 1G4RA 4H8QA 4P23B 1HEZB 2LABA 1EO5A 5I2IA 3ECUA 1A0QL 4MZ2A 3SSGA 3ETSA 3Q5OA 5KYNA 3WEXA 3DX4A 5HD8D 2ZG1A 4Y88A 4OTXH 4CDHA 2XN9A 1FVDA 4PJEF 5E2WL 1AKJB 2FSEB 3O6KL 3J2PA 4LPUA 4ODTH 3VFTA 5TQ2H 3BP5B 2VXUL 4HHGA 4MTMA 1IV8A 5BVPL 3MUY1 1KIQB 5KZCB 3U30C 4FLRA 5BUGA 2QKIB 2WSPA 1BVZA 2Z31A 3DO3A 4A7SA 4BQ6A 1HL9A 4J23A 3PL6C 1UWGH 2AXWA 2D31A 5DHYB 3QZMA 2BDNH 3ZT5A 3TXAA 4GXFA 4WK2B 2C4FU 1J8RA 2J25A 2I9LA 3AACA 4P5KB 5KS9A 2I07B 1IZJA 3I9GL 3ILQD 4GAYA 1SVZA 5IT2H 4XPFH 5EO1A 3CX2A 1HXKA 3FRPB 3GZKA 3FU3A 1LLAA 1T6BX 2DAVA 4NHCL 1YMHA 4YXHL 1QA9A 2O6FA 2I69A 2NT0A 3ECWA 2FD6L 4OGZA 4XH2B 2P28B 3HE6B 5BVPH 1E42A 1CLOH 4H1LH 4U6YB 1WA0X 1MVUB 2C9QA 4KHXL 1NWPA 1CFNA 4MQ7A 5ECJE 4AYBA 5I1LA 3RIKA 3B9VA 4EVNA 3MCG1 3PQYE 2NUTB 3IGUA 1WGOA 3SDYL 1RJYB 1KELL 3LMJH 2C4FT 1FVCB 3QIBB 2C1OB 3CZSA 4A6YH 3VXSB 1INDH 1E43A 1PPIA 1MCSA 3QZWG 3SDXA 3R4DA 4HAFA 1YY9C 3SY0B 2CLRB 4EN3A 3FTGA 1VFAB 2Q8BH 2C7FA 2WAQA 4I77H 3RTQC 2G5BA 1ZTMA 2K7PA 5DZVA 4YHOH 3DX3A 4U05A 5GS0C 3W82A 1LYQA 4RRPG 2ADIB 1OTTC 4RGND 3FO0L 5CWSA 1K5NA 3L1FA 1ZWIB 4ORGB 3T4YA 4PJFB 4W6XB 4RQQA 3NAAL 3ES6B 4PM1A 2BNUA 4D94A 4Q14A 1XF2B 2LLNA 3IRZA 1ZGLA 1TZGL 3LY6A 3PDOA 4U0RC 1ZTXL 1BD2B 5G4NA 1V10A 4JLRB 3WIFB 1RD6A 1HIML 2PO6C 4IIQB 1OAKL 1X7TA 4XO9A 4JB9L 3CX5K 4ODXA 1UQSA 3K2KA 3MJGX 3L7EA 5C2BH 2R4RL 4HSAC 2VLKB 3IKCB 5CU9A 5LAXA 4WNQB 3F7KA 1QUNA 3KGSA 4WV1C 3NZ8B 5FO2A 5TE6L 2NW2A 4OZIA 2YIHA 4KZCA 1U8PB 5CGYD 2GQHA 5HHPA 4F9LA 3GIVB 3RWIB 4LOEA 3MBED 4GSXA 2WLIB 1EHXA 3B34A 3MHZA 4L8SC 3HUJA 3IAPA 4ZYKA 3SBQA 5K9KB 4MA8L 4EBQL 2YAFA 1MIEH 2ZXCA 4IRZL 4UQDA 4K55A 2J2ZA 2N7SA 1BOGB 1AQHA 3QXWA 4X5RA 2VR9A 3I02A 4OD3L 1N6QL 4FQCL 2VSDA 3IKKA 3D85A 1JJUA 4U7KA 2IBGA 1DQVA 3D2UB 1SXCA 4IIQA 4WKZA 5JXEC 2Y07L 5IJKA 3QIUC 2DEXX 4KRLB 4XXCA 1TFHA 1INEH 5LBSH 4UTBA 2KQNA 2B9AA 4J28A 3IE4A 4N3TA 4PLKD 2JKLA 3D4YA 2EDDA 2X5PA 3SPIA 3VFWA 3T0DA 3R0NA 2Z64C 3ETTA 5AAPA 2A73A 2CGYA 3SYAA 5EC1A 3S5LG 1E3FA 2BOLA 1XR9A 2WD0A 2I32A 4RH4A 3OKLB 3AWGA 5MEQB 4QRPA 4UNIA 3FXIC 3LZOA 5B39G 2A3TA 1TU2B 1UWFA 3V4LA 4RMWA 1P7KB 1QZ1A 32C2B 1DBAL 2NY0B 5DJ8A 1MH5B 3LN5B 4N9OB 2GJ6B 1FJ1B 3I02B 3N04A 5J12B 4XP5L 5TPWL 5DU7A 4KH2A 3U0PB 1XD1A 1SXAA 2PTUA 3FO2A 2AJVH 4PS8A 3PHQA 2Z8VC 1ACZA 3KGTA 3BAEH 4Q89A 3GUFA 2J56A 4TQPA 2ZKHL 1Z2KA 2LLLA 4Z7WA 3TJEH 1SEBB 1RJZA 4AUYA 4YLBA 5HXMA 2V7HB 1I9EA 1XF5A 4AQ8C 3M1OA 4QCIB 2YPKA 3QHFL 2J8OA 1XD0A 2H6PA 3ESPA 2HT4D 3RL2A 4OCWH 5HHQA 4QRPD 3ZDZB 4IOSD 1QATA 3W9EB 4K3HA 5EEVA 5GGSA 1JD7A 3F5WA 3KZ8A 4UQ2B 3Q6FB 3F2LA 5E6UB 1YNLL 4MJHA 1LD9A 1KEML 2XA3A 3SGEI 4GMTL 5I8CB 2NMSA 4UQBA 4HYTB 4XX1E 4JDZA 4LSSL 3OL2A 2FJGB 3HPJB 2I9LB 2H1XA 2CJUL 5EU5B 5C2BL 3L4UA 1UXSA 2X3CA 4JFEE 3ZZLA 3HBZA 1J0IA 3RWGA 4A7UA 1VFOA 1G94A 2H26A 3KPSE 3QORB 3S88H 3LKPB 4PG2C 2QVKA 4NWTL 5FM5M 1F8TL 5CZKA 3TFKC 5CD5C 4JVPA 5AOJA 4Y5YB 3S2AA 2MFNA 1FFNA 4HXAL 5AW6B 1X6LA 5TDPA 1U21A 3I50H 5HDQH 3FU9A 3ISRA 4R97B 2Z4QB 5L8LB 2A6IA 4KAQL 4E68A 2DBJA 1H6TA 4G5ZH 3VD7A 1N64L 2DM2A 3MLZH 4WI9A 1QFWL 2BSRB 3TWCL 4OUOA 4R26H 2JJUA 3WIHL 3SGJC 3X14B 5LGHL 1MFDH 1AXSB 4DKDC 4W9EC 1URLA 4LF3A 1FNLA 4N8UA 4RFNB 1JNLH 3WIHA 1PTZA 2DM7A 3UBFA 5IESH 4EZMA 1BD2E 1SYVA 5TK4A 2ZT9C 4XPGL 4D8PA 3WKNA 4WJKB 5ELIA 3T6XA 4NHUA 1H5BB 4PJFE 4N2HA 3TYGL 1ICTA 1JPFB 5CR1A 1UHVA 5CJOL 4AIZB 5I1JL 3SDDD 1T7VA 3TBYB 5EF0A 5IMLA 5IUCA 2WQRA 3HN8A 1HKLL 1KJ2H 2OSXA 1MRFH 3GGWA 3IJ7A 3GO1H 1I82A 3FQTA 1L9RA 2NZIA 3ATEA 1PFOA 3E3QC 2RTTA 4F15B 2APTA 3MNWA 4Z78B 1QQDA 3L3IB 4NPYB 3ABLB 1VFBB 1GJIA 2HG0A 4AMWA 3TVMA 1RP8A 1JMXA 5KN5A 5GJSH 2Z1KA 4M7KH 4H8PA 1U58B 5FYLH 2XTLA 4Z7OB 4G7YL 3C5SA 2LW3A 4GSDL 1OGAA 1TKWB 1WD9A 1JI1A 5IQ7L 2LV4A 4LVOB 4Z9KB 5HY9B 4IBTA 1AGFA 2VAAA 2IH8A 3CSTA 1RZ8B 5C07B 4HWUA 4HA1A 3LD8C 3U6RB 4NZTL 1BIIA 3VGEA 3ZDXE 4P9HH 3SPVA 4G8FA 3W5NA 3IGAB 3G08B 5SWQB 5EOCJ 5AD0B 2EYSB 2HRPL 4A04A 1Z9OA 5I15H 1AZVA 4JQXA 2OYLA 5K9JL 1T4KB 1OTSD 4PW9A 1SLWA 2XXGA 3UIZA 1TTAA 3MV11 2F1EA 1EX0A 3HR5A 1FFOB 4EKXA 5FYKD 2VTFA 3OKNA 4F7TB 2X6UA 4I13B 1V7NL 5AVQB 3QAZC 5DMYA 4N1EA 4MA1C 1D6VH 2Q7YA 1GVIA 2ZXEB 3NZ8A 3CSFA 1I8LC 4HX1A 4KH9A 1F58H 1U8PA 3L3OB 5HHPB 2HKFH 1R5VB 5HJBA 4UMGA 5C0GA 1H3TA 3ARYA 1QX1A 2FUQA 2BVQA 5IV2B 1HYSD 3BDYH 3VH8B 4LP4A 3X1NA 2DM3A 4MNQA 4NPKA 2ZOKA 4I2XE 1EXHA 1DE4B 4N2MA 1JZ3A 3KS0H 1VKXA 3VD4A 1A3ZA 4LQ1A 3TPUA 1R3LA 2IIJA 3HFML 4GW4A 4O9HL 5I1GL 3U46A 4NRYB 2GCYA 3LEXA 3Q9PA 5FK9A 4ORGA 4PJ8C 4B3VA 3QT2A 1CUOA 3PWJA 3ES6A 3B5TA 3UAJA 4WFHE 2MHAA 3NCJL 3OKMB 2XWCA 2ZUTA 4GRLD 2WAHA 1QI5A 5FUZL 3CSYB 3FRPG 5CBEA 2LTQC 3S6CA 2DM4A 4B9ZA 5J8OA 4ZUWA 1TTRA 4PIBA 1H3WM 4FQHB 1AJ7L 4KFMA 3EJUA 4MJ5B 1P5UB 5DZNA 4CAGA 3MLXH 2Y36H 3FB8B 5EPMB 2ADYA 2GTWA 4LFHD 5AKSA 5BS0A 4TOYL 1EMTH 1OPGH 4XVTL 3WE6B 3L9BA 4ZFOL 3WN6A 2R2EA 4PJAA 3DETD 4O02L 1KNOA 4CU7A 4I4WB 4UTAA 1NGXA 2H1PL 3FTZA 3QUXB 1Q1PA 4DAGH 2ERJC 1HWWA 2CO1A 1PAZA 2YOAA 1KNOB 3QC6X 1J8HE 1B0GB 1GOHA 1IBGH 2XQBL 4NAJA 5HHXL 4TULL 3U36B 5GGRY 4XP1L 1N59A 3UOAB 1OGAD 3OPZL 4BQ9A 3NJMA 5TPWH 3IMBA 2XN0A 5D5MA 4PJHF 5EUKA 2ILLA 2ITCB 3NA4A 3H9HA 4KPHL 5C0FA 5I1KL 3PABB 3WFDL 5D5MB 1Q72H 3OTTA 1TEFA 3MV9A 2X1QA 4R4FL 5HHOB 5DLLA 2FTAA 2D7NA 2XG5B 4RWHA 5IF0A 5DRXA 4IBZA 4B0MM 2CM6A 4FCHA 3EYSL 2QQKL 1C8PA 5I0ZA 4G71B 4PRAB 3TCXA 5I73B 2VLMD 5F3HA 1A7NH 4PRAA 1MCPL 4FQ2H 3PXJA 5FDWA 4GAJH 3HZYA 4PJBA 3NPZB 4X8JB 5GS2H 4JRYA 2VDPB 3TJHD 4P4KD 3RURA 1VIWA 3B7RL 1T5XB 3CZEA 3KPNB 1UG9A 2VSCA 5EEZA 3HHRB 4E9RA 5KVDE 1B9KA 4WFEE 1YMMD 1JF1A 3PWNB 5EF1A 3WHE0 2MMXA 4NNXB 1KCSL 1RFDH 2A6DA 2FZ3A 1D5ZA 3CDCA 3MBXL 4O51B 1BPLB 4IRSB 4HZAA 2VABB 3EF4A 4LESA 1VZIA 3VYNA 15C8L 4ZUWB 4MCNA 2CIKB 1FZOA 1FIGH 4JCMA 3PGFL 2BVPB 1RIUH 2I27N 3BJ91 4L0PB 9PCYA 1RUAH 5F9OL 5E2VH 2FO8A 4IOFC 5IG7B 1IU1A 3D08A 4JFED 4IIZA 5E9DA 1KENH 4L8SA 5IBUB 2OMVB 3MRBB 5JPMB 2GBUA 5CCKL 2EVGA 1H3GA 3DI3B 1QFUL 1UM5L 2CU9A 3KBPA 1LP9E 4GSRA 2H8PB 1EHLH 2Y7SA 1GHFL 2KS0A 1J1PL 4LCIH 5FO7A 5JMOC 5I2IB 3S37H 1XGRB 5JTWA 3JWDH 2VAAB 1ZEAH 5MEPB 1UWXH 1ROCA 3VSVA 3JBG7 3KNBB 4ETQA 1DN2A 2VXVH 5D1ZB 2Y5TA 1B2WL 5KW9L 3OGOE 4ZX5A 1YNTB 2ZP9A 3LZFH 4LSUH 1WT5A 1QQDB 5FF6B 3BP5A 2DYSB 1YYLH 2R59A 5B8CB 5E8DH 1M71B 2BWQA 3EO0A 4X99B 4LLYA 4E42A 1VSCA 3MI6A 1CGVA 1N0XH 2WNXA 2D7TH 5EUOF 2P49B 2WXGA 4IK7A 4BZ1A 1K4CA 1UM4H 2VLME 1INDL 2FLRT 1WCBA 3E6HA 2OZ4A 1TCMA 4FQJL 2A77H 4RGMB 2HG5B 3NIDE 2V17H 1T2JA 2HN7B 5IR1A 5EU4A 5HVFB 3M1BB 4LEOA 1WFMA 5D4QA 1KBKA 4PS3A 1I8MB 2A4CA 4G8GE 1VJSA 2N1KA 2GBTA 1UEYA 4AK2A 1A7QH 1A1MB 1SY6A 3NFSL 2XNAB 2VIRB 3NRFA 1S46A 1BW8A 4U1JB 4RGNC 4YHMH 5JIQA 2VJ0A 2ADFL 5F7UA 3EH5B 3MBEB 5HYJA 5GHWL 3TN0D 4ZMZA 5CEXA 1C1EL 1NOFA 2YPLA 1C16A 3V52H 3EBIA 1WBXA 3BOVA 1KDJA 2O5ZH 3UEQA 1BHGA 1BLIA 1YY9D 1P4IH 1S7VB 3DGCR 4LSVL 3X3FL 1DEDA 1BQHG 2OMVA 1A7PL 1EAPB 3OLIA 2V17L 3RVXD 5FECB 1J1XH 1GSKA 1QSZA 5CJOH 4XAWH 4XN7A 4BCYA 4JRYB 3GIZL 2B77A 2YEZA 3QJTB 3EJCA 2XOTA 2WLHA 2X6AA 3IDXL 2WWNA 2NX5E 2VISB 3EBGA 3GRWL 3CZNA 3O3EB 3H6JA 4JHUA 4NO3B 3QR1A 2HJFB 4PJAB 1W9XA 1NGZB 4ONHA 1JPEA 3UMTA 3QHTC 5MHSE 1G7HB 2NZ9D 4JPVL 5TQ0H 3ZKSD 4I5BB 4JKMA 5MENB 4JDVA 1FFPA 4AK1A 2KLSA 1SN5A 3Q8BA 1KB5L 1IKNA 1LILA 1A5FH 2UZXB 4A2EA 4PIRF 4WO4C 5DJXB 25C8L 4W9HC 4OZ4A 4QRRB 1PJWA 1YC7A 1NEZB 5DMJB 3HPLB 3PL6D 2XJLA 1AIZA 4X9HA 43CAA 3N91A 2VW7A 5F8RC 4ZDHB 1ZVYA 1QMUA 4IYKA 3FC8A 1IAIL 1M53A 1MCQA 5FW6A 3MRCA 4HJEA 2W0KA 3F6LA 1THAA 3EH4B 1BEYH 4HF5H 1NGQL 1WIOA 2R2EB 3U1QA 3KPOA 2Q76B 5HI4C 3MLTB 4YFEA 5JORB 3HI6H 4WEBL 1U8JB 3R0MA 5AL0A 4XTRD 3M88A 4NQXA 2ZE0A 4TUKH 3TPUB 3KHQA 3QQ9D 2CO3A 4N68A 4FNPA 1FLRH 4MB1A 4APQC 2EEFA 1THCA 4XP9L 5BV7H 1KN2L 1YECH 2DQFB 1OTTD 3V0FA 1IBDA 1WBZB 4GKZB 5EZJA 1LO5B 2E9BA 3D3VE 3NQKA 3T0XA 4KKQA 1NANH 5DJDB 2JNZA 3PP3K 4MB5A 1XSOA 3BVTA 1CLZL 4P46D 4OLVH 4BZ2A 4QKTA 4F27A 1DBKH 4PJDB 4BFOA 1KCVH 2AABL 1OEZW 4WNQA 4ZTEA 1T7YA 5I16B 4E41D 5E23A 3VXQA 4M02A 4NO0B 4NNYB 2GEQA 1WZ1L 1ZT1B 32C2A 5DJ8B 2DIBA 4HEPG 1Q9OB 4XNQB 5K39B 1LHZA 4AQOA 4PV8A 3MRRA 2I5YL 1N7ML 2YZ1A 3L2LA 3BWZA 4JJ5B 4N8CL 4FFVC 4IMKC 4IBQA 2XZAH 4P4RB 3MLRL 1C8QA 2OPCA 3CSGA 1NLDL 3RLSA 5EN2B 4JPKL 3KW8A 3VXSD 3DYMA 2VR8A 5EN2A 3RVVC 4AL8C 4CN4A 1E0OB 1ECZA 2C3XA 1ET7A 1P4BH 2FATH 2HH0H 1ADWA 4X7EC 3TTYA 4YX2H 1CFBA 4WTQA 3LKNB 4IBUA 4TQHA 3HS9A 4WWKD 5FHBH 2MWCA 2VLJD 3FOMA 3KWVA 3VE0A 4UM9A 5I6LA 5L6YH 1E4KC 2EUXA 3NP3A 3K6FA 3HNVL 2MIZA 4FNLH 3L8QA 1N4XL 3IFOA 1MUJA 5KVGH 4IOIA 1U8LB 1VB9A 3FN3A 3NFNB 4X42A 4YO0B 1VACB 5E6RB 2B1AH 1KGIA 2HVKB 1ED3A 1OAYL 4B95C 2C26A 1GYWA 2A9MH 2XKNB 4H20H 5FR3A 1ZLUK 3FTGB 4E9LA 2FB4L 5KYUA 2Y3AA 3RP1A 4YBQD 4WGVB 3RFRA 2YN3A 1N3NB 5B38B 1X5ZA 1P5VB 4N0CD 2VN5A 1AO7E 1KFAL 3AXLB 4Y4HD 3T8VA 4TVPD 2E76C 5CF3A 4KHXH 3ARBA 2WOBA 4NWUL 3SODB 3UBXI 4YQXH 1MVUA 4MQ7B 4Q6YA 3ZMRA 1G9NC 4UT9A 4PGDB 2A6IB 3VXNA 5F0PB 4E41B 3WN5C 1WF5A 2ZONA 1DLFL 4W68A 4HBCH 4KITB 5MI0C 3VJ6B 1SOKA 3QPQD 2VUKA 3I2CH 1OB1B 3DUSA 3PHOB 1SLUA 3ARFB 4HFUH 4XXWC 3VB9A 3QDJD 3C5SB 1SYVB 4RMTA 1DVFB 5ID0B 2FJHA 3RX5A 4G80A 4R4BB 5DGQA 5KS9B 4LB8A 1NAMB 3S5LA 1TUPA 2QTVA 2F7RA 4QXGH 5H4ZA 3OLEA 2FLMA 2YRLA 2VWEE 1DCEA 1EUTA 4ANUA 5TH2A 3BLBA 4UQ3A 1YUHA 4YXLL 4PYHA 5FXCH 4JFFB 2VN6A 3MRDA 1WS8A 1BQRA 4PJCA 1OSPL 1LNUA 1B0RA 1QFWM 5DD5L 1I8IA 4GW1B 3K5RA 2E7DA 3RIFF 3AY2A 3OD3A 4JFDB 1YQ2A 4X4MA 4TUUA 3GRGA 5FYLD 2BSEA 2IAMC 3OAYK 1WE5A 2DBLH 3PHOA 4TVSa 5GIRA 4EIBA 1NAMH 3UP1A 12E8L 1OXYA 5I1CL 4OZGE 3OR6B 3QUGA 3D06A 3QPQC 4NIKB 3GZPA 3NRPA 5IVOA 1XCQA 2L0DA 4CVXA 1U3HD 5D70H 1A4BA 4IQHA 1LP9F 5E56A 2FJUB 5IHWA 4YXLH 4N2OA 1QI3A 4UAOC 4W70A 1N4XH 3IB4A 1LE5B 2AZUA 4Y9EA 4ZX6A 1AZUA 3PG2A 4ONHB 3OHXB 2E6JA 1KPVA 4ODHL 2VR7A 5F7LB 1J9TA 1WZKA 1A22B 2A99A 3M1BA 1UWGL 1MF2L 2UVEA 1CQKA 1ORQA 5CSGA 4MA3A 4BELD 4JM4L 4Y4HC 1TQUA 3REWA 5FOBA 3NSYA 3HJEA 4NJ9H 4PTUA 2VITB 2QADC 3CV5A 4OFKA 2EDOA 2UWEA 4YBQC 1ZS8A 4EQ3A 4GXVL 2WZ0A 4G72B 4XMLL 2WLLA 2LVEA 3C6LD 1CC3A 3VFWB 4Z7UB 1HZKA 4NZDA 4TVUA 2QHLA 3SKJH 3ULUL 1BBJB 3ZGIA 1CFVH 4C56E 3NSDA 3A4EA 4MKMA 4XAKE 3IPFA 4D9RD 2BIPA 3N41B 4LCVA 3NJNA 4M8RA 1MWAB 2BWDA 3PGFH 1F0LA 1IEHA 1G7JB 4UB0H 1ETZA 3MLVL 1T1WB 3KPRB 3OSVA 4CJ1A 1O6SB 5KTEL 3QRLA 1P7KA 5HHQB 5F9OH 1P4UA 4FQQB 4ZXBA 2D0GA 2PLTA 1HYSC 4WUUB 1XGYL 5CEZE 4FG6D 5D8JH 4C4KO 1S9WB 1IC0A 4ODSH 4WUUA 2YPVA 1TO4A 3JWNG 2V0AA 3KH3A 5D2LF 5KSAC 3PIQB 4YHIB 1PKOA 5DSCB 4ELKA 5JOFA 2Q86B 2Y24A 1RUQL 3BUDA 1E9OA 5JO5A 4FMFA 2IAMB 1LP9B 2N4IA 3KPQB 2X53A 2LAGB 4MJ4A 3PPEA 4P23A 1KTDB 1MLCA 3F84A 4YNYA 5TF0A 3BGFB 5DRNB 4O00A 3T77A 1F4WL 1NLBH 4OCMC 3O0LA 3GHPA 1FBIL 2PYEE 1MFVA 3IWUA 5EOTA 5SWSA 2JCCA 3IJ9A 3K2UH 1MCOL 4FQLH 3J7HA 4KUCF 3MC0A 5MI0B 3W81A 4QRPB 1XBRA 4L18A 5C0AB 2XFXB 3ARGB 3MU3A 1RKRA 4I1NB 5F9WC 5D6DA 1PMYA 3EYSH 1XGPA 3BMWA 4Y0GA 3BP6B 1ZLVH 4HJGA 4J6RH 4L3ED 2FBJH 3GJEB 5CGMA 4DOHE 3JTSB 1UJ3C 4OCXL 4KXZI 1EDQA 2YMXL 1CLVA 1NDGB 4C54A 1KBGL 3GZOA 1LQSR 5GZNA 4FABH 1X7QB 1OAXH 3UFIA 3L95A 2F7QA 4HIXL 2NUPA 4U6HA 1U3ZA 2YMOA 3AXHA 1BZ8A 4ES9A 5INDA 2P5EE 5GGQH 1CVRA 1OGTA 1JF1B 3PWNA 5FGSA 1CI3M 3P0VH 2YSSB 2ESVE 2GHZA 1FH5H 4HFWB 4PJ6A 2EVFA 3D0VB 3WNOA 1PX4A 4JG1H 1IMHC 3H9SE 4HKJB 5GGUA 5KSBF 4HGWB 1JGEA 2IDTA 3KPPA 5J1AB 5HGGS 5MERA 5GRVK 4PJAF 4C55A 4U6YA 1OPGL 3GNML 2Y1YA 5FDWB 4MJ6A 3ABKB 3QFDB 5D7IF 3VMPA 4I87A 4HDIA 1M3IA 3EFDL 2CK0L 4X6CB 5HI3C 5LCVH 4F9PC 3DV4B 1P7QA 2D3NA 1ZEAL 1ZLWK 1A7BA 2X41A 2ZCZA 2D9CA 3WLWD 3FT3A 4N6QA 2WZ6A 3GK8H 3QUYA 5D1XD 2NXZD 3BN9C 1NWOA 1A8JH 5JZ7C 3LNGA 5F2FA 2OMWB 3KE0A 2P24B 3ZKMC 3CVCA 2IEPA 4QTIL 4PJDF 1W6WA 3OMIB 2XSKA 5CJQH 4JRWA 5BS0E 1JMZA 5BQDA 5E70A 1UOVA 2X6VA 4I0PA 1EBAA 5EOQL 3LKQB 1GTFA 5L88L 1KGCE 3U25A 2HFGL 3FSWA 1D3CA 1OARH 1NCOA 1UEMA 4FKKA 1G1OA 5SWZE 4QJ4B 1OAJA 1RZ7H 3FB8A 1GZQA 5GSRB 1CYWA 3KPSB 1RUMH 1NC4D 2GYSA 4FFTA 1CIDA 2O6EA 4L4VB 4HOMA 2W9DL 3FQUA 4MAYD 5DR5H 4Y4FB 5H94A 2B1OA 2AEQL 5IMOB 4PJ7F 5EBLB 1SY6H 2F19L 2CHZA 3P4NA 2QVMA 3ATAA 2VISA 2AEOA 4YLQT 4RMQA 1NDMA 5TJWK 3PXHA 1E4XL 2EDXA 1B0GA 1P6WA 4NQEA 2DW5A 3ASNB 2C1PB 5F44A 5C7XH 4GW4B 1B4LA 1MCNA 1XF3A 2MKLC 2DYPB 3IXAB 2ERJB 4MNQE 4NM4H 1NGYB 3AITA 2W88A 1BG1A 1QI4A 3HAEA 4PRHE 1IKFH 5C0BB 3SDDC 3UYOD 4G8EB 4B0MB 1SYSB 1OQOA 2G0LA 3LV3B 1QSEB 2EDRA 4AVJA 1UD5A 4MAYC 1NSNH 4AT6B 3P4LA 4ICWA 5IV2A 1GHFH 3CFEB 5E00B 2GITB 4ABQA 3ZQ9A 2JJSA 3AU0A 3KAAA 5DWUH 4PS4H 5AOMA 3QIBD 4XZUB 1CU4H 4DCQB 2AJUL 3F7YB 1O6SA 3VMNA 3BH8A 3FQWB 1NCUA 3EBHA 5FK9B 4OF3A 4A39A 5A2KH 3KNBA 4KVPA 4BV1A 1E7VA 2DQHL 1AXTH 1D9KC 4QKXB 2A1WH 1CFQA 3EGDA 4GAGH 1YZZA 1HL5A 1Z9LA 5CHNB 3UAAA 1BEXA 4PJ9C 5D1XC 3BYYA 1D5XA 3BRFA 1T89A 4R0LC 4AXWA 4JFQB 3DIDA 4P5MB 2DKSA 4N3UA 3ZN6A 4OI8A 3F65A 3RY6C 2IC2A 4EEEA 3VU2A 4K15A 5LNDA 3WHXA 3D0LA 5A2IH 1FL6B 5HHNB 1NTDA 4Y4FD 1NFIB 4ATTA 1RAMA 3EFOA 5JW4N 2K8QA 4KI1A 3DPDA 3O6FD 4MJJA 2X09A 3VWKA 5C0IA 3FFCB 4ZQKB 1J8KA 2GUOA 2LR4A 2J6EH 2QQLH 3HN3A 4AQ1B 1MVFA 2PTTB 3W1ZA 4XWGL 2NY5L 1SZNA 3P9MA 5FO7B 4ZSOE 3VD0A 1LO0H 1CDBA 1D5BB 3GSNL 1YDPB 2SEBB 5EU6B 1WIPA 5E1HB 3WAKA 1Y07A 3SGJA 1DL7L 2VDPL 3T2QA 4JRXA 4TUKL 2IFGA 5EU7E 5K1NA 4PLJC 3U79A 3REWB 4P5SA 3TC9A 2VSKB 1JPSL 4FZEL 4J1UA 1E27A 2R2HB 3WS3B 4JFUA 1HHGA 2BVEA 5EZPA 1ZDQA 3GS4A 1R6VA 3TJHC 3V7AE 4MXVE 4ENZA 4ESKA 1OLZA 4HT1H 1E9PB 1S8DA 4K2UH 4KJYA 5T3XL 2X10A 4KJWC 5DJAA 2QPFA 5HI4D 3DX7B 3MUHL 1FV1A 2VC2B 3KPSA 3GRBA 3HNSL 4JPSA 5DI8A 5I19L 4LHUD 3T65B 3WUWB 1U3JA 3BZDA 1F3JA 3QB7C 1YO4A 4EXKA 1Q8MA 4HUUB 1U8CA 1KXTA 1OE1A 1I7TB 5E51A 5ERWB 2WQ8A 5D7EA 3HPJA 2BNQE 5KYYA 1BD2D 1G84A 2OJZH 2W0FA 4AIXA 3QWOA 4OQTH 3K81A 4JE0A 4K9JA 4PJ5E 2EKSA 1OPOA 3O2DA 3ZE1F 3P11H 5HHMB 1T22B 3SE9H 3GMMA 3KLAB 2VAJA 4M7ZC 3LDBC 1L3NA 1IBBA 5TDPB 2I26N 1JG9A 3BKYL 2VDNB 3FFDA 3C6SB 2VDOL 4WZ9A 3W2DH 5DFAA 5LLIC 2Z7UA 4OZFG 4JM2C 3HZKB 4Y2DC 1RXLA 5EEUA 2H6PB 1EXGA 3NBNA 2V7NB 5JNYA 4IGBC 2HJKB 3S3JA 4U1NB 2ORBL 1EHNA 5ADOH 4PRIE 4U1HA 4XVUD 4LKXB 1ONQB 5DMGD 3QNXB 5EU6D 4P2OB 4B9JA 4EN3C 3NIDF 1WGVA 3TN0B 4XCCL 3DOHA 3HG1A 4IJ3B 2WINB 2PO6D 3WSQL 2GUYA 4ZG1A 4WW1A 4A2LA 4W6YB 3MJ7B 4PJCB 1AJ7H 3BSZL 1QNIA 3G5WA 4XN1A 4UT9L 3FQNB 4M48L 3UG3A 1OGTB 4YHLL 5IMMB 3VE0B 1KCUH 2AANA 1M1SA 3VTAA 3KLQA 4NQDD 3REVB 1WHPA 1QSEE 5C0CD 3HC3H 2ZWNA 3Q48A 4D2NA 1UZ8B 2VN7A 2B15A 2BO0A 4OIBA 1WEJH 4FI6A 1JFQL 4PJ8A 4HPYH 3L3DB 4TNWF 1EDHA 3RNKA 2I7OA 4OFYD 3HJ0A 2AXFB 3WU1A 3NFPB 4TUOA 2ZPKL 3T0EB 4FTVB 1T03L 4XP4L 5K39A 1CD1B 5L4MA 4P9HC 5I1AB 4PB0L 1RU9H 4YE4H 5D8JL 5DZJA 5FM8A 1D5RA 4FQXC 3RGVB 5BRZB 2BP8B 2AFNA 3CDYA 3WKML 1ILSA 3A6BH 1JHKL 1BOGA 4XBGA 1CDHA 1MWAL 2FX7H 2XZQH 4KKCD 5DD0H 3WNPA 5EIIA 3RFZC 2BP8A 3H4FA 3AG4B 2FWSA 2PPCA 4IEFB 5D7LA 4PJHE 4YDKH 2MJWA 2B5IC 5T3XD 5E2UH 3JQOB 2EUVA 3FUKA 1E4HA 5DFWH 2IH3A 5CJ5A 2E7HA 1L5GA 3BQUD 5EBWA 4MHHG 1GC1C 4OB5H 2LU7A 4ZSOB 3F7VA 1U8LA 1KOAA 2OXGA 3A6CH 6FABH 4OH2A 2HJKA 1T1WA 3LVTA 1BWWA 3GQFA 2NY3B 2VDMB 3D2TA 4FTDA 4XNQA 5DDHB 2DLIA 3ZE0B 3DX6A 3MBXH 4WHTB 4P46B 5EU6E 4DEUA 4Q0XL 3K80A 3RUGA 4LIQL 2GJRA 2OMXA 4ZMWA 4L23A 4WW1B 2NNXA 2AC0A 4J5VA 4G9FD 2VDLL 4Q56A 5HP5A 1HH6A 4TMPA 1RZJL 1JGUL 5C07D 3TA3D 2ZF8A 5D4HA 5T1LB 3I75A 1A7OL 4NQUA 1J7VR 1CO1A 2IOIA 5IGXL 3LIZH 3ECVA 4KXAA 2H3KA 1GGBL 5AKTA 4WWOA 4QRRA 1KCWA 1EERB 1UZ8A 4LGSB 4PRIA 5BZDB 3PABA 3IDMB 4PJ8B 2X70A 2MOQA 1INEL 2W9EL 3B43A 5LBSL 4A37A 3ZIYA 2C1OA 4QHMA 4Z8FH 3HZKA 2OKMA 1KN4H 2QMKA 2H3NA 1DJGA 2LU4A 1ZS2A 2DWEA 1NBQA 4OJYA 2C3HA 1GKEA 3RGHA 4G83A 1AI1L 1CTMA 3H3KA 1V27A 2YQGA 1E8ZA 4AIEA 5CU5A 1QVOB 5F0MB 1SXSA 4NAQA 2OL3L 4KROD 5ANMA 4IHOA 2FR4A 1A6PA 3CNKA 3K4ZA 5FV1L 2OLDA 1L7TL 3DJZA 1HAUA 4Y19B 4M3KB 1JNNH 1WBZA 4GKZA 3D05A 1YEJL 4WFGD 5ERWA 2QVFB 1X5HA 4LSTH 3FRPA 3T3MF 3I6SA 1NQBA 4M3JA 3LEVH 1AGEB 3WNLA 4QRRE 2QGDA 2EQDA 4Q9RH 3D18B 1UT9A 5AZEL 2OI9C 5DK2A 4KO6A 2H0EA 4KJYB 1KCKA 2F9BT 3VDAA 5D7LD 3OM3B 4E5XG 5A2FA 4JFXB 1RU9L 3VFTB 1OCRB 2GSGB 1NCTA 5FHBL 4NNPL 2HT4C 4G6AC 2P5WE 1SN0A 4I0CC 1USZA 2HX8A 1U9KA 2M26A 4K3JL 4PG9B 1LEKB 1I7TA 2XQYK 3B37A 3FT3B 3QK0A 1F11B 1SJXA 3DX2A 1H8LA 3P9MB 4XNAA 3FH7A 5F88A 3RA7H 2X4UA 4G1EB 2YD1A 4PRBB 5HSFA 2D7MA 4QGTA 2NY6D 5CGTA 2Y7OA 3ELQA 3L5IA 2OJEB 4FXKA 5AWNL 4JQIH 2JCWA 2IWGA 1SDDB 3AU1B 3RZCD 2K6YA 2CWRA 3GJFK 4NC1E 4PJ8D 3LPPA 4U1KB 5ISZB 1A1NB 2YRPA 5FAAA 4XNDA 1H8OA 1XGTA 4MMXC 5C0AA 3V95A 2PPAA 3SBRA 4X8GA 2VXQL 1J05B 1J5OH 4GW5A 4MS8D 4F7MB 1DFBL 2ICWI 2IDQA 5DEFA 3DSFL 4L48A 4MHHI 2CJSA 4F5CA 4JREC 3WKQA 4FLQA 4Q6IC 3QG7L 4EOWH 1A25A 1A7OH 3MJ8A 4HFUL 5TTRA 1JPST 5BRQA 4RISH 2ZG2A 4JN2A 4J3BA 1ZSDA 4YHIA 5JXED 2CJTA 3RWJB 4R3SA 3JVFC 5GSVA 5HBBA 1XZWA 3DVGB 4GS7C 3QWRA 2F54E 3WJMB 4NUJB 4BKTC 2DYPA 3IXAA 4BSVA 4DZ8A 2YJQA 3PJLA 4EJ1C 5KYXB 1FRGL 5EWIH 4HJIA 1EZUA 4NQTA 2TSBA 4UILL 2HT3D 3KM1A 2HWZH 5FGRA 3CC1A 4WI4A 4AEEA 4L4JA 1ZIBA 2E4FA 3BP7B 3C08H 4TPRL 1I4FB 1FZOB 4U0QB 5AVUB 1U93B 1BF2A 4K94C 1GZPB 2F7IA 2ZWZA 5KAQG 2GSIB 4AVIA 3WCYA 2ZSWA 2OCFD 3CPLB 1PZ5B 5D55A 1RSYA 2CNYA 4APXA 4BD4A 2AEQH 1MG3C 2PXYB 2XG4B 1ZA6A 3MODL 3T3ME 1B88A 2DMCA 1DVFD 5BJTA 4TULH 5IJBC 1WH0A 1E4XH 2ZQKA 2Z91B 1TSHA 4PD4K 3PS6A 3CHSA 3LRLA 2WBJD 2ZWLT 2YEVB 1QSFD 2IMMA 2VXTH 2CDEA 2OBGA 2P80D 4XVSL 3ARDD 4UQIM 4WENB 4GMSH 4JHBA 2BZCA 4XO3A 3SD2A 2PP8A 3BXNA 4YEEA 3QQ4B 3HS8A 3QNYA 3QCVL 4HIPA 3Q8CA 4ZPVB 4MX7B 2FX7L 2XZQL 4PJGB 4X9YA 3ULVL 5ESAB 3SQBA 1AGEA 3AWEA 3V5DA 1PD6A 4FFZH 1KTLA 3PGDA 1N18A 4OD1L 3DMMA 3O41B 3FONA 2E47A 2YARA 4QHNA 1MXGA 4WRLA 1KB3A 1KJVB 1XZ0A 3LV3A 4OLWH 3RPKA 1MVYA 1MCRA 2ZPKH 1KG0A 3CHRA 1O9ZA 1OAKH 1DVFA 1A6UL 1NZRA 4PBXA 4N8CH 2HKHH 3I84A 3PF2A 4F9LC 4K73A 2VM3A 5IB4A 4YSTA 5CKAA 3CAFA 3JWDC 2AW2A 3CK0L 4DERA 1PEZA 4NQVA 4J3WA 1E5ZA 1P1VA 3N1PC 1YUHB 1MRFL 1DQLL 4ANXA 2ARJB 5JHDA 3IMRA 2C9PA 4GG8A 4H2AA 3NP4A 5F88B 5EO1B 1Q4NX 4EZKA 1CE6A 1YSOA 4YK4B 3VXRB 5KVDH 4UIKH 4XBEL 3WFBH 4Y7OC 2F53A 2MSPA 2JELL 3ARGD 4S1DD 4B3EA 4H8WL 1MY7A 4TVPE 3K6SB 3H9HB 4U2ZA 1ZK9A 4HKZA 4DPBX 1FE8H 3Q1EA 2IV9A 3AAZA 3O8XB 5A6LA 3D3VD 4MQXD 5GGVH 5JUEL 3HFFA 5TGBA 4DTGL 4K9EC 1OAYH 1BPVA 3E8UH 3FTXA 2OJ1A 4Z7VE 2BVOB 4O58H 4BFNA 4K7PH 1JIBA 5IFHL 5T3ZH 5FFLA 2VRKA 2KLTA 4NZ8A 4NI3A 4WU7B 4JL1A 2WOYA 2O30A 2ED9A 1X9QA 5F3HB 5D1QA 3H9YA 3MJ9A 4MS8C 4PJDE 3BWAA 3W2DL 1FPTH 7CGTA 1VKXB 4I1RA 1HKFA 2WNGA 4DEPC 5FLVA 2Z91A 3I9IA 3O11A 3S97C 2EDNA 4BH7A 1NCDL 1TJIH 2V2XB 3APNA 4AQEB 1XIWB 3IF1B 5D96C 1ZRUA 2ORBH 5HD8C 4M61B 2O1AA 2P5EA 5TF1H 2DQMA 1FO0L 4OGYH 3RZCA 3H7LA 3VXOA 3L54A 3WY1A 2XU9A 3MOQA 5CBEB 1TPXB 3QDHA 1TJGL 2AQ3A 4IBLT 3X1BA 2J4WH 2EYTB 4X6DF 4U7SA 3BKML 3P73B 4X0NA 3VXUD 4AQ8A 2DQUL 1S5HA 2N0KA 2PMZA 4MDIB 4L1DA 3V55A 3KLHD 4NCDA 1PBYA 3NGBB 4P59L 3LH2L 3MV8B 1O6VA 1ND0A 4XOEA 3IDIA 3HNSH 3OVUB 3EJSA 4UOW0 5BVJA 3EJZC 3ATDA 3A4FA 4FS0A 4QO1B 1E4JA 4ZAKC 2BVQB 5FFGA 1BFSA 1D5IH 3NJFA 5AVTB 5D6CB 1RK1B 3HE6C 4P2YA 5BCAA 1TTUA 1KWGA 3BDBA 1NDGA 2AQQA 3WMQA 4PJFF 3B2UD 2Q10A 3W37A 3QDMD 1X7QA 3CH1B 3TLRA 4Q52A 3VA2C 2VUOA 5B1BB 4DIXA 1YEEL 5FGBA 3BXNB 3ATBA 3TBSB 1DANT 2CBPA 4HKJA 5DF0A 4HIHB 1Q0YL 2WVVA 3TV3H 1DVSA 3EUUA 3OZLA 1CFSA 1V3JA 1PSKH 4C83A 4HZ1A 3FFDB 5FGCB 4XNXL 3T2NH 3UTQB 4MJIA 4IDJH 4PJDA 1I7UB 2Y1ZA 4AENA 4BWTA 1BSIA 4ZFZB 4XC1H 4BFIA 2XACC 1SVCP 4I3RL 4PJXA 4MNHB 3CXDL 4IU2A 4AUJA 4C56A 2XBTA 2A9CA 4R84A 3T0EA 4ZI8A 2BIOA 3WELA 4FD0A 2KUTA 5EIVA 3FQXB 2YD9A 4HJJL 4X80L 5LDSA 4UT6A 3TCLB 5D1XA 4A2GA 3L2MA 1C12B 2YKLL 2EEBA 3AFLA 4DN3H 4A6YA 2FT8A 1W0VA 2ENYA 2E9GA 5DRZB 1JYNA 1QSED 3AROA 3CFJA 2ATPA 4ES8A 2K3TA 5AENA 3APDA 4L05A 3O6ML 4S10A 3RVWC 5FFOA 2Q87A 4JO4L 2E7LA 2OJEA 3MJ7A 5L0QB 2EYSA 5IBLD 4KMQA 3RJDA 2R56H 1KGUA 3VM7A 3ARDA 1LMKA 2P42B 3QEGH 4QJ5B 2QT6A 5DVKA 1ANUA 4EVNB 4FHJA 1AMYA 2DQHH 4UB0L 5DVPA 5KOMC 3UO1H 5HVWA 4F5CE 5KTEH 4JFYB 1UGKA 3HI1B 1BYPA 1FC1A 2AV7A 3QA3B 5FYLE 1WFUA 1IT9L 1BGXH 3LZPA 1WA1X 4DVRL 3QA3A 4X83A 4J3OF 3PAZA 2FEJA 4K3DH 5I6OA 3PV6A 3AT9A 3H2PA 1TVBA 1YMME 3T09A 3QDMB 3K46A 1FO0H 3MUZ1 4OGYL 5B1CA 1N67A 3VRLE 2AJZB 4BUQA 3MAWA 3AB0B 2ICES 1XAKA 3BQUA 2HP4A 2AVFA 2YA1A 3IBEA 5EUOB 2X4PA 2A4EA 2X7LB 1DJWA 3PWPD 5I17B 5ISZE 3GXIA 4P3DB 5F1IB 4UQ3B 3V6OE 3CVBA 3IXTA 2QEJA 1I1FB 4XPBH 2G3NA 1GSMA 2EH7H 1D6EB 2NSMA 3BVXA 4G8AC 5EHFA 4PGEB 2HA1A 4MGXA 3RKDC 1OP5H 3EOBA 3EO1B 1GGIL 1HOEA 4ECNA 2Y7NA 2XIDA 2G4GA 4FQXD 4P2QA 2WCPA 2H47C 2WXFA 1JOIA 4AEIH 5H2BA 3HMWL 2I25N 4PJEE 2W94A 5DWPA 5HDWA 3IGLA 1N19A 5J6HB 1C16B 3HCVA 4XN2A 5CD3A 4FG6C 4X6DB 1IARB 1UZ6F 2VMCA 3QFJB 4G3YH 5GGRB 4KKAC 5LG1A 2A77L 3TEXA 3L4YA 5C9JA 3KYKH 5B3JE 2VZ1A 1U91B 4M62H 1TVDA 1CVSC 5BZWA 4P3DA 4H1LB 4WUKH 3BYTA 4AYFB 1FO0B 1X5IA 5FYJE 1N8ZB 3SJVA 4CVUA 5ID1B 3DDFA 3CXFA 2YEZB 2ENPA 4WHDA 1FRGH 5EWIL 2ZOUA 3LZFL 1GGIH 5LGJB 3GS0A 5A2JH 2V8LA 4LAJH 1JGDA 5F7BA 3DSNA 4BA0A 1XGZA 5KYYB 4Y2DA 4WWKB 2VOTA 3NH7L 5EF3A 3ILPA 3DX8B 2AK4B 2ZXWB 1YNKH 3NK3A 4XOBA 4E2OA 2H2SC 2WPGA 4MNGE 3MRPB 2JKSA 2YPLB 3HG1D 3ZDXB 3GDCA 1XIWC 2XKSA 3TGXA 4KDTC 1UH4A 4PWIA 2NR6A 4YDIL 4XP4H 2VDRL 5I6NA 4JFDD 5HGDA 3VG0L 5MEQA 1CGXA 3PWVB 1T2QL 5SWZD 4L8SB 3ZE2B 4F80A 4Y1AB 4FYSA 35C8L 2C3VB 4KK6D 5TDNA 4LVEA 4XNUL 3OWRA 1U8MB 2ZX8A 3Q1SL 3C60C 2R23B 2BY3A 1ZVSB 1XAUA 4OAWA 4HEPA 1GTNA 4QXTA 5CZXC 3OSKA 3KPLA 5MEPA 1MLBA 2Q8BL 4ZQTA 5CHNA 4FQXB 4XO8A 1AY1H 5T5NF 5GZOD 3LHPH 4XPGH 2R0WH 4AWJC 4W4NA 5INCB 3N0PB 2YMXH 3ESNA 2DQIH 3TZVA 4M1CC 3EOTL 4PWFA 3R06B 1G1YA 2WKOF 5CMAB 5C0BA 2Z8RA 4JPIB 4BJLA 5HYEA 3A21A 4PH8A 3EFOB 1NUDA 3P0VL 1L0QA 2P5WA 4XMWA 4DT2A 4UILH 3L3GA 4WFFD 5HGHB 3WJJC 1JUFA 3GM8A 4LU5L 2Q1EA 1AGBB 3VRJA 4JK0D 4ZTPH 1LK3L 4D0BB 2ZCKL 1U3HB 3EJRA 2VB5A 3VNZA 3F83A 1S7QB 1IFHH 2YBRA 3NFPA 4ZFQA 1L7IL 1K2DB 1XH0A 3RIAF 1LTXA 4GYBA 3B1TA 4RMSA 4FQ2L 5DLMH 5C0CB 3V8OA 4XB7A 4M29A 2HCZX 2VDQL 3B4NA 5MEOB 3QJUB 5CP3H 1OOWA 3C6LC 4ELMA 1CBVL 3OXSB 5DUBB 1JE6A 1CICB 2GJJA 4FN0A 2EIEA 4PLJD 3P11L 4ZO6A 4F2ME 1TZIA 5KSBB 3V2AR 5GPRA 3N40P 1BZOA 3BAJA 3V9EA 2C8NA 1HXYA 3ZU8A 1OGSA 3TBYA 3VFGH 5AFAA 1LDPH 2HUHA 3TJPA 2F8VA 5KVMC 4FEMA 4DO4A 3K8KA 2EO9A 3D4CA 3P4OB 4RWYH 3ZO0A 4M9OA 1JPTH 2CA4A 3IJSB 2DQDH 4Y9CA 3CVIH 1PKQB 4AC4A 4DVBB 4ODBD 1KIRA 4BYHA 2FO4A 2ZWKA 5AB0A 3O6FA 3H53A 1KV3A 1L7TH 4LF3B 2IO5A 3Q06A 1EAPA 2HSIA 3QUML 3QNXA 1A4JA 5TDNB 2WCGA 2R7EA 1MHHB 3WHE1 4XBMA 1GZQB 5GSRA 3CJJA 3X1EA 5H35B 4DW2L 1O5PA 5HDBB 3AREB 4TL4A 3TX4A 5A7BA 3HG3A 1AP2B 1XBDA 4LGRB 4J12A 5CEZL 1HEJC 5IUSA 1T20B 4NOBA 5IJKC 1HN1A 1NFDE 3MOBH 4GUCA 3WDIA 5LXGH 2C7UA 4WWKC 4UUJA 3CVHL 1I3UA 2PXYD 4O9HH 5I1GH 2Y3NA 4EKJA 1LO3H 4M03A 4FERA 3RVVD 1WAEA 2VO5A 4M8VA 2QZ5A 3THMH 2YR3A 4XNYH 3MV7E 4GIOA 1GPOH 2D3VA 2P7TB 3ESUF 3VD3A 3VXUA 3FYEB 4N90D 5LAPA 4F58L 1GY1A 5T33L 1QLRB 5GGVL 1FV1B 4Z7WF 1TJMA 4KZDL 4LCWA 4HX1B 4W9KC 2N01B 4MA1B 2WJ7A 3PHSA 3KPOB 1H5BC 1WFIA 3EDDA 3S3CB 4CADB 2FIKB 3VH8G 3QCUH 4GKSB 2IPKB 2DQIL 3QXAA 3BRGC 3WEAA 5J56B 3QQXA 1NFDB 1Q9WB 1JV5B 5GS0H 3OG6B 5GGTL 4FYRA 4NXKA 4PP1D 2AK4E 4LLMB 1O9VA 4QXVA 1D5MA 5ACLA 1UYWH 2VM9A 4QTHB 3GXMA 3M6DA 3MXWH 5D1QD 4G59C 4I48B 5TDOA 1A66A 5KVFL 1TITA 4NRXA 1P7BA 3ZOAA 2GSIA 2QKIC 1P1ZB 2QHRL 5IJVB 1YECL 3NCJH 4KZDH 2XRAL 1VADA 3GSNB 4HIJA 1YY8A 2ZX6A 3LCYA 3MLWL 1R24A 3MLUH 1ZV2A 3BQVA 4JHZA 2V9RA 3DC0A 4YAQB 2Z31B 2APBA 4S2SB 1OHZA 3BKYH 4FNTA 2J8UA 2YHGA 4DCQA 5C6TH 3DWTA 4Y5XB 5LBVA 3ZE2E 3BD4A 4XNBA 5C7XL 1IQWH 5JW4M 3ATFA 1NCBL 2FQDA 3DXAA 3NAAH 4XODA 3VQMA 2OMZB 4MFHA 3PCYA 3ZHLA 2VL5B 4CNIA 1HQRA 1JYWA 1FYTB 3QEUA 1XCTA 2XFGB 4GUPB 3O45B 2X4UB 4G1EA 4OZHE 1KLUB 3ZKMD 5ITBL 2LT9A 5E94B 3RVUD 3UPCA 2IQAA 2HPOA 4PTTA 1KLUA 3T0EE 1D5XB 3QUZA 1MFNA 3GTVA 1X5KA 3M45A 4Z1PA 2P47B 5CEZH 3PL6A 3GYRA 1T04A 3CLFL 4RSVA 4S1DC 3HAEB 3U6XA 1SPDA 2KI6A 4ZMXA 1T83C 5C08A 4WIQA 4X99A 4WI7A 3FT2A 3C09B 1KYDA 3KPSD 1QBBA 2F53D 1V5JA 4A38A 4LVHC 3P3YA 1IUZA 4GQ9H 4R97C 4AYID 4HUWB 4KVCL 3PAVA 1OF0A 3FCTB 1VZGA 1QSFA 3ZSTA 1SOQA 3CXDH 4QXWA 5EU3B 4BH7B 1LEKA 5ACZA 1DBMH 4HXBL 4P5TA 1L4IA 2VITA 3LS4H 4MXWL 3BSHA 4KQ4H 3DBSA 5ILTH 4ONOA 4J3OH 4GRMB 2GKIA 2BNQA 3QUHA 5EF2A 4ODWB 5JIPA 2YLKA 5DUPL 3QI9C 4YE4L 1OSEA 1G9MH 4PVNA 4MRBA 1YVLA 1MN4A 3HB3D 3QFJE 1MREH 4P5TD 4NZJA 2EYRA 3BP4B 3SBPA 1WC7A 1V3KA 4BZ1L 3MRNB 2YK1L 3LNDA 4HISA 4BBWA 5F7FA 1UYWL 1YPZE 2DJSA 4LPCA 4EAEA 3Q44A 5CSZB 4JG5A 1A6VH 4LE8A 2D7QA 1AGCB 1AS7A 4Y9FA 4AZUA 4HZLB 3FN9A 5DJ0B 5L8JB 1UKSA 1CYXA 5EOCH 3RBGA 2QSCL 4RAHA 5EC2A 2HMIC 3RWDB 2ZXAA 5HYFA 4CA4A 3ZL4H 4HLJA 4RBPK 4XI5D 1XXDC 3EOTH 4YE0A 3FFCD 1SXBA 1TPXC 4M1DL 3H7BA 1IB5A 5C6WH 1JZ4A 4P23D 1SF3A 2VMEA 1CYGA 4BDVA 1ZVHA 1T21A 2AJUH 2ZXQA 3VI3E 5GZOA 5F1SA 5I0VA 4HAKA 1U8IA 1I8IB 1IILE 4RA3A 2VDLB 4NOFA 2ARJQ 2APXA 2CKNA 3HLAB 5ICZB 2FHBA 2ZP8A 3SZKC 2WBJB 4ENED 1Q0YH 1RURH 4QHNB 5SV3A 5JPNA 4HZLA 1DQMH 5DJZB 5E1GA 5JPNB 3ZVVA 4YEFA 1TOXA 2DIJA 3JWOC 5JQHC 4H0GA 2Q8AH 2RQEA 2HVJB 4W1TA 3DHPA 4X8JA 5JXEA 1S7QA 4PJXF 3VVWA 4FOMA 4I85A 1Q90A 1XFPA 5E5MA 1QWNA 1FZKA 1O7DC 3FNKA 4IOFD 3U7AA 4OJAA 1ZMYA 3FO2B 3V6ZA 1HHKA 1QHPA 4IKKA 2P8PB 2ODHA 3OXSA 1S3RA 3AS3A 3D0VA 5IK3B 1X9LA 1J0YA 2YAQA 1CPUA 2AJXL 3BT0A 4LHJB 4ZW8A 3V0VA 3VGAB 3ZDYE 4JMNA 5AUMB 3ZKQD 4L4TA 4PRHB 5JQIB 2XPGA 1CE1L 1XWVA 1FH2A 1E8YA 1OF2A 4MCYA 5J7CC 3K6SA 1GMEA 1KUMA 1QBLL 4YNYB 5B1JC 4TLUA 4AC2A 5FYKU 5DZOA 4PP1C 4L1TA 2V7HA 2XWDA 1J0HA 5IW6B 3HMXH 2AXHA 1N9PA 5E2JA 3VDBA 3HC0A 3ECQA 3BVVA 2AQSA 2NXYB 5E6YA 1A3RL 1F6FB 4JO3L 3M8OL 2FX9L 3L9RA 1H19A 3DROA 1TCRA 2A83B 4LLWB 4X9IA 2QGEA 5FKPA 1QUNB 6PAZA 1EH9A 4W81A 1NCWH 3NK4A 1NINA 4P8QA 2R69A 2J73A 1NKGA 2CR3A 5EZIL 4IRZA 2J8UB 2CLZB 3FOLB 4MMYB 1QW8A 2GCYB 4R6UA 2KYIA 3O81A 3H42L 1JXDA 1ILUA 5ACZB 2IADB 2QR0A 1LJMA 4ODUA 4JMXA 2NY3C 1FYTA 5E2WH 4YUEH 5F3FA 4OD1H 3V5DB 3HMXL 2VC2L 3ESOA 1D9KA 2HLEB 3JSSA 4AI7A 1KTDA 4A67A 3QI9B 1KJ2B 3L16A 2Z92A 4HPOH 4JUTA 4KTEL 1U58A 3D7PA 4OLZH 12E8H 5SX4H 1GC1H 5ESVB 2VDKB 1OD7A 4M9PA 3TO4D 2L3BA 4DUVA 5FYJU 4L4TE 3CLEH 1FGVH 4LHUB 4YAQA 3OAUL 3ME0A 5GRYA 4ZTOL 3QDJA 4W9FC 4CSSA 4HLEA 3QCUL 4PVBA 3OB0K 1A65A 1ML0A 2AI0L 5I74B 3MOAL 5GS0L 4R9HA 5K9QG 5K9OB 1UVQA 2HJLA 3UZVB 2DQEH 1BVOA 2ZP0T 1T0OA 4LVHB 4ZD3L 1MEXL 3ZMNA 5I1AA 2DIEA 1XX9C 4UNUA 1NIEA 4U0RB 4FULA 2J21A 4LKCB 4PRPE 3HOGA 2VRQA 5L88H 4DKAA 5H2BB 5SWZB 3MJWA 2NY1B 1VGEH 2PW2A 2UZXA 4G5ZL 5D4IA 3DGGB 5GZND 2DQFA 3O8XD 3GLEA 1YNKL 1CT8B 5CCKH 5C97A 3CHOA 3MLSH 3QJOA 5DEGB 5IB1A 2EEDA 4G8IB 4K5MA 3X1FA 1FFNB 4PS4L 3DURB 1E9QB 2ALAA 3RTQB 1UKQA 3EW3B 4WHCA 4P2OD 3UYRL 4N9GB 1NGPH 1URIA 3DURA 3UAJD 3B2VL 2J6WA 3LN9A 1WICA 2VXUH 2R1WA 4BZ2H 3BWSA 1NIAA 3BAWA 4GRWE 5IREA 2VR4A 4HPYL 1HZHH 2K4WA 4XPHL 3P1VA 1KXTB 3EFDH 1EBPA 5JA9A 4WWKA 5EZOL 5JPMC 3MREA 4NM4L 2NQDA 1E5AA 2W0FB 2BOBA 2F53E 3KDMA 1RMFH 1G9NH 5I5JA 5K69A 1A8ZA 4X4ZA 2SEBA 4H20L 5AYQA 4ONFH 4HULB 3EYUH 4UDTB 3Q8FA 4J8RB 5CSBA 1HEZA 5EULV 3GMMB 4ZS6C 2YAOA 2D0FA 3LHAA 2GAZB 1OGPA 3IETB 2IV8A 1CLCA 4FI8A 1U92B 5F7NC 1KYAA 3BZFA 3L45A 4FJ6A 4FTVD 1EJ8A 4DGYH 4KJPC 3LDBB 3ME0B 1F3RB 5GGTA 3RWHB 3WFHA 4HJSA 3E9TA 4L4TD 1J48A 3HKZA 5CJ8A 1ZANL 4R90L 1M6OB 2Z35A 3ILEA 4FQLL 3LPOA 4OCXH 1MDAA 4N2CA 3VXME 5SWSE 2HFGH 4BHUI 1PJ9A 2DOCA 4IDJL 3GT6A 2E6QA 2HX7A 1KGJA 5EG6C 4P46C 4PRDA 1TR7A 4KKLC 2YFNA 2GG1A 2IG2L 4KQ3H 1UFGA 3I85A 1ZLUH 1LVEA 4PJ7E 2FNBA 4OKDA 1YEGL 2BINA 4JFVA 4B9CA 2VE6A 3EH1A 1LO4H 4HOWA 3HS0A 1ZGLM 4Y1AE 1PLAA 1PF3A 3L3HA 4OLXL 4YXKL 3GMPA 1OB0A 3U4EB 3O2DH 1AHWC 1NGWB 2F5AH 2OJZL 4JFOA 1PZDA 3LKNA 3O6KH 1I3VA 1VCAA 2DQJH 3PE9A 1CT8A 3CFKA 4FNRA 4FEIA 4IMLA 3RIAK 5KSUA 3EYVA 2EE2A 1N6UA 3MLVH 4HIEB 4MD0B 2CIKA 3VRJB 4BFIB 1M05B 5C0EA 5GRZA 3HE7D 3HI1A 3CCHB 3S96B 2R39A 1VACA 1XTLA 2UXFA 1P84K 2R0ZH 2JWYA 3HLKA 2ICCA 4A7QA 3I6KB 2A74B 3EDJA 3U2SB 1U2YA 4PHZA 1R46A 4LASL 2EILB 2WP3O 2PO6A 4HJ1A 4AYEC 2K7QA 1O7DE 4LVNB 4A7VA 1RH8A 1QPKA 1MFDL 1QBML 4Y19D 3PLYA 2ZKHH 1CZ8L 1USQA 3TM6A 1KIUA 3V0EA 1JPSH 4FZEH 1G4MA 5IK3A 2WXRA 1E2VA 4FQXA 4P2QD 2J71A 5CCJA 2OQJB 3QAQA 5H8DA 4XCEB 1J9QA 2CR6A 4N8VB 3CN3A 3FAXA 5JHLH 3AS2A 3EJJX 4OFVA 3DLQR 3JV0A 3E3QE 3GMOA 1ZHBA 4MA7H 4ZS7H 1DQML 2MTPA 2XC8A 1T3FB 4LDOB 1AE6L 4GIPD 5I66B 1TO5A 3RX7A 1YUKB 3LS5L 2KMWA 4OT1L 4QHLB 4L3AA 1IGJA 1JDCA 1W8EA 3TU6A 3WIAA 3NFSH 1SYSA 3M86A 4N2AA 4WEBH 2VDNH 4I0KA 5AAMC 1C5CL 1T0PB 1KTCA 1UQSB 2CLRA 6CGTA 4DESA 2O6CA 3IU3A 2AK4D 2EINB 4AVKA 5FV2A 4JY4A 2COQA 4IJ3C 4ZO8A 3NRQA 2FL5B 4RSYA 1MPAH 2G3MA 4TUOB 2WINA 3ARVA 4XMVA 5KEZA 5D1ZA 2DDQL 4ZMLA 2E9IA 4NQEB 4PU2A 2BH0A 4XCFH 1OSPH 4YSSA 2AAAA 1BX2A 1U42A 4DKEH 1PIFA 1KC5H 2FJSA 4N85A 2A2QT 4DETA 5ESQA 1AQMA 1DDTA 4R2GC 4XRCA 4EIUA 3UBHA 3RFZB 4Y1AD 2W95A 3P9WB 4Y2DB 1OAQH 4FL4C 2DQDL 3WFCH 1JFHA 1AFVH 2UZYB 5E03A 4CW1A 1KEGH 3QJHA 2GK0B 1NANI 3WXWL 5B7EA 1U92A 4M7ZB 5TE6H 4NZUL 1HWGB 1HS6A 3CSYA 4B41A 1FIEA 3BUIA 2YAPA 2BWIA 2FVNA 5IJCC 1Z7JA 1TJHL 4PREA 4C56D 5IHUL 1SLXA 5B7MA 1OE3A 1L9PA 1NSNL 1RHHB 1ZE3C 5J6GB 1EXUA 3T8XB 5DJYB 1IQDB 5DURB 1KJMB 3HC4L 4GAFB 3K6IA 4LPTA 4YDNA 1U8CB 1U8MA 1PNDA 3NZUA 5PAZA 3VXRA 5FC9A 3KWWB 2X2YA 4AQEA 2OZ4H 4HH9B 4PPTA 4P2QE 1ITCA 1RUAL 2MCG1 3U36A 4RISL 3LIZA 3WOVA 4KZ0A 1O0VA 3JV6A 1ZGLB 1T22A 3CFBA 3QNZA 1X4YA 3NVQA 4FRWA 3BCDA 1KYOJ 2A9DA 2WQAA 5D2LE 5D71L 3O6MH 2GFBA 4K07A 4QYOA 4RA0C 2B1AL 4F7TA 3B56A 4YBLB 3GSXA 4YK4C 5DR5L 4PJIB 2EDLA 4XBPB 1RHHA 3NA9H 3OB0H 4PJ7B 2E6PA 4HMCA 3FT2B 5CLYA 2FB4H 1UUSA 3BUYA 4N25A 5SWSB 2HFFB 4HU8A 3FMGL 1OALA 5L2KD 5C86A 1KTKE 1I31A 1L9OA 1FFTB 1DHKA 1DLHB 4KAQH 4NQED 3E6HB 4OCNC 1B2WH 3U0TB 4G43B 2XN9E 5C3LD 1D5BA 1TQSA 3SPVB 1CXFA 3WUWA 3ML8A 3GJEA 2E46A 2Z0UA 1BLNB 4XVJH 5GS3A 3CMGA 1AQKL 3GHBH 3U30B 4QRQA 3FU8A 4U6VH 4W9GC 5ESQB 2E74C 1NC4A 2QFRA 3O3AB 4NFBA 5I8EA 3QZPA 5D2LB 5AAWA 4J3VA 1JERA 3LD8B 4WSGA 4HUVB 1HHGB 2BS8A 3SQRA 4NBXB 4V1DB 1GCYA 5FS5A 2CRMA 3T6VA 4PUBL 2MQCA 4JKPL 1NM4A 2BZ7A 1ZLSL 1GY2A 4EIGB 1NUNB 1NEPA 1QOKA 3Q6GH 4N0UE 5JOEA 1UA6H 2VGLM 5FHAL 4FHKA 4KNUA 3T65A 2YPLE 4ZFZA 1BZQK 3B2PA 3FUMA 1DJIA 4OFDA 3F05A 2N0MA 4PWGA 3WNIA 3IDJA 3HEIB 2O61A 2YC1A 4W9ZA 5L9DL 5LHDA 2OMZA 3NYKA 3MV9D 4KGLA 2PXYC 4MCZB 4X0KB 1XGQB 2IWFA 2DMKA 2RMNA 4QRSB 2LLGA 4KRPD 5GSVB 3GSWB 3C8HA 2FT6A 4H88H 3N44B 3QDGE 4BSVB 4DZ8B 4YHYB 1G6RH 2NXZC 3BN9D 2J55A 4JN1L 5AYTA 4AV5A 2BLFA 4HALA 3STZA 1U3NA 2HRGA 1MLCB 2E5EA 2OFQA 3EF7A 3QFGA 3ARSA 3DETC 1MIML 1XDTT 2HTLC 3P30L 4IKLA 4W4OA 3EDEA 4KFZC 2ZSWB 1BWMA 1ZXKA 3DVNB 4UAOB 1SHWA 2IWKA 5AB9A 3BWUC 5B8CA 3VXUB 3V4PB 3CBRA 5I28A 2OSLA 4P9MH 25C8H 1S4IA 5LVEA 3O6LH 4Y5XA 3OGCA 1FNSH 3OX8B 4IRSC 3RWCB 5L2KE 1OSZB 1QEWB 1T4WA 1U95A 1XIWD 3P9LB 3T08A 4AKPA 1G87A 4X6BA 5FIEA 4ETQB 4Q9QH 3ZPDA 4V11A 4GOSA 4EOWL 1FG9C 1E8XA 4WJ5A 4G8FB 1RZKL 4Y89A 4XHJC 3O3AA 4X5WB 3TVMC 1QWHA 2Z31D 4FZ8H 4MWFA 2B9BA 4MMXB 2YGVA 3TA3A