2OMWB

Crystal structure of inla s192n y369s/mec1 complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
GPLGSWVIPPISCPENEKGEFPKNLVQIKSNRDKETKVFYSITGQGADKPPVGVFIIERETGWLKVTQPLDREAIAKYILYSHAVSSNGNAVEDPMEIVITVTDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Extending the host range of Listeria monocytogenes by rational protein design.
pubmed doi rcsb
molecule keywords Internalin-A
molecule tags Cell invasion/cell adhesion
source organism Listeria monocytogenes
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2omwB00
4AQ8C 4APXA 4AQAB 3K5SA 1WYJA 3Q2WA 3UBFA 3MVSA 2X2UA 3FF7A 3LNEA 4XXWA 2A4CA 4OY9A 1NCGA 4ZMVA 1ZXKA 2OMYB 4ZMXA 3Q2LA 4ZMYA 4AQEB 3K5RA 3Q2VA 4NQQA 1NCHA 4ZMNA 4ZMQA 3UBHA 5KJ4A 4ZMWA 1WUZA 2QVFB 1O6SB 4AQ8A 1ZVNA 4NUMA 3LNFA 2OMWB 3PPEA 2OMTB 5CO1A 2YSTA 3K6DA 3QRBA 4AK1A 4ZMOA 2V37A 1NCJA 2WBXA 3LNIA 2YQGA 5DZVA 2WD0A 4AXWA 3K6IA 3LNHA 4ZMTA 4NUPA 4APXB 2A4EA 3LNDA 4ZMLA 2OMUB 1EDHA 2WHVA 4NUQA 4AQEA 3UBGA 4ZT1A 1NCIA 4ZTEA 4ZMPA 3Q2NA 2WCPA 4QD2E 2EE0A 1FF5A 2O72A 4AQAA 3FF8A 2QVIA 1SUHA 4XXWC 3LNGA 4AXWB 1Q1PA 1OP4A 5JYMA 1L3WA 5JYLA 2OMZB 5CZRA 4ZMZA 2OMVB 3K6FA 2OMXB 4ZI8A
chains in the Genus database with same CATH superfamily
4JE0A 3BKMH 3QG6A 3FMGL 3ZDXB 3O9WA 4M9OA 2YEVB 1KBVA 4DO6A 3PWPE 4PJ5B 2XN9B 4U6VL 5HYJB 1A6ZB 3WIFB 1G7PA 4F58H 3RNKB 1EGJA 3LQAL 5J7CC 2BPBA 3D34A 5KAQF 5JTWA 3T1FA 1OARH 1NDTA 4AENB 5T3ZD 4AW4A 2DLHA 4LPWA 4F57H 2DLIA 5I1CH 3H9SB 3EF4A 1QLRA 4EJ1C 2IDSA 1H6EA 1DQQA 2XXMB 3BIAX 4FEIA 4LLUB 1JZHA 4NQCB 1T1XA 2GW5A 3UPRA 4PJEF 5EOCJ 4FQXD 5F6IB 4J3WA 3E8UH 1TETL 3EJRA 3PS6A 3O3DA 1KBWA 1M42A 1NC2D 2W60A 1IJNA 1THCA 3NEOA 2FEEI 4MRCA 4QXUH 3CFKA 2BOBA 2CPUA 3NVQA 3FTSA 4WI2A 3RVWC 2IPTH 1V8HA 1NEZA 4JFSA 4ZQKA 4BK8A 4XNMB 1HC1A 5K59F 3ZU8A 4ZUTB 1KENL 3S37L 4WSJA 2Z93B 3AFLA 4PJAE 1WZKA 3H42L 3H9ZA 3N04A 1QI4A 4IU3A 1NAKL 5I9QB 3VX1A 4EN2A 1P7BA 4QYOA 4ETQA 4AEIL 1AE6L 1BZEA 1D5XA 2A6JB 4JFVA 4NO5B 1IGIH 2XTSA 3L5JA 5FA4A 1INDH 1RPQA 5DFTA 3N5AA 3TYFA 4BGDA 1AZBA 4H1LB 2X4UA 4QCIA 1A64A 3LRHA 2CXKA 4HUCA 2RGSA 4PRBA 4ELMF 1P5UA 5KYUB 3EHBC 4PJ9B 3IF1B 5FLUA 2FTAA 4IM8A 3NEXA 4RGNE 2XKSA 2QZQA 4S2SA 1QFPA 2VITA 4X4KA 2HPTA 5DGRA 4M00A 3D6GA 2O6CA 1AXSA 2NY0D 5IQLA 3S36L 1P4LA 2GCYB 5I73B 4Y4KD 5I6PA 1G6RB 1KTDB 4ZUSA 4JNXA 2ZUQB 4M7JH 3DPBA 2ZKWA 3JZ7A 1WWCA 1VB9A 2VLRE 3QQ4A 2OR8A 4BKSC 1UOKA 4GP4B 2AJ3A 2RCSH 2APFA 3DX2A 4GUQA 1ACZA 3US1A 3BVDB 2Z3FA 5I15H 1C8QA 3ARGC 3GGWA 2W80C 5JW5A 5KYYB 2CMRL 3QR2A 5TF0A 3V6OC 3L4VA 1AGEA 4UANA 5HBBA 5HHOB 3RA7H 2V9QA 2EE2A 4FL4B 1QMUA 3EOBA 4MB5A 1QLEB 4L5FH 4YDVB 1OEZW 4MZIA 3S3CB 25C8L 4IBUA 1QWUA 1HQRB 4G9FA 4GS7B 3NPSB 4KH2A 2J73A 1MELA 2A73B 2ODIA 5EZIL 3QIUD 3KWUA 4HJJH 4JFFB 5D7LA 1ZLUH 4APQA 2JKJA 4NC0B 3HBQA 4PIRF 2HKHL 2YAMA 4Y19E 4Q9RL 4G6JL 1NCCH 4D8OA 3KVDD 2H9GB 5C0JB 5JXEC 2D2CC 4NZFA 4XC3L 4ODWA 2R7EB 3O0RH 1J0ZA 3EOAB 4OD1L 4PW4A 3QNZB 1DSFH 4OCMC 4X4XB 4AC4A 1RIHH 2P5EE 1NEPA 4OSUL 3GD1C 5CN1A 1TTCA 4HD5A 1QPKA 2FL5A 1E9PA 4QRSA 2AW2A 5IHLB 4PBDA 4XXCA 1F6LL 4QXTA 3K8LA 3MLRL 1GZHC 3P02A 3FCSB 4LVHB 4RMTA 3VXTB 5CD3A 3PJLA 5F7DB 5HHMB 5CZXD 4KK6D 4I0PC 3PLYA 3LXAA 4W4NA 5TFSH 2ICCA 1T0NA 3T8XA 5I1LB 1A2YB 3GMLA 4NNYB 1SRDA 3NCMA 3KYAA 3WENA 3MLTB 2YEQA 43CAB 2VE6A 1YN6B 3FH5A 5C6TL 3NH7H 2GFBB 5F7UA 1F41A 4W6WB 3HR5B 1A9BB 2IH1A 2KS0A 4DEPC 3WXWL 4OI8A 5BRZE 2IH8A 3EKCA 2D7OA 3MNVB 4ZYKB 3RHWF 1YN7A 4N9GB 3FFCE 3IJ7A 3WFDH 2LGNA 4TVUA 1V7NL 4CGUB 3HZKB 4X6EA 1D2OA 4FTVB 1SEBB 1RUQL 1E9QA 1PVHA 3PNWA 4HUWA 3ALPA 4I9WE 2AANA 4MX7A 1HDMA 4PJDE 1Q0XL 5E8EA 3FONB 1UB5A 1A6UL 3CVDA 4GKLA 3WI9A 4HCGA 2PABA 3I9PA 3KHQA 4RISH 5K9QG 2IDCA 3LZLA 4WGVB 2A6DA 1CYWA 2Q7AA 3NFPA 1FGVH 3LEVH 4L9LA 4ZPVB 3JWNC 2ATKB 1T89A 3QQDA 1BFSA 3RWHA 1AXTH 4GW1B 1XIWA 4XC1L 4CUCA 1VFUA 2OMYA 2OYMA 2BSTB 2ADGB 4QHLB 5F9AC 5AEAA 1MFMA 2ICEA 1NMCB 3HS0A 1RSYA 4GRMA 5HHNB 1ILSA 4LLVA 1VADA 3MJ7B 2NUTA 2MOQA 5L8JB 3P73A 5L6YH 2E74C 1CLYL 4WI8A 2YMXH 1QBBA 1E5UI 4P5KB 1KLUA 2Y06L 2ZOOA 1QSFA 2IGLA 2E7MA 1N12A 1X9LA 3KPQB 5F21B 2V2TA 3BAEL 2XXFA 4YVNA 2FIKB 1IM3B 1JHLL 1JNNL 4CKQA 4XCCH 4PJHA 1SJMA 2DQHL 2H5UA 3DVNA 4U1KB 3IU3A 1IBHA 4LB8A 4A2FA 3SYPA 2BNUA 1PX3A 3GHBL 4WW2B 1DEEB 1E0OB 3FMGH 2VXQA 4XN8A 4HCRA 2HUHA 1NIDA 4M8QB 4PJ7A 5BOZG 4FLRA 1WBXA 1DN2A 1QPPA 1KCKA 4XMZA 3LQAH 2UXTA 4PJIB 2JKIS 4JFHE 3HC4L 1P53A 5DEGA 2FHCA 2Y22A 3AABA 3ARYA 1CD9B 1EZLA 2N7BA 2QGCA 1D3CA 4JFOA 1BBDL 1JFQL 1HHGA 5EZLB 5FYJD 4AIZB 5C0EA 5IVNA 2L0DA 3M17B 5KN5B 1P2CA 3WDJA 1GYUA 1D5BA 1UTDA 2FT8A 4GXFA 4RGMC 2KMWA 4BEIA 1TETH 4Y8DC 3ROLB 2X4QA 3VXRB 3HB3D 4QJ5B 3DYMA 4I18A 1XSJA 3TNNA 3GSQB 1JZFA 4JKMA 2G5BB 3QYMA 3LNDA 2VXTL 1UOWA 2WZ0A 1G5AA 3WO3B 3ISYA 1KGCD 5F93C 5JPNB 4Z7OF 2MNWA 4NC1E 5AVYB 5IB5A 3VRLF 1RPUA 2EC8A 4WUKL 2H1LM 2XYCA 4E9LA 1KENH 1GTNA 1OK8A 1QKZL 5D7JB 4JRYA 4MQTB 4P23D 5B8CB 4EZJA 3H42H 1SM3L 5EORH 2VM4A 1NAKH 4WV1B 1NGZB 3CSBA 5DC9B 3HHMA 4WEUD 3IMVA 1AE6H 1O7DC 3MV11 4K2UL 5AOZA 4AEIH 1A3QA 4LBEB 4N87A 4QJ3B 3RFRA 2ICES 3ARRA 2QVMA 3R7QA 1V3KA 4C83A 5DSCA 2BH0A 1TPXB 1HAUA 4LPTA 5DC4B 2IQAA 1N0LA 3P2DA 2YRPA 4TMPA 1XAUA 4MBRA 4YLBA 4U1NB 3S36H 5JNYB 5L4JA 4U1GB 3F64A 2VQ1B 2X1QA 3VXPA 5LCVL 3DUSA 3KCPB 2ICWA 5T3ZE 3P69A 1JWSB 1U3JA 1JDAA 1XZWA 2VZSA 3FQ1A 4N4YB 2P9RA 3WFBL 3TPKA 3TA3A 3CZJA 1R3LA 2XPGB 4PW9A 1SN0A 2QGDA 1NFAA 2BWQA 1THAA 3QFJD 4WI4A 5FB8B 4LPCA 5IG7B 2CMRH 2NNFA 2JB5L 3I3DA 4WFHD 5HI3D 4U1JA 2J2ZB 1YPZB 3QUZC 1JZ2A 5I0XA 2IOOA 3WIHL 2K9UA 2VZOA 4JDZA 3RWFA 1K8IB 2IBZY 5EIIB 4H5SB 3A3YB 25C8H 4RX4D 4Z3EA 5C08D 5IWLA 3E9TA 4AJWA 1UA7A 1MHPL 1YVLA 1S7SA 5EZIH 4IMKC 1R5VA 1P5VA 3FO2B 4TNEA 1S3KL 1U42A 5KVDE 1OAZH 2HKHH 2HB0A 2I07A 3L9BA 4Q9RH 1AGBB 4G6JH 4WDIB 4ZFZA 3P9MB 1Q0YL 2D2OA 2ZOKB 4XC3H 4JMNA 5ABZA 3EJCA 3ULVL 1EFXA 2Y5TB 3CUPB 4TSCL 1NFIB 5IHHA 4GXUM 2GY5A 2DWEA 2LLNA 4OSUH 5CCGE 1LO2L 2VN7A 3SOBH 3I3EA 1RK1B 1I3VA 4N8PA 3FO9A 2R4RL 2N3JA 3MLRH 1HHIB 4YX2L 1XCXA 2X41A 3L3KB 3M88A 4X7FC 1SJHA 2AQNA 1NMBL 3OJMB 5BQDA 1GGBL 4C4UA 4FNQA 1ZA6B 4XOAA 1PLAA 5C09A 3BAXA 3O4LA 4L3AA 3UBGA 5D1QB 5D4QA 4XCNA 5C6TH 5D1ZI 2HT2C 3BYYA 4PCYA 5I1HL 1PDKA 3WXWH 3QG7H 5GIRA 1JUFB 2P8LA 3KLQA 3L16A 5GZOA 4YK4B 1IAOA 3AY4C 3OAWA 4XCYB 3VXUB 5J6GB 3RDTD 1FFNB 2Q5BA 2R1WB 3GBNL 2CGRL 3O6LL 3VTMA 2I9TA 1V7NH 1ZV5A 4XHJC 3S9DB 4PJBE 5DJ8B 3BT2H 3NZHL 4DCQA 5AG8A 1TJHH 5IW6A 3WN5B 2JELL 4M6MH 2UWEB 2HZHA 1Q0XH 4NZTL 2PETA 2PWFA 4QGYA 2ZX6A 4PWHA 3IDMB 4NO0B 3MX0B 1CG9B 1A6UH 1KY6A 3EIFA 3LEXA 3SGEI 5LBSL 5AKVA 1N8ZB 3CFNA 4N2CA 3FTZA 2WXPA 2YA1A 1L0PA 2BWDA 1S8DA 4Z7QE 3TURA 3CWGA 4JANB 3PQYB 4PRDA 1CZ8L 3OKLB 4PS8A 3X1GA 3B2XA 4O00A 2VZUA 1ADQH 5F1IB 4J1UA 4LSSL 3BZ4A 4XC1H 4ONOA 3N91A 4YBHA 3W5NA 1TTBA 1A7RH 2MSPA 3FRUB 3GMNA 4WW1A 1I3GL 4D9QD 2BRRL 1QLFA 4IJTA 4EDWH 3M1BB 4DOHE 3JV0A 5J1AB 4JG9A 4KUCF 4Z3HA 4ES8A 2EYRB 1CLYH 3PWNA 2N0KA 1HHJA 3QDMD 4WFFD 4EIGB 4K71B 2Y06H 5T8IA 1ZSHA 3BN9D 3BP7A 4QAMB 3EAKA 3BAEH 4KK8D 4G7QB 4LRNL 3MN8A 1RJYA 1NGQL 2IFGA 4PJ8C 4BH7B 1JHLH 1JNNH 4F91B 2NQ3A 3AACA 4WO4D 4X2UA 4ZSOB 3GQFA 3WTYA 1USQA 2DQHH 2X6UA 4UBDC 3QUXD 2A6IB 3V95A 3OLEA 3G6JF 1HOEA 3G5XB 4PREB 4KROB 4YUEL 4GRWH 5E51A 5AW2B 3V2AR 2GITA 3EJZD 1P0SE 4L8SB 3MBED 4IRJB 4A63A 1UJTA 4QHNA 3WS6A 3CDZA 3GSWB 3Q9PA 4Q52A 3O6FD 3BVNA 4H8PA 5ICUA 3BZFB 3V4UL 3KAAA 1CDBA 3AJ7A 1NEZG 4K5OA 2HYMA 4R2GB 1NIBA 2QHLA 2CIKB 1NIAA 3RTQA 4E41B 1A4JB 4KI5F 2PMZA 5DYOA 4U0RB 4YHLH 3H0TA 1KSRA 2VZVA 3K80A 1E9OA 3LQAC 3NIGE 1KCRL 4XBEL 5EBMB 1YZZA 3HC4H 1RZPA 2GJZA 3D7PA 2IANB 1DQMH 4GO9A 3DO7B 2B15A 5E6UB 4U1IB 4Z0XB 3QZBA 1BBDH 1JFQH 4YSRA 3EFOB 4JY4B 3IFLL 5I1JL 2MNJB 3EO1A 3RVXD 2GK0B 4KOBA 4NN5C 5MERB 3FB8B 5C70A 4XCFL 1VENA 3HE6B 1NCDL 3O3BA 3OTTA 2QVIA 3BPOC 3UTPD 5GS3A 2DBJA 4LLWA 4GXUN 5FUOH 2IBBA 3GS4A 4FI7A 2VXTH 3RWJB 1AP2A 3JTSA 4I1PA 2BVEA 2QR0B 3L4ZA 5AW5B 1AJ7L 3IETA 2OM5A 5FO7A 4WUKH 3ZY7A 5SWSB 1G1OA 4P46B 4Y9BA 5DURB 3SBWC 1QKZH 3TASA 4DGUA 2DM3A 3TS8A 1SM3H 4RAUA 3WS3B 5F7AA 3AU1B 4YHKL 4X6FA 1GJWA 4K2UH 1NUNB 1J9QA 1FZMB 1ZV9A 5DUBA 1HL4A 3P4NA 3FQUB 3GI8H 5KVFE 2YGOA 3DJSA 4CDGC 5EU3B 1HSAA 5FYLD 4BE6A 3INUH 4FL4C 2FT6A 1ZLUK 1BQHA 4HUUA 1W0WA 3OKMB 1X4XA 3MV8D 3NRQA 3KPLB 1FCCA 2BCKA 5IVXF 5E08L 5D4JA 5ENWB 2VM9A 2PYEE 5GSRA 4NQEA 4F9PC 5CBEA 3HZMA 5LN4A 4FFZA 3GBEA 1S7VA 4J3VA 5FYJE 5GS2H 2YUWA 4B9ZA 2E4TA 4MSWB 1PD1A 2MKWA 3B37A 1HHHB 4R5TA 3AB0B 4FLQA 3B56A 1PZ3A 2R2BB 1Y0LA 5B3JF 3IJYA 1NC4B 3BD3A 2EYTA 2JB5H 1CI3M 1JI1A 3MJ8A 1MSPA 2BFVL 3MLZL 4OCWH 1Q9WB 4PMFA 2RMNA 4P4RB 2B59A 4IOIA 4PJFE 3FQXA 3C5ZA 3EXLA 4BZYA 8FABA 1WITA 4LLQA 2CR6A 1KGCE 2J5LB 3EOYG 3DWTA 1U91A 1H8OA 4GOSA 4MAUL 2CH8A 3V9EA 1SY6A 4LVHC 1MHPH 4YIQA 2OR9L 3MV9D 3OC5A 1S7UA 5F9JB 4D8PB 4WI0A 1TZAA 1RIVH 3NCXA 4F7EA 3QI9D 4KO7A 4XMWA 1S3KH 4N2NA 3BFWA 1OWRM 4ZFOA 3K8KA 2XZCL 3LIZA 1G7IB 4K3HA 4ZMLA 1HZKA 4RNRB 4R0LC 3UH8A 1GW0A 1Q0YH 4PMEA 3MTXA 3UG3A 3QCTL 3VFRB 4R8WL 5LGHH 3DYPA 1QTYT 4TSCH 2G3MA 2LU4A 1XSOA 2WXQA 1LO2H 3BUBA 1JF1B 4HPHA 3BKCL 5K9QI 2R4RH 3C6LC 4GW5B 5F96L 1H9VA 3DX8B 3OGCA 5BXFB 3T0ED 3TN0B 2E59A 3LD8B 1A9EA 2O93L 4JVPA 5FX3A 3KJ4B 2VN3A 4JFWA 2E27L 4KZCA 3V55A 1I85A 5PCYA 1BREA 5KSAA 5C0DB 3O0LA 1VEMA 1VIWA 2JI2A 4AYMC 3V4VL 4AIOA 2FX9L 1KIPB 3EYQC 3F62A 3NJIA 3KGTA 1GJUA 3L1GA 3EJYD 4UNTA 1HU8A 3QFJE 5I1HH 3HHSA 4HLJA 3CG8A 4WFHE 3DO3A 5HGHA 4WENB 3QWRD 4KXBA 2VUYA 5TE6L 3RWGB 3QDJD 3FHAA 3GBNH 1NOLA 5ESVB 2CGRH 3O6LH 2V2WA 2UX7A 1M3JA 1TU2B 1P4IL 3G08A 3U4BL 2WAHA 2BP8B 3MLPA 1OGAB 3PP4L 3L08A 5C08E 3NZHH 3WNLA 2JELH 1VGKB 1X5IA 2A4CA 3CX5J 1ADWA 3CFEA 4A2EA 1U8OB 3V4VB 4FFWD 4YXHL 1TF4A 3THML 3UG5A 2VLRB 1MNNA 3CFDB 3D2UA 5LBSH 1GGTA 3E6HB 2WK2A 4WFGD 5FOBA 5HI5C 1CT8A 5IOPB 3V5HA 1CZ8H 5F7LB 3VG0L 2BY2A 4HAGA 4A7SA 4LSSH 3FRPA 4AWJC 4QTIH 3GM8A 3CMGA 4WUUD 2YD2A 4BK5A 3SDAC 1D7CA 4Y4HD 4UQEA 5LB1A 4A7QA 3BZDA 1I3GH 4BFIA 2BRRH 3B8YA 3FSWA 1HQ4A 4HHWA 1UD8A 2F8XC 3SDYL 4YDJB 3U9WA 2OSLA 5ANMA 3V9CA 5D7IF 2J88L 2DBLL 5DJXB 3VSTA 5M95B 3CZUB 1XF5B 4JREC 4OQTL 5E95B 1LXMA 1OIOA 1VF5C 1M1XB 2R9HC 3H8NA 4JRXD 4QHKJ 1ETB1 4P57B 4WTQA 3QRBA 2VOTA 4LRNH 1NGQH 4Y19B 5FWQA 4LPVA 1BZ7A 3VVWA 4XMVA 4GSQA 4GIOA 4Z6AT 3L3OA 3IBEA 2ZCKL 4N9OB 4BSWB 2AJXL 4RQQA 4KJPD 4A2HA 1RERA 4Y5VA 3L1OL 1C08A 4JVWA 2CBMA 3FQWA 1LK2A 2A83B 3I6GA 4Y1AD 4I7ZC 4O51B 5JMOC 3PL6D 1K8DA 4MCZB 5CR1A 1PNDA 3V4UH 3GXTA 3VH8B 2VQ4A 2KZWA 3L9RA 1VZGA 2NY2B 4ZTEA 3L54A 5GGQL 1XXFC 1ZGLB 4CL7A 1HCZA 3EFDL 4XBEH 1KCRH 4G8GB 4OF3A 3E9UA 5BCAA 3QWQB 3E38A 4P2RA 1O0VA 1TKWA 4ZW3A 3ABLB 4X6BB 5DJZB 1ZLDA 3QPXL 2QADD 4Q9QL 2JK5B 4Z3GA 1NMAL 1VAHA 4W68A 2VQTA 1RL1A 5BRZB 4NQUA 1JWMA 5AB1A 3IFLH 3PGDA 4KRMB 5GGTL 1X4YA 4Z7WA 5IJKC 3GWJA 1GGCL 1MFBH 1DFXA 3UZQA 4D9QE 4XCFH 2V7NB 4MDJB 4DN3L 1BVKA 4HCRH 3LDBB 1KJMA 3U36B 1NCDH 1NAML 1CE6B 4HC1L 5JIIA 5ETUA 2CRYA 3VRJA 3QDME 2DTSA 4WFFE 1OTSC 4Z7UF 4PJDB 4EMZA 5E6YA 4Z23A 2GTWA 1AJ7H 5DQDL 2EUZA 3T04D 1RK7A 3IU4L 3KPRB 3MGAA 3O6KL 4NCC1 3SDXA 4K7PL 4B41A 3GMOA 3BXNA 4LK4A 5F88A 3PHOB 3DV4B 1XH1A 3MGTA 1IV8A 2AEOA 4NAMA 4KFMA 2VKWA 3P0VL 3KVQA 4YHKH 4FJYA 4MVBD 2BCMA 3G04B 3EH5B 4P9MH 1F6AB 2W65B 4FMKA 3TIDB 1F6FB 4LNRA 4MQXC 1I9JL 4QPEA 2FYVA 1LP9A 1S9WA 1R33A 1P7KA 2FHBA 4KZEH 3QZWA 1HYSC 5F7FA 4DP4X 4D0CB 4PGZA 3PPSA 32C2B 4FQIL 4GG8A 3KNBB 3EDEA 5T1MB 4TM9A 1S7QB 1AVAA 1EAPB 1MQKL 1SJEA 2WMPA 4GBXD 4NT6B 5JIKA 5H94A 3QORC 3D12B 1ZPUA 4B27A 4XO5A 5C0GA 3TBYB 3L3DA 2HFEB 3K74B 2V5YA 2IADA 2A77L 4O2FB 2V7HA 3V10A 3D85A 5F7MC 1B3JA 2KYIA 1W80A 1ZT1B 2NZIA 2BOCA 5FW7A 1RURL 4NFDA 3K71A 1N4XL 2DV6A 1KCSL 1PZDA 3MLZH 1U3HD 3S37X 2WOBA 4PB9L 3UTPE 5B1CA 5I23A 4LMQI 5TDOA 2QT6A 2Z31A 1KFAH 5KSUB 3LSOB 1YUHB 4ZS6D 4XP9L 3NRFA 4K5NA 5EC1A 4AUYA 5F3BA 1CQYA 1TEYA 1XFPA 4MAUH 4PLKD 2XSKA 2OR9H 5MENA 1WC7A 2XN1A 4YPJA 3FCUB 5GZNC 2V3FA 4P3CL 5I28A 4HMCA 3M8OH 3C5XA 1I1AC 3CX5K 4YEFA 1PZ2A 4PJ5A 2GQHA 1TVDA 2XN9A 2H3NB 3WIFA 1OSYA 3F12A 4XPGH 5DD1H 3AGVA 3RNKA 5FFGA 5CD5D 3QCTH 3S36X 2DWSA 3FSVA 2DQGL 3Q8AA 4R8WH 6FABH 3ULVC 5DQJB 3N40F 3KGSA 2J5WA 5D8JH 2DQEL 2IIJA 3P3UA 4Y7OC 2WWMD 3ZE2E 3BKCH 5FYLE 4OZHE 4HIXH 4YR6A 1PTZA 5B1AB 1QR4A 5F96H 1C12A 2PO6C 2DM7A 3SYCA 1E3XA 3MV8E 1F8TL 4LLUA 4NQCA 4LLMB 1XD1A 5MEQA 4E0RA 2D7PA 3QXUA 4XMLL 4X5LA 2E27H 4Q6YA 4NZRL 3SDDD 2C9QA 1MAJA 5T3ZL 3ZRFC 1KYFA 3RUGF 3KLLA 2V2XB 4CNIB 1BEYL 3T2PA 5EO9A 2FX9H 1KCUL 4MQ7B 3LIZL 4ZMAT 1ZKAA 5SV4A 1X5YA 1GIGL 1LEGB 4KKCD 3MMEB 4WWKB 4XNMA 3OSKA 3TVMC 1E5ZA 2DYRB 43C9B 1NCAH 2CRIA 5DDHB 5TE6H 3K91A 4A67A 4LT7A 4XXCC 2RFXB 4R90L 4CW1B 1P4IH 5C3TA 3U4BH 1GL4B 1OF2B 4BFEA 9CGTA 5MHSE 1HXMB 2VQUA 4NO5A 4LVOC 3KD4A 4DQAA 2IPKB 3N42F 4YXHH 2R15A 4HWZB 5KVDL 5KYUA 1FLRL 1WUNT 3LJ3A 4PJ9A 3SKUD 1RZKL 2IPUG 3OBAA 2KLRA 2OS7A 2RALA 3V4LA 4LDLB 3VFWB 3BAWA 2I7OA 1MZYA 2DMGA 5CWSB 4FQXB 3AWGA 2GCYA 5D5ME 3VG0H 4D0DA 4F8LA 1G6RA 1Z1WA 1KTDA 2FQDA 2VDQL 3RGVD 1QWNA 2EEBA 1CTMA 1FPTH 1RPKA 4F5CA 4G7VH 1DJXA 3ZZQA 3T0EE 3V7MA 3SDYH 1F18A 4GG6B 4RMSA 2H0EA 4E2OA 4M43L 4UM9B 4GQPH 2F0CA 1MCJA 1UC6A 2DBLH 4LAQL 5ICYB 2XXGA 1DO6A 2AAAA 3I02B 3Q5YA 4OQTH 5KYYA 4QXVA 5BQ7B 1ZXQA 1NKGA 4Y0GA 4NOBA 1QX1A 4S10A 5HHOA 1VKXB 4QMEA 1P9MA 2D8KA 2ZCKH 3QULB 4WI9A 4YDVA 1RZ8B 1HHKB 2AJXH 4HLZG 1NGYB 4ZBJA 5BZXA 1CR9L 1T89C 1CBVH 3L1OH 5IT2L 4W70A 3U2SB 2A73A 3W9EB 1E4XL 3PWLB 1KXQE 2NLJB 3HMXL 1ZHLB 4PHXA 3QDJE 3BPLB 2NZ1A 1AGDA 4BRJA 5J4MA 3D3VA 3RTLA 3RWCB 3CC5B 2PW2B 3NJVA 1BAWA 5C0JA 3HE6C 3IDYB 2NY0B 1GAFL 4HHAB 2R2HB 2R7EA 4Y4KB 5GGQH 3TT3L 4C4KO 3EOAA 2XY2A 3MACL 3NPZB 3QNZA 4M03A 3EFDH 4YXKL 1JXFA 4DIXA 2F1AA 2W38A 3GSUB 4DPCX 3UTTE 3NK3A 5C0FB 4DUXA 3QPXH 3ISWA 4X98B 4IK7A 5A2BA 4JM2C 4Q9QH 1U8LB 1WZ1H 2PCPA 4Y8AA 1NMAH 4N22A 2KQNA 4WFGE 4PQXA 2CO6B 3VD9A 3C8KB 5F7DA 4NN7C 5E6ID 3GMQA 4KTDL 3RZCD 3OKNB 5B39G 3ME0B 5I1LA 2KC0A 1NCGA 4Q14A 1A2YA 4NNYA 2OQJA 3P3SA 4A37A 4ZMXA 1AHMA 1A6AB 3MLTA 43CAA 1BQHG 2JCCF 1YN6A 2UXGA 5TF1H 3QEGL 4PSRA 2GFBA 4W9EC 1NAMH 4HC1H 4K3DL 1JNLL 3HR5A 1A9BA 1AZUA 4GEJA 2IALB 4JRXE 5TH2B 1E6JL 3LKRB 1TEFA 1DQVA 1EH9A 1FNFA 2FSEB 4NYLB 3QDAA 5DQDH 3VFSB 2GSGB 3IS0X 1P7QA 1SHWA 3IU4H 3O6KH 4BHUA 2HT3D 1FC1A 2WIIB 4ODUA 4K7PH 4X83A 1O7VA 2VXUL 3HZKA 3NJKA 4FTVA 1SEBA 4H20L 2XACC 1XL4A 4OT1L 1E5AA 3UZEC 4JY6B 3VB8A 2J4WL 3P0VH 4N0FA 2ED7A 1YYML 3SGKA 4J27A 1MXGA 1T66D 4PV8B 4EUPA 1WIPA 5F9DC 4W9ZA 4Y1AE 4HK3J 4PJXA 3BSZL 1I9JH 3L95B 2AP2A 4DOHB 1DVFC 3T6WA 3ZR6A 3WU1A 4H8QA 4ZTPL 3RRQA 1NICA 2QPFA 3O8XB 1S78C 4IIZA 3RJDA 4FQIH 3EG9A 2ATKA 3I3BA 5EU6B 1R3JB 2XXCB 3ES6A 1G4RA 1GGIL 3FULA 4GW1A 3DMMB 2J5LC 4JFYA 1MQKH 4BZ1H 2ADGA 1HL9A 3F5WB 4QHLA 1AZRA 4FQPA 3MRHB 1FAKT 1P6AB 3LEYL 3PGCB 4AEFA 5KS9E 1RUAH 3NJGA 4S1SL 5HHNA 1CXFA 2COVD 3JWDL 4PP1C 3D25A 1PGRB 4PD4J 4K94L 2A77H 3APDA 3BLPX 2I25N 3H7BB 2B14A 1KJVB 5CJOL 4P5KA 3KPQA 1RURH 1JGLL 1N4XH 2FIKA 2VLJE 3TTYA 1KCSH 1F1DA 5E4EB 2WGXA 4XN1A 3WHE0 1UCBL 4NM8H 1HK6A 3LOWA 5IMOB 3IKCB 5LNDA 1HXKA 2FH8A 4U1KA 4XP9H 3IPBA 4HS6B 4YSSA 4JZNB 4R7DB 3IYLW 3FH8A 5I76B 1E42A 4WW2A 1Z9MA 2W0FB 1DEEA 4P3CH 5IB3B 2TAAA 4XNBA 2Z9TA 4M8QA 1BPVA 2J8UF 5FC9A 3GI9L 2I9LB 4PWJA 2W5PA 4QO1B 3HRZB 4PJIA 4P4KD 4PI0A 2FEDD 2ICWJ 2OL3L 4OGAC 4JZJA 1TSRA 4UT9A 3VXOA 2DQEH 3QIBD 2DLTA 5I6NA 5KVFL 1TTAA 3MCYA 4DN4L 5DHVB 2BO0A 4L1HA 1D7BA 5EF2A 4AIZA 1AR1D 3M17A 3UTSD 4PY7A 4RGNC 2IDUA 1F8TH 4AQEB 2MMXA 5A2CA 1SY6H 3OM3B 5A2JH 4XMLH 3T77A 4KRNA 4K5PA 3KCWA 4W9CC 3VFGH 4NZRH 3S2CA 3FXIC 5T3ZH 3VXRA 3L5XH 2ALWA 5CJXC 1BEYH 1C5DB 1S5HA 1U4EA 4CC4A 3GSQA 2AHIA 1KCUH 3LIZH 2G5BA 5KYWA 1MWOA 5FYJL 3L3GB 5D6CA 1MG3C 1A4BA 2QELA 5BS0A 3FRPG 3VM7A 4BFKA 5JPNA 4LSDA 2YD4A 2Y2YA 1MVFA 2WYHA 5CGYD 1GIGH 1RAMA 4IOFC 2OMWB 3PPEA 1FAIL 4W1TA 1F4XL 2UZXB 3BDXA 5AW7B 5HY9A 5D7JA 4I0KA 1JXKA 5B8CA 2NY6D 5HYFA 4R90H 4RRPA 3RVUD 1OCCB 3QDGD 2SEBA 2XV2A 3FOMB 4GRLC 4POUB 4WV1A 1EXHA 1PU0A 3TBCA 3I9GL 1RY7B 3PAYA 5E7FA 2BXYA 1COBA 3BH9B 4GLRI 1UKSA 1N26A 3T4AC 1MKFA 3TBWB 1IEBB 1TENA 5IKCA 1DUZB 3F7VB 4MLIA 5KVDH 1JK8B 1FLRH 1AOHA 1RZKH 1A47A 4IIQC 1CDJA 4U1NA 5JNYA 4ZT1A 3GT6A 2D3NA 2OW6A 2VQ1A 3RG1C 2VDQH 2GHZA 1I1RA 3HB3B 2HT4D 3KCPA 4ZD3L 4W9KC 2CO1A 3U83A 1IILE 4XPHL 4YHOL 1FFPA 2XPGA 3DIDA 1Q8MA 4N2KA 1VPOL 4QDGA 3ECQA 3K0YA 4KNTA 3I75B 4P06A 4M43H 3SDCB 2EP6A 2ZXEB 3D8MA 2J44A 4RAVA 4LAQH 3X3FL 1ET7A 1X6LA 2EYSA 3B8SA 4ELKB 5FB8A 2NY2C 1A22B 1WEJL 2J2ZA 1YPZA 5ID1B 2YUXA 2M1KA 3UDWC 4B9GA 2PWDA 3BVXA 2XA8H 3CFJA 4P23B 3U1QA 3Q6GL 3ZHNA 3GPEA 1OB1B 4YSDA 3HVNA 5AW1B 1K8IA 2HG5A 3PCYA 5AVWB 1X5ZA 2DL9A 3NQKA 1ZS8B 3X1FA 4BIKA 3FT2B 2HMIC 3F7QA 2ZUUA 2Y6SD 4GT0A 1CR9H 5IT2H 1F3DH 4LHUD 5E9DD 5HYSB 2LOEA 3B9KD 5I8CA 1E4XH 3PDGA 3FO2A 4AVHA 2NYYD 5AZ2L 2HAZA 4UZUA 1BM3H 2NZ9D 5K69A 1ODAA 4F80A 3P9MA 1JGUL 2ZOKA 4HBQA 4XWOC 4B60A 4KDTA 1B0WA 1GAFH 1T21B 1X44A 3B2UC 4DGYL 3NIFF 3BW9B 1R4XA 3TFBA 2FECL 1T6BX 2Y5TA 3MACH 4L2LA 3WEBA 2BX5A 4YXKH 2E6JA 4X5XB 2G9KA 2FLRT 2VR5A 2ADFL 1JRHI 4FHJA 4B50A 3G7TA 4HW6A 1KIRB 4HSCX 1BQRA 2BS9A 2CLRB 3IFNL 3QC5X 3SO5A 4KTDH 4X4MA 2UY7B 1RVFL 4FCHA 4EI5D 3QZWG 2EUWA 4WJ5A 1KGWA 5F1SA 4I88A 4PD4K 5E9AA 1GSMA 2ADIA 3RJOA 1ZA6A 3S7GA 5F7HA 1QO3B 3LQZA 3REVB 4OF7A 2VSCA 5D1QA 1DBJL 2O6EA 3QEGH 4NSKB 3CV5A 3GHEH 3VD7A 5C08B 4AYFB 1TZHB 1JNLH 4K3DH 1SDYA 3WMSA 3KGUA 2LTQC 3VFVB 1B0GB 1UH2A 1E6JH 1JUFA 3N0PB 4DP8X 1OPOA 4HWNA 1JZJA 1PAZA 3EBIA 3VU2A 3B5GA 2VXUH 1VZHA 1T83A 5DJ8A 4H20H 4MXVE 1UXWB 3FHEA 4OT1H 5E5LA 4YSUA 1HINL 5A3IC 3WN5A 1IT9L 2J4WH 5IY5B 2UWEA 2ZXQA 3M45A 5DHXB 3CX2A 1BCIA 1HXYB 3IDMA 4NO0A 3RB7A 3MX0A 1CG9A 3BSZH 4HISA 4KC3B 3JBG7 4YHYB 2FR4B 3TJHC 4TUKL 1N8ZA 4U3XA 5AL8A 4HPOL 4ZTPH 1IEAB 1ERNA 4NZ8A 3UERA 4YPGB 2RD0A 1VJSA 1GR7A 4JANA 5IQOA 3OKLA 1JYXA 5D4HA 3WL9B 5F1IA 5AZUA 5JHDD 1GGIH 4UU9B 1IO4C 3SCMB 2K6WA 4I3GA 1IC7L 4QRRD 2VO5A 3FRUA 2HCZX 5JQ6L 3M1BA 4CU8A 1T0OA 1MHHA 4S1SH 2WV3A 3JWDH 2XWEA 5B1JA 1CFTB 2J6EA 5GISL 4K94H 1G7LB 1MDAA 2EYRA 4C4BA 4X9YA 3CDGB 3RWEB 1NUFA 3OKOB 1JHKH 3BKYL 5CJOH 3EYOB 1IFGA 4N0CC 5AYTA 4ESKA 5AOIA 1M57B 1J9CT 4BUHA 1MAKA 4BH7A 1JGLH 1DVTA 4LOVA 2AJZB 1FLTX 2OAAA 1MCOL 4ZSOA 2OK0L 4XBGA 3AXHA 1IQWL 1GKOA 3G5XA 4HMDA 4PREA 3FT3B 1HWWA 4N86A 2P80A 4L8SA 4IRJA 1AMYA 1IGYB 4FAAB 4HPYL 2Y24A 2ENQA 4NC1C 4JVUA 4BCYA 1LWHA 4WU5B 1BXVA 3GSWA 4J8QA 2ZICA 1OHQA 3GI9H 4GPVA 5T3XH 2CIKA 2B1HL 1A4JA 4ZZKA 1BG9A 1UYWL 1XGTA 2EACA 5EBMA 5KBLA 4WGKA 4DPAX 4LGSB 3RX8A 2OL3H 5C71A 2IANA 3DO7A 4JHUA 4KMTL 2X09A 4DN4H 5FYKE 2DIAA 2YN5A 5GGUB 1X6NA 2V5MA 2IAMD 4JY4A 3KG5A 2JCWA 2GK0A 3ZLQC 5MERA 1SXZA 4XNAA 2ZG1A 2DMCA 2QPSA 4WO4B 1BHGA 4B9CA 3FS9A 3IDUA 3DSFL 5FV1L 3QUXB 1ORQB 1VCAA 2AXFB 5FYJH 3GZQA 1VFAB 1U8HB 2Q7NA 1C16B 3LNHA 2DQUL 4GQRA 2VJ8A 3SYAA 3WE6B 4ZMTA 1TFHA 1E2ZA 1OLLA 5HDBB 2QR0A 5ESAB 4PJEE 3G6DL 1SN5A 1ZIAA 1F4XH 2V8MA 4P46A 1I31A 4LEBA 4BFRA 3TPUB 2CD0A 2WWOA 2YAFA 5INDA 1FIEA 3ZRCC 3M86A 1YEIL 2Z8VC 5ACLA 3AU1A 4G5AA 3TWCH 3D0AA 2XZAL 4XT1C 4G6FD 3I9GH 2WSDA 5BZZA 2IBGA 3A4AA 3SKNB 3RB5A 3QDHA 3OPZL 5K59E 2AS5M 4NN6C 3FQUA 2FJSA 1KPRB 1U93B 4XXWC 1ACCA 4LCIL 3TF7C 2ZUSA 4IGBD 5C7ZA 1RZKC 4B3VA 3UGUA 3OKMA 5F0PB 4MYPA 3KPLA 4XB8A 1KTCA 4CBZA 2DH2A 5ENWA 4G7YL 5CHNB 5D1XB 4M5YL 3VGAB 1NM4A 4JHBA 4ZD3H 1U8KB 4G8EA 4ELME 5I6KA 1NJ9B 3BGFB 4L48A 5G4MA 4XPHH 4YHOH 2ZZUT 3N2JA 4HS8L 4YDKL 5FYLL 5I74C 5FCUH 3UTSE 1M3IA 2OFQA 3T2LA 2GTQA 4MSWA 1WF5A 2ZKHH 1HHHA 1OM3L 4MB3A 3X3FH 3VXNB 5JW3H 2R2BA 4ZO8A 3AAZB 4KXZI 2KKQA 1WEJH 4AMKL 3M1OA 2YD0A 2IPUK 4P4RA 1EZVX 4OZFB 3NFSL 1TITA 3Q6GH 3ZX1A 3ATDA 4HLEA 3DJZA 1KGUA 4G80B 1AY1L 2WXLA 2Z35B 2ZPKL 3S5YA 1OSZB 3PV7A 5DS8B 3HW7A 3RY6C 1EJ6A 3WTUA 1JDDA 4XN5A 4F3FA 2WXIA 5F9JA 4D8PA 3DPDA 4EXKA 4Z3TA 3E0GA 2GABA 3US9A 4BK5C 4DP5X 3LZOA 4FQHB 2AK4B 4WI7A 5D2NE 3WKML 5AZ2H 1EEZB 3QJUB 4TLSA 1ZWIB 5JHLA 3UC0L 3QDGE 1G7IA 5KJ4A 1ET8A 3GJFH 2FWOB 2NR6A 1NDGB 2VKXA 3MV8B 4RNRA 3AGWA 1JGUH 4ZJ9A 1XR8A 2P5WD 1LQSR 2B1OA 1TQBB 1WZLA 4DGYH 1F3DJ 4YO0B 5DFVD 2Q86B 2D31B 3QFDB 3VGDA 4F93B 4O5LL 3UCRA 4JFUA 1RHFA 3QIUC 1I53A 1L7TH 2A9MH 1XH2A 4RBPH 2JJUA 2ADFH 2OA9A 4GW5A 1OE2A 3L3OC 2NY4D 4EUPG 3TN0A 4FKKA 3TNMB 3VFNB 3S4SA 3IFNH 3T0AA 3H2PA 1RVFH 4HJTA 1AS7A 1ZT4B 1JPEA 1WBZB 5C0DA 5D93C 1JZDC 4WKZB 5ICZB 2R4SL 3P4OB 3QZNA 1DBJH 4X7EC 1RZQA 3J27A 4N8VB 1NZRA 1F4WL 4ATTA 1T6VN 3ECBA 3DTXB 3N0AA 4KUCD 3MV9B 3QHFL 3FO1B 3F8UB 1H6UA 5CZXC 4KK6C 3AT9A 3QI9B 1D5IL 2YQ2A 4MMYA 1J0YA 4JX0A 1U8NB 4U1SB 3BRGC 3RWGA 1SPDA 2PR4L 5JPMC 1UQSB 5ESVA 3TJPA 3C5SB 4J3UA 4OZGB 1I9IL 2D73A 4PVMA 2BP8A 1OGAA 2G75B 1G84A 3WTXA 5C07B 4P5SA 1HINH 1SXNA 3NFNA 5AVQB 1IT9H 1VGKA 5EF1A 1OOAA 1INEL 1HI6B 3C60D 1I8MA 3NIDB 1U8OA 1QNZL 5F1NA 5I5RA 4JQIL 4CSPA 4UQ9A 3PJNA 4KK9C 3O4OC 4TUKH 5IJVB 4HPOH 2VC2L 3E6HA 5EZOL 2H1PL 2IVFC 4YBQC 2RACA 5IOPA 4PJHF 1R9FA 3MRKB 1BMZA 2DWDB 4KI5D 1F3RB 2WP3O 3K3QA 1BYOA 4CADB 3K5SA 1IC7H 2ZCZA 1PZCA 5KG9B 4NAJA 1UATA 1C5CL 5D71H 4NZUL 5JQ6H 4HXAL 2CBOA 3GO1L 1E27B 3SPGA 4YDJA 5ALCL 1PY0A 1HIMH 3JWDC 1HILA 5F70A 5GISH 4K94C 2AEPL 1S7WB 5DJXA 3H1ZA 1AO7D 1XF5A 3BKYH 4EUPH 4P57A 5GRUL 1C7SA 3QDJB 4AQ1B 3DVGB 1PZ5B 2KZKA 3HRZC 2MTPA 1WAPA 4K7PX 2EEAA 4KDWA 2MIZA 5B1KA 2ZSWA 3L48A 4BV1A 2OK0H 4BSWA 4U4BA 2FNWA 2XLLA 1IQWH 4FXGB 3WJJC 2X2JA 4F2EA 2WQVA 1JFHA 5I6OA 1R3KB 2XBTA 2GC7C 5IK3B 1R5IA 1ZT7A 4GAAA 1Z5YD 4R3SA 1KEGL 1HCVA 1GZQB 1JN6B 4O51A 1BWMA 4AGMA 3PXLA 4H0LC 2H3KA 2XQBL 3C6SA 2R8SL 1ZVHA 3VH8A 3IXAB 4D3CL 1OY3B 2FDBP 1BA9A 2B1HH 4EVNB 1ZGLA 4JR9L 4WUUB 3W81A 4YSCA 1CI5A 3GJEB 1UYWH 3EZ8A 1N9PA 1WK0A 3QEQD 3P40A 4G8GA 4NNPL 1MJJB 3QC6X 4RRPG 1SHMA 1KTJA 2DAVA 4HZAA 5C0AB 5DJZA 2WZPA 1HCFX 4I1NB 3S5LB 1CE1L 2X2IA 4KMTH 1GKEA 5SWZD 3UP6A 2JK5A 1NIEA 4XX1E 3QIWA 3ARED 3R8QA 5E4IA 1FL3B 2XICA 3NGBC 3FU5A 3BVTA 2XPYA 2AI0L 5BRZA 2JXMB 4F24A 1SMDA 5JHDE 5EV7A 1KDIA 5T5NG 5KOVC 2XQ0A 5SV3A 5J13C 1T5WB 2A7BA 4QRRE 4KKLD 1CD8A 2V7NA 1BZQK 4MDJA 1J12A 2LAGB 1CK0L 4OFIA 3DSFH 2F15A 2XY1A 1G7QB 3BVVA 3P1VA 1CE6A 4KO6A 1CICC 1BXAA 3IM1A 4DP0X 5B22A 4B9YA 2GBTA 2DQUH 2ZUVA 4XBMA 3SHSA 1OE1A 4Y1AB 5MEOA 7PCYA 4IKLA 3KPRA 3PL6B 3STZB 4BSVA 3RVWD 4ENZA 3HB3C 4FJ6A 5JYLA 2PTUA 5EUKB 4DK6A 3GB7B 3DV4A 4QRQB 3I6SA 1F86A 4FCAA 1ZANH 1GC1L 1LM8V 4Z7OE 2XZAH 5SWQA 4PJAF 5E6ZA 3A67L 2NW3A 1F6AA 2W65A 5E7BA 3VRLE 3WJLC 5ES4B 1U3YA 2WIMA 2YO3A 2X2HA 4R7XA 2O30A 4LCIH 3SQOL 4Y9EA 5IHUL 4ZX6A 1EWHA 2EDTA 4P23C 1LEKB 3OF6D 4D0CA 1N6QL 2A38A 2ITDB 3KYOB 4K23L 5T1MA 2ZAHA 2VDOH 3LQMA 3EHBD 2R2CA 5D2LA 8PAZA 3BMWA 1S7QA 1EAPA 5JHMA 5DJ6B 3L1EA 4Y2NA 5INCA 3O2DL 4G7YH 3TBYA 5IEKB 1TZGL 4HS8H 2HFEA 4YDKH 5C8JB 3ZQXA 4O2FA 4P2YA 1OM3H 3EW3B 1SVCP 1JBJA 4JKNA 1EUUA 3UAJD 1ETA1 2QHRL 5DS1A 5KVGE 3ARDB 3MOAL 4QOKD 1UM6L 4AMKH 1S7XB 3NFSH 2BVTA 4B9FA 4AQZA 1MPAL 1AY1H 1YUHA 1CFVH 3LSOA 5KSUA 1NGXB 4RFEA 4XX5A 2LHAA 4DQOH 1NBZB 2JQAA 3V0WL 1KZQA 4O2CA 4I48A 2A9NH 2NY1B 2ZUXA 1KN4L 2XWZA 4PWEA 2V37A 1CYGA 5JDJA 1JZ8A 4IRSC 3UC0H 4YE0A 3D39D 1RUKL 5JORB 1BOGB 2H3NA 3VMOA 3CN0A 4X6CB 4GBXB 1ED3B 3LYRA 2A4EA 3HVDA 3K8MA 4QIRA 3GXUB 3WO4B 5JXED 4XN2A 2K3HA 2MTAA 3FTWA 4MS6A 4O5LH 3S8GB 4P9HH 3UPCA 2FO1A 4J3BA 3NSYA 4I1RA 1UT2A 4WU7B 1GHFL 4QRUB 4Q7DA 2ZAIA 4LLMA 5LGKA 1XCTB 4ZPTA 1IIIA 2X0WA 1AZCA 1L6ZA 1U3HB 3EYFB 4EZLA 1M05B 3BAYA 2V2XA 2D3LA 5JHLL 4MQ7A 1S9XA 1LK3L 2A5UA 1YMHB 4ONFL 2R4SH 1KCVL 1J5HA 2Y72A 5BW7A 1PIGA 4YHYC 1AKJD 1TZOA 2CUMA 2DKUA 1IM9A 2OI9B 2QKIB 1BDYA 3NP3A 1F4WH 4FFTA 1I7TA 2OMZB 3V5KB 1CL7I 4JFDD 3L8QA 2QLYA 4KKRA 5TGBA 1LEGA 2V5TA 3E1F1 4WWKA 6CGTA 1D5IH 1K3IA 3CN3A 43C9A 3KPSD 5L9DL 2B8OT 1T0PB 5DDHA 3WUWB 4FGMA 4M1GL 1B4TA 2PR4H 5DLLA 2RFXA 3JYCA 4AMXA 1IEHA 1OD7A 4CW1A 3IGAB 2YXMA 3V0GA 1OF2A 2WWKO 3SE9L 2EIMB 1A6TB 1INEH 1Z9LA 3RIAK 3UBFA 2HLEB 1E2VA 1E5CA 1QNZH 2KUTA 3OG6B 4LO9A 4JQIH 4HWZA 2ZX9A 3RDTC 1MRCH 3LCYA 1KT2B 3UPAA 2VC2H 2P5WE 3VFWA 3N44F 2CK0L 5EZOH 1UA6L 2H1PH 4QUOA 3LS5L 4AYBA 5I71B 3GSVB 5CWSA 4FQXA 1Q72L 4GY4A 3SE4C 4DT2A 3SDDB 5BNXD 3KPTA 1TMCB 3F3HA 4QT5B 4XNZC 2ED9A 2XWJB 2APBA 5CAYB 5EUOF 1FORL 1JIBA 2MQ0A 2R69L 4HXAH 3GO1H 4XWGL 5ALCH 4GG6A 2PXYC 4UM9A 2VMFA 2J1YA 4O58L 2E7DA 1DZBA 2AEPH 4N0YL 3I02A 2X3AA 4MFHA 5EO0B 1Q0EA 5GRUH 2NSMA 3NCJL 4PRNB 4IBVA 2G5UA 2WPGA 2YLHA 3N3EA 3QULA 2EABA 5CGBA 2NXZC 1T03L 4ZNCD 1HHKA 4HIJB 3ZYZA 1EAQA 1K6QH 1RHHA 2WD0A 3U2SA 1URIA 3ZO0A 1KEGH 3W9EA 3PWLA 2OXHB 2NLJA 4KK8C 1IGCL 1NANH 4Q6IC 5E4OA 1QYGL 1SYSB 3CC5A 2PW2A 2R8SH 4JHZA 3GMRB 3QB7C 4R26H 4XZUA 3NUKA 4D3CH 3G6JE 3QUXC 4HHAA 1FVEB 1H3TA 2M26A 4JR9H 4LEEA 5SX4H 3RGVB 3EJZC 3G5YB 3MBEC 3WGUB 4U05A 4RFOL 5T1LD 5ID0B 2Y7SA 4JW3A 1DE4A 4BWWA 3ARFD 1CE1H 4KV5F 1Q38A 3O6FC 5IVZB 1U8LA 2J7LA 3QFGA 1QFWL 3LNGA 3C8KA 4NC2B 1JV2B 2AI0H 2OX5B 3FU6A 4KI5E 1QSEB 4Z76B 3ZVVA 3OKNA 3DETD 1V27A 1UZGA 5I0VA 5I1EL 5I6LA 2BSBA 5C3IA 5K9JL 3LHAA 1KCLA 1A6AA 1CK0H 2ZF9A 2JKXA 4GKZB 2BNQB 3V4PL 4JO5A 3L6FA 3BGMB 4DFIA 4BD4A 2IH3B 3HPJB 4UF7C 1AO7E 4DAGL 1E4KA 1ZRUA 2IALA 4DZ8B 4G2AA 3LKRA 3RVXC 2FSEA 4NYLA 5C0CD 1N8OE 2GSGA 3CQPA 3KWWB 5AKSA 5E2VL 5HVFB 3NJNA 2WIIA 5EFIA 3FH7A 1OT1A 2FWLB 4BINA 3VGAC 2C1PB 4MD0A 3X13B 1I3RB 3IGLA 1MLCB 3NA4A 1J5DA 3W9DB 3OJ2C 4TNWF 4JY6A 3RPIB 1GC1H 5DU7A 2V17H 4PV8A 1AHWC 3Q2LA 3A67H 3IJHB 1AG6A 4F1SA 4W81A 5GGRY 3ZUCA 5FUZL 5IHUH 1MFUA 3DLQR 5HGAB 1KCBA 2B1AL 3ESPA 3C75A 3O8XA 3Q2VA 5E6IB 1OP3H 3VO0A 3WDIA 5E24E 1N6QH 3IPFA 4AT6B 4K23H 4TL4A 5EU6A 1R3JA 1EHNA 3OLIA 3ROOB 3QEQE 3DMMA 3VCLB 3GJFK 4M5TA 3VUAA 3O2DH 3F5WA 1ZD6A 5EZPA 3V8CA 3MRHA 2AKRA 5SWZE 1S7TB 2ZG2A 1WS8A 4HALA 1TZGH 5FYKL 2UV3A 4FERA 5HJGA 1SDDA 1FYTD 4RBPK 1KJVA 2V4LA 2PCFA 3MRGB 3IAGC 5IVXE 5F0LB 3FSZA 3CH8A 4Y2DD 3MOAH 4KHTL 2BOLA 1I4FB 5CR8A 2EQDA 2VLKD 3S4SG 2AEIT 3U1PA 1L3NA 2O5NA 5IMOA 1UXSA 4N8CL 1MPAH 2I27N 2IWEA 3BWUF 1Z3GL 1QFHA 5FYJU 1Q9KB 1F02I 4LCWB 4NERA 3V0WH 3EH1A 5I76A 5B3JE 3VWKB 5EBWB 2EDBA 4HXBL 4ZAKA 3K4AA 2W0FA 3VYNA 1KN4H 5IB3A 2VW6A 1PCSA 4HAFA 2QPEB 5H35B 2I9LA 2FZ3B 2OYLA 4YNYA 1RUKH 4JO1L 2GJ6D 4G6KL 4QO1A 1A6PA 3WTTA 1MVUB 2XDHA 3HG5A 3Q5TA 4N85A 1E8XA 4YHZL 1WCQA 3OX8B 5BVPL 2EDRA 4M93B 3QI9C 1BVLA 4ZFGL 2HJFB 4MZ3A 2KDGA 3VW3L 1I1FB 5EU4B 5T1KD 3A24A 2VT0A 1E50A 4PJEB 4OZIB 3BQUA 4MAZA 4M4RB 4BE5A 2MQGA 4U49A 4M61B 3II2A 1RJZB 5ICXB 1C5DA 5JHLH 1LK3H 4ONFH 1KCVH 2Y7NA 2VDMH 1SEQL 3T0EC 3PHQB 2BIHA 3MRLB 5CSBA 1J1OL 5JW4R 3DJTA 3T6XA 4I2XE 3II3A 3LNEA 5AVSB 4ODSL 4C55A 4QOKE 4ZK8A 1OXYA 3L5WB 3ZK0A 3ZKXC 4V2BA 1RZ7H 1QA9B 4P3WA 1ONQB 4M1GH 3V6OE 1MIEL 1RV6X 4UZGA 3VRIB 4ZMYA 1EPFA 1KBPA 3EJYC 3FOMA 1A7NL 4I3RL 3RWDB 4EF3A 3SIKA 2AF2A 1XF2B 4P4KB 3QQ9D 3Q6FB 1A65A 2CKNA 3SE9H 3QJHB 2YD5A 2Z8WC 3RIFK 4LL9A 2N0MA 3QIBB 1KBGL 4X8XA 4FYQA 1R47A 3N43F 4ZFFB 1IEBA 1XF3B 1CN4A 1EEUA 1DUZA 4HIQA 1AR1B 4ZDHA 1I9RH 2YD8A 4PRPE 3UTSB 1LNUB 3C12A 3GZKA 4LNVA 2DL2A 4R83A 1UA6H 2R51A 3LS5H 3WIIL 1Q72H 4FXGC 1MI5D 1SXAA 1Z9NA 4X4ZA 3BDBA 4S0TD 4YL9A 2W07B 2QMKA 2L7QA 2JJWA 1GYCA 3VH8G 2F7OA 2HKFL 2IWFA 4FFWC 1FORH 5I75B 4CMMB 2R69H 2CGYA 1Y7VA 5CLZA 4IBYA 4MJ4A 3BPNB 1LLAA 3ERXA 4PRIA 2O6PA 2HJLB 3SDCA 4O58H 5I1AB 5FEBA 2BNRD 4NPYB 4WJG3 4N0YH 4ELKA 3O45B 1DN0B 3ABKB 5DI8B 2XPZA 5ID1A 1WH0A 5DR5H 2FD6L 4J4PA 2NNAA 2NY6B 4Y4HC 5BZDB 2Q76A 4YSOA 2Y07L 4AK2A 2E7LC 1DSWA 1EFQA 1DZ0A 2OV0A 3N6YA 1T03H 3FN9A 1NCIA 1BFOB 1ZS8A 3BAIA 2NY3C 5CINL 5D7IE 3FT2A 5C86A 4JFDE 5K1NA 1RMFL 2XWCA 5KUKA 5FGBC 5C6WH 2G60L 2Q9OA 4IBZA 5I8KL 1KJ2A 1BIIB 3KPSE 3TCTA 1KLFA 4N2AA 1IGCH 3FCBA 3HN5A 4Z7WF 2IXQB 5FV2A 1QYGH 3S88H 1WJ3A 4PWKA 1EHKB 2E8YA 3FQRB 4LVEA 5ITBL 5KBKA 4YS4A 1T21A 2EZ0D 2CSPA 4ZW7A 2L04A 1GY1A 1BBJB 2OMVB 4P3DB 1UEYA 4K9EL 2F54B 4X5XA 5DHYB 1ASQA 3I74A 3MV7B 4RFOH 3WEAA 3VD0A 1EZVY 3GFUA 4TTDC 4G8FB 2MCG1 3X3GL 3MJ9A 4CMHC 2KLTA 3SDXF 3A6BL 1QFWH 2FYYB 3U1SL 5TE7H 2K45A 5IQMA 2WB7A 1GTFA 3F7YB 3TO4B 1T4WA 2UY7A 4Z7VB 2EADA 5AVUB 5I1EH 1PLGL 2QSCH 3L3JB 5IBTH 5K9JH 1VZIA 3VDBA 4FXKA 3KGRA 2PCXA 3REVA 2VDKB 3V4PH 3F84A 2QADC 3KJ6L 4RETB 4NSKA 2PLTA 1HJBC 4RX4A 1LP9F 1OK0A 1NUDA 2W0PA 2IOIA 5E9DB 4DAGH 4WTXA 3VFVA 1B0GA 3B9KB 2QVKA 1X9QA 1E7UA 5DJCB 3UIZA 1K2DB 5G4OA 3DO4A 5E2VH 1QR1B 5F7BA 4EO5A 2A9AA 4UIMB 5GS0D 1Z6JT 4HETA 2YC1B 1UXWA 1XGZA 1CFSB 3QUML 2Y7LA 1MRFL 1LWRA 3TZVA 1GC1C 3WSQL 2VDRB 2GSIB 3FTGB 4WTZA 2FR4A 3AS2A 5KYXA 1B2WL 3B6SA 5FUZH 4P5TD 1KJ3L 2GIMA 1L9TA 1ZHNB 3LVEA 4Y16A 4G83A 2BZDA 3AG1B 2WJ5A 3IJEA 4J3TA 4MMXC 4AGLA 4NKOB 4TLUA 2ZYRA 4IEFA 4UU9A 4MVBC 4N1HB 3OKYA 1Z0MA 3MYZA 3SCMA 1X5LA 1PD0A 3V7AG 5TDPB 3U0WL 1E7VA 1NFKA 3OXRB 3V5DB 4ANVA 2WVVA 1BQSA 2EXTA 2VYRE 2IFFL 5CZKA 5FYKH 2ZP0T 4PVBA 4OD3L 4MNHB 3OKOA 2XG4B 5TD4A 2D3JA 3CSTA 5AWNL 1KCWA 1BFVL 4GNKB 4OAWB 1KACB 5GHWL 5FW8A 3GSRB 1A25A 2DH3A 5I26A 5CIPA 4FTDA 3SYQA 3L3IB 1EVTC 4JN2B 5HTSA 4NIYE 3QR1A 4N8CH 1DSYA 1PFOA 1WA0X 4PS7A 3DX0A 3FT3A 4XBPB 3RL2B 2CU9A 5IBLD 3H54A 1Z3GH 1EBAA 5FKAB 5AVZB 3CHSA 5T33H 1IGYA 2WUBL 3DGCR 4P2QA 1OP4A 5CKGA 5D6DA 4HDIA 5C0CE 2X42A 1U30A 3MRBB 3DXAD 4P2OD 4WU5A 1ZCRA 4HXBH 3L2MA 3QJSB 3BZEB 1OP9A 4ZS6C 4JO1H 2WQXA 4YLCA 3OC8A 2MCPL 3HEIB 1AMXA 2QKIC 2WXKA 4PLKC 4QRRB 3UGXA 3VFPA 1T2XA 2FGWL 3IK2A 2EC9T 4YHZH 4CU7A 4PLJD 3IJSB 4ZUWB 5JDSB 1O7DE 1RP9A 1DL7L 5BVPH 2VDLL 5FO9B 1WYJA 1XGRA 1MHEA 4FFYA 4KZ0A 4K7PY 1QTSA 4JGJA 4ZFGH 5HYQB 5EBLB 2D0GA 3EJJX 3FOLA 3AVEA 3S35H 1WFOA 2N59A 3CK0L 3FFDA 4Y2OB 2OTWB 4OFDA 3BGAA 3GSOB 5EPMB 4K8RH 1T04A 3GLZA 5CD5C 4M7LH 5CCJA 3SJVB 1J1XH 4J5VA 3GRWA 4WO4A 3CHRA 5GRVL 4U33A 3UJIL 3U30C 5EEVA 4CSSA 2ZONA 2RIKA 2WWMC 4L4VD 4ERSL 1ORQA 1FDLL 4HJSA 2VSDA 2AXFA 4HUVB 2WQRA 2M8XA 2H4EA 1FYTE 1VFAA 4O02L 1C16A 2VTFA 1N59B 2VGLM 1K5NB 3HS8A 4Z7OB 1Y6MR 4GKNB 4IHOB 3WE6A 3NA9H 5ESAA 1MF2L 3FCTB 2VDLB 1KTBA 5KVGL 4MJIB 2VLKE 3RUGE 3UTOA 4RA3A 3TPUA 1NCNA 4H25B 3VFOB 1MIEH 3OB0H 4TTGA 5E56A 4XP5L 4PRHB 3CZSA 5H4YA 1JHTA 1A7NH 1M71B 3C08L 2AXWA 4I3RH 3LKSB 1P7HL 4F8TA 4JGMA 1YDPB 3QARA 2W8CA 4WLCA 3BMVA 3SKNA 3BRFA 1U2CA 1WO2A 1KBGH 1YCSA 1WVZA 4O9HL 3EYVA 3PNRB 1KPRA 1DJYA 1U93A 1VEPA 3QUKB 4HGWA 4OKDA 4Z7AA 3L81A 4UUJA 1N18A 4O02B 4HH9B 2GJ6E 3H3BC 4J39A 1FV1A 2YKLL 1X5XA 4CC1A 4F9LA 4YHNB 4OGXL 5I1IL 4NKQB 3WIIH 2CUAA 3DX6B 3HCVB 1HWHB 3Q1SH 2CUIA 4LAJH 4ICXA 3DIVA 4P07A 3UBXI 1YRKA 3NQIA 4W93A 5D1XA 2WTRA 1U8KA 2HKFH 2OTUA 1NJ9A 2IWGA 5CEXB 1J5IA 3O2WL 5D7SL 3TH4T 1CJYA 1QQDB 1GXEA 1OCZB 3SDAD 4P5RA 3ENEA 4B5EA 3HFFA 3NAAL 2O6FA 3QJQB 3HZ3A 5ADPL 3I6LD 4WCYH 2AJSL 1PMYA 3ABMB 1RULH 2R0LL 3CH1A 3RGVC 1KPVB 5BV7B 2FD6H 1L6XA 1PZSA 4YLQT 4OZFA 2B4CH 1CLZL 3HE7A 4G80A 5JIQA 4JKLA 1YNTA 3FT1A 2Y3NA 2Z35A 3L7FA 4G6FB 3TCLB 1CQKA 2PPDA 3GMPB 5CINH 5F71A 4IRZA 3BT0A 4UDTA 2NX5A 1RMFH 2EVGA 1PLCA 3AUVA 1Z7JA 4X6DB 4AYDC 1Y07A 2G60H 5I8KH 4JO3L 3T3MF 3BWSA 2JJTA 3DDGA 2AK4A 4IGBB 1EEZA 1Z2KA 1ZWIA 2P24B 2X10A 4NQTA 3SZ6A 2R0WL 5TK2A 5C0FA 2FWOA 3MV8A 5AW3B 5ITBH 1D9KA 1O9ZA 1JE6A 1UWYA 3QYCA 4PJCA 3ZKSD 4EN3D 2F58L 1CLVA 5F1OB 4K9EH 3QFDA 4G72B 1CFNA 4BZ1L 4ENEC 1AC0A 3V9FA 1J8HD 4B0MB 1UURA 1IGML 4UTCA 2ZOWA 3X3GH 1M6UA 5IW3A 4LFHG 1DJSA 3VFNA 3U1SH 5LWYL 3ARUA 4UT7L 1CGUA 1BD2A 1OP3K 3VI3B 1ZT4A 5FS5A 3GYRA 4IOSD 4YFEA 1D5ZB 1JPFB 2W94A 1PLGH 4LRIC 3R4DA 3V0JA 2Q20A 4MMZC 3ZXAC 5ICZA 3P4OA 2X9XA 1L9QA 4ILDA 4PJXF 5LG6A 3KJ6H 3T71A 2MRYA 4CILA 3KL3A 2FJHA 4DH2A 4N8VA 3DX9A 3O9WD 3LNFA 2BNRE 2GIXA 2HJKA 3MV9A 3FO1A 5E6IC 4H0GA 4Y5YB 3RZCC 5DEZA 2QV2A 1A3LL 1OTSD 4U1SA 4MGXA 2JCCE 4Q2ZB 2YBGA 1UQSA 3UAFA 3VD3A 3C5SA 3OZ9L 4GFXA 4OZGA 2P5WB 4YHIB 4YXLH 1PNCA 5FLVA 2QQLL 5AW0B 2G75A 5C07A 3AS1A 3MRNA 3QUMH 5CMAA 3DUHA 5DJ0B 1MRFH 4AGPA 3WSQH 3WG7B 1TJGL 1CD1B 2BIMA 3WKYA 3WGVB 3AY2A 2FEEL 2HT3C 2NY4B 3MRCA 1B2WH 4OCNC 5IJVA 4LCYA 5KSBA 1DDTA 1CGWA 2YARA 1KJ3H 1CDHA 4TOYL 4BGLA 4AJYV 4EI6A 3I6KB 3MRKA 3NN8B 3DBXB 1BIHA 5DD6B 3QZLA 2ISDA 4NKDB 1T66C 5DXWA 4AM0B 2EDMA 2OBGA 2VWEC 4URKA 2XKNB 4K5MA 5MI0C 3WEXB 3BP4B 5KG9A 1NUGA 3U0WH 3MXVL 1JJUA 4AXWB 2CKBL 2BVQA 1IGFL 1YEJL 4WW2F 3N41B 1JAEA 1FNGB 1ML0A 1ZLEA 2WXHA 3KLKA 2Z1KA 2A1WL 2LFGA 2KBGA 1N6VA 3ZDYB 3MUHL 4OD3H 1S7WA 1SHSA 3BUPA 3GMMB 1BFVH 5ABDE 3QWRA 3NACL 4QNPF 1GA2A 5GHWH 1HZHH 1FFQA 2J25A 3DVGA 4XE5B 1Q9LB 5LAPA 5IFJB 2YR3A 2YN3A 4O4YL 3UAAA 3MUGB 1N10A 4YDLC 4M7LT 2FJGA 4GI8A 3ZPDA 4DUWA 4Q9CA 1PKQB 3C60B 3ZTJG 2ZP9A 4UT6A 3HFMH 5IK3A 3MYJA 4M8RA 5D7EA 1T4KA 1GZQA 3HAEB 2CKBB 3FT4B 3PFQA 4XMTA 1ZK9A 1TUPA 1KB5B 5DTFA 3IMUA 1P1VA 2F2HA 3CGTA 3MNWB 4NP4L 1H3WM 2DLEA 3IXAA 5EOQL 5MEPB 3VWJB 4B95C 2NSXA 1MJ8L 4NM4H 3N1PC 3QJOA 1N5AB 4WUUA 3GJEA 3T3PB 2Q10A 4OM0L 1KXVA 4U0QB 3F7RA 2FGWH 1MJJA 4RRPM 3FU3A 5C0AA 1DL7H 3S5LA 2VDLH 2YHGA 3MRQB 3U6XS 3AT0A 4OJYA 3IS1X 3DRTB 2J8UE 4I3SL 4RVBA 3E8VA 1FL3A 3CAFA 1HCYA 1AO7B 2Y1YA 1NCBL 2JXMA 3CK0H 2CG9X 1ETJA 1ZVNA 3BCDA 3VA2C 1T5WA 1WFJA 1WFIA 3DROB 3B1UA 4DZBB 4WNJA 4G9FD 3UJIH 1YEHH 3LKNB 4KMQA 4I85A 1XTLA 2P4AB 1G7QA 1JTPA 2DD8L 5DYFA 2C9SA 4ERSH 1FDLH 5D1ZA 2BHFA 1S46A 1A0QH 2BSDA 2JIXB 3HG1D 5T5NF 4APQD 3GLEA 4Y5XC 4ZX3A 5CJ8A 4RCAA 4G9DB 1MF2H 3WLBB 2N01B 5I30L 4FHBD 4R4ND 5KVGH 4APXB 1JMZA 1WAAA 3SY0B 4CRPA 4MD4A 1YY9D 2YQBA 4HIIB 3GB7A 3V6BR 4QRQA 4XP5H 5IJBC 2EICA 1A5FL 3EH4B 3C08H 3P3TA 2QDVA 3NZ8B 3P54A 1XEUA 4HFUL 5J6HB 1LHZA 2AVGA 4HHGA 5CGYC 3BSGA 3RX5A 2GG1A 4HK0A 3HMWL 4LU5L 2BY0A 5C0BA 4LSQL 1YPZF 5D2NC 4L0ZA 5L2JA 3FK3A 3DBSA 1LEKA 5FO8B 2AJYH 3RVUC 3BUYA 4B97A 2YKLH 3KYOA 1U21A 5IVXB 1TLMA 4N2DA 4UQBA 5DJ6A 1PJ9A 4A04A 3RVTC 3B2DC 2X05A 3L9YA 3NDYE 1PD6A 5IEKA 4M3JA 2CWRA 3O2WH 5D7SH 3BJ91 5D5MF 4BUQA 4P48A 5C8JA 2MHAB 3BAJA 1BQ5A 5ADPH 1QACA 1RSFA 2VH5L 3VFMB 2JI1A 2AJSH 2LVEA 3GLAA 4ZUVB 2R0LH 4FG6D 3ARDA 4K07A 3QO1B 1ECYA 2HT4C 4ETYA 5HI4D 4L4VE 5HJBA 1T20B 3MO1A 1S7XA 1CLZH 4YBLC 3VFUB 1ZIBA 3QRGL 5ISZB 1NGXA 1FC2D 1F45A 1BVOA 2E86A 3N50A 4F37K 1IARB 3HI5L 4L3CA 4N3UA 3MHZA 1WV7T 1F0LA 1ORSB 4HIPA 1XIWD 3DUUA 4PGBB 1IC5H 2R0WH 5JORA 2APWA 1BOGA 3EHBB 5DJ2B 4X6CA 4GBXA 4RZKA 3LRSB 4AW7A 2Y6SC 1YO4A 1IKNC 3WHXB 1JS4A 2F58H 4GO6B 1ACYL 4K9EC 3CDFA 2YIHA 3B9KC 4UTAA 1PCXA 2NYYC 3VJ6B 3E7JA 1QSFD 2YFNA 5ECGA 1MWAL 1IGMH 2NZ9C 2VDPH 5EEUA 2OMTB 2IMNA 4GMSH 2J21A 4QRUA 1OB0A 3FSOA 1P6FA 3SGJC 1XCTA 3T0DA 4I2XB 4FA6A 5AVRB 4WTZG 1NLDL 3LMJL 4UQCA 4WSKA 3NIFE 4HBCL 4UT7H 4AZUA 1XSKA 4QOKB 3TEZA 5FHAL 1KJ2H 1R17A 1M05A 4L3EA 5FKPB 2XV6B 4LEOB 4E42B 3U0TB 2EIEA 1YMHA 1RFDL 5B21A 3K2UL 3OHXB 2G4EA 2OMZA 5K33A 3I6LE 4ELDA 4NENB 4AIEA 5JXAL 4EI5C 4KY2A 4YSEA 2Y7OA 3SE8H 3X1EA 3TT1L 1MWAB 3WUWA 4UOW0 3D39B 3MJ9H 3OZ9H 2IC2A 1WTGT 2F53B 1SOXA 3IGAA 3QVAA 4MTMA 4S1QH 5IROA 2QQLH 5IFAH 2EE0A 1BJ1H 4X5RA 4FA7B 3G6AA 3H4FA 5DMKB 2F19H 5DO2D 3W0WB 4FYSA 4DKEH 1IVLA 3MXWL 5DVNA 4K3EL 5KJRL 2WINB 4HS3A 3Q48A 4WNQB 3E80A 4PYHA 4TOYH 4OCYH 4IKIA 1DVFD 3GSVA 4MZRA 3DTUB 3SDDA 2JWYA 5DZAA 4EIUA 5DUJA 4QT5A 4I0PB 2XWJA 1J8HE 4X7SL 1PY9A 2EIKB 2VUKA 2Y5QA 1KOAA 3MXVH 1XWVA 5IQ9A 1AKJB 1DBBL 3MUUA 3O3AB 1OGTB 1A9VA 4UQAA 1YEJH 5I19L 3IXTB 1CLOH 5DJYB 4F2MB 5D7IB 1UJ3A 2A1WH 2BC4A 3PY9A 4ANXA 3U4EB 4JRYD 5CILL 1JCKA 4PP1D 5AW8B 4DEPB 2R23B 3FUIA 3NACH 2WC7A 3KPSB 2PP8A 3Q8CA 4U6HB 4CVUA 4PRNA 5E0QA 4XMKL 1W6WA 1I7RA 3IFOB 4PGEB 4Q6KA 4K0OA 4O4YH 4NQSB 4OGYL 5AL0A 1CGYA 4OI7A 3V0EA 3ZDZB 4MDIA 1PQZA 2Z8SA 4HIJA 1TQUA 4MA3B 3ETBF 5EF3A 3QXAB 3EO9L 3MZGB 2JQMA 1RI8A 4FLSA 4EPSA 2OXHA 4PV9B 4ZMQA 5AOKA 2OCFD 3EUDA 1PZUB 1IKFH 4JUTA 2H32H 4NI6A 3HBPA 3GMRA 2AXHA 5T1JA 5EOQH 2M2DA 5HDWA 3WFHB 4TV3A 3TA3D 4C8XA 3OB0K 3G5YA 2FCBA 4OM0H 2YRLA 3TH3T 4R97C 1T2JA 5ID0A 2B9BA 1JVKA 2X4TA 3FYEB 4N1CA 5CIPH 3ZHFA 5I0WA 5IVZA 4OGAD 1KELL 2Y0SA 4I3SH 5DC0A 5HGBB 2EKJA 4KX9A 3NABL 1JV2A 4QRPB 1N0XL 5AUMB 1LE5B 1NCBH 2QQNL 4YSPA 1QSEA 4GI9A 1MHCB 1QZ1A 1T7XA 1BMWA 4W9FC 3P9WB 5F7KC 1MLBB 2V5RA 2NOYA 4ZAKC 1JGIA 4ZRGA 5F0MB 4F58L 1MQ8A 3MRPB 4HZLB 3CCHB 4GKZA 2BNQA 2DD8H 3BGMA 1WA2X 2FIRT 2IH3A 3HPJA 4Z7UB 5FDWA 1SMOA 2Z7UA 2J1XA 2IAMC 1LO3L 5FYKU 4DZ8A 3B83A 2X88A 4TUJB 2CJ3A 4WHTB 3EFFA 2V9TA 1XR9B 5I30H 4UILL 2H2PC 2JE8A 4ZO7A 1T0MB 2K8QA 3IFPB 1JVOA 1E4XI 2C1PA 2F68X 1GY2A 2X4NA 4AGOA 1I3RA 1CURA 1MLCA 3W9DA 1O6TA 1A5FH 3RPIA 4HFUH 1VFMA 5C7XH 4OZFG 1DBAL 5T1LB 3IJHA 3WY2A 3WY3A 2O61B 3JVGC 3HMWH 4LU5H 3TBTA 2XG5A 5EMYA 2K78A 5GJTL 2ATPB 3PAZA 4LSQH 5HGAA 5B7EA 4BFFA 5AAMC 3O4LD 1F97A 5E00B 1BFTA 3KE0A 1IGJB 3ROOA 4ZOEA 3VCLA 2P45B 3Q2WA 3SE3A 1I7UB 2XU9A 4FQ2H 4YDZA 2XWBA 2AC0A 2OW7A 1OO2A 1S7TA 4RGMB 1AS8A 3SKJL 4GP5B 1INDL 3ARPA 4XI5D 5GZOD 3KPNA 3Q3GB 4HV8A 3FBQA 3U48A 1LO5A 3WFEL 3MRGA 5C0CB 1QNIA 3VMPA 4G9FE 2LR4A 1HH9B 2CM5A 2W92A 4L4TA 5CJBA 5E1QA 1F3JB 1TR7A 2G0KA 3HG2A 2G9HA 1XSIA 5E8PA 1CXEA 2N56A 4KX8A 3ZTEA 2BY1A 4FNPA 4PFEA 5CCHE 3QRGH 4MNQA 4Z7NB 5DVLA 4A38A 4NQXB 4AQ8A 3OMZA 3CVHA 4LCWA 2C9AA 1Z9OA 1NBYB 3HI5H 2ED6A 3VWKA 1P84J 4HJ1A 2P26A 5EBWA 4NS0A 2HMID 4H8UA 4N8VG 3BZ5A 2X2YA 3RAJL 4U1LB 3ZE1B 3QT2A 2ZXBA 1JP5A 2WKOA 5H35A 1LEIB 1QTPA 3BIKB 2FZ3A 2H47C 2EUVA 1I8IB 4WZ9A 2C5DC 5F72S 4RH4A 3IDIB 3ULUF 3OX8A 2JKTM 4NQDB 3OSVA 1VGEL 1UKTA 1I75A 3TOPA 1U58B 2WW8A 2VSKB 3RBSA 3HS9A 1YMMA 2BDNL 2K3TA 3Q01A 1MWAH 2HJFA 4Y89A 5DK0B 1A3RL 3C9NB 5EU4A 2BFGA 2X1OA 4F7PB 2PN5A 1AD0B 2LT9A 3T09A 4OZIA 1NLDH 3LMJH 1LJMA 1NCCL 4YFLI 4QGTA 1QAWA 3LHPL 4M61A 4J7RA 1T3FB 1MCPL 3QUZB 3FQNA 2GPZA 1DSFL 2F7QA 1RFDH 3R8BB 3ARTA 3HUJB 3EDKA 2QMJA 1G43A 2Y7QB 3K2UH 2NY4C 4FYTA 1E90A 2HP4A 3PHQA 5LXVA 5E70A 4AJ0A 2CLZB 4I5BB 5JIPA 4W9GC 5DEJA 4PP2B 5CN3A 5FO2A 4OFPA 3RTQD 5A16A 1QA9A 2EDKA 3TT1H 1ONQA 1XH3A 2G2RB 2YA0A 2I85A 5KVEE 3EO0B 3H9HB 3ZSSA 2CHNA 3RWDA 3DOIA 4PUBL 4P4KA 2EDDA 3Q6FA 2F5BL 3QJHA 2EDQA 4BELD 3QIBA 4MJ5A 1P1ZB 2EDFA 1J05B 5K5YA 4PWIA 3F65A 3BISA 1JL8A 2H6PB 1XF3A 4OZ4B 1L9PA 4IMLA 4EQ2A 3TBVA 4K3EH 3HZVB 3UTSA 2LVCA 5T1KB 5KJRH 5E0FA 4RFNC 1BJ1J 2BW4A 4HUMB 4R84A 1D5MB 1MFEL 2C9PA 3C60C 1B2YA 2JJSC 1UACL 1ZAGA 4X7SH 1QSFE 1ZGLM 1MDTA 1FL6B 4CMMA 1DBBH 5I19H 2YEZB 4JFHD 4HFWA 3FAWA 1W8OA 1B6UA 3VTTA 4CBPA 2HJLA 3VD1A 2XTJC 4PJHE 4NPYA 4F37F 4PS3A 3S5LG 1IGTA 2QFPA 3O45A 2AV1A 4KI5C 5TQ2L 1FGVL 5DI8A 2QVFB 1W72A 4QLRA 3PG2A 4H26A 4XMKH 4RZCB 4XNQB 5DRZB 4OCLC 2DDQH 4OGYH 2CCWA 3MBWA 1BFOA 3B3BA 4WY7L 4PJ7E 1IE4A 3OMAB 3PIQB 4JKKA 2Z4QB 3EO9H 5LN8A 1EEYA 1BIIA 1YNLH 2X70A 1JF6A 2YQGA 3ET9F 1INQB 1ASOA 1QI3A 3HKFA 2CQVA 1KLGB 1V5JA 2ESVA 3UP1A 4G71B 5IF0B 3FQRA 5I24A 2HWZL 2P8MB 1MI5B 5K9KB 2E8ZA 4NQED 3MRRB 1BBJA 2FO4A 5I0DA 4FABL 3TLRA 2F54A 1F90L 5DHYA 3DURB 3MV7A 1A3ZA 3OR6A 2OJEB 2Q2LA 1QW8A 3RWIB 2Z7YA 3QNXB 4G8FA 1ZLVH 1XBDA 1KELH 2CR3A 3QH3B 1TXKA 2FYYA 4XGZA 5E99L 2GTZB 3NABH 3Q2NA 4FXLA 1N0XH 2VJ0A 1ZLSL 1FF5A 3TO4A 2QQNH 5ACZB 3C5ZD 2A74C 4Z7VA 3AITA 1UASA 4PTTA 5IHZB 3E6FB 1MFNA 3L3JA 4F15C 2JCCB 4XVUC 3ESMA 4N24A 5DVOA 2WSKA 4D7PA 5LJYH 4PJ8B 1SBSH 3A47A 3PWJB 3J07A 3S3BB 2IV9A 5AOMA 1JOIA 3NJXA 5CLXA 1BYNA 3AM8A 1PLBA 3DJRA 3AREC 3F85A 3KXFA 4JRYE 3UGEA 2GKIA 5E9DA 1JZGA 1LO3H 4FMFA 4C56B 4FA8A 3W11C 1U3NA 5DJCA 3LTVA 4OF0A 5CU9A 4JLRB 3NCYS 5EA0L 5D2LF 4KKLC 4KH9A 4UILH 1QR1A 3GBLA 3PAUA 3B7UX 4MJHA 4QHUB 4A6YL 4XAKD 3BP5B 1P84K 2EDHA 4CVZA 2O4EA 1CFSA 4PY8J 3Q8EA 4V1DB 3S2AA 4TQPA 1DBAH 2GSIA 5DEFB 4FNTA 4G43B 2YD7A 1T7WA 5GS1C 4TNFA 3FTGA 4PYGA 4UDUB 3IAQA 3BPCB 3CXDH 5GJTH 5KSAD 3T2NL 1ZHNA 2PWGA 3MLWL 4XNXH 5C0IB 5GS0L 1G0YR 5CUSH 3FCGA 2VLLB 1A1OB 2IDQA 4NKOA 4UTBL 2F8OA 1JSYA 1IAKB 3PF2A 2VABB 3HA0A 1JGVL 2ZUYA 3QQ3A 2QVTA 5EORL 4JFPB 4Z78B 4TQHA 4XMUA 4NN5B 5TDPA 3OXRA 5G5DB 1JNHB 3V5DA 2X1XR 4KZDL 1RZGB 2GBAA 3SKJH 2XFGB 2C3GA 3RY5A 2Q8AL 3OQ3B 4ISVB 5CBAB 3BPOB 4OGQC 4Z3IA 1AIZA 1IC0A 1G7MB 5T5FL 1OSPH 5DLMH 3WFEH 2P48B 4S0SD 1S4IA 1S3RA 5IEHB 4ZNEA 3GSRA 1GRWA 3SGEH 1OTUC 4QHMA 1D7DA 3TBSA 1H8LA 4OLZH 4JN2A 1G7JB 1JI2A 1UXLA 5FK9B 4FQJL 2WJ7A 5AKTA 1LE9A 3RL2A 3D2UD 5FKAA 2GYSA 2GT9B 3T6VA 4LE8A 1SNRA 3UAJC 3APFA 3QEUB 5IR1B 3ECVA 2CO7B 2EDJA 4HGKC 2J8UB 3RAJH 3BZEA 2HLAB 3GXDA 4NKMA 2LU3A 4KDVA 3MRIA 2UYLB 3S5ZA 1N70A 1ND0B 1E8YA 4M56A 5DFWH 5BJTB 3Q43A 3WUWG 3OHXC 3HC0B 3MJ6A 1EA9C 2A4ZA 5JDSA 2MEJB 4F2FA 4F8OA 1QRNB 2C7FA 1SJXA 2CLVB 4ZUWA 1VGEH 3HG4A 4UV4H 3FF8A 3NJHA 5K39B 1E5BA 2MPAL 4KPHH 1NCUA 5DD5L 3HE7C 5I6MA 2BDNH 4F7CB 3KR3L 2G30A 1HKLL 2C3VB 1A3RH 3O4LE 5GGSY 2Y1ZA 4LQ1A 1YNKL 3CVHL 4Y2OA 5EPMA 1OAZL 3GSOA 5CP3H 3KH3A 3ZBMA 1FO0L 4P04A 2LU5A 3BD4A 3SJVA 3KM1A 3ZJAA 4XP6L 3LHPH 1JGEB 3QUYA 4TSAL 3B3IB 5KVMC 5IB4B 2X89A 4AZ8A 1MCPH 1K5WA 4JQVA 3S3JA 4Y2LA 4H0IA 2ZKYA 4TRPL 1N59A 5SX5H 1A1MB 2OZ4A 3SOBL 3IMBA 4GKNA 1WCBB 2APXA 4JB9L 2O5YH 3ESOA 1BECA 3DXAB 5F44A 4IW4C 5E1AB 3PP3H 1JERA 3BEWB 2J71A 4H2CA 4LDEB 4UMGA 4JDVB 4MJIA 5K93A 4GSUA 3E2HC 4H25A 1X5FA 2H2SD 4XPAL 1SLWA 3D09A 4P2RD 4PRHA 5EZJA 1M71A 6PAZA 5H37A 5TK4A 3LKSA 1MW2A 4KKPA 4PUBH 1AQKL 4R0LB 2WLKA 3U46B 2F5BH 1YDPA 2Z92A 1I8AA 3ARBA 4JG0L 4MAYA 5B7MA 4GG6F 2QPUA 4Q0XL 4JK0D 1Z66A 3QUKA 4FZ8L 3ILDA 3QG7L 2ZIDA 4HOXA 3DX4A 4HH9A 3U9UB 4L8CB