2OMWB

Crystal structure of inla s192n y369s/mec1 complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
b'GPLGSWVIPPISCPENEKGEFPKNLVQIKSNRDKETKVFYSITGQGADKPPVGVFIIERETGWLKVTQPLDREAIAKYILYSHAVSSNGNAVEDPMEIVITVTDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Extending the host range of Listeria monocytogenes by rational protein design.
pubmed doi rcsb
molecule keywords Internalin-A
source organism Listeria monocytogenes
molecule tags Cell invasion/cell adhesion
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2omwB00
1SUHA 4AXWB 2QVFB 1NCJA 4XXWA 2A4EA 3Q2LA 4ZMNA 4AQEB 2OMVB 3FF7A 4NUQA 4ZMLA 3LNDA 2V37A 5CZRA 3LNGA 4AQ8A 4AQEA 4ZMZA 1L3WA 2OMZB 3K6FA 2QVIA 1WYJA 1NCGA 3K5RA 3K6IA 2YSTA 4NUPA 1NCHA 1EDHA 4OY9A 1FF5A 3LNHA 2A4CA 4AQAB 4AXWA 4ZMXA 2OMYB 4ZI8A 2EE0A 4QD2E 4AQAA 1OP4A 3FF8A 2X2UA 4ZMQA 4ZMOA 5JYMA 3LNEA 5DZVA 2WHVA 3MVSA 3Q2VA 1NCIA 4ZMPA 3QRBA 2YQGA 3Q2WA 3UBFA 2OMXB 4ZT1A 4APXB 3K6DA 2WCPA 4ZMYA 5CO1A 1ZXKA 2WD0A 1O6SB 3LNIA 4AK1A 3UBHA 4APXA 3LNFA 5KJ4A 1ZVNA 2OMUB 4XXWC 4ZMWA 3K5SA 1Q1PA 5JYLA 2WBXA 3PPEA 3Q2NA 4ZMVA 2OMTB 4AQ8C 4ZMTA 4ZTEA 2O72A 4NQQA 2OMWB 1WUZA 3UBGA 4NUMA
chains in the Genus database with same CATH superfamily
4UQ3A 4Z77A 5CGTA 2QVFB 2NQDA 5DD3L 4W93A 3VQMA 4YHLL 2NDGA 2X42A 3SO5A 3LYRA 4XPTL 4YSPA 5HHOD 1MCBA 2BIQA 1TT6A 2YZ8A 4F8NA 2VW4A 2LE9A 1IKNA 1OAXL 3S3DB 4UM8A 2F6AA 1MFBH 4OJFL 5ESVA 2AGJL 5EU4B 1BV8A 3T6XA 4K4KA 1MXGA 3UXFA 4F24A 3PWNA 4U1GB 4BZ2H 4JLRA 3K2IA 4ZMZA 5E08L 4OLVH 3QNFA 2OCCB 5AEAA 5I1KH 4CMMB 3BI9X 4KX7A 1XF4B 4CUCA 3CWGA 3IDJA 3DXAA 4CRPA 3LRHA 1AAJA 1E4JA 1I1AB 3BUDA 4OZHE 4P23A 4AUYA 4I7ZC 2YXWA 4GP5B 2JIXA 1JJUA 4GQRA 3KL3A 1RJLB 3WEOA 4EOWL 2X4SB 5HHPA 4UQ2A 4P2OB 2HPTA 1YJDH 3U46A 3Q9QA 1FNGB 3ZGHA 4DGIL 5C6TH 5KYYA 1ZWIB 4M5SA 3BP7A 1H8OA 1QQDB 4YFLF 3ZT5A 1VB9A 4Z7NB 5DFVD 1H8LA 2VO5A 4GAJL 1FPTL 3N9GH 5IQLA 1JXFA 3AQXA 4ZODA 3VFMB 4PVLA 4F33B 4U49A 5B38B 2HWZL 3ZJAA 4PI2A 3C5XA 4LHUG 3CN3A 4KHXH 5LGHH 3SKMA 2UZIH 1KMGA 5EF1A 1TCRA 1IM3A 2ZX5A 1WFOA 2VW7A 4DO5A 1DUYB 4HFUH 3QXDA 3DMMA 1CFTA 2WXQA 3RWGA 4NO0A 4APXB 1MCKA 2V5MA 2F15A 4N0RA 4D9RD 3GSNH 3VG0H 1XB6A 5LGYA 1M3IA 5FYJU 1M71B 2EDYA 1HYRC 4B3VA 2IQAA 5T5FL 2IGLA 5FGCB 4M3KB 5K93A 3RPBA 1NUDA 3EYQD 5DYFA 2D3VA 3V4VB 3BWUF 1THAA 4AJ0A 2AQ1A 3BZFB 3G08A 3ULVD 2XTJB 1XH3B 1XCWA 3FB7B 4XCFL 2GK2A 3L3JB 4HULB 3V9FA 2AV1B 3TCLA 2WZPD 1R24A 4CU6A 4PS4H 1UXMA 2C3VB 2VH5L 1N2RA 4YGVB 5DVNA 4BZ1H 5AB1A 3DV4A 3ISWA 5C09A 1I8IB 3X13A 2A5UA 4JO4H 1EJOH 1AHKA 1R3JB 5F7BA 2F61A 3OR6B 1G1KA 1ETZB 1UASA 2GFBB 3GS0A 3MLUH 2X09A 4OCYL 5F97E 5F21B 1QLFB 3NP3A 2GJRA 2OMWB 5C0BE 3DURA 1CICD 4OB5L 3IAGC 3MUGB 3IFLH 4FCHA 4N8PA 4WFHE 3C8KA 2HAZA 3TV3L 4U1HA 1U8HA 5F88B 3RHWF 4A6YL 4FNLL 5LBSH 4LEEA 2CRYA 3QQNA 1Y1UA 3EYSL 4GUQA 2Y07H 1GSMA 5SX5H 4LLYB 1T80A 4ZQKB 3D5OF 4Y4HA 4YHIB 1TZOA 1UXLA 4HOZA 4I9WE 3W38A 1A6WH 2EEDA 5FYKH 2IF7A 4UT7H 3KS0H 4KWUA 5KVEH 2IOMA 4UQCA 1UOKA 3C08L 3RWHB 4FI6A 1KGXA 1QUNB 1E9PA 4PRPA 2AC0A 1INQA 3B2MA 2ROXA 1QSEE 3ETTA 3HI5H 3HC4H 3Q6GL 3RFZA 3E38A 3GDBA 4UTAA 2FEDD 1BFOB 2B08A 2VUYA 3GMOA 5HHVL 2F1AA 3NJXA 1XF3B 2ZYRA 4F7TA 3L9RA 4HIIA 4N2AA 2VTFA 4Z8FH 1EPFA 3ARYA 3EUUA 4U7SA 1H6EA 1KCVH 2DMCA 3RPIB 1F11B 3NSYA 1LO0L 5GGTA 4M7ZC 5F3HB 32C2A 4LEOA 3SDCC 1EEZA 1MJ7H 3FFCA 2X70A 1ZRUA 4X6DB 5BUPA 1TJHL 4TLTA 4K3JH 3ARZA 1WJ3A 4P9HL 3SOBH 4FQHA 4KMLB 1QSVA 4Y5VC 3UYRH 4FQQA 2VXQL 2I9LB 1S7XB 1EA9C 2EECA 2V8MA 2DQMA 2QJDA 3EYUH 3TCTA 2K7QA 4RAHA 4HW6A 5ESAA 5E2TL 2AJYL 5KSBE 4HAGA 3NVQA 3ESUF 2YZ1A 2FO8A 1U4FA 1UD4A 4KJQC 2FATL 4XVSH 4HOXA 2BNQA 3T2OA 1S8DA 1FORL 3KH4A 2VW6A 4M8VA 3C09B 3QSKB 1U6AL 2YUWA 3P4LA 1R46A 1G7MB 3N3EA 3P4MB 1MVUB 5IHHA 2OFQA 5EFIA 2D7NA 1ZLEA 1CGUA 2B4CC 4WUUD 5KOVC 1HCYA 3E0GA 2CO6A 4FKKA 4WWPA 1WC7A 5DQ9B 4MB5A 4Y1SA 2VB5A 2YC1B 4H8UA 3L9BA 4P99A 3GKWH 4DFIA 5A6LA 5JOPE 3G6DH 3RWDB 2BSRB 4YSDA 2XKSA 1OGAA 1WBZB 3CDZB 1NLDL 5HGGS 2XIBA 4RBPH 4JFZL 1ACCA 3ZHLA 2HJLA 4QRPD 4MMZB 3ZHKA 1XHHA 4F9LC 5AB0A 4GW4B 2KPWA 1T2XA 3T8VA 1RVFH 4XPGH 2NSXA 1IFHH 3LEXA 4XX1E 3ESOA 4LCIL 5AB9A 2E8ZA 5BVPL 3P73B 1PIFA 1Y0LA 1XTLA 5IBUB 4F15C 2D2OA 2PO6C 4HK0B 4CADA 5E5MB 1XEUA 3UMTA 3V4PH 1ASPA 4ELMB 4QOKD 5JPNC 2BVEA 3DO3A 4GKNA 3ATAA 3GMRB 4QHNB 4Y4FB 3QRFM 1MHCB 1RL1A 2CDGB 2NX5A 5TQ2H 5LWYH 3BSGA 2F0CA 2JNZA 2Z91B 4OLXL 2RD0A 3GZPA 3N40P 4BXVA 5MENB 4NQUA 1HE8A 1TZGH 1FG2A 1A6UL 4FKEA 4JFDD 5FWRA 3BKJL 1IL1A 4NXKA 3TA3D 4FQXC 3SE4C 3KJ6L 3VXQB 1L9QA 2I07A 1OIOA 4JDTL 4L2LA 2WVUA 3MRRA 4PRBA 1NCHA 2ZWZA 1RZKL 4KUZH 4JO3L 2WBJC 4YDKL 3HAEA 5D9SA 4Y88A 1ETB1 1S9YB 1WG3A 3OMIB 5B1AB 4KQ3L 4CW1A 2FO4B 4JO1L 3EOAB 4LOUD 4XH2A 2NY2B 5SV4A 3B2PA 2YPLE 3P3UA 4EVNA 4U1IB 2X87A 2ADFH 4LU5L 3F85A 4FG0A 3U82B 4LBEB 2BVYA 1JZIA 3LN5A 4KKBD 4JG0H 5E6YA 4PJHE 4Y7MA 1ZIAA 1DSWA 4NLHA 1T1ZA 1S7SB 5JUEL 3KPPB 1FVCB 1OAUL 3QDAA 4OF8A 5GGRB 4KAQL 3X3FH 3EFDL 4QTIL 2RACA 1F6LL 4GRWH 1KTBA 3BD4A 2JCCA 3INUH 3U30C 5I73B 1FFPA 1D3CA 4LESA 2YOAA 3T6QC 4NRXB 5F1IA 1KT2B 2UXFA 3ZE1F 1DBAL 2OMXB 5GXBB 1N8ZB 3QIBC 4C83B 2X5PA 3QUXD 4JFED 4B60A 2WBWB 4I1RA 3SGKC 3RKDC 3GMMA 5H4ZA 3C75A 3PWVB 4ZDHB 1Z3GL 1A1OB 1RMFH 1GMEA 1KGJA 1FYTD 4TNEA 5GJTH 1NDMB 4RFOH 1YY8B 3O4LA 4IHOA 2JV6A 4XI5C 1NMAL 4H13C 4J6RH 2OMYA 2HN7B 1ZPUA 3ARPA 4I89A 2P46B 4JKLA 1AS7A 4NPKA 3IJHA 1X5YA 5E6IB 4OZIB 1V7NH 2ZUUA 4HWZB 4U3SB 3EO1B 2E6QA 4FL4C 4P3DA 1IGIH 1MRCL 3I85A 5DEGB 3TPUA 4HUWA 1OP3H 1AD9B 2J72A 3PY9A 2CBQA 1M7UA 2AJVH 4KK5D 1I85A 1IAKA 5E23A 3OM3B 3QI9D 4KHTL 5E6RB 3WSQH 2NW2A 5LXGL 5LHDA 1PDKB 2QT6A 3P1VA 2ATAA 3L3OB 3TEXA 3D87B 5FEBA 4P2RB 2UY7B 2WN2A 3FO2A 1UWYA 5IFHH 2J8UF 4DZBB 4HLEA 5ITBH 4KQ4H 3HMXA 2GSGA 3EG9A 3GI8H 4NZRL 3BE1L 3OB0H 3BGMA 3DX6A 3QEUA 2CXKA 5GSVA 3WHE0 2QADC 3VXUE 1DL7H 4IMLB 4G6ML 3LNGA 5GZOD 3OJVC 2OXHA 3EO9L 4JCWA 4HF5H 1IGTA 1EEQA 1KCBA 1VCBC 1ZA3A 1ZK5A 4GG6E 1ZPLA 3TLRA 3NJLA 1I7ZA 4KK6D 5KVGH 2QMKA 3Q01A 1C5DA 4L1LA 1HN1A 3V6FB 2O6EA 4KZDL 4L37A 1RIHL 3ATFA 3KYNB 5BZWB 4ANKA 3MRBB 2WGNB 4U31A 3NJHA 1GAFH 5AG8A 5J1TC 4K8RL 3VQ2C 4XB8A 2VZOA 1MCNA 2MWCA 4YHMH 2AMGA 1CU4H 1WCBB 3K6NA 1DLFL 1N26A 1U8LB 1CDHA 4A2LA 1SJHB 2YAEA 2XWZA 3UG3A 2AHIA 5DD6B 3MLYL 5DRNA 2PYEB 5AVWB 3LXAA 3TIEA 4CDHA 2I69A 4J1UB 1A02N 2J25A 5DUBB 1V3JA 4I18A 3V0WH 3WHE1 4M8QB 5HHXL 1LO5B 1MHPH 1NBZB 4BSVB 5CBAB 5I1AB 1UEMA 4JQXC 2CR6A 4WEEA 3OKEB 2J7LA 4TUKL 3Q13A 3WXVH 5I0WA 3DSFH 3NSDA 4QYOA 4FFVD 2IEPA 1WP6A 3HG3A 4ZNEE 1EH9A 1G1YA 3VXMA 3P4OA 4XE5B 1FGNH 1IGYB 1L7IH 2XZAH 4LHUB 5D2LA 4GKZB 3QDJA 4NSKA 3GSRA 2X6AA 4L4TB 3H85A 4XO3A 1YEHH 3O11A 3QQ3A 3DROB 1RI8A 1FNHA 2CHDA 2WAQA 1I1CA 4FQ2H 2AZUA 4M1GH 5GS1C 1XGRA 3MUHL 4URKA 4ZYKA 5H35A 4G6AD 3SDYH 5EIIG 3VI4E 15C8L 3GBDA 4ZPVA 3K4AA 4B0MB 4WKZA 1Q1PA 3HS0C 4XNYH 3HG2A 5D7EA 1N12A 1Z6JT 4ZUSB 5FB8A 2NY1D 4H88L 2OQJA 4DN3L 1QBML 4XO4A 1CFBA 2NY7H 2E9WA 3HRZC 4A2HA 2HSIA 2YKLH 5GZNA 3SJVB 1M4KA 1IO4C 4P5KB 4WO4D 3ZXAC 3EJYD 2Z31D 4L05A 3LDBB 2OV0A 2ZPKH 3C8HA 2QPDB 3BWSA 3NABL 1ASOA 2E7HA 4JMXA 1CDYA 4KKNA 4WI6A 3G5ZB 4MCZA 1IGFH 1OCCB 4MMYA 3RJOA 3MKKA 2OMTA 1UYWH 1EAPA 3IJ7A 3D05A 3MOAH 2O4EA 4FX5A 3M86A 1AYRA 3PAUA 3PV7A 5CGMA 3TOPA 3O0LA 4CSPA 4I1PA 3MJ9H 4JB9H 3TBTA 2QFRA 2A9NH 1VEPA 1FG9C 3JV4B 1KYOK 3FO1A 4EI5C 4K8RD 1MFCL 1BQHB 1CL7I 2WLLA 3CDGA 2OW6A 3DI3B 2JJSA 3ARBB 2AANA 1XGYH 3WIFB 2CD0A 1E5AA 3CLWA 1S7UB 2R69L 4ZS7H 1JIBA 1OB1B 4FZEL 2FD6L 3E2HC 3FQNB 3F01A 4FEIA 2AI0L 2VDRL 2CUAA 1KCLA 2MKWA 3OLGA 4PLKC 5G2NA 3ZUNC 2WNXA 4N8VG 1ED3B 5IQMA 2OL3A 1IC0A 3P0VH 3II3A 2L7EA 1EMTL 3ARDC 2EQDA 3ROOA 2DICA 4FG6C 1NAML 2VE6B 4RFNC 3VFVB 2OK0L 4AEHL 4X4YA 3F7QA 3PL6D 4YVNA 4G8EA 4K5OA 4TSBL 2C7UB 1UZGA 2CO7A 1JPGB 4GRLB 3HZVB 5CGYC 4N0UA 5E4EB 3DDGA 1PPIA 3LN9A 2Q76A 2APSA 5DK0A 1W8EA 1TZIB 3HEIB 4TXVB 5DVOA 4XNXH 3ZDZF 4LOVA 4M7LL 4F93B 1LO2L 2B5IC 2B15A 2Q3AA 3IN0A 4KZEL 1YNTF 4YLBA 3WFCL 2OJZH 4U7KA 2Y36H 2J1XA 2K8MA 4N6QA 3BJLA 1CTOA 2YN5A 4N0CC 3KYMB 1AZNA 4OKVB 5SX5K 3CSGA 5T1KD 4JFXB 1A5FL 4Z7WA 4M8UA 5KSAB 1DBBL 2NNRA 2LQRA 4ZOBA 3AU0A 5DWUL 3NJNA 1P9MA 1DQML 4M61A 4ELKB 5FYJH 4E9QA 1HHIB 3PV6B 1OGTB 2APXA 4LSDA 1IEHA 3FAXA 1P1ZB 5MEOB 5CJQL 4UTBL 2M1KA 5HYSA 3EJUA 3D6GA 4LEXL 1S4IA 2VITB 3T0AA 5BV7H 1ZHKA 4GINA 2P8PB 5B3SB 1DDHB 3H54A 5HVFB 1HTYA 5EG6C 4C57C 2V7HA 4K5NA 1QFUH 2QGBA 1XD1A 3VACA 3ZX1A 2Z8RA 5GGSB 2ICEB 1QVOB 2I7SA 2M2DA 4HJEA 1TKWA 3QORA 1G5GA 4J23A 5IHZB 1GOFA 3S5ZA 1KEMH 3H9SD 1EERB 2CCVA 4PCSA 1NIDA 4NUMA 2B1AL 5FX3A 4DGWC 3LQAC 3UZQA 3OXRA 1F58L 3F6IA 2XWDA 4IU2A 4JHBA 4RMRA 1QYGH 1KJ2A 4PJ7A 2D7OA 5LDUA 4GSXA 1YECH 3FF7A 3QWNA 2Q7NA 4ABVA 4E5XG 1XAKA 1G7LB 4FXGA 3N6YA 5I8CB 3MRMB 4F3FB 3QCVL 3KPSA 4MJID 3T2QA 2ITEA 4L8CB 4NC2B 5H37A 4YHPA 1HX0A 1UT1A 1VADA 2PR9A 3NPZB 4OLEA 4YSRA 4JREC 4PJBB 1X7QB 2IIJA 5FFOA 1G43A 1FL5B 4KK9D 1NM4A 4PS8A 4YO0A 1NCGA 3T1FA 1FGVH 1QNZH 1YUHA 3QQXA 1DJGA 4FQCL 4GAYA 2GSIB 1SY6L 4TUOA 3L9YA 2YMXL 3AACA 4MA8L 4BXSV 4LSTH 3AXHA 4MSWA 1N59A 4PRID 4WTZA 3L4XA 2MCPL 1EIBA 1WAAE 1QLEH 2EYTB 3GYRA 4H26B 2BP5M 1CFSB 4LCUA 1E90A 3ZW3A 1U8MA 2CLZB 3GMQB 3UJTL 4BUHA 5DSCA 1QFOA 4RBPK 3RHWK 4Z0BL 1YEDB 1AD0B 3JZ7A 2DQHL 5EN2B 2VDMH 5AKRA 2CR0A 2FL5A 4PJCE 5I17B 4WWKC 4M5ZL 3DGDA 1NMBL 4UILH 4DZ8A 5D8JH 3BDYL 2R15A 1H5BA 4ZAKA 4A66A 4MD0B 1EDYA 4LAJH 3T77A 1JVKA 5D7JB 1RZ8B 3LHAA 4YDIH 4AC2A 2BZDA 3N04A 3ATDA 4LLVB 2J71A 3RVWD 3HLKA 1GZHA 1CLZL 5CINL 3MV7E 2QHRH 3RTQC 1NC4B 4RH4A 2H9GA 4PD4K 1D7DA 4MDJA 1BEYL 3MACH 1M7DA 3MLZL 3MROB 1CDIA 1R5WA 4RIRB 2MKLC 2GEQA 1W0WA 5F7WC 5F9DC 1N6QL 2W9LA 3UCRA 5ES4B 4JG1L 4DFHA 1RURL 1WGOA 1DUZB 4BFIB 4IGBC 3IVKA 1F6AA 1KJVA 5HHNB 3OKNA 2XBTA 1CE1L 3MNDA 1KIQB 2EYSA 4MRCA 4BFKA 3QDMD 5IB2B 3MTXA 3V79C 4YXHH 1ROCA 1D9KB 5KVDH 4OLZL 4PJDE 2WZ5A 1OSZB 2HFFB 2OR8A 2OW7A 3B9VA 3Q43A 3SPVA 4FE9A 1BAGA 5C0ND 2G2RA 1MCHA 4D0CB 5IVXE 3VYOA 2AQQA 2JVUA 4FGMA 1JG9A 1SXCA 2Y7SA 4M43L 1ACYH 4Z77B 5L0QB 5FUOH 4ZMTA 1Z9MA 1LEKA 3IDXH 4L1DA 4NNPL 1P7QD 1E4WH 4P04A 2HTKD 1VHPA 1TCMA 3D85D 1CGSL 1MJ8H 1U8QA 3CV5A 3H9ZA 5JTWA 3L45A 4HYTB 4UM8B 2EDLA 4Q9QH 2NSMA 2JJVA 3O8XA 1B4TA 4XMLH 3LS5H 4JZJA 3PWNB 1TFPA 4JLRB 1ES0B 2XYBA 4OJYA 4PJGF 3CXHJ 5TF1H 3TO4A 4CSTA 2C3GA 3WFBH 3RWJA 2B1OA 3O2DH 4E41D 3IDJB 1DFXA 5JO5B 2PF6A 5I23A 2R51A 4QRUA 3DSNA 5HI4C 1ZT4A 4P23B 3NGBC 1EXHA 4TRPH 2YUZA 1U92A 1BBJA 1T6BX 5HHPB 1DVZA 3O3DA 2D2CC 3DHMA 2JK5A 5IQ7L 2P7TA 3T3MB 3U46B 4AVJA 2Y3NA 3BZEA 4Z3HA 5KYYB 4EUPG 1GC1L 2E9BA 3C6LA 1A64A 3BP7B 4TYUA 5A6MA 4GPVA 3NJIA 5I6XC 2CUIA 3FHQA 2JELH 3FW6A 2AQNA 1OAQL 3WIAA 3ARGD 4NBXB 2W65A 5EZJA 1UQSA 1NSNL 1L4IA 2ZXBA 1DVFB 4XBPA 1DQDH 3L08A 4LK4A 3VW3H 1AI1H 1TCRB 1IM3B 2X2JA 1BECA 3QXDB 5A3IC 3DMMB 1CFTB 4G8GB 3RWGB 4NO0B 3PLYA 2OX5A 2JWYA 3C60A 1AGFA 1BVNP 1NCDH 4NJAH 4D3CL 3EFFA 3OB0K 4M5TA 2IQAB 2MQ3A 4AMKH 4JN1L 1D6EA 4A7QA 2WLNA 2CCLA 2NY6D 2EIMB 2VUOA 3GJFH 2D4FA 3G08B 1KYOJ 4EJ1C 3JV6A 4M7JL 4NJ9L 4OCLC 2EH7H 4JCLA 4CN6A 5BOZG 3FRUA 3TCLB 1R24B 4D8OA 2EXTA 5HYEA 2NNFA 4APQA 1N2RB 2WSPA 5E6UB 1BQKA 4BJLA 2EUXA 3QUYA 4F57H 1JPEA 1AC0A 5C09B 4ZMWA 1PZUB 1BG1A 4IDJL 5DC2A 3FPYA 3EAKA 3X13B 4RZKA 2XWJB 5EIIB 4XTRC 2IPKA 1PL3A 5D71H 1OTSD 1JGUH 1I8UA 5JW3H 4XCCH 2JKLA 5AW5B 3FCTA 3DURB 3FUEA 5GS0H 4OZGF 4RMTA 5FCSH 5A2JH 3TFKD 3C8KB 5B1JA 1WS8A 2Q1EA 4U1HB 1U8HB 4OFYD 1CIUA 5HI5C 1NCOA 1L9RA 2VERN 1KCUL 4B3EA 3GJEA 3IEAA 5LBVA 4Y4HB 1UOVA 3WJLA 3CU7A 3CZNA 4DQOH 1TTBA 5HYJE 5ACZA 4FFYA 2ZTBA 2IVFC 5F9JA 1WWBX 4QCIA 2AEQH 4PRPB 1TEFA 1E9PB 4GKSA 4PLJD 3Q8CA 1INQB 5I28A 3RFZB 3DC0A 5EZOL 4OVUA 4U6XA 4HMEA 3GMOB 1USQA 4H8WL 4OZHA 3GRWL 1N70A 3RX5A 5MI0C 1ZVSA 4F7TB 3L9RB 4HIIB 5BZZA 3V4VL 2IG2H 3UP1A 5B4MD 4X7FC 3TWCH 5E2VH 5IF0A 2AJXH 4QHMA 2J5LC 32C2B 2ETWA 1FBIH 1EEZB 3FFCB 4NWUL 2X70B 3ULVE 3T3PE 2WWKO 4YDJA 2NW3A 5IM7A 3NDZE 4QF1A 1IM9A 3SY0A 1CVSC 1VGEL 4FQQB 2D3NA 3HKZA 4BUQA 2BFGA 4X6CF 4HX1A 5KVFE 1LO3L 1M05A 4FMKA 1XH0A 3KAAA 3UTOA 1I9JH 5IR1A 2OCJA 5CILL 4GMSH 3WY2A 1AGEA 2X4RA 4O5LH 1EZVY 2BNQB 5ADPL 1S8DB 2XWBB 3MXWL 1S5HA 4IRSD 3X1GA 3EH3B 2NY3D 4LSSH 1LE9A 4PWGA 2ZE0A 3ME0A 5EFIB 3L7EA 4L8SC 4LSUL 4Y89A 2GBVA 2EDQA 1PIGA 3D50A 3SDCA 1WC7B 4ECNA 4FJ6A 5F7DA 3ULUF 1UKTA 4AK1A 4BIKA 5C3IA 1MEXL 1J48A 4G7VH 4GRMA 5DFVC 4Y5VA 1CXLA 3UJJL 5L4FA 4WUKH 1OGAB 1MRDL 1OB0A 2CBPA 5IBTH 4A04A 1JWUA 1BBDL 1UZ6F 2HJLB 4HSCX 2RALA 5C0EA 5SWQA 5TE6H 3VFWA 1MFEH 1FVDB 4EIBA 3LEXB 2FECL 1B2YA 2O6PA 5KOMC 4ZMVA 5CCKL 5C0BA 1Y0LB 4TSAL 5JA9A 3P3RA 3TEYA 1ETJA 2YAOA 4XMVA 3V0AC 4NWTL 4ODVH 1D7CA 2DAVA 4GKNB 3GTVA 4HLJA 1IGMH 2DLFH 2NX5B 2ZSWA 3QXAA 1F18A 3EYQC 5DMYA 3L3KA 3KDMA 1U95A 4ZX6A 5DU7A 3ULVC 1PU0A 2CK0L 2BDNL 1FG2B 1NUGA 1ET5A 3EO0A 3SD5A 1J1XH 4JPSA 1QFHA 1HK6A 2KYIA 3N42B 2VDPB 1V10A 5I1IL 3VGEA 3QE5A 1NWOA 4OM1L 2OYLA 3FTUA 1HAWA 1QSEA 1SDYA 4FI8A 3MRRB 4PRBB 4PD4J 3HI5L 3SE3C 1F1GA 3HAEB 5EZLA 1I1YA 2BC4A 4BWTA 1WTGT 4GI8A 2J6EA 3C6SB 1FLTX 5LCVA 3SKUD 4CW1B 1ZAGA 2PO6A 4XN4A 4XH2B 4GS7C 1EV2E 1RJCA 5IREA 3HJEA 3GFUA 4J8RA 3QIUA 1CICC 3DTDA 5JPNA 4DP8X 4WUUE 4S1DD 3I2CH 3I50L 4X5QA 3U4BL 3LN5B 3VE0A 3NTCH 4AIZB 1A4JA 1UCTA 2DW5A 4J7RA 3FFDA 1T1ZB 2MNJB 4F8QA 1GGIH 5KJRH 3EH1A 2NNXA 4LOEA 3BGFB 3U0WL 4FQXA 1AXTH 3F58L 3KM1A 2HX9A 1R33A 4QRPE 2JCCB 3G6JF 4GSDH 5EEVA 5KSBA 1FFPB 2WBJA 3ULUH 2I9TA 5CLXA 2AEIT 4FFZH 5EB9A 2FEDC 2X38A 5C70A 5B1CA 3GMMB 4ANUA 1DBMH 2YQGA 1BQUA 1GGCL 2PTTA 3RG1C 3O4LB 2R0ZL 4V1DD 4IHOB 4L9LA 1A8ZA 2VAAA 1JF1A 1T7ZA 1S5IL 3A24A 2VDNB 1S7VA 3MKGA 5F9WB 2J88H 4XC3H 2DMKA 3ZZSA 5INCA 1N18A 2TRYA 3UDWC 3R06A 4HJSA 1REIA 1HEHC 4X7EC 2IGFL 4P3DB 3TPUB 3VD2A 4HUWB 1PQZB 3MRCA 4PREA 4Q4EA 3WFDL 4DN4L 1T83C 1X5XA 1CF8H 1P4BL 2BW5A 5CM1A 1IAKB 1JNLH 5KS9A 3RDTA 3PQYD 3QIBA 5I5MA 2NW2B 3OJ2C 4LE8A 5L2JB 4OU3A 3UAAA 4UQDA 1MOEA 3TFBA 3FO2B 1SRDA 3P77A 1SHSA 3B7RL 2WLKA 5FYKD 5LVEA 2XV0A 4Z7VF 3F7LA 3ZTJG 5JR1H 4U0RB 2PETA 1F4WL 3W9DA 3F7PC 35C8L 5D6CA 4PBWD 2GSGB 3EG9B 5E99L 3QEUB 3DX6B 3N40F 5GSVB 1GCFA 3FB5A 1CFMA 3FH7A 3PXJA 4WI9A 5LWYL 3ZZLA 2W9DH 1PSKH 2OXHB 3HNSH 4MD4A 2Y06H 2P3YA 4OZFG 4DK3A 5BW7A 1IGTB 4M3JA 3Q44A 4CVXA 4EI6A 3QQ4A 1ZA3B 2EICA 3N43B 5CEZE 4JHWH 3SE6A 1MLCB 1I7ZB 1NBYA 3EHBB 5SV3A 1C5DB 5I8KH 4L37B 3ZK0A 4EQ2A 5SWZE 5BOPA 4UT6A 2LVEA 2CLRA 1KNOA 1FIGH 2FEEL 2XJKA 2Z92A 4HKBA 4NM8H 2OTUA 5FO9A 2YPLA 1FYTE 1YN7A 2MH4A 3A4EA 1NEZG 1QA9A 2YA0A 4YZWA 2R23A 3BKYH 2QHLA 5JOFA 4ZFFA 1KDJA 3QJVB 2QSCL 4KO9A 5TD4A 4PJHA 4KU1A 4TPRL 2ZAGA 1R3KB 1OCZB 4Y4FD 2CO3A 2YPVH 4OLYL 1RZJL 1YYLH 4X4MA 1M57B 4QYOB 2A7BA 1IGJA 4PJXE 1TTFA 1B9ZA 2BVTA 3SDAA 3X3FL 1HYSD 1BSIA 3TA3C 1U2YA 3KYKH 3VXMB 3P4OB 4P2QD 4EZLA 3QUZD 4S1RH 4NQEE 4HJJH 1O75A 2IANE 4JL2A 1F4YL 4NX0A 2QFPA 3GSRB 1NFIA 4NSKB 4U05A 4U1JA 3VXOA 3O11B 3QQ3B 3PDOA 5I1DA 1XGRB 4LOUC 2QSQA 5H35B 4ZYKB 4JNXA 4ZTOL 2B7DT 2VN6A 4FXKC 5LUMA 2G3NA 4O2FA 1E6JH 1XZ0A 3RJQB 4MKMA 5T1JA 4Z7NF 2HH0L 3MUY1 4KKBC 4ZPVB 3IDIA 2F8XC 4NRZA 4PJ7F 4WKZB 3GF8A 2DM3A 5FB8B 1UXWA 2JXMA 4JQXA 4X9YA 4KTEL 1ZHBA 3NCYS 2OQJB 3VXNA 1BF5A 4X7TA 3RYMA 4P4KB 4GW5A 4PV8A 2EDHA 5ID1A 5F0JB 3BRGC 3FTGB 2BOCA 1JZGA 2RB8A 4JPKL 3SGDI 4F7CA 3FU7A 1K72A 1MG3C 2N7SA 4S11A 4MCZB 2OMTB 3QUXC 4JO8A 5GS1A 4OIIL 1JI1A 3MV8E 5B1KA 5K39A 4PMFA 1OF2A 2HKHH 3TBTB 3MRDB 1KG0B 4OGZA 3A5VA 4CU8A 3P69A 1NGPH 3FO1B 4RGND 4NN5B 5T3XL 3CDGB 3HS0A 2WLLB 1NCCL 3VXUA 4JY6A 4ZMLA 5GGVY 4FA6A 5DJ0A 1NPUA 2UV3A 3HRZA 5C71A 1HQ4A 5EULV 3WIHH 2X89A 3VI3E 2KT6A 4LLUA 2YS4A 3WNPA 3DYMA 2YD1A 3MBED 2YD9A 3UBXI 2R7EA 2BWIA 3GJFK 4KK5C 4P0DA 2XV6B 2CBTA 2WUCL 4KXCA 5JIHA 5IFJA 3QI9C 1TJXA 3ESVF 4FTVD 3ROOB 3E8UL 5LLIC 2BXYA 1T66D 4XP1H 1ZS8A 1JXKA 3UIYA 4DKFH 3UBXG 4X4YB 5IROD 4N3UA 4G8EB 1SM3L 4C56E 3IGUA 2CO7B 2ZCLH 2H41A 4WQOA 5A2FA 4GKLA 2DQCL 4WFGD 4EI5A 3QIWD 4N0UB 4I88A 5AD0A 1HL5A 3CZGA 2Q76B 1RZKC 3CX2A 5DK0B 3VWKA 4KV5E 2M26A 4OI9A 4A67A 2IFGA 4ZUWB 4EBQH 3S5LG 2R8SH 3CDYA 3N1FC 1BPVA 3G6AA 4OGXH 3TZVD 5GZOC 4KDVA 1MCIA 1ZTXE 1CN4A 3H1ZA 4FQIL 1DQJA 3VFGH 3AROA 4KK6C 4ZNEA 2ATPA 4NBYB 4OUUA 2H4EA 1YQ2A 4FHJA 1TNMA 2ZKHL 2JKTM 4F7PA 4TQEH 1KGUA 2HKFH 3M6DA 3QO1A 4Z7WB 1NCIA 4KKCD 1NLBL 2FNBA 3SE9L 2G3ZA 2BIIA 1N5AA 4M93B 1WQVT 2X2HA 1JGEB 3EJQA 4M61B 3L5IA 4MX7A 3K6DA 3WNKA 1INDL 5AWNL 1ZDSA 5EO9A 2A77L 3NH7L 4RDBA 2WXLA 1ZHKB 2AQRA 3MLRL 2BSSA 3K74B 2D9CA 4MFHA 5BUAA 3DRQA 2PYED 5FCUL 5GRVK 1YN6A 1E8YA 2V7HB 3DIFA 4NZTH 5IB3B 4OLWH 4AKPA 4XNUH 3MOQA 1KTLA 2H3XC 4XXWC 2SEBB 4DNLA 2EDOA 1TKWB 3QORB 3B9KB 2YBGA 1M7IA 3ZZ1A 4FFVC 5A2BA 4HLZH 4LOFA 2NY0D 1N8OE 4H0IA 5EHFA 3BQUD 4L3AA 5T3XD 3UO1L 2O5ZH 4Q9RL 2VKXA 1AQHA 3OPZL 3FO0H 1EGJA 3MLXH 5EORH 5E8OA 1YEJL 2WWMD 2JB6A 5AYTA 4UIKH 3GLZA 3L1OL 2TAAA 3HTLX 4G9FD 3ZYIA 3GLDA 3KYOB 1KJ2B 3DYPA 1AZBA 3MOAL 4XPHL 5I1JL 2FH6A 3NEEA 1XH2A 3LKQA 4FXGB 2IAAC 4G6AC 1A7OH 5C2BL 2ORBH 4MQXD 5ALBH 4LB8A 3HE6D 5DT1H 4ZX5A 4NGHH 3QZWA 1J11A 1VADB 5TE4L 3FQ4A 2NY1C 1E5ZA 4HXBH 3BP4B 3OF6A 1KCKA 2CA4A 4YO0B 3SZ6A 3T1FB 3DX2A 4GAYB 3T9WA 5DS2A 4FYTA 4AYBA 4PB0L 4LVNB 2XX0A 4RX4D 1HOCA 3K6FA 5E9DE 4WO4C 3EJYC 1QPPA 3SJVD 2Z31C 1KGYE 4MSWB 4EIZC 1N59B 5IMMA 3KNBA 3V52L 1PTZA 2EKSA 3ERXA 4ZO9A 3PWPA 4XODA 4LCUB 4WEBH 1U8MB 2CR3A 5DSCB 4LSRH 1AP2B 2PCXA 4N2EA 5L2KD 1W6LA 1BQLH 3U9WA 1MCSA 5KYWA 2PLTA 5AYUL 3S4SG 1K8DA 2FDBP 2FL5B 3ECBB 5LKNA 4RA0C 4DZ8B 2YEVB 1H5BB 2XQBL 4ZAKB 3U7WH 4K8RC 3T77B 5FM5O 1P2CB 4QXWA 4J3OH 4WI0A 2X2UA 2C4XA 3RWEA 4LQFH 1NKGA 1DBKL 1NBQA 4P5SA 1DJWA 4GXFA 2H9GB 1S78D 2Y36L 3IGFA 4MDJB 2EDFA 3CN1A 4DUXA 1R5WB 4HS8H 4UAOC 1W0WB 4JO2H 4WJKB 2RCSH 4GMTL 4JJHA 3DVNB 5KWYC 3IVKB 2YO3A 3MX0B 1F6AB 2WWNA 1IKOP 4ZT1A 3H3BC 4M6NL 1KJVB 1J88A 3K7UA 3OKNB 2MRYA 3PL6C 4WWKA 2EYSB 3LB6D 5L4IA 5EOCJ 5FW8A 1QSZA 4TM9A 1OHQA 3U6XS 1SF5A 3SPVB 1SMDA 2Y7LA 4MA1C 2WYIA 2G2RB 1IFRA 1HH6A 3ZBMA 3DUUB 3S88L 4PPTA 4QHUA 1E4XH 1VCAA 2EEBA 3US0A 1O7SA 1VESA 1LEKB 2E75C 2NPLX 4MNQD 1CR9H 1JDAA 4WK0B 4JJ5A 1P69B 1HU8A 1P4IL 2L7JA 4JFHE 1U8QB 3UOAB 2VZ1A 3LPFA 4BFNA 4IGBA 5D2NE 4WAFA 4JL1A 3C5ZB 3FU3A 1YMMD 3O8XB 2MJWA 4G6JH 4JZJB 3EJRA 4I85A 5J11B 1F3RB 1QWNA 2VDOL 4JFTA 3MA7B 3TO4B 2COQA 3K6SA 2W0FA 4XNQA 1BGXL 3AGWA 3RWJB 2NTFA 4JRXA 2K4WA 2QTVA 4OJCA 4E0RB 3UTSD 2CMRH 2R1YA 4ODHL 3IJYA 4X9IA 3DSNB 1S7RA 1ZT4B 4M9OA 4XP9L 1JVLA 1U92B 3CZFB 3NIGE 4W4OA 5H8DA 4ZFOL 2VLME 1D5IH 2BIOA 2JK5B 3LS4L 2P7TB 4ENED 4WU7A 3EXJA 2WQRA 2UY6A 3AMLA 4NQTA 2HKAA 4DH2A 3BZEB 1RU9L 4LSTL 3C6LB 4DJMA 4LLDA 1YNLH 5G4MA 1MCWW 5DD0L 1F3DH 1UWGH 3BN3B 4L0ZA 4OY9A 1QP1A 4KFZC 4MAUH 1G5AA 1YUKB 4J3BA 2CJUL 3BP6A 3QHTC 5GGQH 3HZMA 3WFEL 3ZQWA 3BAXA 2VM4A 3FJTA 4JDEA 5E2WL 5D55A 1EFQA 4FI7A 1H3WM 2W65B 2J4WL 4PJCA 1UQSB 2WZ0A 2VOTA 1U42A 2P24A 2X9YA 2R4SL 3BW9A 4NI6A 4XBPB 5C0IB 1NEZB 1UKQA 4L3ED 2VL5A 1ZD6A 1ID2A 3VFSA 2EE0A 4HGMA 2F5AH 2YXMA 3ARUA 5EEWA 3KBPA 3MV7A 4KH2A 5ABZA 1F42A 4B7IA 3C60B 1AGFB 4JE0A 4KK9C 4LLAA 3IT8D 1FV1A 4AL8H 3UABA 2XQYK 3EFFB 3GNML 5EOCL 5HDQH 3HNVL 4PB9L 2MHAA 2XV3A 1KBKA 1D6EB 4G11A 1MAMH 2PTUA 5T1DL 2NNAA 3JV6B 9PCYA 3GUTA 1TQBC 4OCWL 1TEGA 2P5EB 2VXUL 4WI5A 5D1QD 4WGKA 1SFHA 1JF6A 1EAJA 4X5PA 1JPTL 4G59C 4APQB 4FLSA 4HUNB 2EO9A 5MP6H 1C12B 3LD8C 1H3PH 3FU9A 3NZ8A 4PJDA 3KR3H 5ABDE 1NCWH 3LNFA 4NNYA 5JW4Q 3BFWA 2FB4L 5AZUA 3LRSA 5BUGA 4AITA 5IVXA 5G4OA 3X11A 5AW6B 2BINA 3C5JA 3FCTB 4XP6L 2X44D 3RVWC 3DOSB 1YPZE 5DMGD 4MQTB 3ZQ9A 2BIHA 1GIGH 5FKPA 3AB0C 3H56A 1KB5L 4R7VA 5FUOL 4DEPC 2WO3B 5F72S 1ULVA 2MOQA 3K91A 2O5NA 4AV5A 5E95B 4P3CH 3MFGB 4UV7L 1SJEA 5G55A 5I9QC 3EGXA 3N2JA 3IRCA 5FHAH 3BDBA 1QHQA 4U7MA 4NQQA 2MQ0A 4HJ1A 4OFKA 5FOJA 3FT3A 3B7SA 1LLAA 5IIEA 5CJBA 5F9JB 2UWEA 4QCIB 3U79A 4C4KT 5EOTA 2QVKA 4GKSB 4HIQA 4IM8A 1NGZB 4CN4A 3CAFA 4U6XB 4B9IA 4Q97A 2HRGA 1D9KD 2K45A 4XXDA 5C0NC 2FBRA 5FUCC 3CFBB 4YAQA 1AKPA 3OZKA 4XNDA 1Q4NX 1QI3A 3CFJA 3U4EA 5B39A 1EJFA 3I6GA 1PBYA 5IF0B 1PG7W 3CC5B 1NPNA 5D93C 2ZYIA 4QHMB 2HTKC 1BD2E 2N7BA 4NUPA 2TSAA 3NZSA 1EDHA 3U4AA 4NUGL 3N55A 1S6NA 2VNCA 5IM7B 2EILB 2P47B 3BYYA 1U8KA 2YD6A 4QF1B 2ICWI 4XC1H 1RQ5A 3SY0B 2OM5A 1F4HA 2YGVA 4L9DA 3X17A 4BGLA 2W91A 2HUHA 1L7TL 2OTWB 4XP4L 8PAZA 3A3YB 3PWJB 3BKCH 3GUFA 3RUGE 1CIDA 2BVQA 5C08D 4FQJL 5A2AA 1DBJL 4OQTH 2YEZA 4JVWA 1AGEB 1FUNA 4NQDE 2KUTA 3CIQA 1ONQA 2V5TA 2MIZA 3DXAD 4I3GA 3SPIA 1S5HB 3IMSA 4UI2A 1SHMA 3U0PA 3VD0A 1LE9B 1F2XK 3ME0B 5GHWH 3L7EB 5C97A 3TBYA 4ZZFA 2X3AA 2JIXD 1XIWD 4M7ZB 3SDCB 5HHOA 3UO8B 2DDQL 5F7DB 3T65B 1MCPH 4MXWH 4KVPA 3JQOB 2Q5BA 4R3SB 4Y5VB 4Q89A 1G7JA 2D0HA 1ZVHA 3CPLA 1JWUB 4UTAL 4P59H 1S9VA 1KGWA 1I4FA 3ARGC 4TOYL 3QQDA 4WIQA 1QSFD 1HZHL 1HI6A 2XZQH 1HNYA 2DIJA 3WTVA 4C4BA 2VQTA 5C0EB 5SWQB 1UUNA 2MCMA 3VNZA 3SQOL 5I24A 1D5BA 1JGDA 2QELA 4Q9CA 2OJEA 4BINA 2FEJA 3AG1B 2YA2A 5C0BB 4YFDB 5CGBA 5GGTL 3KMDA 2QKSA 4L8SA 5E1AA 5DRXB 1QPXA 2ZJSH 4EDWL 2X4NB 2FHCA 3IWVA 4NP4L 2ZX6A 3DK0A 2ZSWB 3ABGA 3QXAB 3AREA 1IJNA 1AY1H 4HWEL 1WGVA 2NY6C 2UZPA 3L3KB 3KDMB 1U95B 3NJFA 2G0KA 1Z32X 4H25A 4YR6B 1B3JA 2JLPA 2VGLM 2YD4A 5A1AA 1F8TL 3FNKA 5DVPA 2W9EL 1PZ3A 2X6BA 3DTXA 4TVPE 2LU4A 4YSQA 1QSEB 3ZO0A 3QHFL 3V4UH 4UT9A 1OAYL 2O1AA 4OI7A 5EZLB 1I1YB 3PP4L 4IS6A 3KPRD 2E56A 4F15B 1OTSC 5LXVA 2PO6B 3G5YA 3VTTA 3FK3A 1A3ZA 4J8RB 3T8MA 5JPNB 4U0QB 1AG6A 2HFEA 2CWRA 2P49B 1F1DA 5KBNC 3TFKC 1ML0A 2CKNA 2CU9A 2D73A 1QBLH 2GC4C 4NO2A 2AEWA 3ZQXA 3ZRCC 5FA4A 3DGGA 4R90H 1WBYA 2DF3A 3G3LA 2PMZA 4NNXA 1VFUA 3D69A 3FFDB 4HWUA 3LZLA 1F5WA 5D7SH 1XL4A 4S1QH 1DJZA 3MGOA 5L8KB 5CR8A 1IT9H 1OP5H 2C1PA 1XCTA 2NXZD 4FQXB 7TAAA 2Q2LA 1ZGLM 2H8PA 5EU5A 3TBVA 4I0CC 2OMNA 1R75A 4XVTH 5KSBB 1GC1C 1YEKL 2WBJB 1RIUL 3FQ2A 4Y5XA 3BO8A 4PLJC 3X3GH 1BP3B 3N44F 5JHMA 4RSVA 3NSCA 1CDGA 4OGYL 5KANI 4M6MH 5DR5L 5AQ0A 1MUJA 4I8DA 4X8CA 1CICA 1Q72H 4PJEE 3T5WA 2CPUA 3FTYA 4WW1A 2PTTB 2X6VA 2FX7H 3H9HB 1HKLL 1JF1B 3DLQR 3MDJA 5B4MC 3F65A 3OHXC 1YYMH 1Q0XL 1CC3A 1Y6NR 1AGBA 2CA3A 5HJDA 4MDIA 4HIEA 5KANG 1UACH 4ONGL 5INCB 3CHXA 1EO5A 4FZ8H 2VDPL 3OZ9H 3R06B 5GS0D 4XVJH 2VMEA 5J1SC 5EU7E 4WUKL 1FH2A 2Y5EA 4K71C 3MRCB 3NRPA 4PREB 4OQ1A 3U30B 1TVHA 1UATA 2D7TH 4C4UA 2XPZA 5KS9B 1DN0A 2GABA 4BEIA 2I5YL 5CUSH 4GG6F 4OLUH 1KIUA 2OBGA 3QIBB 4DKAA 4Q9BA 3NN8A 4IRZA 4JY5H 4Q0XL 1AQMA 1CF1A 1W2KT 3UTQA 3MV11 4ZJ9A 2AF2A 3PGCB 5ITFA 3JV0A 3QZOA 3P77B 3KHQA 4Q14A 3HG1E 4XZ4A 5ALCH 5DZ9A 1OM3H 4IRSC 4EN2A 2NY3C 1W16A 1KLUA 3BKMH 1TU2A 5EBMB 4MZRA 1YEGH 3UDWA 1JPST 1RUML 1TO4A 5DK2A 2CUMA 3D0VB 4DEUA 3H0TA 4FL4B 4MD4B 4FFWD 3S9DB 1KC5H 4KPHH 4ZD3L 4EI6B 4Y9CA 2AV7A 3VDBA 1T83A 1DJYA 5T5FA 3Q2LA 1TJMA 1MFAH 1NBYB 2O5XL 4YNYA 1IU1A 3WV0A 3QEHB 5GS3A 5J06A 1RFDH 3WLWD 5I0VA 2ZOUA 1BZEA 3KLSA 5J12C 4ZO7A 5GISH 5J3HD 1KNOB 3VXTA 3ZL4H 2P8LA 4I2XE 5IJKC 2Z92B 4HKBB 4F7MA 2K6WA 2GTQA 2VDNL 3FB8A 5EOQH 4OT1L 1M2OA 2OTUB 5FO9B 1S9WA 3IU4H 5GRUH 3US1A 5IGXH 2HFGH 3NCMA 3FOLA 1QA9B 4WUUA 3FT0A 1ZA6A 1OAKH 2H5UA 3CMOL 5F1SA 2R23B 4ZUUA 3WTYA 5JOFB 2PN5A 2QADB 3V5DA 4ZFFB 4W6XB 2Z4TA 4PJHB 1RUKL 2V9QA 4A2DA 3L3DA 1AQDA 1SBSL 1NCBL 3VI4F 4ADJA 3JT0A 2JKRM 2XZCH 1Q94B 2TRHA 2VQ4A 2Z1KA 4PJIA 3O81A 2MCAA 5JLZA 2BFVH 4Z95H 2R29H 4QRPA 2H1XA 2IDFA 5LG1A 4LSQL 2Z7WA 4FQLL 4PWFA 3ILPA 2XOTA 5HVGB 1HC1A 4AG4H 4LPWA 4LPUA 12E8L 1NFIB 4U1JB 1E5UI 4ZW7A 1QR4A 1B4JH 2I32A 3VXOB 1OW0C 2YXVA 1IC1A 3PDOB 5FYKE 4ZMOA 5I1DB 1KDIA 2OR9H 2ZOTA 1YNKL 1DBML 2V0AA 5KVEE 4LPCA 5EEYA 5I2IB 2I27N 3HFFA 2B1HL 3B9EA 4QOKA 2ZNXA 4XPAL 2ZXCA 4O2FB 3KM2A 1JNJA 1XZ0B 4PG9B 1BFSA 3JVGA 1AJ7H 1JUFA 4HEPA 4S1DC 3RY4A 4R4FH 3MAWA 3CZUB 2ED9A 2RTTA 4NRZB 4ZX4A 5LO7A 5E7BA 3TXAA 4DKEL 1UXWB 5HJ3A 2JXMB 1R3HB 1A3RH 3VXNB 1P6AB 4X7TB 2BIMA 1AC6A 3TM6A 1R3LA 4GW5B 4PV8B 3BYTA 5FA3A 2X6CA 4R6UA 2Y1AA 1FCCA 1RUAH 2YD5A 3REWA 1JGLL 2BOCB 4F7CB 2B9BA 2ZT9C 4HKZA 2X05A 4ABWA 3FU7B 4BM7A 4LF3A 2HTLD 1RHFA 4LASL 1E5CA 1IBGH 5GS1B 4FNTA 4MLIA 1AE6L 4BH8A 1W72H 4FXKA 2BW4A 3HCVB 4V2BA 5K39B 4KRMB 4XO8A 1X9LA 1OF2B 8FABA 4KXZH 1A2YA 5PCYA 4UYQA 5IW1B 4G8FA 4AQ8C 2QPEB 4WK4B 1JE6A 3HS0B 1PY0A 3VXUB 2D03L 4WO0A 4JY6B 1I3GL 4K3GA 1EJ8A 3KGSA 4B9GA 3BWZA 1BQRA 5DJ0B 4XAKD 5B39G 1Z9SA 3HRZB 3GT6A 3IYLW 4E9YA 2EXWD 1HQ4B 3CQPA 5K9KA 1EZLA 2FO1A 4EIUA 4LLUB 1PLGH 5AAPA 5D70H 5C9JA 1MFDL 3D30A 1UVQA 5CJOH 1UJ3C 4IKNA 2R7EB 1YEIH 3HHSA 3KWTA 2K3TA 2G3XA 2K0RA 3ZUCA 5GIRA 4XPFH 2PKDA 4AEIH 5IFJB 4QXTA 3IS1X 4N86A 2APVA 2DTML 3QUXA 4JFEA 4AY0A 5AAWC 1OLLA 4HISA 2H1LM 3CVHH 3O6LL 4NHUA 5CKAA 1ZS8B 3U6XA 1FYTA 3RBSA 3ZTDC 4R8WL 4W9JC 4EI5B 4WNQA 1JYNA 5AD0B 3ULUD 3VWKB 2IFFL 4K5PA 2QMJA 1T2JA 2V3DA 2AEPH 5HYQA 2J44A 2H6PA 2YRLA 4AGLA 3E2HB 2VDQB 1Z9LA 4F58L 3FUFA 5HYFA 5KBLA 4PJXA 2BZCA 3QC6X 3ZT7A 5I74C 5E70A 5E4OA 5HGBA 1SVBA 3S36H 1TPXC 3QR2A 1UG9A 4KTYA 4S0TD 3ARDB 4F7PB 1UUSA 2IANA 3UAFA 1KACB 3QO1B 1JERA 2AK1L 3MC0A 4RFNB 2G5UA 3TBWA 1N5AB 1RK0A 5C0RH 5DF0A 5IOPA 1JNHA 1EHNA 4WJG3 1P6FA 5EO9B 1A7NH 1FHGA 4HKJB 3OAZK 2V5YA 3BWUC 2BSSB 2EABA 4KBPA 4LAQH 3ZL2A 3TEWA 3DRQB 1ILUA 3GHEL 1FRGL 1S7TB 1YN6B 2B5IB 5GZOA 3SYQA 3DIFB 4LP4A 3EOTH 4Y4FC 2VLJD 4DOHE 1J9SA 5T3ZH 4GUPA 1KTLB 2OL3L 2VL4A 3BN9D 2VQUA 1M7IB 1H3TA 1LMIA 1HYSC 3WMQA 4P4RB 5E5UB 2F9BT 4E9SA 3R4RA 5E8OB 1DEEA 1U8PA 1PX4A 3QUZC 3OX8A 3A6OA 4FTVE 4Z3FA 2Y6SD 2JB6B 4PJ8A 4FMVA 1IIKA 3W2DL 4PLNC 1LTXA 2EH8L 1AOHA 1KBWA 4D8PA 3QDJD 1F90H 5DI8A 1THCA 3MV8A 4UMGA 4RRPG 1WZKA 1WAAF 5L9DL 3LKQB 2XLLA 2WC7A 43CAA 1UCBH 2VLLA 4ZMAT 3AVEA 2E7DA 1N68A 4QY8A 4M48H 1MDAA 3QZWB 3QHZL 1HWHB 4JFFB 4XXWA 1MRFL 3NJVA 3F5WA 4UNIA 2IPTH 3VI3A 2ZOKA 3PGDA 3JWNH 4TN9A 4FG4A 1A6VH 1HOCB 3F6JA 4AOFA 2HVJA 1KELH 1TTAA 1KENH 1SJVA 5IW3A 2F53E 2V37A 3BQVA 1Q38A 2AJSL 2UVEA 3KNBB 5IMMB 5L8JB 1QFWH 4HWBA 2EKSB 3K8LA 3PWPB 4QRBA 1IC5H 4JFQA 4PRHE 1DEDA 4HHGA 3CFTA 2ZP0T 5DJYA 1CE6A 2MOVA 1EVTC 4C56A 5KYWB 1MREH 1TUPA 3THML 3VXRE 1HHGA 4N2FA 5TPWL 4G8AC 5I8EA 3U4KA 3RWCA 4RGNC 2YBRA 1RK1A 3FUHA 4JREB 4F2ME 1T4KA 3S5YA 2VCOA 5I15H 1H6UA 2C9SA 5FHBL 2P4AB 2VLRE 4YHOL 3RWEB 1XMWA 1MG2C 5LG6A 1M56B 4DKTA 4PBVC 3BMWA 2C9RA 1TITA 2XIDA 4OKDA 4WO4A 5T3XE 1AZRA 2Z31A 3MBEC 4K5MA 1ITCA 4YX2H 1FNFA 2WJ5A 3MV9D 4M02A 4AQ1C 2VLKD 1NQBA 3D48R 4PY8I 1J0ZA 5MEPA 2EADA 1VA9A 1RZJC 2H1PH 1AXIB 4RAUB 1JI2A 1T66C 3KVPA 2G9HA 5KVGE 2D0FA 1EXUB 2R9HD 3VWJD 5IROC 5A43C 4WWKB 1MW3A 1T2QH 1GR7A 3L17A 5DUJA 5DVKA 1J5OL 3RX8A 1KTCA 1LYQA 3DBXA 1BIHA 4AH2B 3QIWC 3O6KL 3BT2L 3UJIH 1ETA1 1VPOL 4YMPA 2AITA 4CVWA 4UOQA 1HH6B 2L3BA 3IFPA 3KXFB 5HHMD 4OCXH 5EWIH 4NZDA 3N1PC 2VM9A 3TZVC 4AE0A 3RTQB 5G5DA 3LH2H 1BZOA 5E56A 1WAPA 4DK5A 1ACXA 5ETUB 2QSVA 3EJJX 2YK1L 4FN0A 4JJ5B 3SDXA 3OQ3B 4UZSA 2C4FT 3BGAA 2FJUB 4B53A 3QZNA 4IGBB 3HFMH 1J86A 4P57A 5EZIH 2CO1A 4G1MA 3NZUA 4KKCC 1OP5K 3BLPX 1YEFH 2OSWA 3PL6A 5L2KE 3L3GB 3WXWH 1Q9KB 4OSUH 5IK3A 2WNWA 4X80L 2FUTA 3TF4A 3K6SB 1RJZA 4WFEE 4XNQB 4DVRH 5BRZB 1A7OL 4BD4A 2QQQA 2NTFB 3CFCH 4JRXB 2QPUA 4X99A 3RY6C 2R1YB 1BM3H 3IJYB 3MBWA 2QR0A 3T2NL 1B2WH 3DX8A 4UB0H 2XKNA 3KHOA 1AFVL 5BJTA 5ADOH 2XTLA 4PQXA 4W9EC 1YQVL 1E42A 4MQSB 4YIQA 1WBXB 3U9UA 4FKHA 5CEXA 4JKPL 2Y23A 5E9DA 4K2UL 4WU7B 2UY6B 2NY0C 1JRHH 2VWEE 3BQUC 2FIKB 2ZCKH 1FWXA 3T0ED 4LLDB 2Z0UA 1SEQL 2OS7A 1A7BA 4UBDD 2ZUQB 2WWMC 1LVEA 4Y9FA 3WEXA 4HJIA 4KXAA 2CNYA 4J3XA 3ALWA 3AU1B 4JDEB 4WTXA 4YFEA 4HCRA 4PJCB 3NFSL 3STZB 2Y3AA 3PFUA 4Q7DA 3EDDA 2P24B 1TTGA 3LVEA 3BW9B 4RGOH 3DTUB 4MQXC 2DLEA 4LFHD 3B3IA 2VL5B 3HE6C 5BMFL 4TTDD 3V8CA 1JHLH 3VFSB 2PW1B 3KPSD 4R4ND 3NGBB 1ZANL 3LEVH 1GGBL 3MV7B 2UYLA 1RULH 1R34A 1ASQA 1T03L 4MNQE 2CKBA 2MHAB 4X5RA 4FA7B 3MRFA 1L5GA 5TDNA 1XR8A 1NTDA 2HRPL 3ZTEA 4ZMQA 1FP5A 5I6XB 1E6OL 2R69A 3HPJA 2NY5H 2MPAL 2NNAB 2QQNL 1E28A 3GUTB 1CDBA 1SZNA 4K7PH 4QJ3B 3CFIC 1L9OA 2QV2A 4M1DH 4PAZA 4IHBA 4XNMB 2G30A 3NSJA 4Q52A 4Z7QB 2FT8A 4BA0A 1RIVL 1JXGA 3OL2A 4MJIA 5BQDA 4I3RL 3VRLF 3TS8A 1I9RH 4NNYB 3BPOC 4FQPA 1NAMA 3UEZA 3LRSB 4E9XA 1EHLH 2ZWYA 4ERSL 5IVXB 4WJ5B 3X11B 1QMUA 2DMHA 4I3SL 2H0FA 1E7VA 3A21A 3KPMA 4ETQA 1DSYA 1Z5LA 3HNTL 5JW5A 3LV3B 4CBZA 5FKPB 3MODH 3EDFA 1S78C 5INDA 1O7DE 3ZVVA 2VWEC 3SQRA 5JDSA 3W3BA 1SJEB 4M6OL 4QRQA 4S0SD 3EGXB 3CK0H 4WW2A 1JCVA 2NSQA 1CFVH 3ESMA 3Q2NA 1DYZA 1E9OA 4WI4A 4XMWA 4YXKL 3ZTNH 5IIEB 4G3YH 1I82A 2UWEB 3LB6C 5ANHA 1U3ZA 2DY2A 5EOTB 1KJMB 3QEQD 3RIAF 6TAAA 1FZMA 1U8IA 3PRZA 4UZGA 4YDLC 2N59A 3BLBA 4P46D 4BCZA 4O2CA 1GJWA 1O5PA 4XXDB 3VGAC 5E4EC 5G4NA 4DPAX 4K07A 3QEGL 5FYJE 4M6AA 3HMXH 1WWAX 4XWGH 1ZEAL 1GA2A 2ZCZA 5I19L 3CFJB 3AUVA 3U4EB 5B39B 4YZFE 4N2CA 3V6OE 4BFEA 4AT6A 5I18L 2GPZA 2X9ZA 3DWTA 3I6GB 3JWOH 2HJFA 4IKKA 1KWKA 1FZJA 2XXGA 4LSPH 4OR1A 5CLTA 2WKOF 4P5TD 5C0CB 1MXDA 3ZDXE 1U8KB 4KRLB 3MRNA 3B3BA 1SMOA 5TQ0H 3VD1A 4DP1X 4IK7A 2HT3D 5AL8A 4Y2DD 3DJ9A 1OTUD 1YZZA 3QDMA 3K4DA 1NFKA 5FWQA 2BVQB 4MZ2A 2BY3A 3L4VA 4FNRA 2EE6A 2GQHA 4YHZH 1ZXQA 4BYHA 2YEZB 5MI0B 2Q7YA 1IRAY 2DBLL 1ONQB 2BX5A 3QARA 2ZCHH 4WI2A 3NIDB 1UWEH 3WAKA 1FC2D 4NCC2 3CVIL 3TBYB 4UDUA 1SUJA 4ENEC 3SCMD 2VDLB 4DW2H 5HHOB 1ZT7A 1R4XA 3D85A 2YD2A 3RX7A 1OSPL 2A3TA 1V05A 1TJIL 3L3IA 4PY7B 4CC1A 1M9SA 3RGHA 1NICA 4N3TA 4NKOA 3C6LD 4RMBA 3RX9A 1G7JB 3WKYA 2JKJA 3CPLB 1SY6A 3UTZB 3WU1A 1I4FB 3QQDB 4D9LL 1IEBB 1HI6B 3OG6B 5I16A 2ID5A 4X0KA 3QG7H 4P2YA 5HDBF 2GEEA 4KOCA 2EDKA 2OYMA 1D5BB 2DYPD 3UYOD 4PCKA 3IFNH 2Z9TA 1Z0MA 2DLIA 4HGKC 1YPZA 5E2JA 3VU1A 4L8SB 1XH1A 2OMUB 5FO7A 3C60D 3V6OC 2DI8A 4FAAB 3VM7A 3X1NA 3B7YA 3VH8G 5BV7C 2R59A 3AREB 3BVVA 2FSEA 1HKFA 5CHNB 4Z7OF 1M7XA 4ZW5A 1SN2A 4TTGA 2A83A 2N56A 3BPLC 3FRPA 2KC0A 3KBFA 4H25B 5D1QC 3DPBA 3M8OH 3INOA 3T4AC 3VDCA 1K8IA 2P5WE 2ARWA 3HMWL 3L2NA 5DQJA 2WLHA 2CGRH 2ZKXA 3DTXB 4Y5YA 4ZBJA 2HP4A 1C5BL 5IT2L 1KB9K 4APQD 4XP5L 3QYCA 2BP0A 3QUYD 3IGAB 3Q06A 2X1QA 4IS6B 3CZEA 1QTPA 2XFGB 2G60L 4GQQA 3IJ8A 5DO2D 3G5YB 1DANT 2HFEB 5DMGC 2X9WA 4M7LT 2GUOA 2GY7B 4G6FB 1UD8A 4WY7H 5C2UB 5KVDE 3DGGB 4X8JA 1BX2A 4QXVA 5IHUL 1IQWL 2EVIA 1WBYB 4HH9A 4N9GA 4Y2OA 1DVQA 2B9AA 3J07A 3T3PB 5E0FA 5DHYB 4ZSOB 4LRNL 3JTBA 1NJ9A 4PJFA 2IBBA 4L18A 2C1PB 1VJSA 1XCTB 2YA1A 3PYCA 1DQKA 4M1CD 2H8PB 2WGXA 5EU5B 3A23A 1QSFE 3POHA 2ITFA 3TBVB 1J9TA 3UZEC 3RUGA 1R0AH 3BO8B 1U21A 4PM1A 4NERA 1XXDC 2R0KH 1F4AA 4GS7B 1D9KC 2YRZA 4GQZA 3MRHA 4CJ0A 1RY7B 1CICB 5HSFA 3CQQA 4J3VA 5DHVA 1VIWA 2BZ7A 1BJ1H 2GBAA 4OFYA 4LL4A 1LGVA 3OV6A 1AGBB 4PR5A 4MDIB 4HIEB 4XHQA 3UFIA 2ZONA 4IKIA 3HG5A 1OARL 3OKOA 1G6RA 1K2DA 4FP8L 4GIPD 4XBEL 1WEJH 5HDOA 3NFNA 5IV2A 4JPWH 5J6HA 1IKNC 5JIKA 3JSSA 5CSGA 1KN2H 1ANUA 1TVHB 4I1NB 4AIXA 1IM9D 1IVTA 3VG9C 5D7LD 3QO0A 1DN0B 2AEOA 2FR4A 1HXKA 1KIUB 2VSKB 3B5TA 1GPOL 3CG8A 5FS5A 2AQSA 4B0MM 4RNRA 1NCTA 3C6EA 4H20H 3UTQB 4HS3B 3KPRE 5ITFB 2WQVA 5CS7A 1CK0H 3FL7A 3MV01 4ZFQA 3OHXA 2C5DC 5LQBH 1TU2B 1V7MH 1XIWC 4F8TA 4MJ5A 4TQPA 4ACTA 5EMYA 2WXRA 4DTGH 2BSBA 5EF0A 3H0TB 2BOLA 4XN1A 1HH9A 5ELIA 4YNYB 1RERA 3CBRA 4MNGE 4ODXA 3ABZA 3CX5K 2HX7A 5JXAL 5FUZL 3MRJA 3WOVA 1C7TA 1Z2KA 2AXHA 2DMBA 3G5XA 1QASA 3VXTB 2P8LB 1KJ3H 4F7MB 1B6UA 1KJ2H 1VRSA 3FB8B 4IRSA 1S9WB 4J4PD 3PWLA 4TULH 1DE4A 3FN0H 1E30A 3FOLB 4KY1L 4WUUB 1ZIBA 1ZA6B 5D1ZI 4FMFA 1NCUA 4WFHD 2DV6A 2LVCA 1QBLL 3V5DB 2WQSA 3ABMB 5CR1A 5IZ7A 4O51A 1SXNA 1RXLA 2H6UA 3L3DB 4GXVH 1AQDB 1TLKA 2ICES 4NDMA 4GJTB 3OKDA 5L88L 4JFOB 4PJGE 3FMGH 4ZS6D 3GXFA 4YWGL 3GK8L 3HOGA 5EF2A 4PJIB 1KFGA 4HXAL 2ZX9A 5JLZB 4QRPB 1SJXA 3SYOA 2CXGA 2CK2A 1NBVL 3F62A 4Y19E 3K2UH 1AZUA 4UQAA 2DWTA 1OPGL 3ILPB 1B88A 5E5RB 5IJKA 2C26A 1NGQL 3EGDA 1OP9A 4JHVA 2BSDA 2ZUTA 1PNDA 2WOBA 3GBNH 4PJEA 4MS8D 4QOKB 2FZ3B 3F84A 3VRIA 4PBXA 1LO4L 1S3RA 1JUFB 3QIUD 5CIPH 4NENA 1WT5A 2YARA 2NYKA 4X8XA 4XMKH 5DS8A 5HJ3B 1KXTA 1J8HE 5K69A 3OZ9L 3L1FA 1JS4A 5DWPA 2DQDL 3U2SA 1IGCL 3I9PA 4JFDB 1UM4H 4UT6L 5BZDA 4K3EH 1R3LB 3HS8A 5A16A 4LDLB 3TA3B 2NXZC 5FA3B 2H47C 1T1XA 1XTMA 3HN3A 3REWB 5DZNA 1N6VA 3UEQA 5FDYA 3A4AA 1JZ5A 2N0MA 5I1CL 4AGNA 4KMTL 3C9NA 3GMNB 4LF3B 4KX8A 5AOZA 3NA4A 1ZVNA 2GTZA 4JKKA 5GSRA 4BH8B 4HK3N 4H8PA 4FXKB 3KL5A 4NOFA 3I02A 1T0NA 4ZFGL 1I8KA 1A2YB 3P9LA 5FF6A 2OZNA 2YQ2A 3BP5A 3RAJL 3WGUB 3WIIH 1MCOL 4KDWA 2KZBA 4WZ9A 1EVUA 1J1PL 5C0JA 1Z9SB 5JOPD 2RA1A 1DQLL 3GSNA 5K9KB 5GS0C 3FTWA 3MLWH 5IQNA 3V55A 3D3VE 1HL4A 5C9JB 1FE8H 3U1PA 1UVQB 4RZCB 4HT1H 4YSEA 3HHSB 4Y2NA 6FABH 4AYSA 5DUMH 5GIRB 4L1TA 4XRCA 5T33H 4QXTB 3RVUD 5A2LH 4I2XA 3QUXB 4JFEB 2B59A 3RDTD 4OZGE 3D25B 2JF1A 4NHUB 4O9HH 3S37H 1FYTB 1A7PH 3ZTJH 4V1DA 4BZ1A 3B2VL 4KGJA 2GB2A 4AQ8A 1PZAA 2IAMD 1ZLSL 3MLSH 1ORSB 4WNQB 1YCSA 3VFNA 5DD5L 4E2OA 3MUJA 3MXVL 3TEUA 3D07A 4DUVA 4OZFH 2H6PB 2Z93A 3TJEH 3D0LB 3WUWA 3CXDL 2ZD0A 4FFWC 3RA7H 1XGTA 4PJXB 2YGQA 4BFFA 1T1WA 1UJ3A 3DJRA 4XCYB 5HGBB 1LILA 2BFVL 3JYBA 4WCYH 5LBSA 5I1EL 3WLWC 5A40E 3PQYA 4LRIC 3U0TA 4O4YL 4W9LC 5H2BB 4MXQD 2Q20A 5GRYA 5J3HC 1WE5A 2WY3B 3WFHA 1K6QH 1IQDA 3H42H 1HE7A 3TBWB 1CDUA 3V6ZA 3X14A 4ORGB 3G7TA 5IOPB 1J10A 3IAQA 3DBSA 2FBJL 3V5KB 3QDGE 2YPLD 3V2AR 1GYWA 4NZUH 2W59A 3RU8L 3VM5A 2XQYG 1KB9J 4KZ0A 1INEL 4TV3A 5I0XA 4YBLC 4WVRA 4X6CE 1B0GA 3GD1C 3WUZA 5IOKA 2CGYA 4OD1L 4YHKL 2A9DA 1ADWA 2AVFA 3SDAD 2JLLA 5DEFA 5AL0A 2NZ1A 1DEEB 1U8PB 2RR3A 3QFJE 3OX8B 1BYNA 4BQ9A 3ARSA 1XGPA 3L4UA 3ELAT 4OCRH 4LSVH 4CC0A 4D8PB 2ZIDA 5DMKA 5DI8B 3MV8B 3ZMNA 3PDDA 5ANME 2VXSH 3A6CH 3AWFA 3GSUB 43CAB 4GUOA 2VLLB 5I6PA 2O5YL 3TT1H 4QY8B 1TQUA 3ULUE 1WA1X 3BD3A 4YH6A 4AYDC 5CLWA 3ZHDA 4IIQA 2WLYA 5I8OH 2BSED 2FX9L 3VH8B 4MA7L 1XSKA 2E8YA 3F7YA 2F2HA 1WFJA 2QKIC 3SKJL 1UZ6E 3F5WB 3L7FA 4HAKA 4OF7A 3VI3B 2ZOKB 3PGDB 3WO4C 3ML9A 1OVZA 2A38A 2HVJB 1LK2A 1NFAA 2DJSA 4E36A 2DD8L 1E3ZA 3D4GA 1BOGA 3QUZA 5M95B 3L1EA 2DWYA 2F74A 4I48B 3IDNA 4JFQB 3RVVD 2APFA 3ZE0B 4YSUA 2YAQA 2HTLC 5IVZA 4GQ9L 5DJYB 4FFYH 3VYNA 2EDWA 1CE6B 4E42A 5CZRA 4C56B 4YPGA 2WVVA 2OMVA 1NOLA 1T7VA 2AJUH 2BY0A 1HIMH 2V7NA 2EZ0D 5D6DC 3B1TA 5I8EB 1RLWA 3HC3L 2BHUA 4N8CL 3RWCB 1RZIA 1J5IA 4R0LA 4IBLT 1HL9A 3RB5A 2NY1B 1T4KB 2VLJE 3VXUD 1RHHA 4DCQA 3JTSB 3V4PA 2EXWC 3E9UA 4H4NA 4WO4B 5ICZA 2Z31B 3S3JA 2X89D 1HESA 5E1GA 1ILSA 1MQKH 3QPXL 3NQKA 1W80A 1M42A 1I85C 5MEPB 4LIQH 2G9HB 2LHAA 4PJ9A 5CP3A 2OCFD 3KPNA 2ZXAA 3O6MH 1E3XA 2NOYA 1UH2A 1GKEA 2E0PA 3DBXB 5J9PA 1F4XH 4G9DA 5AOMA 3ULUC 5KSUA 4GAGH 3T04D 2EE9A 4LVOC 4DERA 3IFPB 1NCAH 2FLRT 2ZUYA 3VWKD 1J1OL 1CWVA 4DGYL 5B3JF 1Q9OB 5G5DB 1WFMA 5D7IF 3LQAL 4PG2C 4ZMYA 4GG8A 4Z7UF 3O9WA 1MNUH 2W60B 3AFLA 3MBEA 4KROD 3HZKA 4UAOB 3A6BH 4LCWD 5CCHE 1QWUA 1JZ3A 3KH3A 3SDXB 2BHZA 4AQ1A 4FYSA 3SYPA 5I6KA 1BAFH 3P40A 3G04B 3V0HA 3FKUS 4FTVA 5I1GL 2YAHA 3GSQA 4P57B 3ILEA 3PL6B 1OCOB 2XPYA 4JM4L 5IROA 3TASA 4AEFA 5BS0D 4LCCC 2OSXA 4JDVA 4YC2C 1QKZH 5IK3B 3CBKB 1EUTA 1G0YR 5J7CC 1JZDC 4OTXL 3L3HA 1L6ZA 3QIWA 3O0RL 4X99B 3F8UB 1P7BA 4G43A 4HU2A 4MA1B 2V3EA 4Z3TA 4O02H 5DMIH 1SHWA 2QR0B 3DJZA 3TZVA 3DX8B 1A9BA 2BJMH 1YRKA 2B4CH 2XKNB 3AMKA 3FB6A 1QFWM 1T20A 2DJ4A 4I18C 4R9HA 4QJ4B 2WXIA 5CEXB 5DZJA 1VFBA 3TNMA 3K71B 4NM4L 4GNKB 3BN9C 3W57A 3EZ8A 5E9DB 2VC2L 2F53A 1MHEA 4OFDA 2P9RA 2CDEA 4NQCE 5T1KB 3FQWA 5T5NG 1QD0A 3FSWA 1MIML 2BRQA 1U3HD 2VLKE 3MV9E 2DQIH 4KMQA 3VXSE 4AYFA 3D4YA 4DP0X 2Y6SC 1KYDA 2WN3A 3D39D 1TJGH 3VXRA 3QNYA 3EH5B 2G5BA 3RY6A 2E27L 2R4RH 2XN2A 2YAMA 2J6EH 1I75A 1FL3A 3B3IB 5LCVH 1BVLA 1ZOXA 3EJTA 5DQDL 3V0VA 1ZKAA 2PP8A 5HHME 2ICCA 4XO5A 3UP6A 3L5WA 2E4TA 2VLRA 2UYLB 3GXPA 4FF9A 4LT7A 4S2SA 3LHPL 4HG4K 1LK3L 3REVA 1CL7L 3UC0L 3BQUA 1MPAH 3OF6D 2CKBB 3CZSA 4G80A 1F41A 3H9SB 1NANH 3MRFB 1SGKA 5TDNB 4XB3A 3HPJB 4B9KC 2H6OA 2EIZA 1PKQE 1E28B 1MF2H 2ZKWA 3HE7A 5BO1H 3MREA 1OT4A 1D6VL 2YAFA 4L4JA 3HR6A 1JHKH 2EYRA 6CGTA 3WS6C 4YK4C 1OO2A 4YUEH 5JHLH 4MJIB 5ACMA 3HE6A 4NQVA 1FC1A 1YEEH 2JE8A 1ADQH 4QRRD 1NAMB 2IWKA 1NL0L 4RQQA 2DS4A 2PPCA 1BPLB 1FNSH 4OCXL 3KPMB 4ETQB 1CYGA 2JJSC 3KWUA 4LLMA 5JW5B 5TDPA 4RMQA 4LLWA 1AR1D 5INDB 2FWSA 5BQ7A 5MEQA 4K7PX 4EAEA 4MJ4A 4HP5A 5JDSB 3T0EE 1DSFL 1GVIA 1GRWA 1TQBB 1N7ML 4WW2B 5E1HB 4OBSA 5L2KA 1NAKL 3SYCA 1E9OB 1BYOA 1DQVA 3LD8B 2R9HC 2X4PB 3VWJC 4QRSB 4Z7NE 4YGAB 1FVEA 3O6FD 1FZMB 1OAZL 2AAAA 1U8IB 3KVDD 5E51A 1IX2A 3EJPA 2GIMA 4TL4A 4O2CB 5TFSL 1RUPL 2B2XH 4U6VH 1EHKB 1E4KC 2VABA 1MZYA 1ICTA 2W80C 4KUCF 1IZKA 4S0HA 3AB0B 1SOKA 4J3OG 5F6HI 4DEPB 3EH4B 3BEWA 1I1FA 4AT6B 2HJFB 5AW9B 3DX1A 5DJ6A 4G8IA 5I9QB 3NAAL 1FZJB 5DZOA 2DQJH 4JHAH 3D7PA 5AW0B 4PUBH 7FABH 2B20A 2VZ3A 3W5NA 4OJAA 1MCLA 2V2TB 3BPNB 4KX9A 4JR9H 3I9IA 3A67L 3FUNA 3VB9A 2FWOA 1QR1A 1A9EA 4R26H 1J8RA 5F7AA 5FO8A 2WANA 1K5NA 3APDA 3DVFA 2QGDA 3QDMB 1T5XA 3KLQA 3VMNA 1JDCA 4F37F 3QZLA 4M93C 2XTJE 4Z3EA 2ROYA 1T22B 3EBHA 1E4XI 1YC8A 5KUMA 1JYXA 2W0LA 2Q7YB 4A7VA 3H55A 2CPCA 2ZUVA 2ZAHA 4NHCL 1HINH 3JBG7 1WZ1H 2JMRA 3MJ9A 1N0XL 3LKRA 3GMPA 2BVUA 3B1UA 4MNQA 4R7LA 4UV4H 5D93B 1P7QB 4UDUB 1PY4A 1K9TA 1I8LA 2AFNA 3QRGL 3D85B 2E7LC 2IWFA 4KKRA 2WXNA 1U8NA 3GB7A 3NOIA 3OMZA 3T0EC 3BX7C 4X6FB 5F1KC 1GGYA 4NKOB 1MAJA 4UBDC 4ZPTB 5ILTH 2V4LA 1XO8A 3BUYB 1DVSA 5I75C 3MHZA 3PNWB 5F7NC 4AKQA 5EUKA 3QEQE 1OHZA 4E41B 1WTLA 3UTSA 2AQ2A 2BK8A 3CNKA 2DL2A 4TTDC 5C8JA 1J05A 4HUCA 2BRRH 4R4NC 1IC7H 3F7VA 1X5HA 4M5YL 5IBUG 1YPZB 3GHBH 4PMEA 2F5BH 1A3QA 3FDWA 3LZOA 3IU3A 3EBIA 5FO7B 5EA0L 2XKUA 5KZCD 2ADIA 1Q9LA 5F1NA 4TLKA 5IG7B 2FSEB 3SPGA 4A39A 3HBZA 3BWAA 4TSCH 4N22A 4PIBA 5T1LD 3FRPB 4H7VA 4KO5A 1X9QA 1W8OA 3ISYA 3TVMD 43C9A 4Y1AD 1IKFL 1CFVL 1A0QL 3ARGB 3DPBB 3ZDYF 4IK6A 5DD1H 4XMPL 3HBQA 1K8IB 3DUSA 5DQJB 2PR4H 1DQTA 1KXQA 2BP0B 3LOWA 4QT5A 3ETSA 3MBXL 5IJBC 1KXVA 1ZJAA 3KCWA 3II2A 1XF5A 4JRYD 1OSYA 4M7KH 3NACH 3DHPA 1GJIA 3QS3A 3C2AH 4WRLA 3QCUL 4BFGA 4AGPA 3V6OA 1FDLH 4ETYA 2GUOB 4HPHA 2XA8L 3E7JA 4OFIA 3US9A 4AK2A 2VDKL 5D5MB 1BX2B 2ATKB 4OGQC 5E6SB 3T2LA 4DPBX 4PJEF 2NY6B 1KLGA 4N0YH 4Y2OB 3MNZA 3KGTA 3MRGB 3K81A 3HJ0A 1CLOH 1PLAA 2ENJA 3ZKQD 1Q9WA 4NO5B 1NJ9B 4PJFB 3T4AA 1CMOA 5HD8D 1YMHA 3GRBA 5M94B 2MTPA 2OKMA 5J56B 4FNPA 4PN6A 5JZ7D 5D72L 4G83A 5F6IC 4P46C 1A7RL 5JQHC 1A3LL 3LRGA 3MRHB 1BFTA 5DDHB 5KBDA 4BHUI 5AG9A 1NCNA 1EZVX 2A9BA 1VF5C 2GHZA 1H3VA 4JQIH 4X2UA 5DHVB 3DETD 4FTDA 2F8IA 4LZKA 1MJJA 5HGAA 1MVYA 4KI5E 4PR5B 3D06A 2FNWA 3MU3A 2VDQH 2DQTH 4N2IA 2WCSA 1JBJA 4R5TA 3P02A 3OKOB 4ELME 3DX9B 1K2DB 4X9FA 2DL9A 4P5TC 4ZFOA 3NFNB 4HK3J 1PVHA 1FLRL 5IV2B 5J6HB 3ZHFA 3UZEA 4MWFB 1YSOA 3WTXA 2HT3C 3TYGL 4A68A 4Y2DC 3ASWA 1DO5A 1OTUC 2K6ZA 2P42B 3P11H 3QO0B 1BJ1J 5F8QC 4CVZA 5MENE 1ZGLP 1TZHA 1V8HA 2FR4B 2A73A 3I75A 4YE0A 1UM5L 1I7TA 3QC5X 1YNTA 4RNRB 4KNQA 2J21A 4RISH 2PCYA 3P9MA 2Z3FA 1UM6H 5C0GB 5ID0B 2BH0A 3ULVL 3ZRSA 1PZBA 3OHXB 2JQZA 3W81A 1TYJA 1E5YA 3MCLL 1J9RA 4MJ5B 3SCMC 3NA9H 3F00A 3QNZA 3DX7A 1JTOA 1RZQA 2JKXA 2IPUG 5JQ6H 4QAMB 5KVFL 4PBDA 1UJTA 5CZVH 1HH9B 4G7YL 4K71B 1W9XA 4W9DC 3C6LC 4KI1A 3D08A 1WRFA 2A74C 1CPUA 1UT2A 4U1SB 3UGXA 2I7OA 1EGJH 5FW7A 1BZ9A 2VERA 2CGRL 1WFTA 5C08A 1ZLDA 2FQDA 3AS1A 1BQ5A 1C1EL 3QUML 3UTPE 4HG4J 1BM7A 3MRJB 3G5XB 2BCMA 4H44C 1RPUA 1M1XB 3CQFA 4IRSB 5FYLH 2NY3B 4FOMA 1DE4B 3CFEA 2M8XA 3FOMA 1XIWA 2WO2B 4D0DA 5DA4A 1EZUA 5DRZA 3LKOA 3C60C 5DJ2B 3PJSA 4O51B 3SBPA 3O3AA 4NDMB 3OKDB 2X0WA 1BFVH 3ARED 3FSAA 2R0WL 3FT2A 3LZQA 3WS3A 1C5CL 4AYEC 1KB5A 3IKCA 5KW9L 5HGHA 4IRZL 1QSFA 5C0DA 5HYJD 2JB5L 2RQ8A 5J12B 2DLGA 2WZAA 4PWHA 4OZIE 5D7LE 4AM0A 2L7UA 3CHQA 3HW7A 3Q7JA 5DUPL 3ZPDA 4QNPE 4APQC 2G4GA 2JKSA 5GRZA 2LFGA 3QUYC 5GJSH 1B0RA 1PY9A 1JZ6A 3LQMA 1WIUA 2NUPA 1RV6X 3GO1L 5DO2C 4G5ZL 1HHJA 4K3DL 3FXIC 3TTSA 3TCXA 3VRIB 2XN1A 4NENB 4ORZC 4R5XA 4G6FD 5DS8B 5B1JC 4K9EH 4G5AA 2KERA 2AXGA 5JW4N 1N4XH 1KFAL 2F1EA 3N41F 1X5ZA 2A9AA 4X7SH 5BZDB 1WEJL 5DZVA 5A16B 4RWYL 3TJHD 1X6NA 4CAGA 1QPKA 4ZW6A 4M1CC 3WJLC 2NLJB 3ZKMD 3OGOE 4EXKA 3VSQA 4GEIA 4J12A 4GUCA 5TDOA 4QXGH 4ANVA 1AGDB 2JJUA 3C9NB 3CVCA 3VFOA 2LGNA 2XN9D 3KPRA 2VN3A 3P0YL 4H20L 2GTZB 5CO1A 1FNLA 1QAWA 4JHUA 4L4VD 5GSRB 3U7AA 2A9MH 2B0SH 5FGRA 3DUHA 3I02B 1D5RA 4Z7IA 3MPCA 3S34L 2ADGA 1I8KB 4OV5A 3LTVA 4OCSH 1SBBA 5I5RA 3P9LB 3BH9A 5FF6B 2DRUA 5F96L 1PYWA 3BP5B 1BQHG 5AZ2H 1SDDB 1MFNA 4UYPA 4HIXL 1D7FA 4PGDA 5C0JB 5CN3A 3TYFA 4A2MA 1I8AA 2HRLA 5E24E 1CZ8H 3SEPA 5KAQG 2DQGH 5DJ6B 1IE5A 4MNGA 3M88A 3NPSB 2WXMA 4UDTA 3S35H 3MO1A 1P84K 1IAIH 4XPBH 2VUKA 3GJFA 1AR1B 3BVDB 4XRCB 3CIAA 4N6RA 4ZTEA 1XD0A 5FW6A 3T1WA 4I2XB 5F7EH 3QBTB 2B59B 3VA6A 3B9AA 4A2EA 5GRJH 4G42A 2R1WA 4NAMA 4B41A 4V1DB 2OXGA 5ICYA 1S3KL 4N20A 5EIQA 4L4TE 1G7IA 4JEGB 5E8DH 4JY4B 3CLEH 1J18A 4NUJA 3O2WH 2VXTL 4XGZA 1KCSL 5CD5D 2XC8A 2DIBA 2Z93B 4PJGA 3WUWB 4DP2X 3KLHD 4DGVH 1DJHA 1N5YL 1XGTB 3L5XH 1X9UA 4HJUA 4DO4A 2QQKL 1T1WB 4UINH 3D18A 1UJ3B 3O45A 4JPIA 5SX4I 3O3UN 3H6JA 3RIFF 1GW6A 1JWSA 4Y19A 5FV2A 4HALA 3PQYB 1BF2A 3CHPA 5I76A 1E2VA 2PWDA 3S37X 5E2UH 3CMGA 1F86A 1FFOA 4Z5RA 1U58A 4KNTA 4M62L 4R7DA 3WFHB 1IQDB 2A4CA 2X3BA 3V6ZB 3TONA 3X14B 1W0VA 1P4LA 2FGWH 1AQKH 1XCQA 4J4PC 1R17A 2VXVH 1GTNA 4B9ZA 3GSOB 1O9WA 2VN5A 4ODTH 3KPTA 4BQ8A 5CEZL 4P9MH 2FX8L 1A6TA 2F58L 4GRWF 1MJUL 1T21A 1H15B 3DJSA 1LEIA 2BVOA 4L29B 2QEJA 2CSPA 3SBQA 4FHKA 1KEGL 4X4XB 3N85H 4YQXL