2OMWB

Crystal structure of inla s192n y369s/mec1 complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
GPLGSWVIPPISCPENEKGEFPKNLVQIKSNRDKETKVFYSITGQGADKPPVGVFIIERETGWLKVTQPLDREAIAKYILYSHAVSSNGNAVEDPMEIVITVTDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Internalin-A
publication title Extending the host range of Listeria monocytogenes by rational protein design.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Cell invasion/cell adhesion
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2omwB00
4XXWA 1WUZA 4ZT1A 3K5RA 1FF5A 3FF7A 4ZTEA 3UBGA 1NCJA 2WHVA 4ZMOA 3K5SA 4AQ8C 4AK1A 4ZMLA 4ZMZA 4ZMQA 1Q1PA 4AQEA 3K6DA 2A4CA 1NCIA 1ZVNA 4AXWB 4NUPA 3K6IA 3Q2VA 3FF8A 2OMXB 1EDHA 3QRBA 2YQGA 3LNEA 4NQQA 2OMVB 1ZXKA 3LNDA 2WD0A 3Q2WA 4ZMXA 2OMWB 3LNFA 4AQ8A 3K6FA 4APXB 2V37A 3LNHA 4ZMTA 4XXWC 3LNGA 3PPEA 1NCGA 4ZI8A 3Q2NA 2OMYB 3LNIA 4AQAB 1L3WA 5KJ4A 2O72A 1OP4A 3UBHA 2QVIA 2EE0A 5DZVA 2OMTB 2A4EA 4OY9A 4QD2E 1SUHA 4AXWA 4ZMWA 4NUQA 3Q2LA 4ZMNA 4AQEB 2WBXA 2OMUB 2QVFB 2WCPA 5JYLA 5CO1A 1O6SB 4ZMVA 3MVSA 4APXA 2YSTA 5CZRA 1WYJA 4ZMPA 3UBFA 1NCHA 4AQAA 2OMZB 4NUMA 5JYMA 4ZMYA 2X2UA
chains in the Genus database with same CATH superfamily
1BZQK 4ICWA 3I6GB 4WNJA 1QKZH 3RBGA 3NJJA 3SPVB 1WFIA 5T1MB 4G9FA 4XBMA 4OUUA 1G7PB 5CEZL 4FI7A 5HYFA 3B56A 2AEOA 3O6KH 3I6SA 4WEUD 1W8EA 2AZAA 1ZT7B 3ZDWA 2ITEA 3Q6FA 4IRZL 3ROOB 4KZDL 3QVAA 3WY3A 2MOVA 3GDBA 2ZAGA 5JXED 1QHPA 4LLWA 5FM5O 1FL3B 4DPBX 2QHRH 3FONA 3S5ZA 4R7DB 5A2CA 1Q9WA 4M62H 5IW1B 1P7KB 3VXRE 5EBLB 2ITCA 3ZRCC 1FGNL 2ALAA 3QJHB 4K94C 5DC0A 3ARFB 2D7PA 3EJZD 4J3XA 1KEML 3CLFH 2IMNA 1I7RB 4PWJA 2DEYX 1R3IL 4QR7A 5AW8B 3VXUE 1P6WA 3UTZB 3MMEB 3UC0L 4FQ1L 3PG2A 8PAZA 1UURA 2QADB 2VWEE 1AR1C 1AKPA 3H4HA 4JHBA 2BRQA 1TJHL 2P24B 3IGUA 3QISA 4PGEB 4O58L 4APXB 4PG9A 3OKDA 4YFDB 1CFVL 4AC2A 4KZCA 1LTXA 3TA3C 5GS2H 2AV7A 3HUJB 3ZYZA 1B0RA 3QIUC 4N0RA 3UDWA 2X09A 3ZDZF 2XZZA 3IXAB 3C5SB 3QT2A 5E4EB 2JCCE 3B9KC 2W91A 4XNYH 1S7WA 4X2UA 2O1AA 1DVFA 2FYYB 3P30L 4DCQB 3GIZL 4YSOA 5C0ND 4K3EL 2R4RL 2X1XR 4NO3B 1RZGB 3LKSA 2NZ9D 1F45A 5CEXA 1CD1A 2HJKA 3FU0A 4F33A 3EDDA 1FYHB 3VCLB 4RFOL 3C2SA 2DLEA 3O0RH 4PJ8B 1XSKA 2BZDA 5DHYB 3RIFF 4NO0D 3SPGA 4AZ8B 2H47C 4YHYC 3LKRB 3E3QC 3I50L 4MMZB 1PKQA 4YSPA 1CICD 43C9B 2ORBH 5I6NA 2QVFB 4H0LC 3BIBX 5CO1A 4EI5C 4OLZL 1FFOA 4IHBA 4M48L 3ES6B 3BO8B 5DJ6A 5DK3A 2X4NB 1AACA 2EDFA 3E7JA 1NOFA 1V3MA 4MHHG 3FO1B 3HMXL 1BQSA 2GCYA 2H45A 3AB0C 4MJ6B 4LLDB 5CJOH 1HILA 1S6NA 3MLSH 4PRPD 4URTB 4Y4KC 1ZK9A 2IAMB 2Q5BA 1ROWA 3O6LL 2BP0A 4HQQL 2CO6A 5F1OB 5BS0E 3E2HC 5HHME 4M7KH 1ORQA 4UDUA 4UTBH 5DTFB 3S96A 2RB8A 5DFVC 4LSDA 2XWJA 3B3IB 2R0KL 1AG0A 5EFIA 1QBLL 2G2RA 5KANG 1CGSH 2ERJB 2P9RA 3B7YA 2XN9A 4FX5A 3U4BL 2IH8A 2IQAA 1NC2A 4HJ1A 3SB3A 4MXQC 4UV7L 2NCEA 5LGHL 3H42L 3RY6A 4PJ7F 1IGCL 3BGFB 3ZQXA 2G5BA 1J8RA 3P3RA 4UAHA 5EZLB 3FU7A 2WM0A 5HVHB 3NQIA 5FXCH 3OKLB 5AKTA 2E9GA 4AQZA 5LXGL 4P2QD 3KD4A 4JS7A 3FQUA 4LDLB 4JFDD 3WIAA 4M1GH 1RIVL 1XH2A 1ECYA 3GHBL 1J10A 1U3HB 2WSKA 5GGSY 5GIRB 4GS7C 3RKDC 3FL7A 3Q2WA 2XV3A 2OX5A 2Z8SA 4Y4HB 4NJ9H 3BX7C 2H6PB 1M6OB 5LCVH 1AXSA 5B1KA 3VFNA 3DIDA 4KK6C 1VSCA 2BNRD 4UB0L 2WANA 4M5ZL 1OSPH 1TYEB 3ZVVA 3DVGA 5AB9A 2FLRT 1V3LA 1BEYH 1HESA 3DX8B 2GSGB 1XO8A 2GJZB 2ADIB 2HRPH 3CHRA 3L1EA 2X4TB 5LGKA 5DVMA 1KB5H 1KEGH 4KOBA 1BWWA 5BZWB 3GLDA 4F8LA 3K2IA 5AYQA 3PJSB 4F2FA 4HDIB 3CHXA 1S9YA 3OAUH 4ZX6A 4HJEA 3VFPB 3IN0A 3SDCA 3VWJD 5CJ5A 3GSXA 4MBOA 4JN2B 4M62L 4L23A 5DJDA 1X4ZA 2Q86A 4I18A 1RJYB 4LLQA 4O2EB 2NW3B 4IBUA 4ZUVB 2ZUQB 4Q6IA 1NCCH 3PL6C 1A65A 3PWPA 4ONGH 4X6CE 5IR1B 5TK4A 4M6NH 1MFDH 4BIKA 2APFA 1MH5B 5T3ZH 3EJSA 4Q0XH 1WA0X 1U58B 4ABWA 1RZPA 2MOQA 2JIXB 2UWEA 1IGJA 4YUEL 2WINB 2FJUB 2DM4A 4PWFA 1UWXK 1ZVSB 1BBJB 2P26A 2NUPA 4PD4K 3GD1C 1IQWH 4N8CH 4JQVA 1JNNH 1XTLA 1EXUB 3AADB 4UI2A 4GQQA 1J1OH 4E9TA 4HSAC 1MCKA 1YN7A 1T5WA 4GXUN 2YUVA 3MV9A 5CLXA 3MACH 3P4OA 2V17H 3NZ8B 1Y1UA 2BCKB 2SODB 4DP4X 1OF2A 1XR9B 4K55A 2WNXA 4XNYL 3ULVE 1RLBA 3S2CA 2HN7A 3OHMB 4WHYG 5KS9B 5A43C 3F7KA 4DESA 4WFGE 1KJ2A 1EVUA 1VACB 3ZHNA 1I4FB 1AGFB 3M1BA 4OCSH 5DHMC 1YEFH 2YA0A 1TVDA 5D4IA 3APFA 4YSAA 2O26U 2APSA 2Z0UA 2I9LB 3EYQC 2JE8A 4HIQA 3V0HA 1AGDB 2AABH 3SDXA 5JQ6H 5E4IA 2J43A 2BP5M 2IWGA 2HT3D 4FNRA 3RUGB 1E5YA 1JXGA 2Y0SA 3ERXA 1WE5A 4OQTH 4I0PC 3PP3K 4OGAD 5L8LB 3A47A 4YSQA 5CLYA 4R96B 5HYSG 4GKOA 1TQVA 3EFOA 3FBKA 1X4YA 3P2TA 3S5LG 1X9LA 1AXTH 1K2DA 4PS7A 4WSJA 4PHZA 2XWBA 1MCSA 5DHDA 3SJVE 5D70H 5FHBH 4TNWK 3T0EE 1F00I 3O2VH 1E0OB 1DJZA 3ZBMA 4J3WA 3WKMH 5FGCB 1U92B 2J5WA 2E7LC 4AVJA 1IC1A 1U8LA 3U7AA 5DRXA 3JV6B 3NIFE 5JQHC 2WWKO 4HIEA 3UBXG 1FIEA 4WJ5A 2BSRB 2DH2A 4UTBL 4C56A 3STLA 1IU1A 4XVSL 3IF1A 3M46A 2BZCA 3ZR6A 3M17A 5JXEC 3L17A 5ECJE 4E41D 2WMPA 2ZNXA 5JZ7D 1CGSL 4O9HH 3T1FB 5GS1B 3KM2A 4NKMA 4A04A 2ZG1A 3LKNA 5AG9A 3CH8A 2XETA 4JQXA 5F7FA 3ZQ9A 1MPAL 2Q10A 4V33A 2ZOOA 3RWDB 3L2MA 3EJZC 2C5DC 4XNXH 4JM2D 3FU6A 2HA1A 4HX1B 3HC0B 4RWYH 5TH2B 2H2PD 4HOMA 2BHUA 3TX4A 5SX4H 5I82A 5G55A 1OM3H 1KIUB 5EZJB 1MLCA 1UWGH 3MNWA 5C09D 2DYPA 5DVOA 1IEAA 1KTJA 3L3GA 1YNKH 2BFVH 4XB7A 3SQBB 2EE9A 3KPMB 4W9JC 4OZFH 5DVKA 3MRBA 4GRMB 3ZSSA 4OUUB 4NNXA 4H2AA 1BVZA 1ICTA 2EICA 3GXFA 3QEQE 5AKSA 1MNNA 4OCXH 5TDOB 3PY9A 4NJ9L 4CGUB 5CZVH 5E9AA 5LCVL 4UMSA 1Z32X 4N2BA 4K4KA 3HCVA 4KI5F 4FXKC 5IBUB 4FNLH 3LIUA 3F05A 5FV1L 3UPRA 1RIUL 2BP8B 4QHMA 3KWVA 1P7BA 3CHSA 1BEYL 5G4OA 5ADPH 4U1JB 1OAUH 2D3LA 2HRPL 3BAJA 4WKZA 3GSUB 1KB5L 1KEGL 3DO7A 1W0VA 3K4DA 3OR6A 3L7FB 4YSDA 4FG2A 1PLBA 2GI7A 1CICC 1QSVA 3OAUL 4KQ3L 3VXRD 1DEDA 4U6XB 3NJGA 2YAEA 1LK3H 4HS8H 2ICEB 4NKIL 3RWFA 1OOWA 4MJIB 4PG9B 1TMQA 1TVHB 1JZDC 1CE6B 2N7BA 3UZVA 1INEH 1N9PA 1HXMA 2I07A 5CSZA 4JZNA 1R5WB 2GUYA 3HI6H 4WU5A 3W9DB 4X0KB 4TM9A 2ETWA 5KSVB 3AREA 4ONGL 4QNPE 1R3KA 4LOVA 4M6NL 1MFDL 3ALXA 5T3ZL 4Q0XL 5ENWB 4G1EB 5DD0L 1FPTH 1FE8H 2CLRA 3T3PB 3NVQA 5AENA 2Y7LA 3EGXA 4IOFC 4N2HA 5SX5K 1XF4B 2AI0H 2Z65C 4L3FA 5L8KB 4PMEA 2OYMA 1IQWL 4N8CL 4LZKA 1JNNL 1LO5A 1YHPA 4UYPA 5D7LB 1CD1B 1KF9B 1BIIB 1J1OL 4MWFA 4ZNEA 5D2LF 1QR4A 1JD7A 4WO4A 2XXMB 1WAAF 2V17L 1RZIA 2J2ZB 1M7IA 2JWYA 2XI9A 5I1LA 4NERA 1YCSA 3A5VA 4U1SA 3P77A 4Q97A 3HMWL 1PIFA 3IS1X 3M45A 3PWJA 4NQDE 5FOBB 2Z91B 5J9PA 3OZ9L 2ZKHH 3ASWA 3QO1A 3QG6A 4GJTB 2HPOA 4LAJH 3LPPA 4OCSL 4QHUB 2YSSA 1YEFL 3CUPB 5AOKA 5J89A 1FCGA 2OYKA 2IDTA 3LZNA 4P2AA 4XX1G 3RVVD 1MWAB 3LQMA 5J7CC 4PRIA 2AABL 4RZCA 4MA7H 4WZ9A 4YBQC 5C0JA 5JQ6L 1IE5A 1JHKH 5ETUA 5IFJA 5I18H 2R27A 2WCPA 3HG1D 1T89A 4TSCL 1G7IA 3ECQA 2ZYSA 3QXDB 1DEEB 3AS3A 1DLHB 1X6LA 3LXAA 4OQTL 3DO4A 3G5ZA 1KCBA 4OSUH 3M1OA 3VXSA 3HG4A 2MTAA 1HWWA 5FC9A 2WQRA 5F7NC 1AXTL 5BW7C 2WYHA 1WFJA 4JQIA 5DJAA 4QT5A 2COQA 1QTYT 5D70L 1IM3D 4GBXD 4PJ9D 3O2VL 4OAWB 5BS0D 5HHMD 3QSKB 3WKML 3IFOA 4QRRB 1E43A 1FNSH 3BH9A 4FHJA 1OP9A 2C7UB 1HHJB 4JJOA 4S1DC 4PBVC 2Q8AH 3EFFB 2P8MB 4PLKD 4Y2LA 1UB5B 3JTSB 3HC4H 5DQDH 4RZKA 4OLEA 5CMAA 2UZPA 3ABGA 2X2YA 4KV5E 3AXIA 4LAQH 4ADJA 1G43A 4O9HL 4NRYB 3TCXA 3V0FA 2VM9A 4NO2B 5BZXA 3CSTA 3SDDD 1G9NH 4JFYB 3SKUD 5JDSB 3QAQA 4FJYA 3P73A 2LHAA 1JNHA 4OF0A 1CFTA 1MVUB 1U93B 2P7TA 3WJMA 4XNXL 2HKHL 2QMKA 3IDUA 3VFSA 2JJVA 1XD0A 4B6ZA 1X7QB 1U8KA 4RVBA 4RWYL 4HD5A 4E68A 4NC1E 2MKLC 2AXGA 4RETB 4JO8A 4Y19D 5GRUL 4KNUA 1OM3L 3T6VA 3JWOC 4NLHA 1UWGL 3QIWD 1QBBA 4Y7OC 2GI0A 4XC3H 2Z4TA 2BFVL 4S0HA 2WKOF 1XGPA 3G08B 1H15A 5J11C 4I48B 4YO0A 1TEFA 1A3RL 3HNTH 1GZPA 3F85A 3QORC 4JE0A 1XGQA 5E08L 1M1SA 3W9EA 3BN3B 3MREA 4G7VH 4OCXL 1EWHA 5F7AA 3PAUA 3CFIC 4N2LA 1KGUA 3PHOA 5CZVL 3HNSH 3K0YA 4F24A 1WS7A 4EEEA 4IBLT 1AAJA 2P80D 3FYEB 3SGDH 4DH2A 4YDLB 5LO7A 4MLSA 4WFED 5T8IA 1S7RA 3EJCA 2BXZA 4C4UA 2UZIH 4NP9A 2L3BA 1E3FA 5D2NA 1OE3A 1TTFA 4BZ1H 1OAUL 3LZPA 5AW1B 4NQED 3B9EA 1OQOA 3O9WB 4W1TA 3FAXA 3KPRB 2HT3C 3RB7A 1ED3A 5E6UB 3KH3A 4YSRA 2FX8H 4PAZA 4KXDA 4QHKJ 4HMEA 4NQTA 4DEWA 2VLKA 3GEWB 4OGAC 4OIBA 1VADA 3BP7A 2IANA 1ETJA 1LK3L 3K4AA 3QIBB 4HS8L 1EAPB 3W37A 1AKJB 1JGIA 4X7TB 1M57B 4Q56A 5JHMA 1NIAA 3GUFA 4HISA 1ETB1 1DO5A 1B9ZA 1YN7B 2VDNH 5ECGA 5EOTB 1RHFA 5LBSA 1INEL 4GW1B 4W9GC 1EJ6A 1NAKH 3HI6L 3UP1A 1C16A 4ZFOL 5IMLB 3E6FB 1ZA3A 4MGXA 3RU8H 1A0QH 1AGEB 3T8XA 1TZHA 1BBDH 3HE7B 3G5XA 3STBA 1FPTL 2DI8A 5AL0A 1FE8L 5DLML 5FUOH 2NUTA 3UTTE 1KJ2B 1Y18A 3I75A 4WFHE 5EBGA 5LAXB 1JV2A 1UD4A 2AI0L 3EJYC 5BRZA 3I74A 1JPGA 1S7SA 2EJ1A 5J13B 1P69B 4WI5A 5T1DH 4FXGB 3C5XA 2UWEF 3L2NA 1AOZA 4EUPA 3L4VA 2VLJE 3D18A 2AJUL 3QUKB 3ULVD 4CC4A 4JY6A 4PJCF 3WTUA 1DBJH 2VQ4A 5IF0B 4WFGD 4Q89A 1WO2A 2J6EA 5C0CE 1HOCB 5AVQB 5I1EH 1E2ZA 3IJYA 1MELA 2PP8A 1RUPH 3WE6A 3BKMH 4FQJH 2ZKHL 3ZYJA 1M53A 1QWUA 2E9IA 2YPKA 3F8UB 3OJMB 3SZKC 3VXMA 2KKQA 3KWUA 3QRGL 3TURA 1SHWA 2O30A 2OJEB 5C08A 2GJPA 3MA7A 1WZKA 2H0FA 5F70A 3L3OC 3ZKMC 1AS8A 4X8JB 1L7IH 3IBEA 2WZPA 1AI1H 3BIKA 4IKNA 4DF9A 5IMKB 5MEPA 4MA7L 4BWUA 4Z7WE 5D1ZA 3ZYOA 1JHKL 4NN7C 5I18L 3TO4B 1JWUA 4HIEB 4K94H 4DPAX 3O3BA 2ZPKH 4K2UL 3WY1A 5C3TA 2MPVA 1HCYA 2VDOB 4MD0B 1ONQA 2QPSA 3SJVD 1XX9C 1S5HA 3OWRA 1I1YA 3T0ED 1T4WA 2ROYA 4J5VA 1GY2A 1O9WA 2WMPB 2YQBA 3MRNB 3ZE0F 1MI5B 3FBQA 3UAFA 3HFMH 5EUOF 3EJJX 4XVJH 4KWUA 2G0LA 4GAAA 1R5IA 4JHWH 1CDJA 3C09B 2BDNH 4IU2A 5B21A 3U82B 5FECA 5I8KH 5MENB 2CKNA 3HW7A 3AS2A 4L0ZA 2GBTA 5E94A 1E8YA 1FNSL 4QPEA 3T0XA 2EYSB 3QYNA 5IT2H 1EZSA 5DO2C 4IRJD 4LLYA 2Q8AL 4N2FA 1P6FA 3HC4L 4LCWE 3HBZA 3PQYE 5DQDL 1IKOP 1SDDA 1FZMB 4NPJA 3BZ5A 5D7EA 3ZUCA 3ARYA 4LAQL 1G6RH 2IALB 4LPTA 2V7HB 4DKTA 3DRQA 4FQXB 1JYWA 1ERNA 2UY7B 1G9NL 3KCPA 2VR3A 2UZXA 1O75A 4J3SA 1CDGA 3UIYA 5F97E 3UO8B 1ZJBA 4CKVX 2VWEC 4EN3A 3L81A 3AG4B 1HINH 3VI3F 4PJXB 3EFDH 4AKOA 1MCIA 4LLMB 3DPDA 2CE6A 2K9FB 4QKTA 3Q1SH 3T71A 1BMWA 4XC3L 1UD8A 4Z78B 1K3IA 3B5TA 5CN2A 4ZX4A 5ID1B 3QEQD 3POCA 5K9KB 3S3PA 1GKEA 1FCCA 4AV4A 1W6WA 1BQHB 5IEKA 1T20A 3HNTL 3IJSB 2CGYA 1XCXA 5MEQA 1BVKA 3MJ9A 2IH1A 4G7VL 1C7TA 3V4PA 4D0DB 2FTAA 2VAAA 1TLKA 1E4XH 4Y4FA 1VESA 3GSNH 3ZKND 3HNSL 3EXJA 2QPUA 3B6SA 1GZQB 2PN5A 3QO0A 1KZQA 2O6PA 2ZJSH 5HTSA 2GFBA 3TBCA 1A47A 4FCAA 4Z18A 2GUOB 2UZIL 1W9XA 2I07B 4IBYA 4UZSA 5CSZB 1A4KA 1KCUH 3D0VB 2KDYA 4BZ1L 4Z0BH 1RSFA 3AREB 2WC7A 5F0MB 3VFVB 1E3ZA 1V5JA 5CGYC 2FBJH 2J12B 3CLWA 1ANUA 1T22B 4Q7DA 3T4YA 4F8OA 3ARDD 4X4MA 3NJMA 1AIFB 3IKCB 3PP3H 2F8XC 2FX8L 1P5UB 1YYLL 2A3TA 4XVOA 2C3WA 5E7FA 3HI1A 2G0KA 4U6VH 1FN4A 5FDWA 1DE4B 1XGYH 2NTFB 4ODXA 2QKIC 5FO9A 4PSPA 1YSOA 1YPZB 5E5LA 1WEJH 2PPCA 1NAKL 1A6AB 4PJ9C 2V2WA 2YLHA 3L9RA 5D5ME 2YMXH 3KYOA 5IOPA 3LS5H 4DO6A 2ZUSA 3RU8L 1A0QL 4AYFB 2PO6C 1J11A 1BBDL 2Y06H 3QZWG 4UILL 4PLJD 3T2NH 2XWTB 2PPFA 3AW5A 1W0WA 4ESKA 5LLIC 2BRRH 1MIEH 2R69H 4I2XB 4CU6A 3T09A 3HE6B 2VZ3A 3QULB 2FWOA 4X42A 1YN6B 1CF8H 1CF1A 3LPGA 5FLUA 1QPPA 5T1DL 2X0WA 3FT4A 2FNWA 2APTA 4LSVH 3OXSB 1BZDA 4PRIB 5F7WC 4YHYB 4NQDD 3SDDC 4P2OC 2VN6A 5IFJB 1DBJL 3MROA 4Y8AA 1F11A 1U8JB 3WTVA 5C6TH 3DX7B 1MJJB 1V05A 1G7MB 2YFOA 4NSKB 4AZUA 4YLCA 1RUPL 4HK3J 5EG6C 3BKML 4FQJL 5IWLA 1O7SA 3UCRA 3GJFK 5AZUA 2GK2A 4B60A 1UZ8A 2FSDA 1WC7B 2QL1A 4FL4B 1GTFA 2VC2B 4OCYH 3CAFA 3QIWC 4P5KA 3EO1A 2VUYA 3DMMD 2H0JA 2P5WB 2WBXA 2VXQA 4J7RA 4NI6A 1L7IL 3GMPA 3QUZD 1AI1L 3GSNB 1KBWA 3GSRB 2BSSB 5TDPA 1UA7A 1S7QA 3W11C 4V1DA 3O2DH 1Y7VA 4UM8A 2D9CA 1MW2A 3BH9B 3CVIH 4YGVB 4K94L 4HKZA 2N01B 5KUMA 4QRUB 4EQ3A 4PIRF 1PNCA 2Q1EA 4UT6A 5KN5A 1CZ8L 2FIKB 2X70A 4JANA 4P8QA 2J88L 2FHFA 4S2SA 1I9JL 2M2DA 1JDCA 3D50A 4DUWA 3SDAC 3HFML 4J3UA 3OHXC 4XVJL 1O9ZA 3QUXC 2BINA 1PDKA 2B77A 2BDNL 5I8KL 4JRXE 1MCPH 5BQDA 4WI4A 4RGNB 1WCBA 3F6IA 4A7GA 2YIHA 4P5TA 3B9AA 1ZLDA 3VGDA 2HSIA 4WUUB 5IT2L 4L9LC 4K8RD 4XO4A 1KPVA 3V7MA 3TU6A 2FL5A 3DVFA 1JPST 3KR3L 4GMTH 5EDSA 2UY6B 2W38A 1A2YB 1WRFA 3TYFA 2HVBA 4HG4K 1IFGA 1NIDA 1H15B 2R15A 1QSEE 1O6SA 4XBGA 4YO0B 4G83A 3G04B 2F15A 3M1CA 5CD3B 2B20A 3OQRA 3QXTA 5CJBA 2C8NA 1L9QA 5ANMA 5MERB 2O6FA 4P59H 5DLLA 1LQSR 4QLWA 4IBQA 2KLTA 4DERA 3G6JA 4RGMB 3D25A 4GT0A 1F2XK 1HINL 1T83C 2W80C 5F9OH 5SX5H 1UOWA 3IFLH 2B4CC 3UX9B 3UAJD 5KBMA 3L3HA 2FJGB 4XE5B 3Q1SL 3JTTB 2N1TE 1P4LA 1GPOH 3A6CL 4UM9A 4BJLA 4MNQE 5H2BB 1UH3A 4ORGB 3ARUA 2OSWA 5FW8A 3ULVC 4JHUA 5EH1A 1FGVH 3IGLA 3OGCA 3DBXA 3O41A 3U36A 1B2WH 1I85C 4AL8L 1E4XL 1HHGB 1CE1H 1TENA 3B2VH 4JUSA 3GSNL 2VW6A 3BSZL 4ZUUB 3OKMB 4UIMA 4KI5E 4B53A 2FR4A 2ZJSL 5F72S 3V9EA 5D7KE 1I7UA 2Y69B 3EDKA 2AEIT 3IDNB 3KAAA 5KYYA 1LP9B 4XMLH 1KCUL 1IT9H 1C16B 5ICXA 5IKCB 4JRYB 2OKMA 4UF7C 2H8PB 1XXFC 2UX7A 5E51A 3QNYB 4GQZA 1J12A 4J6RH 3T8XB 2FBJL 3RTLA 1XIWA 4X4YB 3F62A 3WG7B 5F1IB 1AS6A 2ZOTA 1AZZC 2SEBA 4L29B 5HSFA 1R6VA 3GMLA 1ZRUA 1B6UA 1J8HA 4HV8A 3TBSB 1YLBB 2PTTB 2EUVA 3RAJL 3ARGB 4U6VL 1CL7H 1FP5A 4DSYA 1QSFE 3T0EC 5IW6B 2PXYB 3Q44A 1XGYL 3QXVA 1EEZA 4HBCL 4EUPB 1H3UA 3JXAA 1WEJL 4FLOA 2FJHA 2YMXL 1DZ0A 2DQCH 4HOXA 4P4RB 1OALA 4YVNA 3GXNA 4ODBD 1DVUA 4M3HA 1DQJA 2Y06L 3A4DA 2VL5B 3L3KA 1J9RA 3CZNA 3FQYA 2WXLA 3QZLA 3T2NL 3PCYA 2W94A 2OTWA 4IRJC 4OCWH 2R69L 1MIEL 4JDVB 2J8UB 3KHOA 4PM1A 3C60A 2YD0A 2K7PA 1CF8L 2Q76A 4LSVL 1U9KA 5C0CD 3MCKA 1OTUD 2E8YA 2M83A 3FOMA 4TLTA 4L05A 4M7ZB 4E9XA 1OCOB 5EU7E 4FNQA 3TV3H 4DEUA 1SYVA 5C6TL 5E4AA 1CVRA 1KLFB 2Y5EA 1A14H 2JI1A 2W07A 1NFDF 1S78D 4IKJA 5IFAL 1MCHA 3UTQB 2AXJA 3RWIA 4ZFFB 4B0MB 3CFDB 4PH8A 2LLGA 3B9VA 1MG2C 4MA3A 4OCYL 3D3VA 4OZHE 1Z3GH 1HEZB 4A37A 1XQ4A 3DX6B 3TCLA 3CZFB 2YGPA 4QTHB 2N4IA 5IJKC 3O2DL 4QGYA 4OZGB 1YECH 1FZKB 3CVIL 2ADGB 2AVFA 4K3HA 5HVFB 2VDQB 4QRQB 5CUSL 1E9PB 4NNYB 3ZHDA 1RFDH 1OP5K 1A64A 1XCQA 3ZKNC 4ORZC 2L7QA 1D9KA 4F5CA 2WCSA 1JOIA 2OMYB 4JDEB 1RJLA 4RAHA 3DRQB 5E6RB 1DQLH 5JHDE 5H37G 3SYAA 1IQDA 1ACXA 1F8TH 1II4E 4KK5D 4X7EC 1LGVA 2YFNA 5B8CC 1MCPL 1N5AB 5CJXC 2VMJA 4BXVA 3EOTH 4PLNC 4LCWD 3PQYD 3T6WA 4PPTA 5CHNA 3T65B 3L8QA 1ZT1B 3BWAA 2EIZA 3ARDC 3VRLF 5BJTB 1MAMH 2L7EA 1KXVC 2PUQT 3HHRB 4FQHB 1NICA 3DHJA 2OCFD 4XH2A 4MRCA 4MD4B 3B7SA 5ICUA 3Q5TA 3RGVB 1H0DA 3IB4A 1NJ9B 1H8SA 2NR6D 3QJOA 1X5MA 4OKVA 5DYOA 1T1YA 3ZW3A 1UACH 1Z5HA 4FA8A 1XCTA 1SZNA 3CVCA 1GY1A 4OM1H 5I8CB 4P59L 5GXBB 1TFPA 3AAZB 1NC4A 2Z92A 3LH2L 5F9OL 1HL9A 2ATPB 4MXVF 1JHLH 3IFLL 4QO1B 5KVEH 4P46B 2LLNA 1N59B 3ZZLA 5AB2A 1R1CA 3DTDA 3VFMB 4KK8D 4J3TA 4KRNA 4ENED 1D5MA 2F9BT 1XF2B 4Q4EA 4AT6B 4PY8J 1FGVL 4I89A 4JREC 5LHDA 2VE6A 3C6LD 4LEOB 3HZKA 3B2VL 4IBVA 1YUHA 4G6KH 1R4XA 4GPVA 3GRWL 4HOWA 5A6LA 3RZCD 4EZMA 3WNLA 2V2XA 1G94A 3MRQA 4QRPB 3AZUA 3SE6A 1P84K 4JO1H 5KVGE 4LEXL 3I85A 3O4LE 4B50A 1JMZA 1HWHB 4PRPB 3DMMC 4XMLL 1FFPB 1IT9L 3OX8B 1DQQA 5IG7B 3KPTA 2ZF9A 3CVHB 5HHPA 1N2RB 4JGJA 1ROCA 4PTUB 4RMQA 2CO3A 4J6RL 2H3NB 5IB4B 4CAGA 3A0OA 1FSKC 3CFBB 4HD9A 3ZKSD 3LB6D 3V8OA 4BQCA 1RP9A 3I9GL 4P2RD 2P47B 3HFFA 1EHXA 1YEIH 4FKEA 3BPOB 3NH7H 4KTYA 5FW7A 3VFWB 1CL7L 2P5ED 4JAMA 4M8UA 2KZKA 2HB0A 3II1A 4NQSB 5SWSE 3KPSA 3LNFA 3IXTA 1T0NA 1NGXB 1XF3A 2OR7A 3EZ8A 3JWOH 4CVXA 1UKSA 4FF9A 3MGTA 4EZKA 4BFRA 4UTBA 2DQCL 5IHUH 3BPNC 4DGUA 2DWTA 2EEXA 3S8FB 3OJVC 1A1NB 3LRHA 4NLAA 3HS0C 4DN3H 5I17B 4P2QB 4PJEB 2CCLA 3BT2H 4K8RC 3RNQB 1CDUA 5D8JL 3DOSA 2GJ6E 4XXCA 3ZZQA 1KYUA 4P5KB 2P28B 2UVFA 1PLGH 3VH8A 4F3FA 4X4XA 4Z7IA 4PJCE 3RPIA 2E56A 4FTVE 4UM8B 1A4AA 3TV3L 4NC1C 4KJPD 1FYTA 1N6UA 4X9GA 5FM8A 5B38B 2FX7L 1FVDA 2IPUK 4XZUA 5J3HC 4BGLA 2BNRB 4LKXB 5JA8B 1P9MC 2IBBA 1J5IA 3P3SA 4PJBB 4S2SB 1S7TA 1ZOXA 2AJYH 4H8WC 3VMNA 1TJGH 2OMWA 5T1JA 2FCBA 4JO5A 4KXZI 1KLGB 4S0TD 2XTLA 2AEWA 3E38A 4OJDH 4CDGC 2QT6A 1HH9A 4HH9A 2QLVB 4A2MA 4HZ1A 3HHSA 1JWSA 1QFWI 4TUOB 4MQTB 1E6JH 2PWHA 1RFDL 2YD2A 5EDXA 4ZS7H 2Q6WB 3VWJB 4EI6A 1IKNC 3CVHL 1TEYA 1OK0A 3J2PA 3DXAE 4YC2C 5KVMC 5IIEA 4JRXD 3RTQD 2R2EA 1A4JB 1KBKA 4ONFL 3TP4A 1KB5A 4WV1C 1IVTA 1F8TL 2CGRH 2DQEH 4XBGB 4F1ZA 3WS3B 2R9HC 4I9WE 2P5PA 5AAWA 3EOTL 5I76B 1IBDA 2H6OA 1NWPA 3R06A 3SYOA 4AITA 4CMHC 2J72A 4X6DF 2L0DA 5C0AE 1MAML 2J4WH 3MYZA 1RVFL 2VDMB 4A7GF 4EVNB 4GKNB 4PV8B 4A7VA 1SMDA 3INUL 1P4LB 1HEHC 4N8UA 1UH4A 1GOFA 1HNYA 2ZX5A 4WW1B 1N4XL 4JG1L 3QXAA 3SO3B 2XC8A 3TBWA 1QO3A 5EPMB 3KH4A 2OLDA 4ETQA 2IDSA 2CJSA 4IMLB 1P5VB 1SXSA 3DBXB 3DSFL 4YDNA 1P4BH 3KGSA 3IMUA 4J39A 4OD2A 5B1BB 4OM1L 4YHLH 4XPGH 1NIEA 3QRFM 3ILQD 5DC2A 3GQFA 3VI3E 2XG4B 1JHLL 1FFTB 3QDGA 4MNQD 1OPOA 2JJSA 4L4TE 3MRKA 3MRHB 4GFXA 5D7IB 4QIRA 3D2UB 4HIJB 4NHCL 4XTRC 4ZSOB 3VYNA 4BH7A 3H85A 5TE6H 2HTKC 3QUYD 2OMVA 3C5JA 3KNBA 1TTBA 2KPWA 4WJKB 5KSAD 1YMME 3VX1A 3RHWF 4AV5A 2ICES 4EKXA 4ELME 5D7KD 4OGQC 4RRPA 3EGSA 3QEHA 3V5HB 5GRWA 1DL7L 1KT2A 1BJ1H 1MCRA 2YD8A 2BHFA 1B88A 3GJFH 4G6KL 3KPPA 2DKMA 4NZUH 3RVUD 1INQA 4PGCA 1PTZA 5I75C 4JO1L 2W0FA 3DIFA 2VLRA 2W59A 5K1VA 1DBKH 1JGUH 4UAOB 1IIKA 3EYSL 2ZZUT 4OQTA 5DJ8B 3ECBB 5K9OB 2NNFA 5KVFL 4R0LA 4FFYA 4XHQA 4B9ZA 3BP4A 1H6UA 4NN6C 1QSFD 2WB1A 3FRUA 3CN3A 1OSYA 2ENQA 4JFPB 4WDIB 3BQUA 3EG9A 4K3JH 1YEIL 1OLLA 3CK0H 2QV4A 3NH7L 4HS6A 3MAWA 2CHXA 1C5CL 4Z7VE 2B2XH 3UTPD 3LKQB 3HRZB 2OTUA 2OXGA 1X5ZA 1CTMA 1MW1A 1HZKA 2Z4QA 1H3VA 1N0XL 4JM2B 4LBEA 1G4RA 2F1EA 4ZFQA 4P2YA 3WI9A 4BDVB 4DN3L 5IM7A 3AG2B 3PIQA 2GIYA 5M95B 5HGHA 1YC8A 2YD9A 3BT2L 3RI5K 5C09B 3OAYK 3OVUB 1A7RH 3S88L 3C8KA 4BHUI 1SXAA 2R51A 4NWUH 1WIUA 4QRBA 4NIKB 4WFFE 4IEFB 1QBMH 1PLGL 3C6SB 3IEAA 3OKNA 3SEPA 3KCWA 3FCSB 2NR6C 3KLAB 3MV8A 1OCZB 2HRGA 2EVFA 3IE9A 2EP6A 1CYGA 4U1LB 5ACMA 3QR0A 1E7VA 5DT1L 3GS0A 4K3DH 4ZO9A 3BFWA 2NYYD 3VTMA 1WSST 4U1KB 3II3A 3QAZC 4MKMA 5J06A 1WS8A 1TXKA 4OZFA 1ND0A 2NDGA 1TJGL 1JGLH 1GC1L 2ZSVB 4LCYA 2OZ4H 1BF2A 5C9KA 3MJ8A 5FM5M 4AQ8A 5HVGB 3FB6A 4NUJB 3FTYA 2YWYA 1K5NA 3U0TB 4QJ5B 2YGNA 4M8QB 4YHIA 1BQLL 4AW4A 3HC3H 1IGTB 5DD5H 1HQRB 3ATDA 3BUIA 3FQNA 3S34H 1IBGH 3N42B 3K81A 4NKDA 5CXPA 1E6JL 2W1NA 2W88A 3TGXA 4N2AA 4PB9H 3N43B 4ZS7L 4O2CB 3VU2A 3MV7E 5HGBA 3PXHA 3EYVB 5IQ7H 3CDZB 4M43H 2CKBH 3FCTA 4FJ6A 1E28A 2X4QA 1JV5A 3APNA 4PRAB 2IGFL 3FU5A 2VABB 3TBVB 1MDTA 5AL8A 2D3JA 2CGRL 2DQEL 3WEMA 3N9GH 4J3OF 4HJGB 1J9TA 5ES4B 3GZPA 1W72H 3FRPB 2PCPA 4UV4L 3LN5A 4P9ML 4PJIA 3X12A 5J12B 25C8L 5F0JB 5T5FH 5EN2B 2CDGB 3VG9B 2NDFA 4Z7QF 1KACB 3EH2A 2JV6A 3BXNA 3K46A 2QHLA 3LB6C 1VZGA 3FFCA 3PGCA 4H5SB 3LVTA 2J4WL 4NIYE 2RJMA 1MJ7H 4RMWA 1DUZA 4C8XA 3MFGB 2HAZA 3NSDA 1M1XA 4D0CA 2JCCB 2JI2A 4ZFOA 3NK4A 4OV5B 3NESA 1R5VA 4FQIH 1X5XA 4HZLA 2D2OA 3RIFK 5E2WL 5DSCB 1P4BL 5KTEH 1KFGA 3T77B 4IYKA 1UTDA 2X1OA 4KK9C 1VCAA 3NCWA 1YUHB 5DZJA 4YHLL 4XPGL 3ECUA 1N6QL 5JHLA 4X7SL 3S5YA 1MOEA 3LTVA 4JPIA 1JTPA 1HHIA 2XV6B 4BV1A 3H8NA 4AYBA 4KITB 1WIOA 5TE6L 5D7JD 4G42B 4FADA 1IGYB 1T2QH 4GXUM 3QZNA 4UQ2A 2M1KA 3V8CA 1RJCA 4XCCL 3HG1B 2XRAH 1RJZA 4L1DA 3DX9A 4G1MA 3TJPA 1YY9D 3Q0HA 2YMOA 1ET7A 1LEIB 4P5MB 3IFNH 2BIPA 1FZOA 3BAKA 3O4LD 5B1JA 1JPEA 4MD5A 3ARBC 3MGOA 4NZUL 5HGDA 3ZL4H 2J44A 3HN8A 3K6DA 4GRLD 4GBXB 3CFEB 4PJ9B 5BS0B 5HHMB 4W4OA 3MGTB 4PJHB 1DBKL 1MDAA 1JGUL 3ARWA 4TQHA 1I1AC 1VFAB 5HYJA 2YC1B 1COBA 1FA4A 4PREB 1OHQA 3QPQC 3VB9A 4TUJB 2Z8WC 1KWKA 1JGDB 4U6HA 3F84A 3OJ2C 1K72A 3HBGA 3PPSA 3EDFA 3QJFA 4X6BA 1OP5H 4LCUA 3BUBA 4K3JL 2BVTA 3CK0L 1HT6A 1ZLSH 5BZDB 1BF8A 1YYCA 3ATEA 2ZG2A 5CBAB 2J20A 2PYEA 5IMMB 2B2XL 2B4CH 4C83A 5CGMA 2XVGA 4MAUH 1M9WA 5LG6A 3MN8A 3CC5B 2PCFB 5KSBB 3PJNA 5CBEA 2GHZA 1UCTA 3L5WB 5BVPH 1TQBB 1S9XA 4LCCC 2J73A 1CT8B 4MSWB 3RPBA 4QRSB 1Y1DA 2F68X 3ULVH 3HN3A 4FQQB 4Y19B 3W5MA 5E1AA 2XPGA 3ILPB 2IMMA 3WHE1 4HJJH 4A6YH 5FUCE 2I9TB 1AHMA 4WTQA 3NFSH 4WHCA 4JPWH 1A7RL 4HIIA 3KLQA 4FTVD 5IB3A 3BZ4A 4HEME 4NWUL 1W8NA 1NGWA 4QHLB 1QBML 3MFFA 4MDIA 3MRJB 4OCNC 3WFHA 2Z0BA 4K0OA 1MHCA 1LHZA 4AIEA 1OTTD 1OB0A 1SDYA 2DD8L 3PABA 3KBEA 3T4AC 3OXRA 3W0WE 5ISZE 4LGPB 3TN0A 4K3DL 3FT2A 3NN8A 4H7VA 4AQEB 5C71A 3CFUA 1NFDE 2FD6L 4N0UA 2BXYA 2X1QA 2EC9T 2EC8A 3WAJA 3NOIA 3NJFA 5J6HB 3R19A 3FO2A 1JGLL 4NOFA 5T33H 4OB5H 3T08A 5HHQB 4GW5A 3U6XS 2OZ4L 3D4YA 2WBJC 4LKCB 5JPMB 4XAWH 2A38A 1AQDA 4NQEB 3CSPA 5KS9F 1K8IA 3QUYC 3MJ7B 3HA0A 3DXAD 5DD5L 5I1CH 3S34L 2EECA 4KI5C 1IBGL 4N25A 4G43A 4R5TA 1XVSA 5AVZB 1H5BB 3ZTJG 4PB9L 3BRFA 4ZAKA 3QDJE 5IQ7L 1P7QD 4M43L 1TKWB 5IB2A 1U2CA 1A6VH 1CS6A 4TV3A 4X6CB 2Z7WA 3MRPA 3FB8A 3VGEA 4BZ1A 4FQ2H 4N8VA 3RUGF 3L5HA 3O3UN 4GUPA 2NY6C 4IJ3C 4P0DA 2EO1A 3N9GL 4P3WA 5CZKA 5IQOA 2Y22A 3OM3B 5IHLB 4PJFA 3ME0B 1W72L 4NQXB 2C1OA 5C0AD 3OJDA 3KLKA 1IAOB 1NZRA 4JX0A 5E8PA 5EO0A 2NLJB 2YUXA 5GGSB 3P11H 4D8OA 1GMIA 1JWMA 2F54A 3PXJA 5EOQL 4FLRA 1CYXA 9CGTA 1ETA1 1BYPA 2IDFA 3GGWA 2X9XA 4FDWA 4MNGE 1RIHH 5E2TH 1A9BA 2WZ5A 2OMVB 1X5GA 3IM1A 4WWKC 2FATH 4GKLA 3WEXA 4BFJA 1WWBX 5EUKB 4A6YB 4HGMA 5KAQG 4JZJA 5AZEH 5KTEL 1JF1A 2K70A 4XOBA 4L4TD 3K4ZA 1KT2B 3FQWA 1P2CA 5EU3A 3Q8CA 3ZE2B 4XPFH 4ALAH 2V6HA 1JP5A 3G9VA 3MRMA 3ULUF 1BFOB 3LKOB 3QQXA 1OGSA 3X1FA 4F27A 1LK2A 1L0PA 2H26B 1YMMD 1PAMA 3RWCB 5LG1A 1A6UL 2AQTA 5EU7C 3J7HA 3ZIYA 2L8AA 1T2QL 3QI9C 5AVWB 3IU4H 3RNKB 4CBZA 2WXKA 2A4EA 4FYSA 2XRAL 3H0TA 4X4ZA 3RFRA 2NOYA 4NPYB 4PFEA 1U91B 1WTLA 4FQLH 5HHOE 3IFNL 2NYYC 4Z7UB 2CQVA 5DYFA 5KW9H 1J1XL 1BQ5A 5FCUL 1MLBA 4LP4A 3MLRH 3PAZA 4I4WA 5IUSA 2C3XA 2OMXA 5E8EB 5DGQA 3TESA 2AERT 3MBXH 3I02B 3P2DA 4JJHA 5JYLA 3AU1A 3Q7JA 3CZEA 1HZHL 4HSCX 5C1MB 1CBVH 1OHZA 2CLZB 4WNQA 1U8OB 5HJDA 2GIXA 3UTSE 4MJ5A 4W70A 1AOHA 3BZEB 2MHAA 4KROC 4UQEA 3D85D 4X8XA 3G6DH 2A73A 5LVEA 1XSIA 3AY2A 3MBWB 5HGHB 4F7EB 3TWYA 2X6UA 2B08A 1QPKA 3D1MC 3QFJE 4G11A 4HK3N 2DQGH 3V55A 5B3NA 1ZLSL 3WIFA 3KL3A 4LFHG 2A83B 5EO9B 1DDHB 3OLEA 3ENEA 3TA3A 2VLME 3THMH 3QIUA 4XMUA 4QYOB 5DEGB 5H35A 1Z9LA 3PWVA 1NL0H 3B9KA 3KYMB 3DC0A 3SPIA 3VJ6A 3P9WB 5BVPL 2IVFC 3LX9A 4APQB 3ULVL 1U95B 3QNZA 2XKUA 4KUZH 2A0LD 2WQXA 1G6RA 4WFFD 5F93C 3T0AA 2R2BB 4A6YL 1ZA6A 1CLZH 2RALA 4HJJL 4LIQE 5ACLA 3NFSL 3OMIB 4JPWL 5DO8A 3QEQB 3VDAA 3WJLC 2E9JA 1SLXA 2MPAL 4YPGA 3V6FB 1Q0EA 3T3PF 5C0BD 1K5NB 2FZ3A 2ZOWA 4P23C 1ZVNA 5ALCH 4QOKA 1FAIH 2JJUA 2H41A 4NKDB 5LGJA 1XAKA 2KQNA 3CIAA 4JFFE 4BQ6A 1EDHA 1D7CA 3B34A 2VUKA 4EI5A 1EO5A 4OZIE 3BD3A 2DIAA 3JZYA 5EULV 2WYIA 4PYHA 3UIZA 1BEXA 2CNYA 5DQ9B 4GLRH 4WTZA 5T33L 1E65A 4OB5L 5BV7C 4Q74A 3EOAB 4XAWL 3LS4L 3GBDA 4Y4KA 2FSEB 5GGTH 5LN8A 2F7OA 5D7JC 1AC0A 4NRXB 1BJ1J 3KXFE 3MV7D 3MO1B 5I1CL 3PNWB 2XHNA 2Q7YA 1NDMB 3BMVA 1YY9C 3ORJA 4AC4A 2XFXA 1S9WB 2G3NA 1ZVYA 4C4KO 4L4VD 4K8RH 3LZQA 4PGZA 2JSFA 4GRLC 4PJ5E 2MCPH 1I7TB 2HJFA 3C9NB 1U8PA 4P4KA 1CXKA 5I24A 3UYRH 1C8PA 3D39D 4LK4A 2F8OA 5JORA 3PV7A 5KBPA 5CEZE 3QXWA 3QJTB 4H20H 3MCYA 1FBIL 2A9NL 2K0RA 4X6DE 1IFRA 1XR8B 2MH4A 1C08A 2RCSL 4LOUD 4ES8A 3DHMA 3OAZK 3P11L 4HW6A 1PJ9A 2GB2A 4V2CB 2NY7L 3NSJA 5DWPA 4DQAA 5E2TL 1KCVH 3W2DH 3SY0B 4NQDB 4H8WH 3OC8A 2EDMA 4CW1B 2LU5A 1NIFA 3BVUA 3TPUB 3NSCA 3DOHA 3UCQA 1AO7B 5AZEL 3V0AC 2NY3C 3D06A 1QTSA 4JNXA 3MBEB 2QPEB 1FNAA 2GG1A 1NMCB 3MOAH 4ZW5A 3NA9H 2JELL 4XPFL 4ALAL 4IHOB 3JVGC 3BESR 3OAYH 5B1CA 3K72A 5I1DB 1N19A 2F5AH 4Y1SA 5DJ2B 2TRYA 5F88A 2NNAB 1PYWA 3QUZB 5F1NB 2IADB 4LDCA 2WLHA 3IU4L 5CD5D 1CBJA 1KIPB 1X5LA 5A2JH 4ZMQA 1YMHA 3LQZA 5D1XB 2AQPA 2VZOA 1KPUA 1QQDB 3SBWC 1SYSB 2ZONA 5KW9L 5I0ZA 2ARWA 3J27A 2J1KA 4HUMB 3MLRL 4LU5H 4F8TA 3O2DA 5DJYA 35C8H 4N5EC 2B5IC 1ADWA 1TR7A 2YD4A 3EJQA 1CBVL 5TE4H 3PL6A 4L3CA 4ZDHB 2EDKA 3DA0A 2Y5TA 3H4FA 1S9XB 3KYAA 4B9YA 3G6DL 2E75C 4XNZB 2BSTB 4L3EB 3IDXH 1Z5LA 3NFNA 5JIMA 2GKIA 4WF7A 3LXUX 5D6CA 4LVEA 4L8BA 2DQGL 1KBPA 3V0IA 3CFJB 2JF1A 2IH9A 3THML 3VXPB 1IAII 3DYMA 5DRWA 2NTSP 3HZ3A 5DRNB 1PD1A 4HUNB 3NFPB 4L8SC 2OCCB 2VDPH 2XVBA 3ETSA 1NL0L 3OMNB 1NGQH 3QEGH 5SV3A 3DX4A 3O45A 4RAUA 5CJQH 1XGRA 2EO9A 2ZX6A 4KUZL 5JPNC 1ITCA 2Z93B 2YAOA 2BVPB 1E8XA 2VLLB 1CLZL 1U4EA 1PX4A 2WO2B 2P8PA 4NNPL 4PR5B 4Y16D 3LZRA 5IJVA 2Z8RA 3VXOA 3W0WD 5ISZD 3O6FD 1JTOA 1XGUA 3KPQB 5EU4B 2DWDB 3KLHD 4F7CA 5L7XH 1Q0YL 5ALCL 4I1PA 4YIQB 2L4OA 5L2KD 4I0PA 4E9VA 4UQBA 4K15A 4R83A 3ALWA 3L16A 3RL2B 2BVOB 4LNRA 2DMGA 2PW2A 4GKZA 3HUJE 5JXAH 3CX2A 3WJJC 2BX5A 1IM9A 4PCTA 3GUTB 4O51A 2ZXDA 4JFQA 4NO5A 2YXVA 3GMNB 1CXEA 1TQCC 4PJFB 3MKKA 4J12A 4B5ZA 5GGTL 3Q05A 1G7QA 3LPWA 2E7LA 4HUKB 2R1YA 5MEOA 4A55A 2ZXBA 2G30A 3IRZA 3QDJD 4KO9A 4YL9A 4ZTPL 7PCYA 4XP6H 5CU5A 1X5IA 3D33A 4DWHA 5IHWA 2DMBA 3CN4A 4ZPTB 3L4CA 2PPDA 3BVVA 3VRIB 3TFBA 4JFXB 3WHXB 2F8IA 2FECI 3P9MA 1J5OH 1JWMB 5JXEA 4B9IA 2I69A 4JDZA 3H56A 3VXNA 4TNVF 2H1XA 3LZOA 4K8RL 4XMTA 2HTLD 2V5SA 4GAYB 5EIIG 1GCYA 2Z9TA 1KBVA 4PLOB 4XGZA 1DJYA 1UQSA 2UUDK 3PHAA 5EEZA 4FFZH 4HWZB 1T3FA 1H8OA 1IKFH 1Q9KA 3COOA 1U8MB 2X4RB 3ESUF 5HHXH 4PW9A 3CSYA 1XBDA 4H20L 1QFUH 2E59A 2VN7A 5ILTH 5DQJB 2NQ3A 1UEYA 3GBNH 5EU3B 4U0QB 4MAYB 1IBHA 4HUXB 4U3SA 1JPFA 2OL3B 1A7PH 2VDPB 2WQVA 4JKLA 1ZAGA 4LOFA 5AOLA 4FE9A 5C0CB 3GMMB 1KCVL 3W2DL 4KTGA 1KCSH 1JZ5A 3NCEB 1IC7H 4MNHB 3IMSA 4DZBB 1BZ9B 4ONOA 4RX4D 2R0ZH 4ZTOH 2IOIA 2VERA 4Z76A 1KGIA 4MCZA 4JCLA 3E8VA 3N44B 4JFWA 3MOAL 3NA9L 3SGKC 4ABQA 5I75B 4FXKA 3JVFC 4FMKA 4M6AA 1DFBH 1E8WA 2BVEA 4K23H 4FI6A 1X6NA 5D93C 2Z1PA 3QEUB 4KNQA 2J21A 5TE7H 4I9XA 2HFFA 2W9LA 3HAEB 2HZHA 3CXHK 1J0IA 3K6SB 4NN6B 3Q8FA 3S35X 4PJXF 5CKGA 3SOBL 4A7QA 5IGXL 4NO0A 5F0LB 2ZF8A 1SVZA 3MNZA 2A74B 4TSBH 1L5GA 3L2LA 2QSCH 1ZLWK 2CUHA 2FQDA 3KE0A 1FC1A 1MY5A 3QFGA 4WO0A 4B96A 1AQ8A 2GSIA 2K1MA 3W38A 3HPJB 5F89A 4LU5L 5AFAA 35C8L 1S7XB 4G5ZH 4YHNB 2YSTA 5K9JH 3MLYH 4PJDA 1V7MH 2Y7SA 5TE4L 2E76C 2H2SC 3NIGB 3PQYB 3QDAA 4KH9A 3VDCA 3AQDA 4NXSA 4LQFH 4DEPC 3CFKA 3O11B 4O2FB 3SD5A 1M2OA 3IDXL 1E5AA 5E9DE 4PGBB 1ZHKB 2ZXCA 2A99A 2EVHA 4POZD 3FOLA 3IDYC 4Q52A 3ZO9A 4IOIA 4ZUSA 1X9RA 3VH8G 4OVVA 5M94B 4UU9B 5JO5B 4JKWA 4WI7A 3CVDA 2CO2A 2R2CA 5AW0B 4TVSa 2YOCA 2OL3L 1VGKB 3SN6N 4Y2DD 2VDPL 1NGQL 1JS4A 1TQWA 3KYNA 1MCLA 4AENA 3CN1A 1E4HA 3RDJA 3C5ZC 5IEHB 4XCFH 4PW4A 4AMWA 3O8XC 2XWRA 1RZJC 4FNSA 3D4GA 3MHZA 1YPZF 3TT1H 4LOUC 2ITFA 2NNRA 3PWUA 1G6VK 5CZXD 1LO4L 2C3GA 2EDHA 4JFDA 4WRLA 4LLUB 4KO7A 2K4AA 4C4KT 3FB5B 1YEDA 1KTLB 4HGKC 2QTEA 4X5WB 3A24A 3C2AL 3L1OL 4MCNA 3C6LB 1N64H 4WVRA 3BVXA 1IUZA 4ES9A 3VXQA 2HG5A 1U8QA 3SGEH 4IU3A 1GA2A 3RZCB 3IETB 2OAAA 4MDJB 5JXAL 1KBGL 3LZFH 1MXGA 4PG2C 4XXWC 1IGMH 3U0PA 5BW7A 1OD7A 2XIIA 4N2CA 1I53A 5HPOA 3KXFD 5AEAA 2HFEA 1FVCA 1QRNA 2BNQA 5HHNA 1KUMA 2OSXA 2ICWB 2GAZA 3QQNA 3WO4B 1M05A 3FQ2A 4ZXBD 2AVGA 4RGOH 5SWZB 4QCIA 3GPEA 4Y1AA 3JTBA 4P2RB 1IB5A 1OT4A 4UQ3A 2HFGL 3WY4A 1J5OL 1NLDH 3FT3B 2P5EB 4PJ5D 5HYQA 4EMZA 2GT9B 4R7VA 4RAVA 5D5MB 4FNUA 3RYMA 3IDJA 3RUGE 3GSWA 2EDJA 5A7EA 5EHFA 1WAEA 5IVXB 1OCRB 2NXZD 5B22A 4KGLA 1JD9A 1EVTC 1AE6L 3AM8C 4BUHA 4H1LB 4HUVB 4PWHA 3CZKA 4XN9A 4ZMNA 1LNUA 2RIKA 4L2YA 1SJXA 1HCZA 1HXKA 4RA3A 5ILTL 3QHFH 4O02H 4M1CC 4YDJA 3GBNL 4NZFA 4DP2X 1WJ3A 3LEVH 3IRCA 2J25A 1A8ZA 3MRDB 4G8GD 3BGMA 1A7PL 5FGCE 3X17A 1JIBA 3GMRA 4BCZA 3VI4E 1CO1A 2EXWC 3QWOA 1WFTA 2NY0B 1KCSL 1ASOA 4TVPE 4AQ1C 1IC7L 3WDJA 1N26A 1PQZA 2D7TH 3QORA 4NEHB 3UJIH 2R0ZL 1LEGA 4RRPG 4ZTOL 3BIAX 2IOOA 3GRGA 1UM5H 2IDCA 2X88A 3PDOA 4K5MA 1BIHA 5GS0C 5IB1B 3BZDA 3MLPA 1DANU 4B3VA 3ULUE 1R24B 3B8SA 1DFBL 4AK1A 3WLBB 3QJQB 4K23L 3S8WA 3GK8H 1LMKA 3O6FC 4WI9A 5TE7L 5DUMH 4YSEA 2UZYA 4YNYA 5EOCH 3FPXA 3U9UB 4B95C 3WUWB 2NY1C 3BZFB 3GTTA 4TSBL 5IB5A 4K7FB 4NQCA 1E5CA 5BO0D 2QSCL 2ZTBA 2V5YA 5F21B 1IEBA 1OCCB 3RTQB 4HWNA 1H9DA 4G9FE 1FNEB 5EC2A 1NANH 2ED8A 2XXCB 4IIQB 1VKXA 1U8HA 2R7EA 4JO3H 3GHEH 3VVWA 4G5ZL 2NCMA 4ODWA 5E8DH 2CA3A 2YKLH 4ZW3A 5K9JL 3BUPA 3MLYL 4DTGH 1CG9A 3GJEA 2XWZA 1V7ML 3CCHA 1TZGH 3NJIA 3SKMB 5LNDA 1UXSB 4ODUB 2DY2A 2OSLB 1DJWA 4RAUB 1QP1A 2I5YH 3WD5H 2E5EA 3VWKC 1D5XB 1VEPA 1I3RA 1KJVB 2XYBA 4R4BA 1LP9F 4FQCH 3IFPA 5IJDC 4WQOA 1QLEB 3G5VA 2VDKH 3Q3GA 1G87A 5F9JA 1A1OA 2OJZH 2P8LA 3B1TA 1P1ZB 1MHPL 1AGCB 4QWWD 2HCZX 4XWOC 1IL1B 2XKNA 2ZT9C 1A9EB 4NC0B 1G7JA 2QFRA 4OM0L 4Z6AT 3SKNA 3DGGB 3KLDA 4ZOCA 3ML9A 4XCFL 4CMMB 4QHNB 4MJIE 2GK0A 1HCFX 1PW3A 1FJ1B 4R4FH 4FFTA 4GKZB 4MNQB 1UT9A 2X89A 4OZFG 3R7QA 4G6AD 5EMYA 3TT1L 5I16A 1IM9B 2XJKA 5F7HA 1RK0A 1YEWA 1G5AA 1L0XA 1UUNA 1KV7A 4JFQB 4ZFZB 4I3GA 5DMKB 1JDAA 3L3OA 4WU7A 4KKPA 3ISYA 2ZSWB 3SGJC 2YN3A 1S3KL 3ZT5A 2NSXA 5KSAB 2EZ0C 3MA9H 4LP8A 3H9SA 5CZRA 1ZHNA 3LMJH 1FVEB 2J8UF 1LE9B 1PZ5B 2AK4A 3CLEH 1M3JA 2PCYA 1F2QA 1E9OB 1A1MA 4RCAA 15C8H 4JDZB 3LZFL 2WTPA 3QA3A 3ZYIA 1G7LA 2V33A 4G6MH 1D6EA 4UQ9A 4A7TA 4OFVA 1PKQE 5TF1L 1A22B 4G6JH 3LIZH 1Q9KB 3ZKXB 1LL1A 2O4EA 3GJFA 2QDVA 2NYZA 3SDYH 2JJWA 1AVAA 2BNUB 3DK2A 4ANXA 2VERN 4CRPA 4F57H 3QYCA 1GXEA 3CDGB 1MN4A 1YAIA 3KS0H 3ABMB 3B7TA 3GBEA 1NLDL 4GAFB 3VXRA 4IRSD 2YBGA 3NGBB 4OZGF 4ZUWB 1UXWA 4Z1PA 3IN2A 4H8QA 4MQXC 1GSMA 2A77L 1W2KT 1NDGA 5SWQB 3VXUA 1HI6B 2ICWI 5ESVA 1KN4L 4TRPL 3QNXA 5C9JA 5B39B 1SFDA 2IAMD 2VRKA 3QHFL 4O02L 4U05A 1U8IB 4DKDC 1NCDH 1I8IA 3LEVL 4GI9A 4BFFA 5GGRA 3M8OH 3DX2A 2ADFH 1URIA 3LHPH 4FA7B 3B2XA 4KXBA 1BD2D 5HGAA 1ZLUH 3HLAA 5CCGE 2A6KB 5J4MA 2COVD 5IROD 3L7EA 4HOZA 5BV7H 5E00A 3QQDB 3PRZA 1OP4A 3BEWB 1JI1A 1KXQE 3OAWA 1WWCA 1UM5L 4OZHB 3TVMC 1KIRA 1ZTXH 3VSVA 2CO7B 3GIVA 1USZA 4XXDB 1UEMA 3ZIMA 4QXTB 3SYCA 1P4IH 3MLWH 1U30A 4HF5H 5KVGH 2C3VB 3MRLB 3EYFA 5JW4M 2D8KA 2XA3A 4MX7B 3GK8L 2F53B 5FEBA 2E46A 4OF7A 5HGGS 5DUML 3IMBA 1D7FA 3LN4B 2CLVA 5EOCL 4PJAB 4Z0XA 3ARRA 3TO2A 3DHUA 4DIXA 4BEIA 1ZS8B 3KGUA 4Z3GA 4OIAA 4Y4HD 5C0GA 3QQ3B 3BDYH 1TO5A 4HKXB 3UEQA 1QASA 2XZCH 2ZCHH 2OZ4A 3SSGA 5BMFH 3VGHA 5DEJA 2QKIA 4JL1A 4N2DA 3GHEL 4P2CG 1CURA 5GZND 5E8DL 1IM3A 1QA9A 2YKLL 4WWOA 3S35L 3WMQA 1TZGL 5E9DD 1V10A 2WXJA 4ZXBC 2PO6A 2GW5A 3WD5L 1E2WA 1IGIH 2CKBA 1ZWIA 5C6WH 1KFAL 4A2HA 2KHAA 1IBFA 4XP4L 1T1ZA 1SLUA 4E42A 3F7QA 1TTGA 3FF7A 2MQ0A 3NRQA 5HYIA 2VDKL 3DJZA 4QDGA 4WTXA 4AEEA 2MWCA 1W72A 2OJZL 2PWGA 3X11B 4EDWH 2UUDH 3KPRE 4NP4H 4RQQB 5FDYA 5FO7B 5L0QB 3ZR5A 3WU1A 5T5FA 3SQRA 1V55B 1XF5B 4P9HC 3BLBA 2E9BA 4P2OA 3SDDA 3DRTA 1C12A 3F7PC 1FV1A 4GRWB 2A6DA 2JB6B 4M4RB 4NUGH 3FFDB 4WTWA 2O6DA 3CPLA 1U8QB 3GSQA 4YJZL 2WLIA 5CWSA 5F3BB 5K9QI 1J87A 4FXTA 1QATA 2J8HA 4GINA 4R4FL 3U7WH 1JZ6A 2WUBH 1BQRA 3MV9E 1X5HA 1SN5A 3TJEH 3DV6A 5KYNA 2BSDA 2IF7A 4LEBA 4HFWB 4BXSV 4K3GA 3NJLA 2DN7A 4UTCA 5I6MA 4M9PA 4WI2A 2ZIDA 4C55A 4PRDA 4PJEF 1WBZA 4D0BB 2W81C 3U6RB 3LMJL 5HI4D 5BNXD 3H2QA 2OPCA 2ZOKA 4Z7OB 1A6TA 3IPEA 3NPSC 3CLEL 1R47A 3ZQWA 5D9SB 4UYQA 15C8L 4Z5RB 4N8VG 4OFYA 5CKAA 4G6ML 5BRQA 3SDAA 3HR5B 3OHXA 5C7ZA 1ID5I 3QUXA 4PRHD 2R1XB 5I1JL 1WFOA 1QHOA 2QVIA 3JWDC 6CGTA 3FUEA 2NY4C 4ZNCD 3WN5B 4G6JL 3LIZL 2OMTB 1HDMA 2ICWJ 2W8CA 4PJBF 3DROB 1KG0A 5ABAA 5EZIL 3SDYL 2C9RA 4F57L 4L9LA 1ZLWH 5JW5B 1PD6A 4TNGA 5E6IC 1VFBB 4IGBA 1NM9A 2R23B 5F8QC 1RPKA 3LXBA 1WV7T 3BHBB 1IILE 4NOBA 5F7MC 4EE2A 3UGUA 2R8SL 2FUQA 3ASOB 5IREA 4XBPB 4G8EA 3OKEA 4E0RA 5FYLD 1E9QA 2F2HA 4U6YA 2YMTA 2EE3A 3ZHKA 4KTDH 3RP1A 4HHAA 3SBRA 4G2AA 3VSQA 3OD3A 1T1XA 3EF4A 1PY4A 1MI5E 4OGYH 1PPIA 3FS9A 4KPHH 3FHQA 3IU3A 3BD5A 4LRIC 1T83A 1NCDL 3PHQA 5MENE 4TVPD 2EIMB 2JKIS 1H6TA 2ADFL 4FTVB 1WBYB 4TSAL 4YDIH 2HH0H 5J1SC 5DJCB 4ZPVB 1QZNA 1N3NB 5I2IB 5BV7L 2CBPA 4FFWC 1O6VA 5JMRA 4W9DC 3KDMB 1I85A 2Q0ZX 4G80B 1WT5A 4JFED 3TNMA 4DFIA 1H19A 3ARFC 4PS4H 1BMZA 3QHTC 1DR9A 5A16B 1EMTH 3MYJB 1P4IL 4HULB 2HJLB 2V9QA 4PWKA 2B5IB 2QGDA 3X3FH 1HKFA 5KVGL 5IQ9A 3V4VH 5IHHA 3PV6B 4HKJA 2CDEA 1NFIB 3D6GA 4CJ0A 3P3UA 2QADC 4YK4B 1JPSH 1BVLA 3DXAB 4PJXE 3N1QC 3DDFA 2JTYA 4G9DB 5BQ7A 2NPLX 4G9FD 1H3GA 4PRBA 5D7IF 4H0IA 5GS3A 1DQIA 3WNNA 4FD0A 4E5XB 2H6UA 5DGRA 4N0FB 5E4EC 2VITB 4DKFH 4ECNA 1UC6A 3SJVA 2XZCL 2ZCHL 3T0EA 4CILA 4H8PA 3RWEB 1MHHB 2X7LA 2XZQH 4Z7NB 4JL2A 3UZQB 4PTTA 1T80A 1YNTB 4BFNA 4FULA 4JGNA 3N85H 2IXQA 4Q6KA 2GABA 1Q8MA 2AK1H 1BFVL 3GINA 3ASNB 4W81A 3STZB 3H3KA 1B4TA 3L3DA 4ONHA 1R3HB 2LFGA 3QH3A 1UOLA 4PJ8C 4IRJA 1AMXA 4DZ8A 2HMIC 3F7VA 4MMZC 3KJ6H 4J3OC 2QQQA 1JNLH 2JKTM 3K74B 2W9EH 4NWTL 3H7BB 4YHPA 4D7PA 1WZ1H 4NP4L 4EDWL 1YC7A 5BXFB 2Y6TE 1CFQA 2IGTA 4QAMB 3ZDYB 4YOKA 2CHNA 2K9UA 2Y5QA 3BW9B 3R18A 3ZUNC 4NUGL 4F2MB 1XFPA 4BH8A 4L4TB 3RHWK 1B4LA 1NBVH 2BOBB 3L9YA 2YD1A 5E8NB 2IAMC 3NG5A 5EO1A 4RFEA 2OQJB 3JV4B 1YPZE 4M3JA 2WUBL 3HBPA 3VD1A 4WTZG 1DVFD 3TJEL 4JM2F 4JY4A 2EYTB 1YMMB 2F18A 4ELMB 2V7NB 3T3MB 4CVZB 3UBFA 1UM4H 5ADOL 2EAEA 3ELAT 3PXLA 3QJRB 5EIQA 5IJKA 3OL2A 4I2XE 3US9A 2AKRA 2JQMA 5D1QA 2DQJL 1RERA 2ERJC 2YPLB 2CBOA 2VXUH 4F93B 1GYVA 3DI2B 1OPGL 2ED9A 4XCYA 3V4VB 3RWHA 4QY8B 1HHKB 2R1WA 4PRIE 1OAYH 1TZ8A 1QUNB 1Z3RA 2FBRA 3AT8A 4J8RA 4YDVA 1NPJA 1VB9A 1WVZA 3ZTEA 5T1LA 3VB8A 2Z7ZA 2VR4A 4IDJH 5DA0B 5IVNA 3RJOA 2BHYA 4JFZH 5B8CA 3S37X 3TT3H 5CJXA 3AVEA 3LQAC 1HAWA 2AGJH 2X6AA 3K7UA 5IHZA 3REWA 3KPOA 3QG7H 1AP2A 3D85B 3MJGX 1ES0A 3OB8A 2JQZA 1U3HC 2WKLA 4MS8D 5HPMB 4GG8B 4XAKE 1KXVA 2P5WE 3QNFA 1BZ7B 1YNLH 4MQ7A 5KVDE 4Y4HC 1MNUL 1QW9A 1AD0A 1USQA 3T2QA 2W0LA 3TNNB 3OKYA 3D0LA 5CN1A 1EXHA 1PVHA 2MMXA 3IMWA 5BPPA 4YFLI 4JPKH 1U3NA 1NBZA 3N41B 3N42F 4HP5A 1K8DB 1JZIA 3K6NA 1HSBA 4DP0X 3N43F 4P3DA 1SF5A 2DWEB 12E8L 3FQTB 3MNVB 2XN9D 6FABH 1KCWA 1NC2D 3DV4A 4OGYL 3FJTA 3LH8A 4KPHL 1F4WL 1N67A 2DWXA 2ATKB 2R0LH 2OXHA 4YHMH 3U1QA 1QEWA 1J5CA 2VDRH 4RGNE 1TU2B 4X99B 1BVNP 3D07A 4YDIL 4HHWA 3GB7A 4WUUE 4MZRA 2WZ6A 5C0BB 4K7PH 1L0QA 3TZVA 3PU7A 1S9VB 2ZD0A 2ADJA 2QGEA 1T5KA 2EEFA 3O3DB 3QUMH 3P4MA 4GSQA 3UROR 4G3YH 4LLVB 5D4HA 3GSOA 2JCCF 1MREH 2ZUQC 4PS4L 4QMEA 2O61A 2DQFB 2H1PH 2APVA 1UKQA 5A3ID 3LSOB 2BWIA 2CBQA 3P4NA 3DX0A 1U6AH 3KPLA 3KPNA 4OJCA 1JE6A 2CSPA 3V4VL 1AZVA 1XMWA 4NRZB 2R83A 3AY4C 3DMMA 1O6TA 5TFSH 2DJUA 4M8RA 3V0VA 2CH8A 4KMQA 3NZHL 3CXDH 4TTDD 3MV7B 4XHJD 1JPSL 1F1DA 4LVHB 3ULSA 2WUCH 3L1GA 4BA8A 3PWLA 1SMOA 5J1AA 5JW3H 5GGVY 1LWRA 3OKKA 4PP1C 4E42B 4DKFL 2F1AA 1NCHA 5ICZB 4L4VB 2W0KA 5GGTA 2CIIB 3SDCD 4LT7A 2O5NA 3UH8A 3S9DB 1QW8A 3N85L 3QDMA 2Q3ZA 4N24A 2Q2LA 3D39B 4GP8B 3V4UL 2HFTA 3FCGA 2IANE 1FDLH 3HS0A 5DHVH 5GRVK 1EFXB 4BSWA 4W6XB 1D5IH 3FUIA 3PWPD 1VEOA 3FQRA 4X5XA 1LP9E 1DVQA 1I3GH 3BGAA 2NT1A 3KPRD 3AMKA 3JZ7A 4PJHF 4WI0A 4JRYE 2X10A 3KJ6L 1LJMA 4RLDA 5FYJD 1JNLL 4D9QE 5GS0H 3T2LA 5EU6A 2CXKA 2W9EL 3OPZH 4KKAC 1WZ1L 2YD6A 1AKJD 2IDQA 4PRDB 1ZIAA 3KHQA 5FA3B 4XNQB 3WIHH 1FH5H 2VDRB 3QWQB 1WGVA 5DEZA 3BPCB 3MV9D 2K8QA 4MCYA 1NBVL 4HS3B 4EN2A 1FNGA 2VDLH 1ZEAH 3D2TA 3H9HB 5CIPA 5HI5D 5KSUB 1P9MA 3HS9A 2GC4C 4XPAH 5EWIH 1F6AB 5I66A 2IBGA 1OSZA 2AV1B 5KSBF 3V2AR 1PZUB 4GG6A 3QUMB 3WNOA 1OTSC 1FAKT 3K6FA 1A6WL 2I7SA 1Q94A 3RIKA 1MHEB 5FHAH 1H8LA 1NAMB 1MUJA 1UM4L 4HYTB 3EHBD 4M29A 2K8MA 2ZNWA 5GS1C 3VXME 3U2SA 2WZ0A 2VXUL 3RJQB 3RKPA 3ULUC 1JRHI 2WQWA 4HPOH 5ELIA 5C08E 4IGBB 1IKNA 2C1PA 4ZQKB 2Z35A 2H32H 3VACA 1OAYL 2XACC 5E8OA 4M61B 1XGZA 2Q3XA 1BQUA 1F42A 2Y2YA 4WV1A 4Z3TA 4IDJL 4G8EB 3I9AA 4JFZL 5FO8B 2YBRB 4E0RB 4XP9H 1KIQA 2AGJL 2YRBA 5BO1H 3QZMA 5I1AA 1ILSA 1FG9C 1A3ZA 2IH3B 1N10A 4XNMA 1BHGA 3QG7L 1AY1H 3FH7A 1ET5A 3MUGA 5D71H 3IU3B 4JE4B 3BPLB 3O4OB 3TO4D 1FL6A 4XMXA 4L37A 3RWJB 2DL2A 2DQUL 1YNLL 4LL1A 1G7HA 1YEJL 4Y5VB 1KYFA 2XWCA 4RISH 3SE3A 1LD9B 4OZGE 4NENA 5EC1B 4JKMA 5DHVB 1EEYB 4JPKL 1MI5D 3G5YA 5L2JB 1QVOB 2WVVA 4KBPA 3GLZA 3ZT6A 2RR3A 5DEFA 1NGYB 1SOSA 3UTTA 5MEND 5E5MB 1IC5H 3TNMB 6FABL 4GW4B 3LRMA 4X6CF 2G60H 3O3AA 2R0LL 4ZMYA 2QMJA 4TL4A 4FHBD 4WK4B 4XZ4A 5C0EA 2VDRL 4Y16B 3CNKA 4MTMA 4MS6A 5F2FA 2WWMD 2VLJA 3EO9H 5AW3B 5ISZB 1FF5A 3L6FA 4OF5A 3BKCH 3O6FB 2AJVH 2TRHA 3PWNA 4GP4B 4L0YA 1JZ3A 5DD6B 4OLUH 3U46B 2C9AA 2ICEC 1T6VN 1DP0A 1N5YL 3QUML 4LMQE 4O5LH 4F7MB 5L2KB 2A2QT 4G3YL 1KGXA 2JLLA 5E6ZA 2BK8A 3B3BA 3IJHB 2LLLA 1NAML 2H1PL 3ULVF 2VR9A 2RACA 1KNOA 1XL6A 3A4FA 4GY4A 3KWWB 1K4CB 1OANA 5K93A 4LCIL 5TFSL 1ZDSA 1BM7A 3FHEA 4LVNB 5I6XB 3CXDL 3NCJH 2YO3A 3ZE2F 2FJFA 1NBCA 3RILA 1PG7X 2WUCL 5HY9A 2ENJA 2EIDA 5AAPA 3U25A 3WDHA 4GXVH 4PBDA 3L3DB 5JW3L 3MX0A 2X05A 4Z77B 2VH5L 2HT2C 2C9VA 4MDRA 5T5NG 1Z7JA 4HUUB 3WNIA 4D8PB 3QCTH 2X4OA 5DR5H 4P04A 5HYSB 3BVNA 5C0DB 2WXRA 5CGBA 3S5LB 3TFKD 4Z7UF 2YAQA 4X4KA 2VXSH 2VKWA 5BOPA 4F58L 1N70A 3VFOA 2VZ1A 4QRPE 2WZAA 4IJTA 1FDLL 4LCWA 2BFGA 4PY7A 5DF0A 4HK0A 4Q2ZB 2DQHH 1D5IL 3ARED 5CEYA 2YK1H 4LPWA 4PRPE 1L9OA 2A1WH 4GOSA 4TLKA 3UBXB 4LIQH 1O0VA 4MMXB 3FNKA 4PRNA 3MXWH 4Y9FA 5GS0L 5GZOA 4FFZA 3U48A 5TDNB 5AVUB 4PJ7A 4D9LH 2W92A 2NR6A 4KMLB 1RURH 3WIHL 1FH5L 4ANKA 4I5BB 4WO4D 5H94A 1UWYA 2MTPA 4HZAA 3CV5A 4ZQTA 1D5BA 2VISA 1PU0A 4NYLA 2VDLL 1ZEAL 4X5QA 1S9KC 4PJGB 5GRJH 32C2A 3EGDA 4XPAL 5EWIL 4D94A 1UXLA 1OGAA 5E03A 4HIHB 5DJZB 3RX8A 5DK0A 2DRUA 3IDGB 1IAMA 3SCMB 4YHOL 3L3IA 2CIKB 4JG0H 1A6ZA 5FHAL 3U83A 3FDWA 4P2QE 4PJEE 5KANI 3U1SH 2YAMA 3NABH 2H4EA 4PRID 4WUKH 3RVXD 3BE1L 2XBDA 4ANWA 2YPVH 2VSMB 1Q9OA 3LY6A 1KDIA 4HPOL 1BP3B 5E7BA 5EBWA 4DK6A 2C26A 2X38A 2CR3A 4MA1B 1AD0B 1NM4A 3ROLB 1J9CT 1JUFB 2PYFA 4XCEA 2DJSA 1T5XB 4XP5H 3BKJH 5F3FA 2XIBA 1FZJA 1VFOA 3FB7A 1S7UB 4W9ZA 4XP9L 2BNRE 1WISA 4XMKL 5BO1L 2F58H 4BM7A 4KQ4H 4XAKD 2ITDB 1TOXA 4PJBE 4P9HH 1RP8A 2LAAA 2P4AB 5CEZH 1AY1L 4GAJH 3FCUB 4KXCA 2EDYA 1Q9LA 1RQ5A 3CZGA 2JXMA 1E5BA 3EKCA 1KBBA 3HZYA 3P4LA 2R2HA 1BFSA 1FO0H 3G6AB 4UT7L 1UJ3A 2WXNA 4IK7A 3IDIA 5FKPB 2EQDA 1KJMB 5IY5B 4YDLC 1UD3A 4Y2DB 1RLWA 3FTXA 2JI3A 1FGNH 1L6XA 4BGDA 1CI3M 4WSGA 3JYBA 3BP5B 4R90L 3VO0A 1IC5L 3R8BB 1PY0A 1SLVA 4Q8BA 5KVFE 1K4DA 3CZJA 2G60L 2QSVA 2X4SB 4JZOA 2YQ3A 4J4PC 4U4IA 1AGBB 4PVNA 3O9WC 2LT9A 3QQ4A 1J0HA 4FQ1H 4ZUTB 3GMOA 2HVJB 3VXTA 1T21A 2BMKB 2EKSB 3TS8A 3BKCL 2AJVL 5TK2A 3HZVA 2LGNA 3A4EA 4BA0A 3QIBC 3EJTA 3LV3A 5F6HJ 1GRWA 1MCDA 3R0NA 5GSVB 3LEXB 4IS6B 3JWDH 3W3BA 4O5LL 3F12A 3TJHC 4YDKH 2B15A 4AM0Q 2ZKYA 5EIVA 4AGMA 3ARBA 3HE7C 3QK0A 3NIDB 3KXFB 1A66A 1TEGA 3FO9B 4AEIL 5IFHH 1WFNA 4XRCA 2V2TA 1BMGA 3RWGB 3FFOA 2DDQL 1RCYA 2ZYIA 3P0GB 3QDMB 3PFQA 3RG1C 3BUYB 4H4NA 3ZPDA 1I1AA 5C3LD 1RK1A 4ZXBB 5J13C 3AWGA 3NCJL 2WV3A 2NW2B 5G2NA 2VL4A 4FXGC 5HD8C 2BC4A 4GXVL 5D7IE 3BJ91 3BVWA 2XOTA 3BWZA 5GSRA 2V4LA 4ZSOE 3NBNA 4U0RB 4XN8A 4PJ5B 1RZ8B 4KJYA 2G75A 4XO9A 5FGRA 1I8MA 2J71A 4JRXA 2VLKD 3U4KA 3QCTL 5DR5L 1GYUA 4M48H 5DFAA 2NXZB 2IAND 4G8IB 1EXGA 1QR1A 2ZX8A 4X98A 3NACH 3V5DB 5C97A 3TEZA 2GJRA 2JK5A 4GFTB 3C12A 3HMXH 4PV9B 4K71B 7CGTA 4UOJA 5FW6A 5DI8A 2QGBA 3DGDA 4LCCA 2AXFA 4XCNA 4LHUA 2DQHL 4D9QD 3GXIA 5KZCD 1T4KB 2YK1L 2P49B 5ESQB 3KVPA 4G8GB 4K5NA 2HP4A 3LDBB 3TO4C 5ID0B 1A3QA 3S36H 3UXFA 3SE4C 1QSEA 4GG6B 3MXWL 4U2ZA 1HEJC 1M71B 2YHGA 5BRZD 1QBLH 1EZVX 3RFZA 3ARGD 3B43A 1JI2A 5F7YC 1ZV9A 1JN6A 3UMNA 1R3JA 2CU9A 2D0FA 5DRZB 1TVBA 4XPHH 5F9AC 4O02A 3T4AA 1PY9A 3U4BH 1B9KA 1YY8B 5LGHH 3C09C 5DJ0A 1CFNB 5F6IB 4AY0A 1JMXA 2R29H 3NCXA 3Q8AA 4KNSA 3MRIA 1OAJA 2X4PA 1LO2L 2XNAA 3WL9A 1EDYA 4NHUA 4WENB 4X6EA 5GRJL 4NM4H 3RX7A 5GGUB 5HJGA 1KPRB 3UBXI 4RDQG 3F5WB 2C4FT 2WWMC 2YD3A 3VXMD 1CMOA 2WBJA 4DP9X 1XGTA 2XKSA 5I73B 1B0GB 4JG0L 1CGYA 2P48B 3TXAA 5ESAA 2A9CA 1KIQB 2B3RA 5C08D 2I60H 3NDZE 4B9CA 3U1SL 1NCWH 2WZPD 2TAAA 5C09E 2GSMB 1OO2A 4TN9A 3K71B 4FQXC 4WUKL 4KKRA 4XNAA 2YPVL 5D1ZD 5I5IA 3D3VE 4S0SD 1GH7A 2RGSA 2QZ5A 4IBWA 4J3VA 3JT0A 3MUY1 4M8VA 4OY9A 5FV2A 3MV01 1LE5A 1KZYA 4BKLA 1LLAA 5FIEA 5I5JA 2WQUA 3BKJL 1E27A 1B4JH 5DDHA 4J3OH 4RFNB 2ZAHA 3VRJB 1AZBA 4I1RA 1R3LA 3TBYA 2F58L 2A6IB 4KQ4L 5TGBB 4P9HL 1IJ9A 1E4KC 3R4RA 2VR6A 4GAJL 4GUCA 1LVEA 4CNIA 1KTDA 1CD8A 1QSFA 4MVBC 1HCVA 1GW0A 1CLOH 1AYRA 4K9JA 4LSRH 4TULL 1FO0L 4LGSB 4GB9A 3ZDZB 4U1IA 4CBPA 4DVBB 1A4CA 1J05A 4WWKA 2VQUA 1JGEB 2F7QA 1X7SA 3FT1A 3AWEA 4XWGH 5DK2A 2HVKA 3TFKC 5LQBL 1LMIA 1QHQA 4R8WH 1A7NH 4Y2OA 43CAA 5HHVL 4V11A 4LBAA 2GBAA 4PWIA 3MUZ1 3AREC 5EZOH 4EDXA 5D2LA 1ZSDA 4YUEH 1NCJA 1U8NA 1WAAA 1D5ZB 1P5UC 4MZ3A 3BP6A 4AE0A 2OJ1A 3QI9A 5DZLA 3OPUA 4B9PA 1RHHB 2CWRA 2ZOLA 2PP7A 3N0AA 2ZCLH 2JVUA 3RGVD 3QS3A 3JWDL 5HJBA 4KVCH 4YDKL 3LQAH 2BOCA 1DVTA 5INCB 4YEFA 1CVSC 4JMXA 4Y9BA 4EAEA 4Y4FD 4QXWA 4AXWB 3IJ8A 2XTJD 4YWGH 2B8OT 1ZHBB 4TNVK 4ISVB 4Z3FA 1KLUB 5IFHL 2HPTA 2PF6A 4NB7A 2IV8A 1MQKL 4P46D 4WW2B 3HE6C 3N44F 3DETD 2CRIA 3L9BA 2JNZA 2YJLA 1AFVH 1AD9A 4Z7WF 5ACZB 5C0IA 2IIJA 1T03L 1NFKA 2FO4B 4WGWB 1ZSHA 4ZOAA 5JHDA 4AM0A 4IRSB 5DS8B 5AD0A 1T89C 4X6FB 3FUNA 3HG1E 1MRDH 1I1RA 5ITFA 3LIZA 2Q87A 4PJ7B 1XZ0A 4QRPD 3NACL 3QFDB 3FT9A 3PYCA 2DMHA 2G4GA 2VQ1B 3LKPA 2PLTA 4FL4C 2IFFH 1IMHC 3W1ZA 4AL8C 4LEEA 1BYNA 1GJWA 2V3FA 4KZ0A 5FB8B 3GKWL 2DJ4A 2DQIH 1XAUA 4PJHE 3ARQA 3L4YA 3S36L 4XVSH 1BD2B 1B6DA 2WSDA 2E7HA 2ZX9A 4Q4IA 2ZKWA 3NIGF 3WJLA 2KT6A 3TYGH 5IK3B 4KKLD 2MNWA 2EILB 1ZCRA 4R7LA 1GIGH 4XPHL 4P23A 5CGTA 5AAMA 4F7TB 1MPAH 2R56H 2QFPA 4UDTA 5H37A 3KJ4B 1JXFA 1HH6B 3CZSA 5I23A 2R29L 5KYUA 3FC8A 1TCRB 1T7YA 1EA9C 4RGNC 1AHWA 4LF3B 3E1F1 1OGTA 2WKOA 4NM4L 4FC3E 3V52L 4MBRA 1Q72H 4YSCA 2PYFB 5KSBE 5KYXA 2WTRA 5DUBB 1ZGLP 3UL4A 1U41A 1ZPLA 1N0LA 5AB0A 4IOSA 2CO1A 5D7JA 4PUBH 2D0GA 4RH4A 4Y19E 2I60L 3DTXB 3HZMB 1M7DB 1NCBH 1NCWL 3D87B 2OYLA 1R19A 4V1DD 1PCSA 2VIRB 4Y5YB 4FGMA 1DQTA 2IPKA 3HZYB 3O4LA 2TSAA 2K45A 4FMVA 4JJ5B 4MYPA 4F37F 5J0BA 2ODIA 3VW3H 1SF3A 1UJ3B 3QCUL 3D9AL 4HKBB 3FSAA 3UP6A 1HK6A 1EO7A 1I7ZA 4RGMC 5C0FB 2OMUA 1B4JL 1RIUH 4JLRA 1JL8A 4DP1X 1ULVA 5DVLA 5E9DB 4PP2B 3VM5A 4RMBA 2ZWZA 3QR2A 1BLIA 4WFEE 2ZWSA 4MMYA 5E0FA 3W39B 3VMOA 3D51A 3WFBL 5B7EA 3TBTB 4N6RB 4N2KA 2XX1A 4P5TD 5K39A