2OMWB

Crystal structure of inla s192n y369s/mec1 complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
b'GPLGSWVIPPISCPENEKGEFPKNLVQIKSNRDKETKVFYSITGQGADKPPVGVFIIERETGWLKVTQPLDREAIAKYILYSHAVSSNGNAVEDPMEIVITVTDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Internalin-A
molecule tags Cell invasion/cell adhesion
source organism Listeria monocytogenes
publication title Extending the host range of Listeria monocytogenes by rational protein design.
pubmed doi rcsb
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2omwB00
4APXA 3LNIA 2WD0A 4XXWA 5KJ4A 3LNDA 5JYMA 3Q2LA 1WYJA 4ZMLA 4AXWA 4ZMTA 2EE0A 2OMUB 4ZMNA 3UBGA 4NUMA 4AQAA 1NCGA 2OMWB 5CZRA 3LNGA 3Q2WA 3Q2VA 2OMVB 3K5RA 4AK1A 1WUZA 4ZTEA 2O72A 3LNEA 4APXB 2WHVA 4ZMWA 1SUHA 4AQEB 3K6DA 2WBXA 4ZMYA 1EDHA 1NCIA 2YSTA 1FF5A 2OMZB 3PPEA 4ZMXA 5JYLA 2WCPA 3FF8A 5CO1A 2YQGA 3K6IA 4QD2E 3FF7A 1ZVNA 4ZMVA 2A4EA 3LNFA 2OMXB 3K6FA 1L3WA 4ZMZA 2OMTB 2QVFB 4ZMOA 4NUQA 5DZVA 3K5SA 4XXWC 1ZXKA 4NUPA 3LNHA 4NQQA 1O6SB 2A4CA 4AQAB 1NCHA 4AQ8C 3Q2NA 2QVIA 4AXWB 4AQ8A 4AQEA 4ZI8A 3UBHA 4ZMQA 3MVSA 4ZT1A 1Q1PA 2V37A 1NCJA 2OMYB 4OY9A 4ZMPA 3UBFA 1OP4A 2X2UA 3QRBA
chains in the Genus database with same CATH superfamily
2ATPA 4XNYH 2JWYA 3MPCA 2FT6A 3FQ1A 4HXBL 3O2VH 4Y4KA 2D9QB 4U1KA 1ZD6A 5B1JC 2YD9A 1QEXA 4LSSL 2CGZA 4CVZA 1HXYB 2EEDA 1F42A 1HL5A 3IS0X 1U4EA 3UBGA 4PJ5E 2QQLL 5FW8A 3OX8A 3OD3A 4RGNC 5E51A 2WK2A 3VXSE 3ULUL 5J11B 2HLFC 1XF3A 3QQ4A 3KE0A 3DX4A 4H13C 4ZFGL 4YMPA 4H88L 5F3HB 2O6DA 4F58L 1Q72L 1QPKA 1RJYB 5FS5A 1KBBA 1A6ZA 1JWSA 4M3JA 1MJ7L 2D7NA 4PRPA 1WBXB 1GGTA 4X4KA 1CT8B 1L5GA 2OYPA 3M6DA 1MJUL 1NBZA 1U2HA 1G5GA 1YA5A 4NO0A 4RNRB 4NZJA 2ZG2A 3MREB 3DGCR 3ET9F 2VDOB 3ILEA 4Y5VC 3OZ9H 2FHCA 1JZGA 3WFHB 3WDHA 3VXME 4X9BA 3TNMB 3TJHC 3QCUH 4U31A 2YQ2A 3ZIYA 3RYMA 1EXHA 5KYWA 4KX7A 5I1JL 1OXYA 5DK2B 4BK5C 1I31A 3GIZH 5EU5B 3WIHA 3WIFA 3WCYA 4RQQB 2WZPD 1RZIA 3DJSA 2J6WA 4JZJA 5KYYB 4PJHA 5C0FA 3KPLA 2UYLA 4JY4A 4CMHC 5A2FA 4R9HA 5FGCB 4OF5A 4WTXA 3TBYA 2CGYA 2GTQA 1CI5A 4KX8A 1G7HB 1RP9A 2FX8H 3L3JB 4B5EA 4O02A 5CIPA 1AZUA 1E5YA 3APNA 2HJFA 4XI5D 3SBQA 5HHPB 2FEDC 4WI6A 3CSYB 1DL7L 3PWVB 3QHFL 3HNVL 1WICA 1MFEL 3MFFA 3LKQB 1EMTH 4LCWB 4RH4A 2ZAIA 4WJG3 2YK1L 2ROYA 3EH5B 2VDKB 1DQQA 1KGIA 5TDPB 2WZPA 2VDRB 2ICWA 3HC3L 4PTUB 4JPWH 3VVWA 1BX2B 1W72B 1YEHL 3MRGA 3V5DB 4KRNA 1DVSA 1DL7H 3O2DL 1DUZA 5KWYC 1BMGA 3U79A 4ABVA 4MGXA 4PS4L 43CAB 3QXAB 4JHWH 3VFGL 3P1VA 2WSPA 2X40A 1L7TH 3RDTC 2MMXA 1XSOA 3L4UA 2UYLB 3BDYL 3P69A 4NZRL 1GOHA 4TQEL 2I07A 4GIOA 1MHEA 3CXFA 4HKZA 3P9MB 4XP9L 4NKMB 4A38A 2KS0A 2WKOF 1VFUA 3FO2A 5I1AA 5C0BD 2C34A 4ETQB 5C09A 2YC1A 4F8PA 3QFDB 4OGZA 5L4IA 2K4AA 2UXVA 3NT0A 5D1QE 3OKMA 4XHJC 5DS2A 5M95B 3EFFB 1ETB1 4AQAA 3T6VA 2VW7A 3FT4A 4DVBA 5MP6H 3RHWK 5DFTA 5E4AA 2PTTB 3U4EB 1QHPA 1AKPA 1FWXA 2DIJA 4LLWA 4PSRA 4GRLA 1RIUL 4BH7B 2HVKA 5E4EC 3SKOA 2Q3XA 3QEQD 1IVTA 4TNEA 3HVNA 1M7IA 3E6FA 1FZJA 3HUJE 3WS6C 4EJ1C 1EV2E 5EUOB 4X5XB 4PP2B 2FIRT 4AIOA 5F70A 2BNRB 5F7MC 3SPVB 3WHE0 3SN6N 1TYEB 2X0WA 1QLEL 5CP3A 3TS8A 1AS7A 3RPIA 1M6OB 4IRSB 5KS9F 1AXTL 2F5AH 1JD7A 3O9WA 2HT2C 5E8EA 3VA2C 4XMWA 3AMKA 1AXIB 4M7LL 4R4BB 1ZGLP 1GGBH 4HK3J 1JRHL 3E8UH 2W38A 4YQXH 2XNAB 5E2UL 1EJ8A 1FORL 4NKMA 3S88H 3S8GB 3HR5A 5LG1A 1D2OA 5DJ8B 3DVGA 5I0XA 2ZKHL 5GS0D 2A4EA 3N43F 5LGHL 3IJ9A 3O11A 2VH5H 1H19A 2OK0H 2OMTB 2VSKB 3QZPA 4KPHL 4AOFA 1IAIH 2X88A 2ZAHA 2ZYSA 3DTUB 3RX8A 3ZSSA 1ZT7B 4Q9CA 3GKZA 1ANUA 5GGQH 4YUEL 1L9MA 3UXFA 4TNGA 3UOAB 1D6VH 3DXAA 1BQHA 1P7QD 2WZAA 1HWWA 1XGYH 2CU9A 2GFBB 1T03H 2VN3A 3EGDB 3JWDC 5JXEC 2F7IA 3C2SA 4UYQA 1UM4H 4LPXA 4XMLL 1CR9L 1FYHB 2D7MA 5D5MF 2P42B 4OD3H 4PBWD 1KTKE 1XF3B 3QQ4B 4ZT1A 4Y5YA 1O5DT 4ZFGH 4XN8A 3D4GA 3D07A 5TF1L 3O6KH 4IOFC 1FVCA 4ODWA 4XX1G 4GQ9L 2ZYIA 1A1OA 2DN7A 4OM1H 2X4RB 2Y1AA 4DP2X 4CDHA 3C5ZD 4X4YA 3BEVB 1I82A 1TTFA 4MNGA 4GAFB 5J0BA 5GZOA 1MRFH 3FQRA 4JFEB 2W5PA 4NBXB 3BGAA 5IQ9A 4MNHA 3R8BB 1ETZB 3DDGA 4XXDB 4BKTC 4N1EA 2NY3D 3B2VL 4JAMB 5HHOA 3M1CA 2DQDL 5AUMB 2X2YA 3O0RH 3LZNA 5KSVB 5E00A 3US9A 4XNQB 1AI1H 2Z9TA 1LDPL 4XBPA 2FT7A 1KCUH 4Z76B 4MRBA 4OF3A 4LEOA 2MNJB 1HL8A 3M45A 3L3OB 1MAKA 3FRUA 2ZWZA 3T6WA 5AL0A 5EOQH 3C5ZA 4KXAA 3Q8AA 4PJBF 3X1FA 1H3PL 5C08B 1KIQA 1TF4A 5F7LB 4CUCA 2PETA 3DSNA 3ETBF 4A2GA 4YXLH 1X4ZA 3VXTB 3FZUC 2XHNA 2AK4A 2C3HA 4NCC1 1WPCA 3NRPA 1YMMD 5GZND 3X3FL 4I9WD 3F85A 3S5YA 3ZE1F 1BMZA 3EHBB 2NNAA 1D5MA 2W8CA 2GSMB 1IBFA 2AJUH 1JYNA 3OLDA 1AIZA 4I9WE 3BD4A 1A3ZA 3C60C 4KO9A 1T0NA 1UVQA 2R0KH 5CN2A 2QSCL 5I66B 1D6VL 5BVJA 5I1KL 5IB4B 1QWNA 3TONA 1L9NA 2N56A 2Z35A 3PXHA 4N9GB 5EZIH 1OP3K 3FCSA 3OHXA 3HG1E 2XTLA 3NSFA 2YD1A 4GAGL 5KSUB 3SBWC 2ZWYA 3NGBC 2UZPA 3ZOAA 1EZLA 3NGBB 1YEFH 1U3HC 3MLWH 2IH3B 2ZKHH 3HG3A 3NTCH 4TRPL 3X11B 2R0KL 4ATWA 3O3UN 3VXSB 4Q6IB 1C5DB 2C7FA 1OCOB 5DJCA 5IOPB 4GQ9H 1NCBL 1VADB 1AGEB 3QEGH 4MNGE 2F8IA 4MA3A 5DLML 4DP5X 4QKXB 3UFIA 2HT3C 3SDCD 1AKJB 3B9KC 4U7SA 5M7QA 1I3VA 3PWNA 1MF2L 1P1VA 3NFSL 3AJ7A 1BVLB 4G8EB 4NKDB 3CZEA 4ERSL 2YQ3A 3BCDA 1U8LB 3AWFA 3GXIA 4AVJA 2LVEA 3ULVH 2DWYA 4WY7H 1R3LA 3TIEA 1T03L 4HJEA 2OS7A 1U8OB 1NC2B 1I9JL 4Q8BA 1IFGA 4L4TE 2VJXA 4BYHA 3QJVB 4BFFA 3UZEC 3KGSA 2ALAA 1MZZA 4FJ6A 5FDYA 4O2CA 4EBQH 2C4FT 4LZKA 1XF1A 1QNIA 4A7VA 3V10A 5D7IF 3C60B 4Y1AE 1FN4A 4RAVB 3S37H 5CFHA 1XZ0A 5IKCB 4EKXA 1N70A 4KGLA 5MEQB 1ED3A 1CVSC 3Q3GA 2DI9A 2GYSA 3NZ8A 3MX0A 1GSKA 3PRZA 3HMWH 4BJLA 3HS0A 4KKCD 1PY0A 4L8DB 3GT6A 2GK0B 1J0KA 5FOBB 1WIUA 1U21A 1U8LA 1P2CB 3EDDA 1EAQA 1HEZB 4HGMA 4X6BA 4Z7WB 1QA9A 2AEIT 2ICEA 3HLAB 1NIFA 2FCBA 2COQA 5CEXB 3QJXA 1ZWIB 2EH8H 5CGMA 1HYSC 1DQLL 1ND0B 4NC0B 3D4CA 4P2RE 4YDVB 4LCWE 5F1KC 4NKQB 2GHWB 3FU7A 4MS8C 3ZSTA 3BKYH 2LW3A 4OQTH 4HGWA 4F9PA 3IRPX 2ARWA 1ZLVH 3O4OC 3VD7A 4HU8A 3KDMB 4EIGB 4UMSA 4PJ9B 3TJHD 3VD3A 3P77B 3U30B 3VE0A 1GR7A 2F53B 2DEWX 3IRCA 5IF0A 2A2QT 1XL4A 3QR0A 1E3ZA 4WI8A 3QG7L 3AS2A 3TVMA 1XZ0B 2ESVA 2X4NA 4M7ZC 4BK8A 3KYMB 1QVOB 1N26A 1RUQL 2P8LB 3WN5C 1M05B 5LAPA 2AQSA 3JV6B 3LVTA 1BVOA 4P4RA 4GSUA 5L88L 1J5IA 4CGTA 5J13C 1SN5A 4ENEC 2VABB 5SV4A 1C5BH 1YNKL 4F7MA 4L1BA 3OV6A 2VL5B 2X2JA 4F1SA 4CRPA 3GNML 2W0FA 3BVVA 4O2CB 4ZSOE 1JOIA 3N9GL 3LS4H 4FTVB 3T0ED 5D2NC 2GAZB 4PHZA 3U0PB 1GKOA 3KLAB 4PRHD 3WL9B 3UGEA 3EH1A 4FZEL 4MAYC 5CHNA 5AVQB 3CN1A 2W9DH 4PJFB 3KPQB 2C9XA 1V5JA 2VNCA 2Y7QA 5CR8A 4DF9A 5L2JA 1JUFB 4UUJA 5EA0L 3IJ8A 3ATBA 4G7QB 2YD6A 1KCUL 1VF5C 2OYKA 4TNVF 2JIXA 1RUML 1J8RA 5MERA 5KYXB 3OAZH 2AGJH 3ARTA 3IDJB 1P2CA 3IMTA 4RMBA 2AXHA 1UA6L 5B38G 1MCQA 2C1OA 2JJWA 3POCA 4UTCA 2Q7AA 3H55A 4MHHI 4Y1TA 3MJ7A 2QJDA 1CLZH 5DS8B 2WKLA 1TZHA 1BCIA 5E4OA 1C7TA 1A5FH 4PN6A 4PJ5B 4ZUSB 5ITFB 1USZA 4JANA 3ESMA 4MZIA 3LAFA 4TV3A 1IO4C 35C8H 3VWKC 2VLKE 4H2CA 3F64A 2ZCKH 3QDGB 3D2TA 3DRTA 1RZQA 1F4WH 1RZGA 2V8LA 3MUY1 5GIRB 5EOCJ 1UGNA 2XYCA 2ZP0T 4HD9A 5F93C 1TJMA 2ZCLL 4KZEL 3IFLL 4HWEH 3KYAA 3E3QE 2YRLA 1J0HA 4OZFG 5EZIL 5C0AE 5L2KA 4GIAA 4XTRC 3VFWA 4PJ8B 5HHQB 3BH4A 3VFVB 4KVNL 2O61A 2Z8SA 2ITDB 4N2EA 1AOHA 1DQDL 3FQUB 3OKLB 1AE6L 4QCIA 3D3VE 3ME0B 1NKOA 3MACH 1ONQA 4MMYB 1HJCA 3QJUB 2R23A 4PH8A 1LEGA 3V55A 4YSSA 3RU8L 1DN2A 2P80A 2J6EL 3EGSA 4MMZB 2EE6A 3WIAA 4FJYA 4LOEA 2EH8L 3STBA 2I69A 1KXVC 1HHKA 4Y8DC 4P2QE 2ED9A 4YSRA 2VMCA 4UOW1 4Y5YB 4Q9RL 5GGRB 2WOYA 2DIBA 3BMWA 4N2MA 2HWZL 4H40A 4R26L 4WDIB 3NSXA 3STZA 3X17A 4CA4A 4IBUA 2XTSA 3Q2CA 5FC9A 5EU6B 3GPSA 3ZDZB 3CBRA 3EBHA 3MUUA 2OJZH 4U2ZA 5DHEA 1XHHA 2EIJB 3LDBC 4LSPH 1J05A 4QXWA 1KIUA 3CSFA 3C5JA 3QG7H 2D03H 4GT7A 1EJOL 4WHYH 5C97A 3PE9A 4MNHB 4XP6L 3VMNA 3KBFA 5EOCH 1BF8A 4KQ3L 3LKNA 1SEBA 4NRZA 2NY2B 2MH4A 4LVEA 4LXFA 1Q9LA 2O4EA 3O6FA 4MA8H 4KRPB 2CDEB 2IDQA 3IPBA 1QR1A 5H4YA 2JKJA 3F05A 5KBLA 1ILSA 2D0FA 1HN1A 5MP6L 3L3DA 2GJRA 5KAQG 4PMEA 3QO0A 3VXOA 3GQFA 3VYOA 3F3HA 4B27A 3BGFC 1UZ8B 1CL7H 3FUIA 1CICD 2A6KA 4YBQD 1ODUA 3RWGA 3NJFA 4ZSOA 4F37K 3K7UA 2IH9A 2C7UB 3BWUF 4X7TA 4OQTA 4P4RB 1UXSB 3W0WD 2X2UA 1C5CL 5JOFB 1HHIB 4N5ED 1SF3A 1KCSL 2BSRA 2EEFA 4PJBE 5B38B 3K6NA 3QUXD 4R7NA 4X6DA 3LKSA 2EDRA 5GS0H 3PL6C 3W5NA 3S96A 3FU0A 1EJ6A 1LP9F 3WKQA 2JJSC 4GW5B 1B0RB 3OQRA 3RX5A 1NZRA 1KN4H 1P4UA 4IOSD 3BAYA 4PJ9A 4HCRA 4JDEB 3ZE2F 1NLBL 1AZCA 4R4BA 4MJIB 2YRZA 5EPMB 2XZCL 2NXZD 3V95A 1G6RB 3GO1H 3V4VA 2FX9L 4XN5A 4KV5F 4XAKE 1JPEA 4FQQA 3O6LL 3F7QA 3VG0H 1FG2A 2COVD 3WIHH 5J57B 1B0GB 3B7YA 3K80A 2OMYA 1P1ZA 4XAKD 4JPKH 1ZS8B 4ZW7A 3S48A 3IETB 1NBVH 1CYGA 2QZQA 2XIIA 4DERA 3U1PA 3GLAA 2X6AA 2QKIC 5FLVA 2FAUA 4NNYB 5IW3A 2OJZL 5GGUA 4KY1H 1RIVH 4Y1AD 4D9QE 2PUQT 2D4DA 3M8OH 3LQAL 4EZMA 3BAXA 3G6AB 4NQEE 3EIFA 3TWCH 3UTOA 2YAHA 1CR9H 1J9CT 4U1NB 3GXTA 4PJGF 5FCUH 5I8KL 3ZKMD 3QYCA 3PV6B 2A73B 2H2PD 4Z7QF 5KW9H 4KZDL 3DIFA 4J23A 1TCMA 1LE5B 4J2XA 2ZPKH 1JHTB 3LH9A 4HXAL 5EF0A 3S0PA 5D9SA 3PUCA 3OC5A 3HCVA 4J1UB 3IDMB 1LNUB 3QUMA 4JFXA 5BRQA 1MDAA 4D0CA 4FP8L 2FNWA 1SBSH 3MXVL 1OT4A 3LKPA 3EO1A 1THCA 3GSNH 4A6YB 3MV7B 5B38A 2H0JA 2N0MA 3BGMA 4JE4B 3N44B 2WUBL 4L4VB 1CLYL 1SLUA 4KC3B 1Q0YH 1MG3C 3WO4C 3VXPA 4XNMB 3MRLB 4M61A 4R96B 2XRAL 1P7KB 3GMNA 2DJ4A 5F2FA 5DO2C 3DK2A 35C8L 4NRYB 4XVJH 5PAZA 3GDBA 1D5RA 3KJ6H 2IV8A 4OGAC 1TO5A 2EKSB 5BOPA 4HDIA 3FH7A 1SFDA 4Y9EA 5AVVB 2AC0A 2EP6A 1GYUA 4AEEA 1F1AA 1MCSA 3RWJA 4EOWL 4YS4A 2Y7NA 3CPLB 1E2VA 4HIEB 4FXKB 4YSPA 1I1AB 5KG9B 3FB7B 5IIEB 3DV6A 3AXHA 5E7BA 1U8CA 3ILPA 2W60B 2J5WA 2JJVA 3WV0A 3KYNB 5T8IA 1I7UA 1HL4A 3CLFH 1HHJA 3D34A 3JTSB 1P6AB 3LZFH 4N2OA 3VX0A 5E70A 3WXWH 3VG0L 3GXDA 3TZVC 4K9JA 1G9NH 4KJPC 2BP8A 3LH2L 4X9IA 3DXAD 3WIIL 4K2UH 4JY5H 5HHVH 3A0OA 4LU5L 1W91A 3D06A 5KVEH 1DVUA 3ARDA 4NJ9L 4FNRA 4KJYA 4L1HA 1CXIA 4A39A 3NACL 4FULA 5CBEA 3MFFB 2AQ3A 2DH2A 4K23L 4M61B 3TP4A 5G4OA 3U2SA 1WFUA 1Y07A 1I8MA 2P5WB 3CNKA 5LWYL 5EU6A 2H0FA 3I85A 3B9VA 1DSYA 3MLYL 3VRJB 3GMLA 3WY1A 4D0CB 5BVPL 3AABA 3ISWA 4NZTH 4TRPH 3VD0A 1DJZA 4JY6B 1YPZA 2CLZA 1TXKA 1I1RA 2PWHA 1ZLWK 4NJ9H 2Y2TA 2Y3NA 5CINL 4NFCA 3O6LH 2XVGA 4LIQE 1UD8A 5D7LB 1BG1A 3ARUA 1OB0A 1IC7H 1SBBA 4G6MH 4IIQB 3AREC 4G42B 5B4MC 4Z7NB 4QO1A 1Q4NX 3MO1B 4PGCA 4RMSA 2IWEA 4U05A 1MCHA 3KYOA 3PIQB 4E9QA 1OCWL 1JBJA 2Z92A 4KH9A 2DLIA 2NSQA 3EG9A 3MZTA 3RGBA 4G5AA 3U2IA 3ARBC 2IH1A 4RA0C 5BRZE 4RDQG 3EGXA 3KPSA 2X10A 5BO1L 5L6YL 2BHFA 2WWNA 4KRPC 3QJZA 4PJDE 3KJ6L 1KYOK 5D7SH 4O2FA 2YAPA 1FVCB 3HAEH 4ODWB 2BFGA 3EFDH 1S3KL 2NSMA 5EZLA 3T8MA 4WHCA 5BV7B 1PX8A 1ZSDB 3TEYA 1OCCB 1TSRA 3US0A 5GZNA 4NWTH 1V3KA 1YMMA 4HEPA 1N5AA 3DUSA 4NQUA 2JXMB 4LDOB 1I3GL 3FFCE 4PJEA 1EO5A 1M71B 3OX8B 2EYSA 4BFGA 4OJYA 4IIQA 3AY4C 3B9DA 1UUNA 1EBAA 4JKNA 5JZ7D 4AQ8A 5D2LE 3MREA 5IT2H 4ZO9A 3O3EA 2EDYA 4IRZA 1H6UA 1ZSHA 1GOFA 1JPFB 1FH5L 1GS8A 1WAAA 3BIKB 4U6HA 4CMMB 4OCLC 2VDKL 2FBRA 5HBBA 1BLIA 3LSOB 4LO9A 4H8UA 3RY6A 4A7GF 5FGBC 1G84A 5AG9A 1N4XH 5E6UB 2EDLA 4OB5H 5INCA 5GSVB 4H8VA 4P2QB 3MRKB 1BFOB 1LP9A 2FSEA 2OCJA 4IMKA 3SO5A 2WY3B 1CI3M 4MJIE 3QUZD 5IQLA 3HRZB 5TE6H 5KJRL 5BRPA 3NOIA 4DKAA 3NA9L 1J8HD 1QFWM 2UX6A 3MBXL 4YSCA 2CDEA 2XZQH 4L37B 4YOKA 3SDDC 4LHUB 4CSZA 4XMTA 3EFOB 3L3DB 4DHLA 3C6SB 1IC0A 3VD2A 3H42L 4Z7WF 4GO8A 1XWVA 4WUKH 1F58L 3VFMA 4DGVH 4CSTA 1HCVA 3ELQA 2CE6A 4UNIA 1F2XK 1NDTA 2HRHA 5H8DA 2OR7A 5GJSH 3WS3A 3DV6B 5HHME 3BQUA 2YFOA 2FR4B 1MNNA 3CE1A 3EYOB 1T1WA 4U1SA 3QA3A 3MLYH 3S35H 1K3IA 4U6VH 1QTSA 4FNUA 1LO2L 2AEPH 3HFML 4BFOA 4U3SA 2NY6D 3UC2A 3QIWB 5ABAA 1FNEA 1YNTF 3B7UX 5DD6A 4F8OA 1JUFA 5LBVA 3ZGIA 3K6DA 4DZBA 3TEUA 3E80A 2BZCA 1G4MA 1OARH 3TH2T 4TF4A 3D52A 5C8JA 5B1AB 1I8KA 4V33A 5BZXA 2ZOKB 3KPPB 1OB1A 1BXUA 3G6JB 3PGCA 5TDNB 3F58L 3SYCA 5B3JF 1UA6H 5DEFA 4IEFB 3R4RA 4F2FA 2XN9A 1AJ7H 4Q58C 3CK0H 2TSBA 4GKSA 1RUKH 5T1DH 1QSED 5I30L 3AROA 3WKMH 2TSAA 3ESNA 4KWUA 3U82B 1SDYA 3CFNA 4GRMA 3WTXA 3CFJB 4L0YA 2CZNA 5LGKA 3FQ4A 4DH2A 1OAQL 3IF1A 1DBKL 1X5MA 3PQYD 3A6OA 1O5PA 4F91B 4HUXA 1JZFA 4BCZA 4CSPA 3UAEA 4KTEH 4X5RA 1BQSA 1JWMA 1SXSA 2XWDA 2YD2A 2V6HA 4PWEA 4LLDA 4ELMB 4FEIA 2GJ6D 4XNZC 5F7UA 4R0LA 5I2IA 1NEUA 4K55A 3H4HA 2HPTA 1WV7T 1UD6A 5EUKB 4YWGL 5KBNC 2G5RA 5I82A 5IB2B 1JHLH 3QPXH 1KGWA 2W59A 2BP5M 6PCYA 1A9EA 2Y69B 5DJ2A 3RTQB 1ZLUH 1DVQA 3PJLA 2ED8A 2X41A 4OY9A 1QO3A 4UU9B 1INQA 1KNOB 3I6KB 3ZMRA 5C9KA 2LAGB 1QA9B 4RX4A 1S8DA 1R24A 5GRWA 1T22A 3JV0A 5CLXA 3WIFB 4QOKD 1IAOB 3GKWL 3VSVA 3MODL 3RVWD 3TYGL 5D72L 5SX5H 1YUHB 3BO8A 5I75C 2EDXA 1G5AA 1TEYA 4YXKH 3TT1L 3WFHA 2YN3A 4EI6A 3DX7A 4QRPA 4HK3N 2VDNH 2VLKD 5EO9B 1XGPA 5D1ZC 3D48R 2QSCH 2B8OT 5D71L 3MBXH 4JRYD 1E4WL 2O30A 5TPWH 1ZT1B 2DQJH 2I5YH 5EOTB 2HN7B 3FSOA 4LSTH 5IW1A 5GGTA 3L3HB 4WK4B 4GKSB 5K9KA 4J3SA 2F7QA 4BKLB 4DN4H 2IDCA 4IKIA 2NW2A 2HSIA 3Q6GL 5F6HI 3GEFA 1BFOA 1LP9B 2W94A 3OC8A 2Q0ZX 2X09A 1JI1A 3OZLA 4C56E 4Z78B 1UOVA 3AADB 4H20H 3DI3B 4PWGA 3S3JA 5CGTA 4XMUA 3UAJA 4HEPG 5BXFA 3P4MA 5IEKA 3GI8H 1K5NB 1TQSA 2GI0A 4P4KB 4PS7A 3DX1A 3RIKA 5JORB 1R5VB 1HXYA 4QRPD 3LKOA 4YR6B 1E8ZA 2QPFA 2K8QA 2IC2A 4HBQA 3KVPA 5B3SB 4Z7NE 5EC2A 1IBBA 1NGXA 1MFAL 4HWBL 3PDOA 5CEYB 3C9NA 1KCBA 1CDJA 1KYOJ 1AZRA 1IB5A 4E9YA 1KF9B 3P2BA 3JTBA 2O5XH 3B6SB 1RERA 4F8TA 4TTDD 4PGZA 5FYLL 3L9BA 1X6NA 1KTRL 3GSXB 1MW3A 5I9QC 3ARVA 4HUMB 3EBIA 1XH3B 3CVBA 5ESAB 2FVNA 2WYZA 5IM7A 5ID0A 2DLHA 4H8PA 4IRZH 5I5RA 2ITCB 2NY1C 4M48H 1ED3B 4V2CB 4L8SC 1MCLA 1IQDB 1U93B 2XV6B 4D0BA 4X0KA 1R17A 1PEWA 3WTSA 4HJ1A 1VEOA 2R15A 1HAUA 2OMZA 3ZTNL 4N5EC 5DC9B 5IGXH 2X2HA 2L7QA 2YUWA 5AENA 1EEYA 3IJHB 2F5BH 4E9XA 3ZDZF 4ABWA 4EI5D 4ZDHB 4HALA 4RFNB 5F1IA 3BW9B 3ARED 3JWOL 5B4MD 3DSNB 4XBEL 5L2KB 3UDWC 4Y88A 2L4OA 1W8OA 1REIA 3SGJC 1YYML 2ZSWB 3VWJB 3JVGA 2Z1PA 4XE0A 2ZONA 1QQDA 4NT6A 1LILA 2VDMH 4FQXB 5E1QA 3ZTNH 1DEEA 4PJCB 2PO6C 2H26A 3DJRA 4ZOCA 4N87A 2PTUA 1VGEH 1BBDL 8CGTA 5JYMA 3U4BH 3H4FA 2KZBA 4FKKA 3DOSB 2DM3A 4PBVC 4JHWL 3VFGH 4S2SA 2JB6B 2XWJB 1KGUA 5IOPA 3TT3H 3Q1SL 3AY2A 3H9YA 1RD6A 3SDYH 4NKOB 2ICWJ 2PCPA 3LZOA 4Q2ZA 4WF7A 5C7XL 5KYXA 1UG9A 1CDCA 2CJUL 5IK3A 2X6BA 2JKSA 3SJVD 4U7KA 4C4KO 4UQBA 1IIKA 1ZJBA 1NIDA 5E99L 1P5VA 1YC7A 2HX7A 4X6EA 3RL2B 1G87A 5IG7A 2EE3A 2GY7B 1TZGH 3HBQA 4KTEL 1RIUH 2R4SL 4UF7C 3RWFB 4LHUA 1IM9A 5DU7A 5C0CB 2Q3ZA 2JVUA 1DJXA 5SV3A 1WFJA 3U36A 4G6JH 2VDLL 3PFQA 3WFCH 2XTJC 1YEIH 4EUPH 1H3GA 5G2NA 3V5HB 1IBZA 3RZCA 1Z32X 1M9WA 3O45A 1UFUA 1CXHA 5IW1B 3WEOA 3CFTA 2V5MA 5EZOH 5HJBA 2BH0A 2R69H 3BAEH 4JO4L 3DO4A 1CURA 5IGXL 4XBMA 1E40A 3O2WH 1ZIBA 4TULL 1MHEB 1A2YA 2OW7A 5MEOA 1WHOA 4F7TB 4NUQA 2JQAA 4IS6A 3WFDH 3OKKB 5F7HA 3ROOB 3UCQA 4AYSA 5I1EL 4P2RD 1B0WA 2IGLA 3HG1B 5EBLB 5TF0A 2ISDA 1BGXL 3IU3B 5T3ZE 1WT5C 4AQAB 5ICYB 1MREH 1NPUA 5AVTB 3BJLA 1AG6A 2VDNL 1WZMA 3BWAA 2CGRH 1TJGH 4PPTA 1CGYA 3IJYA 3OMIB 3JTTB 9CGTA 1SXNA 2L8AA 2UY6A 3DUUB 2YZ8A 4FFWC 4QXGH 4UM9D 2O6FA 2PO6D 2RFXB 4Q4IA 4NAJA 4OLWL 4XCNA 4C4UA 1M7IB 1CFSA 3E6FB 3QXUA 3ZKXB 1W0VB 4YGVB 3REVA 3SYPA 3VGGA 1KJVB 5IEHB 3O11B 1KEMH 4W70A 4A55A 3L9RB 4ANUA 3LMJL 1SYSB 4XAWH 5HHMB 1FGVH 4LCVA 5AQ0A 2MEJB 4TYUA 4MKTA 5HHNB 3A5VA 2ZOLB 2RA1A 2CO2A 2WYTA 4RETB 4TQ8A 2MCPL 3BD5A 2ATKA 2D3VA 3CIQA 3KPOB 4TNWF 3IGFA 1H9DA 4FXGB 3EHBD 3DPBB 3RL1B 3VCLA 3AZUA 4ICXA 5J12B 4FTVE 3MRCB 1M2VA 1ZGLM 5DYOB 3I9AA 3BRFA 3KPRB 3HZVB 4OLUL 4W81A 3ZXAC 1MJ8L 1JGEA 1KJ3H 1XH0A 1SMOA 3NZUA 1T21A 3QDMB 3QNZA 4JR9L 2JCCA 2NDFA 3T8XB 2WLNA 2F54A 1SXAA 3UPCA 2H8PB 3NH7H 2IEPA 4Y4FA 3T9WA 4RMRA 1PAMA 2EYSB 4V1DD 5HP5A 3T0AA 4L3CA 1JZHA 3HI5L 1IJNA 2R0ZH 4FLSA 3NFSH 4GI6A 5GS1A 2YPVA 2BOBA 4H26B 4JO8A 4PJCE 1J87A 2IAND 2A6IA 1P7KA 5AAMC 3O6ML 3LEVL 4EZKA 4MS8D 1EDHA 4UDUB 2D7TH 2LLGA 3KR3H 1RY7B 4KDVA 3WNMA 4U7MA 1OSZB 5CJXA 4HSCX 5KVEE 3SE4C 4LNRB 3NN8A 5ANME 3RNQA 1KXQA 5C07E 4IBYA 4GXUN 3DDFA 1LVEA 4JDVB 4UILL 3SDXF 1JK8B 4BM7A 4ZYKB 1WZKA 2E74C 2NX5D 2G2RB 2CM6A 1J48A 3ECWA 2CQVA 3WNPA 2XG4B 3FQTB 1X7QA 2OBGA 5DFVC 2E7MA 2GIYA 5IMLB 5DMIH 3H42H 5IMOA 4UOZA 2YC1B 4HK0B 2BDNL 1SLXA 4MWFA 4UAOC 3WNOA 1CC3A 3LXCA 4WV1A 4AG4L 3FUFA 1K8DA 4X2UA 2NTFB 4U1NA 3UBXB 5AB2A 3OAYK 1FNGB 4QF1B 4QHUB 4GRWF 1HQRB 4F92B 3OLIA 3RY4A 5JIQA 3UAJC 1NAML 4BRJA 3HW7A 4NO2B 4ZQTA 3QIUB 3WD5L 5ACMA 4OV5B 3F6JA 3C6LB 2PCFB 2CKBH 2BCKA 3S88L 3GI9H 2VIRA 4JQXA 3QIWA 5BO0D 4P5MA 2ZSVA 1MEXH 5B7FA 3ZQXA 4HJGB 4YDNA 1TNMA 2WLIB 3M1OA 3KLLA 1UXWA 3FO1A 2ESVE 4BZ1A 2WZ0A 1DJHA 3BPNB 1TZGL 1G4RA 1B9KA 3H7LA 4ODVL 4DCQB 5KSAA 1AP2A 2FQDA 4FMVA 1AO7B 4F5CE 1XGRB 2EEAA 2ZXDA 3IXTB 4LVHB 3HFFA 4PLJD 1G7IB 5ALCL 4BH8B 3NJHA 4AGQA 5I16A 1HK6A 2PR4H 2EQDA 3D51A 4W9LC 5D1XD 3P0VH 1VAHA 4K07A 1UGKA 1L7IL 3D0VA 5GGSA 3HVDA 5EDXA 4ZW6A 3OL2A 4BZ1H 3A4FA 4DK6A 1X5XA 5AAMA 3TGXA 4MS6A 3X13A 2HMID 4N2GA 1QATA 4U1LA 4XB7A 5BS0B 2CA4A 4NO3A 3H9SD 3UJJL 1NSNL 2G30A 3LKRB 4AL8H 4KROD 4OIIH 5LAXB 2JI2A 1OGAE 2DBJA 1UJTA 2J4WL 5EBMA 1ZHLB 3BUYA 3QI9B 3U6RA 3ULUF 5D8JH 5DD3L 3VVVA 2OL3A 3FHEA 2PWGA 1X9RA 2XT1B 4Z7VB 1W9XA 2QKSA 2JI3A 4KRMB 4Q97A 1IGJB 4M3KB 3JWNE 3U46B 4FQJL 4FZ8H 2VSMB 1R19A 2APVA 3FTZA 4DZ8A 5DD1H 5F3HA 2DAVA 1X3DA 4JG0H 1AZBA 3FUKA 5D72H 4IRSC 2YD4A 2B15A 4JS7A 4XNDA 5JZ7C 4OIIL 4ZD3H 3DETD 3TO2B 4L4TA 5T3XE 2UZXB 1B6UA 4NSKA 4RAHA 1O6TA 3S5ZA 3QAZB 2H1PL 1ILUA 3G3LA 1SJVA 2ZF8A 4AGOA 2ZCKL 3P4LA 5HHNA 1I75A 5HI4C 3V6FB 4A7UA 1ZVYA 3LS5H 1BVKA 3B83A 4UIMB 1G7PA 3H7BA 4HPYH 3ZZLA 1EGJL 4FQHA 3UERA 2PMZA 4EN3D 3SPVA 5D70L 1TEGA 3AFLA 5CZVL 4YHYC 3OQ3B 4FHJA 1JNLL 5DVPA 3FFDB 5EU3B 4G59C 3GJFB 4FQ2L 5FB8B 4IOFD 5D96B 4JKPL 4WNQA 1MAML 2CO1A 5CZKA 1K2DA 3EOTH 3UBXI 1F4YH 4RQQA 4Y4HB 2R83A 4ZFQA 5I17A 1A22B 2W0LA 2YPVH 4GMTH 1S9YB 5HDWA 3DLQR 4PYHA 3GSOA 1T5KA 2VZ3A 5EA0H 4N85A 2VXTH 2GKIA 1BBJA 3L2MA 1RUMH 2X4UB 4TNWK 2FEEI 3QYMA 4YR6A 1NANH 4AMKL 2HG5A 3TH3T 1OVZA 4URTB 3QC6X 3P4MB 5IEKB 1X44A 4DGYL 1AY1H 3TA4D 2ZXEB 5IQMA 1CVRA 4ANXA 2CHXA 2N1TE 5JORA 3RILA 4MTMA 4LRIC 5FUZH 5TE7L 3FTVA 3LRSB 1R0AH 2EO9A 1HQRA 5FYJU 3GMMA 4ONHB 2QSVA 4PRNA 2AK4E 5DVMA 1NAKH 2R7EB 5FECA 4WUUD 3PGFL 4FG2A 2YAOA 1U41A 5BZDA 3L54A 4HJTA 3MRJA 4DO6A 2WO4A 4IOIA 4N0YL 3LNGA 3F65A 3LPFA 3TYFA 1FFNB 2P5PA 4YDMA 4MQXD 5GHWH 4PJGA 5PCYA 4NUJB 3CVHB 3X14A 4I0PB 3DV4A 5JXEA 1XFPA 4N4YB 3QQNA 1QSFB 3FQTA 4DOHB 4WTWA 5DMIL 4FHKA 1L7IH 2AV7B 4GUPA 1WC7A 5B1KA 2VN4A 2WXNA 5ESAA 3DX9A 3WJMB 4PJFA 4I7ZC 2HT4C 4ZZFA 1G43A 3JYCA 3BSZL 4U1KB 4F93B 5FUOL 1BAWA 2GT9B 5CBAB 3PXJA 5I1LA 2H6OA 4Q0XH 1C12A 2AVGA 1YCSA 4XCNB 2BOLA 4W9DC 2MWCA 5ECGA 4AV0A 1ZGLB 1PZ5A 2BMKB 2P49B 3P11L 3GBNL 4O5LL 4HPYL 3SE9L 1XO8A 4N0FA 2BSTB 1BZ8A 1IKNC 4PR5A 3QJSB 4D7PA 5EIIA 3G5VB 2NLJB 4XVOA 1XGUA 1OT1A 3VXRB 4APQD 2NRDA 5J89A 4X4XB 3CVCA 2JCCF 4XZUA 4ELMF 2GK0A 2RALA 4EVNA 2CCLA 3EH2A 3PWUB 1IZJA 3S96B 2XZCH 3ARBA 2D31A 2W65A 5I1JH 5I71C 2RCSH 5JHDB 5EO1B 1YQ2A 1N64H 1Q9OB 3IGUA 3Q0HA 4WLCA 5D1ZB 1J0ZA 1T7YA 2DKUA 1QD0A 2F8VA 1JZ4A 2BIQA 3DX9B 4NO0B 4KGJA 5C0BA 3UDWA 4IIQC 4YAQB 4EDWH 3SHSA 4MJ6A 3UTSE 2YPLA 4MA8L 2EXTA 5EZJA 1SQ2N 2ZP8A 3NEXA 4KHTH 1GHFL 3FB6A 1IC4L 3PP3K 4A2EA 4UB0L 5FFGA 2A9NL 1A3RL 1FE8H 1VEMA 2BS9A 4KJPD 3HR6A 6PAZA 2NYYD 2XV3A 5J9PA 2ETWA 1HQ4B 4K5LA 1CL7L 4RVBA 3N0AA 1FYTE 4FQ2H 2XQBL 4MB3A 4KAQL 4B53A 2GI7A 2L0DA 1HZHL 2QFPA 3H54A 4QMEA 4Z7IA 1ROWA 4HAKA 5D7JC 5DGRA 5GGUB 4G6JL 2KUTA 2WW8A 4NP9A 4F58H 4UZUA 3UO1L 1QZ1A 2FJFA 4Z8FL 2Y0SA 1NWOA 7CGTA 4JFOA 1A7PL 1U8QA 3QNXB 4IU2A 1HHHA 4NN5B 5BV7L 1CFTB 3PUUA 1DQMH 3MUHL 3W2DH 1O7DE 2WQ8A 5C0GA 3AQXA 3BE1L 2FRGP 5ADOH 5I19H 1FLRH 4HCIA 1W6WA 1KLGB 4MCZA 1TYRA 2WINB 1MVUA 2H47C 4XPFH 1BVNP 3AREA 2QADC 1OGSA 1KC5H 1VPOH 1UA7A 1I7RB 3GBLA 1BFSA 4OH2A 4WY7L 4E2OA 3BZ4B 5TQ0H 4HMDA 2FNBA 3KGTA 3OKKA 4J4PD 3K5RA 3WUWG 1KB9K 3CHXA 3QZWB 4KZCA 1AOZA 2QQNL 5D55A 2YZ1A 5F9JB 4MNGB 4LBEA 4WU5A 4X6DB 2AJUL 4Z0XA 4W68A 3BISA 1KSRA 1SDDB 2O5ZL 1IBGL 2EZ0D 1BWMA 1BJ1H 1PIFA 3O3DB 2AMUA 4P3CH 3TJPA 3K6SB 1GS7A 1L9PA 1G7PB 1CMOA 3AXIA 5T3ZL 4LL1A 1UQSA 2BHUA 4R3SA 3ARGD 4GBXC 3SE3A 5CILL 3ZKMC 3QORC 1DUYA 3FUHA 5K1JA 4OD1L 4JGNA 1EVUA 2ZUQC 3FK3A 1KB5H 4LVOC 4P49A 4M9OA 1EAOA 2R2EB 4DGIH 1X5LA 3VFSA 3VGEA 4M8RA 1H8NA 3MRHA 4JO5A 4JPVL 4IBQA 3VI3F 1DYZA 4K7PL 2PPCA 4GP4B 3VRLF 1XGQB 5KVEL 1DBJL 2ADYA 1WGOA 3GSNA 4PRAB 4JFYB 2GC4C 5A2JH 3LCYA 4XPHL 3ULVE 1P53A 1A6WH 2DIEA 3U7WH 1R75A 1HSAB 4G8IA 3KXFA 1KJ2B 4XE5B 2XBTA 4B7IA 3HN5A 1TVBA 2X9WA 3RZCD 4AQEA 5EUOE 3GSQB 4QJ4B 5JDJA 4L3EB 3UBHA 1P4IL 4P2AA 3E8VA 3CV5A 3PL6D 1ASPA 2Z35B 4HJUA 4RISH 3OPZL 4S11A 1VDGA 1VZHA 4UTAH 3FCSB 2AERT 4KQ4L 4R0LC 1NC2D 4PI2A 3HI5H 3KNBB 4NCC2 4WEEA 4BFJA 4XO5A 2APTA 3PREA 5BOZG 5EEZA 2QPDB 4P48A 1K5NA 1S7UB 4PW9A 1ZHKA 4B9GA 2OSWA 2ZCHL 5CP7B 5KYNA 3D39A 4YBQC 4DPBX 3QVAA 2VDQH 4WFHE 2W0FB 2V17H 1LL1A 3MXWH 1PX3A 3G08B 1FZMB 3JUYA 3C09C 5DO2D 2H3NB 1WEJH 2Y1ZA 1F4XH 3IEAA 3MHZA 4POZD 4CSSA 1QTPA 4OFKA 4DTGH 1A4KB 1RLBA 2BRQA 5F7NC 5L9DL 3KMDA 2E56A 5T3ZH 4LSUH 2OMTA 1T1YA 2APSA 3UZQB 3V4PA 1AGFA 1IM3D 3EF7A 1A4JB 1EHAA 1FORH 3EBAA 4DP0X 2ADIA 1WLHA 3FO9B 3GRGA 1I85C 4X4XA 1KB5B 3NG5A 5JHAA 2DM4A 2NTFA 3GUFA 2JQMA 5J6GB 2PYEA 2K9FB 3VW3L 2H32H 1CFTA 1U58B 3FB5A 1I7TA 4MDRA 4YFEA 4J8RA 2D4FA 2XY1A 3MGTB 5JR1H 4P9MH 2F19L 3H0TA 5MENA 3EYSL 4B9KC 2X4RA 5L7XH 5BQDA 3JTSA 1PCSA 1NMAH 4QAWA 4FABH 1WS7A 1CYXA 3EF4A 4Z7QE 4M02A 1H3XA 1G6RL 2F54D 3I74A 4HWBA 1JDCA 1HQ4A 1FP5A 1HWGB 4X7SH 4KAQH 2A9DA 1MRCH 3AMLA 1D5IL 2J3SA 1XCTA 4GBXB 3HE6B 4H0IA 5K39A 2YSSB 3IDYC 2AK4B 4IMKC 2VLJD 4FLHA 4JX0A 3CX2A 1BAGA 3ZKQD 1J5OH 2PR4L 4XVSL 2O6CA 5E2TH 5EWIH 2EUVA 5DK0A 7TAAA 3V6ZA 1QWUA 4P9HH 3QJTB 5KZCD 2YA0A 4HZLA 2P8PA 1I9IH 3M86A 3ZE0F 1NANI 4Z7AA 4HIJA 1UWYA 1YPZB 4IU3A 2IOOA 3D0LB 5DD5H 3NIDF 43C9A 5I5JA 4EN3B 1S7QB 1WFMA 4QY8A 4W9JC 1I8KB 3QIUC 5BQ7B 2PTTA 3ZE2E 2FHBA 5TQ0L 4YHZL 3AY4A 5IT2L 5MHSE 4I88A 2QQNH 2DWSA 3ZTCC 1CTNA 4HZAA 4KXBA 4XP6H 5HYFA 4XZUB 2DKSA 2I25N 2X9ZA 1CT8A 4Y2DB 1L5GB 2VR6A 3WTUA 1I1FA 4Y4HD 2VLJA 5IQOA 3C5XA 5HGBB 4PJXE 1F4WL 1C5DA 3V0JA 4M1GL 4IYKA 5D1XE 1ZTXL 3TA3D 2E9GA 4YLQT 5F7FA 5CKGA 1E7VA 2HLAA 2PN5A 5T3ZD 4OZFB 4MD0A 1CXKA 3EOBA 5TE6L 5KVGL 4HJJL 3DVNB 3NPSC 4BWUA 5D5ME 3MRMA 2OJEA 5E6ID 1M53A 4ZUTB 4ELMA 4IBWA 1FL5B 3PAZA 5KVDL 2ESVD 3FOLB 1OY3B 4HDIB 4X8GA 1PCXA 1NGZB 3MRLA 1OLLA 1MFCH 1Y1UA 2QHRH 1VFAB 4NN7C 4N28A 1MHCB 2Q76A 3US1A 4MA7L 2RACA 4R4FH 4PS3A 3I75B 4P3WA 5DVKA 3SKJL 5JHMA 1QFPA 1RH8A 1HH6B 5IVOA 1Z3GH 3KPMB 1KCRH 5ESVA 2YLHA 2VGLM 1OGAD 3P30L 4U1IA 4CGUB 5CCGE 5TK2A 1ZDQA 2V5RA 3ZHDA 2BP3A 5A16B 2AS5M 5D2NA 4HIJB 4XH2B 3RQ3A 1YEKL 4WU7B 4OI8A 1M1SA 3CDZB 4RISL 4XVSH 1UKQA 2ZOUA 2XXGA 1FLTX 1OARL 5E2TL 2E7LC 5BJTA 2VERA 5IFJA 3LIZA 1LMKA 2X4PB 4PTUA 4M7JH 1NUDA 2J21A 5LNGA 5DUMH 4TUKL 4HV8A 4QRFA 4ERSH 3B1UA 4UTBA 2HT3D 4A68A 3MV11 2WXLA 3PWPB 1S5HA 3ARDC 4LCIL 4XAWL 3SOBH 1MWAL 4UOW0 3NDZE 5ANHA 4OD2A 3JVFC 5HXMA 2ZUUA 1UOWA 2CK2A 4LVNB 1MELA 3N44F 1RUPH 4OZGF 1JGDB 2PW2B 2DQIL 2DEXX 4U6VL 3VWKD 3N6YA 4OZFA 1O6VA 1IT9H 2QTVA 2AJZA 1E8WA 1OQXA 1RURL 4DO5A 4HXAH 3KGRA 3FBKA 1P9MC 1WQVT 1A6ZB 2IDSA 4I0PA 1RJZB 5EU5A 4DVBB 1B0GA 1MZYA 2QQKL 4NN5C 4Q6KA 3P73B 1NOLA 1USQA 4HS6A 4G6AD 1ZS2A 1J1OH 3QPXL 5E6RB 1CDYA 2YMXH 2Z31D 3KBPA 5C0AB 3KJ4B 3VH8A 2KDYA 4Z6AT 2VLLB 4HJIA 3QUKA 4PLOB 4Q0XL 4QJ5B 3N1MC 1FVEB 1JV5B 2B1HL 3QI9C 4HH9B 5EUOF 1CJYA 4TSCL 3S97C 1R3KB 3K1DA 1VZIA 3SDCB 2DMKA 5FYKU 2CUMA 1U30A 1J8HB 3HMXH 1E27B 1SLWA 2AXGA 2CG9X 1G0YR 3SKJH 3STLA 5JQHC 1P4BL 2MOGA 5EN2B 4FLRA 1EA9C 4FABL 5MEPA 3BYYA 3N41B 4Z5RA 1LQBC 1I9RH 3II3A 4XNUH 2NY3C 3MYZA 4XMZA 3S9DB 3K8KA 4AK1A 5HY9B 2Q3AA 2ICEC 3QORD 1J1XH 5FCUL 4LP8A 2XTJE 2QBWA 4XN7A 4WHYG 3RWEA 3RVXD 1R34A 1F41A 1CD1B 2Y9RT 1J5OL 2P5ED 4BUGA 4ZTPL 4Z3EA 4ZUUA 1S7VA 2EZ0C 1I3UA 3N0PB 4ALAC 2Y5TA 5DZJA 3C60D 2VC2H 4NQDE 2BNUB 5DGQA 5F8QC 3D85A 4GINA 1WWCA 1JV5A 2VYRE 5I16B 1U3HB 4D94A 4L1LA 1P5UB 3CPLA 3GSNL 1X9QA 2XQBH 1TMQA 3ARGB 5C0CE 3VGHA 1SEQH 4L3EE 4BFBD 3K6FA 3STLB 3ABKB 5J6HB 4WWKB 1MCBA 4FYSA 1NBYB 1XEUA 2RR3A 3CHQA 3VNZA 1PS3A 2CLZB 4OUOA 4QGYA 5EU7E 2P5EA 2JCCB 4U1GC 4P46A 4QRUA 2OZNA 3ULVC 1FVEA 1ADQH 4OFPA 4P4KA 4NJAH 1FJ1A 4WNJA 3Q1SH 1RK1A 2DWDB 4FTDA 4OVVA 4EMZA 1NFAA 2QVIA 3ECUA 2Z4TA 1ZA3B 4KO5A 5T3XD 2NYYC 1OAKH 4S1SH 1I8MB 3HRZC 1EEZA 1M7UA 2VZUA 3MLUL 3KHOA 1DANT 4UBDC 1L6ZA 3HZMB 3CX5K 4Z3JA 5F89A 4Z0XB 2Y23A 4HV8B 4HOMA 3C5ZC 2NMSA 3MJ9A 2IGFH 3BXNB 1S9WB 5HI5D 4A2FA 1TQBC 2J57A 5LJYH 3FCTB 1AD0A 1PKQB 2OMNA 3TBCA 3O6FC 4E9RA 3UPRA 2OI9B 3QEQA 4LBEB 4CN6A 4DAGH 2J1YA 3SD2A 4M62H 2YGPA 2YK1H 3UTTB 1GW6A 4DPRA 2A9BA 1AO7E 3ZE0E 2GJ6E 5ICXB 1D2PA 1G7HA 3R1GH 5ESVB 3NCWA 1AZVA 1IL1A 1DBKH 2A74A 4JVWA 5IHLB 1YQVL 3RZWA 4APQC 2JKIS 1JYWA 4ANVA 2OQJB 2F7OA 3NCBB 2GCYA 3BP4B 3ARFC 1MFNA 2ICWI 4RGOL 4LQFL 1KB9J 2OMWB 4K3DL 3WJLA 3K2IA 4C57C 1DANU 1MRDH 2J44A 4X4ZA 3T09A 3VFPA 4JFYA 4TUKH 4G43B 1I8LA 3D8MA 2QVMA 2E3VA 3TT3L 3VI4A 1IC5H 4JGJA 1XGQA 1CXLA 1L9RA 2E7HA 4D9LL 1OSYA 4FL4B 3SPJA 4GFTB 3QJHB 3QHTC 5ABDE 4P57A 3B2XA 3F62A 3I9GL 4K7FB 4N8CL 5I2IB 4A7GA 2ZX9A 2GEQA 1AG0A 2LQRA 4JRWA 5H94B 3V0FA 1HZKA 4K3DH 1M9SA 5EC1B 1XCXA 4ZZKA 4K9EC 3AT0A 4OV6F 4IBSA 4MJ5A 2OTUA 1MI5A 4OAWA 5GS2H 3MV8B 1BLNA 1SY6A 2FJHB 3U9UA 4Y89A 1A0QL 3LN5B 2YPLB 1F6FB 3DX7B 5GRVK 3NIDE 3HS0B 3NJGA 4KNUA 1R3LB 4QDGA 1U0QA 2ZUSA 4MQSB 5E95B 2QDWA 4P3DB 4GSQA 4D8PA 1YUHA 1S7WB 2D7QA 2YRBA 2ZX7A 2WXIA 4NNYA 3HPLB 2C9VA 2VLMD 2X1WL 5HPOA 4JK0D 3FU7B 3ZKND 4G43A 2DDQH 3IETA 2VITA 1WWWX 4QGTA 4KQ0A 4K9EL 3KLQA 1Q90A 1RFDH 2VXQA 1U8PB 3O2WL 5A2LH 2QVKA 5E2VH 3AS0A 1FG9C 5F7KC 5EN3A 3MLXH 1JK9B 3MUGB 3VXMD 1BIIB 5HGAB 2VM3A 1XH1A 3HOGA 1AR2A 4OB5L 3EJJX 4BCXA 1MWAB 2CHWA 2M26A 5J7CC 1AVAA 2VISB 3ARQA 4CW1B 1U92B 5E9DA 2Z7ZA 4YDLB 5IW6A 2R2BB 5LXGL 1WC7B 5KZCB 4HWBH 2NY1B 4R84A 3WKML 3L5JA 2E76C 4MMZC 1ETJA 2ILLA 3K4DA 1SMDA 4FKEA 4F15B 1PDKB 1UC6A 3BP7A 1D5MB 1YECH 1QMUA 3WJJA 3BAEL 3W1ZA 5JA9A 1QLRA 2WCSA 5ID1A 3FSVA 4ONFH 5E1GA 5J4MA 4GRMB 1IGCL 1VACA 3BIBX 1XCTB 3HMWL 2HTLC 2EE0A 2OMUB 4ZQKA 4N8CH 4AZ8B 3CZUB 2ICCA 2C4XA 3LTVA 3T0BA 25C8L 3TWCL 2NPLX 3TVMB 2QTEA 2XN2A 1UCBH 3RDTA 1HINL 3SIKA 3LN4A 3IFOA 1MRCL 3HKFA 3PABB 4RGND 4TLSA 2GTWA 4IKNA 2VXUL 3P0YL 1DLHA 1KIPB 3GF8A 1T89C 4JO2L 4QRRE 1DVTA 3REVB 4AEIL 1YEHH 3MLZH 4W93A 4ZAKB 4B95C 3JV4B 4RGOH 4O51B 3AQYA 5IW6B 4ZPVA 3SBPA 4I77L 3HAEG 2FUQA 5B7EA 5JQ6L 3H6JA 3MODH 4NRZB 5I73C 2ZX5A 3NJLA 2QGEA 2RCSL 3QWOB 3QJFA 4ZPTA 2A5UA 2ENQA 4BEIA 3SO3B 3FQRB 4JFEA 3P0YH 1R3IH 1KPRA 2BVOA 4QOKE 4WRLA 3RBSA 2DDQL 3CZGA 3HS0C 1MFDL 4X9YA 5HHXL 1TKWB 3IKCB 2G0KA 3D5OF 4N8VG 3SDAD 3RY5A 5CKAA 4I18C 5IV2B 2DEYX 1DBBL 1OGAB 3TFKC 1JG9A 5IB1A 1I53A 3DO7B 3QG6A 4JFFD 3ZRFC 1R47A 3K2UL 4J3TA 1YAZA 3H56A 3GSVA 4XNQA 5I0YA 3BHBA 4QR7A 3F7PC 2GTZB 5FW6A 2WWKT 1KXHA 2GTWB 5HDQH 2HTKC 1INEL 2YD8A 3H9ZA 1QFOA 4YSTA 3N3EA 4HUWB 3QHZL 4HT1H 1AH1A 4QRSA 1HFUA 1TPXC 1DQVA 4TLTA 1TQWA 4F7CB 1KIQB 4WWOA 4QO1B 2B2XH 2DMBA 5F9OH 1ACYH 1IBDA 2IQ9H 5H2BA 1DJIA 1UM5L 4MJ5B 3EYFA 4N2NA 2OM5A 4Y5VA 3HAEB 1XGPB 2H3KA 2I9TB 3ASNB 1ECYA 1ZLVK 5KN5A 4XPFL 4NQCB 2BY2A 2VDRL 2WQXA 1OV8A 3ENEA 3JWNC 2IGTA 5F3FA 3IAGC 4PGJA 3MLTB 2BIMA 5F1NB 3DVGB 3HN8A 4GP8B 2ADFH 3EOAB 1ORQA 1UJ3C 4GPVA 1Q72H 1HXMA 5J6HA 5DDHA 4OLXL 5I6OA 2ZG3A 5HVWA 1IC5L 5F6IB 4UM9B 4OCYL 4MRCA 5BZZA 1YNLH 1ZE3H 1WH0A 4HH8A 2R8SH 2DQGH 2K70A 4BK5A 1KJMA 3BUPA 2ZKMX 1WP6A 2HFFA 2F8OA 4Z0BH 4JVPA 1ZGLA 1L9TA 3BWZA 5AKSA 2W0PA 1JGUL 4NQSB 2UXTA 3KYKL 3OHMB 1K85A 4O4YH 4LHQB 4M9PA 3ZE0B 1ML0A 3WLWD 1CGVA 3CH1B 2HKFL 4FKHA 1Y18B 5JLZB 4L1TA 4YE0A 2R2BA 2J5LC 2WWMC 2FZ3A 1J10A 2XN9D 3GS4A 5TH2B 4EPSA 1D9KA 3HNTH 2I9LA 3SBRA 3TIDB 1DZBA 4HWZB 2Z0BA 2UZXA 1RJCA 1BQUA 4Z95H 4TVSa 2EDTA 4TUOA 2PABA 1JF5A 5F96L 5E94B 2BC4A 4KX9A 5E5MB 2Y4SA 2GSIA 2N4IA 4RAUB 5IB5A 3I6SA 2JELH 3PQYA 1E4XI 1C7SA 1FNSH 4R96A 4Y2NA 5EZJB 4E68A 3ECBB 3KVQA 4QRPB 3VJ6A 3A21A 1T7WA 3C87A 2YBRB 1NC4B 1XZWA 4I3RL 5D4IA 5DSCA 4AVIA 2EXSA 2YQGA 4ECNA 4ZO8A 4OJFH 3W37A 2IQ9L 1LO4H 3TURA 1GY1A 4XP5L 3RJDA 3ZBMA 5EEVA 1S78C 5LXGH 1JDAA 2OMXB 4HHWA 2WMPB 5ITBL 1KXTA 4YDKH 3MNWA 4PJ8C 2DIAA 5DRNB 4L8CA 4ZMOA 3QA3B 4G8GB 4QRQB 5C6PB 3FO2B 2A9CA 2JK5A 4PJ7B 4X6BB 4GYBA 4MXVF 3I84A 3LNHA 3IXAA 1DN0A 1BEXA 2PPEA 4ZMAT 3QDGD 1I85A 1LO4L 4Y9FA 2XFXA 1N12A 1NCHA 1URLA 4RWHA 3CK0L 4W9KC 5DJAB 1VFBB 1YNLL 2R0ZL 2QV2A 5AAWC 4ZI8A 5E23A 3GPEA 3L4ZA 2H2SC 2ZXAA 4Y5YC 1A6TB 5JIMA 2A9ML 2VR8A 5IB4A 2Q8AH 2YD5A 4DVRL 5BVJB 2BX5A 1BZQK 4Y4HC 4PJ8D 4HCRH 4P23D 2CD0A 4HFWA 3QO1A 2OMYB 4ZNEA 5L2KD 1BBDH 3H85A 3ZU8A 2PCYA 4HC1H 4WO4D 2ERJC 4P5KA 3QRBA 3UTQA 3HE7D 1HVXA 4PRDB 1NLBH 2WBJC 2IBBA 4MAZA 5D1QC 5FGSA 4B9ZA 5LNDA 3SOTA 3RI5F 2CR6A 4BSWB 3HNTL 2K78A 2L7EA 4CU8A 4NHCH 2VXTL 4UTAA 5SX4I 3ASWA 1BYPA 1A9BB 5MHSD 3HEIB 1H3UA 3FFCD 1YUKB 3PWUA 3SCMA 4HZLB 5IVZA 1BVLA 5GJTH 3BLKA 3RX9A 4WWKA 4P06A 4ZOBA 2CJTA 2KKQA 3APDA 1F3DH 2CA3A 3UTSD 1DVZA 5CWSA 3OR6B 5E7FA 4G5ZH 1G6RH 4MX7B 4GBXA 4UNVA 1AHKA 4JRXA 1EEZB 2A38A 4LOUC 1I4FA 1EZVY 3WLBA 2YJLA 5DWUL 4LPTA 3PF2A 1ZSDA 5I74B 1AGDA 4LVNC 4HIPA 1UD2A 2X0VA 1TFPA 1KN2H 4N68A 1PKOA 1KTCA 2OP4H 2VW4A 4KK9D 2WXJA 3ZTEA 1AD0B 3QP3A 1FJ1B 1DN0B 4OBRA 1XGYL 1H3TA 2WSKA 4H44C 4U3CA 4GSDL 5HVHC 2JKTM 4R97C 1PJ9A 3OJMB 1CLCA 4HHAA 2VSDA 1FE8L 1G9EA 3CN4A 1CBVH 3HZMA 3BCFA 3GMOA 4MA1B 1G6RA 1NPJA 3V4VB 4QRRA 4TVPE 1AP2B 32C2A 1T1XB 3AQDA 5CO1A 4U6XA 2XPGB 1N9PA 5E08H 4JN1L 2IV9A 2W81C 4LSQL 3ZW3A 2ZICA 3P3TA 1FCCA 3ZMEA 3F7RA 1EANA 4JRXD 3AT9A 4ZO7A 2D7OA 2Z8WC 5ENWB 5FHAL 4AUYA 3GI8L 4OLXH 4HSQA 4CKVX 2XRAH 3UO1H 3QDJB 5DHXB 2I07B 2YN5A 3MRIB 3B5GA 4AQZA 2FQGA 4Q9RH 5JNYB 2VO5A 4LDEB 3L95B 4G7VL 2X6CA 4XVTL 2MCAA 4E0RB 4PG9A 3LRSA 2CLVB 2B4CH 4XO8A 5F9DC 3SDCC 1UJ3B 4GG6E 5ADPH 3BKML 4RA3A 4YL9A 2PTVA 4XBPB 1T83C 1BEYL 5F88B 3TO4C 2FJSA 4UT6H 2Q8BL 2E4FA 5FYLH 5IBLC 2F7PA 3GUTB 3LPGA 5GGSY 2LFEA 3L6FB 4I85A 3KWWB 3OSVA 3AAZB 3WXWL 1N8ZA 1MCFA 2BVQA 3DIVA 4UV7L 2E7BA 1E28A 1PKQE 3GJEB 5C2BH 5BS0A 1RV6X 3IDNB 3V0VB 1IFHH 5FYKL 4KUZH 4JFQB 2L7UA 3SPHA 3TFKD 1NIBA 5DZPA 3ZTJH 4R7LA 4DZ8B 2UV3A 4G8FB 5FDWB 1UENA 2BSCA 1FAIH 1N5YH 4PBDA 4YH6A 5FYLE 1H6TA 1JNHA 3QZNA 4FRWA 1AGBA 1O6SA 1IEAA 4N2DA 3BI9X 2WQRA 3NMEA 4XCFL 1LWJA 2BJMH 1U6AH 3PHOB 2DQUL 4R5XA 2ZUWA 1MQKH 4EKJA 2F15A 2R0LH 5E9NA 4PSPA 1QSZA 1Q94B 2NUPA 2VLRB 3EYVA 3KGUA 3X1EA 2VMJA 5GS1C 1ULVA 4NAMA 4BXVA 1TTAA 5MERB 4PJXF 5DI8A 1ORQB 4W4OA 3GUTA 2UVEA 4XPHH 3AGVA 4RFOL 2WXOA 4X8JB 3B5HA 2FQFA 3DXAB 1R4XA 4XPBH 4NZFA 4TKWA 3T0VA 4AT6B 1PZUB 1M42A 4E41E 1SVBA 1BZOA 1F1GA 1UXSA 5JIDA 2X89A 4K94L 3E3QC 2HTLD 3OWRA 4PJ9D 4M93C 4QLRA 5CBEB 3FQ2A 1A7RL 5F1IB 4TL4A 1PX4A 3LV3B 1O9WA 1JF6A 2NY3B 3HHMA 3LZQA 2OP4L 5F44A 4N8VB 4JGMA 4J3XA 2E9IA 4PWFA 4DVRH 4M48L 5I1DB 3MUJA 1U8HB 2CCVA 1A7OH 4OGQC 5TH2A 4ZMVA 4M7LH 2XVKA 3UCRA 4MDIB 5CIPH 1AR1C 1WAAF 1HDMA 1SFHA 2WLJA 5F9JA 3SB3A 2VDQL 5H4ZA 1BOGA 1E6OL 3WFCL 4LCCA 4N0UE 3AVEA 2X89D 3H9SE 1V7NL 3RAJL 5DS8A 2KLSA 2VQ1A 4QOKB 4BSWA 3L3IA 1DSWA 3V9CA 5FYKH 4NM8H 4OUUB 1NLDL 5C0IB 4Z77A 4GG6F 1GTFA 3A6CH 3I75A 5JW4R 5FO9A 2FJGB 3BP6B 3K72A 4NQDD 4U4BA 4GW1A 1A8JH 1A64A 5GS0L 5K93A 1OHZA 1ORSB 2CMRH 3F5WB 5LCVH 4DNLA 4QPEA 2VLKB 3BKMH 1H0DA 1E9OB 2W9EH 4IBZA 5CCJA 1DLHB 1KIPA 3GB7A 4B3EA 3C6LD 3IB4A 4ZYKA 5I23A 3NA9H 4FL4C 5GS0C 4Q89A 1SN0A 3QDJA 5F7BA 4JDZA 4NQCD 8FABB 1FBIH 3HC4L 4DJMA 5A7EA 4PRIA 4NAQA 4Y5XA 2VMEA 4V1DA 3ARFA 2Z31C 5CSZB 5DFWH 3VXSD 1BD2B 3NCYS 3PJNA 5LLIC 3D3VB 4CILA 3E1F1 3WKYA 2X9XA 4OW6A 3HE6A 3DIDA 4JN2A 1Y6KR 1D3CA 1RJLA 2BSDA 2P8LA 1QLFB 2G2PA 1XF4A 1A6TA 1UH2A 1PLAA 4OCRH 4GAGH 1T4WA 1PBYA 2BSSA 2ZIDA 2Z7YA 5FKPB 3DMMA 1MCOH 3QIBA 5BMFL 3FQXA 1E65A 5D1XC 4M43H 1SEQL 3ZT6A 1KJVA 1QBML 5IHUL 4FXTA 4EVNB 5CIPB 3V4VL 1OQOA 1I1AA 4QHMB 5DEJA 1T22B 1UT2A 5GZOD 4KKZA 4ODSL 3ALXA 1O9VA 3ARFD 3V7AE 3RGVA 4XNXL 5L4FA 1GZHC 2CIKB 2Y5EA 2EVGA 4M5ZH 2W88A 4JO4H 3SE6A 2WCGA 2CBPA 1YYCA 2N7BA 1QFWI 1Z3RA 3HE6D 5FFOA 3J07A 1NKRA 4ZS7H 4ZMYA 5C0EB 3AM8A 2VLJB 3CLEH 3AXLA 1Q0YL 1VLXA 5EU6D 4KI5E 1FHNA 5GRVL 3RDTD 2Q2LA 1F45A 4JB9H 4A66A 2K7PA 3EO0B 5AOKA 3EJTA 4HUVB 1AQ8A 1JZEA 5HI5C 1ZVNA 3AACA 3BE1H 5HYEA 4PVBA 1GCFA 5SWQB 4PWIA 4KVPA 4QHLB 2YGVA 4P04A 1CD9B 1UD5A 2F1BA 2IOIA 3K2KA 4HW6A 3SGJA 2WIMA 1GGCH 3O4LA 2F8XC 1C16A 5FYKE 4PRPB 1O7VA 2IH8A 1RMFH 5IUCA 3H1ZA 1MAMH 3C09B 3ISRA 1H5BC 3MZGB 1I7ZA 1D5BB 3INOA 4UINH 5T5FH 2XKUA 3WMQA 1IBGH 1QHOA 2FZ3B 1UTDA 2MCPH 4N2KA 3N85H 1X6LA 1Y18A 4JFFA 4RZKA 4IHOB 4PJCF 1MRDL 1N7ML 1IEBB 1YLBB 2H0PA 3FUMA 5I1GH 4IHBA 1P1ZB 4JPKL 5D7IB 2G9HA 3R19A 4NHUB 4BBWA 4K71B 1BP3B 1EUUA 2ZXQA 3CZFA 4NBZB 4B50A 2A6JA 2YUXA 4PG2A 3Q48A 2EO7A 4GOSA 5H35B 1XIWA 2E46A 4LLVB 3RUGF 4KMTH 3X1BA 4K5MA 2Q86B 5DS1A 6TAAA 2V0AA 1YEWA 4WW2B 5DEGB 1CK0H 3T6ZA 2VLRE 4JEGB 1BECA 1QBMH 3H9SA 5IHUH 4OZIB 4ZPTB 4UDTA 3IDIB 3QDHA 2ZOOA 1Q8MA 2BZDA 5I1LB 4WCYL 3E9UA 4JQXC 4DP6X 2P45B 3O0LA 2YD0A 3CFIC 1F4HA 1B2YA 1N6QH 5IV2A 1UADC 2X1OA 3TPKA 1OT2A 4HQQL 1UXMA 4QHPA 4F27A 4GKNA 1A9VA 3BAJA 2NR6C 5K39B 2H4EA 1FYTD 4AUUA 4MBRA 4A2LA 5IMKA 4ZK8A 2GUOA 3QFJA 4G1MA 4YX2H 2FO4A 4BFEA 3PAYA 5B8CC 4XWGL 4DWHA 4IJ3C 2ZUQB 3MJ9H 3B2MA 2ITEA 4LVOB 4QRSB 3FL7A 4NM4H 3NRFA 1ZHKB 4KJQD 3MBED 3L5XL 2B3RA 3QT2A 4N3UA 4PB9L 5CD5C 5CP7A 3N04A 4ETYA 2APBA 2OMZB 4Y9CA 2W91A 5CJ5A 2IWGA 2I9TA 3HI1A 3NFNA 4JDTH 4WFED 1FC2D 4JRFA 3AS1A 1FFRA 1AQKL 1E9PB 1JI2A 4JJ5B 2R59A 4MQ7A 2V33A 4G6AC 2BHZA 1E8XA 4PJIF 5CP3H 4EIUA 4B97A 1XAUA 3UYRL 2OMWA 1A5FL 4PGDA 1I7RA 1UD4A 2H9GA 4JHAL 2K4WA 1CQKA 4XXWC 1DFXA 4K2UL 1A47A 2A74B 5HHVL 4LEXH 2CKBL 1ZXKA 2NDGA 4KV5E 2GUOB 4XC1L 4F2MB 1ZLSL 4KI5D 3TBVA 1R5VA 3D50A 4JJOA 1D7FA 3TPUA 4JFOB 4PLJC 2BNRA 4H1LA 1HEHC 3IFOB 4GAJH 1Z9SB 1OCWH 2X1XR 3THMH 4X8XA 5C3IA 4NZUH 4ZD3L 5E8OA 5BS0E 1RZ7H 2NYKA 2IH1B 1KCRL 2KBGA 3IKCA 4JZOA 1YRKA 3G6DL 4YE4H 2FWLB 3HC2A 4DPCX 3GMQA 4E41B 2Q1EA 4PGBB 2W9DL 3H6AA 1DUYB 2WZ5A 4K4KA 4N1HB 3TV3H 4DETA 4ZFOB 3AT8A 3ECQA 1E6JH 2IIJA 3I50L 5IMKB 3RDJA 1KYUA 3QQ9C 4P2QD 4DUXA 4ODUB 1IMHC 2DQHL 3LHAA 3NIFF 4N20A 3FN9A 4XMKH 1MI5B 5DJYA 4GS7B 2NY2D 4HQQH 1PD0A 3K6SA 1RVFL 3DX6A 3V0EA 2VR9A 3NYKA 2HVBA 2XUWA 3SKMB 2F53A 2P5EB 5IF0B 3CZJA 2OTWB 1NMCB 4PJAE 3RWIA 2W92A 1MCWM 3HZKA 3IDGB 5E0FA 3G9VA 3RUGE 2HFEA 2VXSL 1EK3A 2DYPA 3UTTE 3UIZA 4P23A 5IP4A 1JGVH 1NCOA 1VENA 3RZCC 3GSWA 3SE8L 2V7NA 3AU0A 1BIHA 3EHBC 1DJYA 4RX4D 4WO4A 1S7SA 2KLTA 2R4SH 4NN6C 4JFHD 4PUBH 1GC1H 3BPOB 2ZWKA 3BPOC 2EYTB 1A3LL 1QO3B 1UM6L 4CC4A 1F4AA 2AV1A 2YJQA 1T0MA 1CF8L 5ICZA 3CSYA 3V52H 1JGVL 1KCLA 3BH9B 4ZX4A 1HI6A 1PYWA 4KNQA 2ZUXA 4QYOA 2A99A 3KLDA 1A1NA 4CW1A 2YHGA 4JRXE 1EFQA 4J3UA 3UPAA 1SMAA 1JZ3A 3QUHA 3BVNA 1RPQA 1ACCA 1VACB 2X42A 3CG8A 2NY0B 4JL2A 2RMNA 3C8HA 5LO7A 1P6FA 1BM3H 3JSSA 1C5CH 2LU4A 5LGYA 3OMZA 4AYDC 4H20L 5IQ7L 3L08A 2VW6A 4Z5RB 2OMVA 3LQZB 3V7AG 3VI3E 2EVIA 3GMRA 4Y5XB 1INQB 2BCKB 3ULUD 3QIUD 2FLBT 2FB4L 3K74B 5GISH 1EFXB 3IKKA 2VWEC 1LEKB 2K9UA 1HNGA 3IBEA 4NEHB 2Y06L 1YEEH 2AEPL 3HFMH 3TV3L 3RVTC 2AHIA 1MHHB 1NBCA 2P47B 1XBDA 1MFCL 2QHRL 4KROB 3WYRA 4MA7H 4R4FL 2JLLA 3WJMA 4AQ8C 2MJWA 1V55B 2J8OA 5FHBH 3ULUC 2QADD 4FXGA 3IT8D 5E5UB 5G55A 2EC9T 4I1NB 1SGKA 4DGVL 1Y1DA 1Q94A 2NUPB 2BMKA 3CVHA 3FT1A 3X14B 4X5QA 5DC0A 3H8NA 3CUPA 3MV8A 4JQVC 4MB5A 1S5IL 4KY1L 5HJ3B 2XXFA 3SYQA 3V9EA 1CS6A 5SWSA 4ADJA 3HC0B 3MR9A 2OW6A 1XBRA 2C3XA 4MVBC 2JE8A 4GG8B 4OGYL 2Y07L 1A7RH 2F08A 5DUML 2BNUA 4GXVL 1WE5A 4BFIA 2GABA 5HYSA 4LGSB 4HUXB 3MA7A 5AW0B 3TBSA 5L9DH 5FO7A 2P7TA 3HUJF 4FEMA 1KTLA 1FFQA 4LLDB 4JZNA 2YQBA 3NESA 1GTNA 3QDGE 5DD0L 5DVNA 1A6PA 3AUWB 5DK2A 3V6FA 4A7QA 5JW3H 1C8QA 1DSFH 5GRUL 4OAWB 5JDSA 3S37X 3LV3A 3ZZSA 5HGHB 1QX1A 3HS9A 1I9IL 2CRIA 2OMXA 3L7EA 5JA8B 3MV8D 4LCUA 2XWXA 1EZUA 3K4AA 4C55A 2ADGA 1HKFA 4JG9A 3K81A 4L4VA 4HUKB 4UNUA 2VIRB 4WNQB 43C9B 4P46B 3V0WH 5GSVA 3F12A 3QUXA 2WXMA 5JW3L 2VJ8A 2FWSA 4RGMB 3VFUB 4PCYA 4AGLA 5JNYA 5DJXB 4LDLB 3TYGH 2WTOA 2ZT9C 2WVVA 1P4LB 1U4FA 2CIIA 2CLVA 3MNVB 4XC1H 5A2BA 4CNIB 2WNWA 4JFDB 4ZOAA 2WBXA 3OXSA 3F5WA 4IRJC 3QWNA 4A7TA 4QF1A 4OLYH 3ILDA 3UROR 3DA0A 4JW3A 4LOVA 4MZ3A 4ZS6C 4NPYB 2DWTA 2VM9A 3BRGC 1CLVA 3Q6FB 6FABL 5D71H 2P8MA 3WDIA 4I5BB 5DUBB 4AE1A 1QBBA 4L4VD 5GGSB 2ICES 2AI0H 2E0PA 2R2HB 3RWHA 1ZTXE 3FRPA 1E6JL 2OKMA 4YHIB 5A6LA 4ZMZA 3N1PC 4XWOC 5ECJE 5HHMD 3UYPB 1WZAA 5GRJL 4PI0A 1NJ9B 4NPKA 1GAFH 2NY1D 3EJRA 4D0DA 4BQ8A 5FV1L 1X4YA 4DCQA 2WBKA 3QCTH 3D08A 5EORH 4BQ6A 4DGIL 5HYQB 2D9CA 4PV1C 1AGCA 3VXRE 3FT4B 1CQYA 5I26A 3VXNA 1GW0A 4B9CA 1F0LA 4X0NA 4MX7A 3V4VH 1TJHH 5DT1H 4CBPA 2IANE 4M1CD 1YEKH 1X5AA 3FB8B 1WWBX 4P2YA 2A83A 4GS7C 5I9QB 1CIUA 2QGDA 3CZNA 5A6IA 2EDQA 5JO5A 4NUGH 1YY9D 5T1LA 3ML9A 5A16A 1YPZF 3QCTL 4OFYD 3WSQH 4X8JA 2G4EA 1LEKA 3MBEC 3DI2B 1XMEB 1S7XA 1LO2H 5DJ0A 3GZKA 3CSTA 2AJYH 3GIVB 3Q8BA 4MAYD 2UXFA 4YHIA 4EI5C 1JE6A 3BP5B 4JKMA 4UIKL 2VDPL 3LZFL 1T1XA 3R18A 2ZJSL 3N1QC 1WYJA 1JPGB 2PYED 4LLUA 3E1ZA 5LCVA 1E0OB 1CFVH 3M17A 5BZWA 3VH8G 4OGXL 3L1GA 2G2RA 1TVHA 5D7JA 3NQKA 5T1LD 1E2ZA 4M5TA 1I3RA 2B59A 1E4KC 2PCFA 3Q9QA 4OLYL 2QT6A 3T6QC 4GT0A 3SDAB 3IDNA 3V0VA 2JJTC 3FRPB 2I24N 4UIKH 4XPGH 1O7DC 1Z9LA 1RMFL 5KSBA 3BZDA 4PRID 2WM0A 2ODHA 5C71A 4OZ4A 2NT1A 5EZPA 3DBXA 5J3HD 5JHLL 4F3FA 5CXPA 3WY4A 4LASL 1HSBA 4G7RB 4N5UA 1JPTL 3MGOB 3GIVA 5T1KD 3UH8A 5ICYA 3U7YH 4HFWB 4JFTA 4QXUH 4NOBA 1GS6X 5AKVA 4HKZB 2NW3A 1TQTA 1QI5A 5D7JD 1NCTA 3ZTJG 3ARSA 4Z3HA 1RHFA 4UT7H 4YO0B 1GMIA 1MCDA 3SCMB 2LV4A 1GY2A 4QD2E 3GTTA 1HOCA 3LS5L 5GRZA 2W60A 4PU2A 4Z7UA 1A4AA 1HS6A 2OXHA 3UC0L 4QKTA 4XX1E 3WGUB 4F24A 2WIIB 4E42B 3EJZD 4BZ2H 4Z0BL 3C08H 5AYUH 4OGYH 3VFWB 5HHQA 4FDWA 1FUNA 4J3VA 4OCXL 1UZ6E 4FS0A 5CZXC 4H1LG 5JIIA 1JSYA 1XF2B 1ZRUA 2ARJA 4G9FE 1S3KH 1KG0A 4JFDA 2UY7B 3CU1A 3GZQA 2BJML 4QYOB 4X42A 3BVNB 5D1XB 2TAAA 1N3NB 4G1EB 1KDJA 1D9KC 5JPNA 3UTZA 1FIGL 1BWWA 4ADGA 5IJVB 3CD4A 1T3FB 3CN2A 2BWIA 3MRBB 2G9KA 3NJJA 3T0DA 2F1AA 4MB1A 4Q9BA 3KPRA 2CJUH 2AP2A 3MYJA 3ULAB 1JTOA 5KSBF 3I3EA 4UZSA 5AZ2H 4WI7A 1M4KA 4N2CA 3ROLB 5CSBA 2LTQC 1DBBH 2BOCA 3BLPX 3L5IA 3HBGA 2NY6C 2BIPA 3FB5B 3KPLB 3VXPB 3K3QA 3ZHKA 4LOFA 1SY6H 4PGDB 5A2KH 4ZUVB 3CJJA 1LO3L 2GC7C 3WD5H 2G0LA 4NO5A 3NH7L 1QZNA 1ET8A 4J27A 3VXQB 1E3FA 5D1ZI 5AVRB 4PY8I 4AH2A 4OLVL 4WI9A 2EIBA 2OA9A 2XFXB 3UG3A 2XA8L 2VAJA 4H1LB 5DK0B 3EO1B 1TDQA 3LQAC 4Z7OE 1MFBL 3WBDA 2BNQA 1SOQA 5EF3A 1SHSA 2NTSP 3MRHB 1OAQH 5LQBL 4BSVB 4X98A 3IF1B 3QIWD 5CNHA 1MI5E 2E6PA 3FRPG 4F7CA 4H25A 2N1KA 5DRNA 2BNQE 4PGEA 2H9GB 1I1FB 5H2BB 2VERN 3T0EE 2JK5B 4DAGL 3NCYP 4DKTA 1A14L 3KS0H 2HRGA 1D5XB 1SUHA 2QGCA 1HILA 3P9LB 3AQZA 2GY5A 5EO1A 3TZVD 1G6VK 1UZ8A 5KVDH 2WB7A 1Z9NA 3RJQB 2VC2B 3ZQ9A 3ULVF 2IOMA 3P4OA 4PJIB 3B9AA 1D5IH 2RIKA 2H0EA 4FFYA 4EN3A 4P05A 1XD1A 1UOKA 2BXYA 3DX6B 4TUJB 4HX1A 3UADA 4H2AA 4OJEH 1CYWA 1ZK5A 1CDUA 4F8QA 3WO4B 4IBTA 1G1OA 3PP4L 1FVDA 3A47A 4NQVA 3U83A 5GGVH 3WNIA 3BZ4A 5G4MA 4HAFA 4IKLA 4Z3IA 1XR9A 1DCLA 2ROXA 1KNOA 4X5WA 3LD8C 1E8YA 4J3OH 3NCMA 3GRWH 3FYIB 3AW5A 4A37A 1FO0B 1SVZA 1MSPA 2A6JB 4KKAC 4XP5H 4BUHA 1FFPA 2BC4B 5E5MA 3HZ3A 3SKMA 4OZHF 4YHZH 3ZE1E 5GJTL 1JNNL 5IB3B 5IBUG 2Y1YA 1GHFH 1J9TA 3CH1A 5TJWK 1IC7L 3UAFA 3KW8A 4JFUA 2ALWA 5IVXE 4G9FA 3DPBA 5E6YA 1NA8A 5C3LD 2AZUA 5JQIB 4W9EC 3LQMA 4NC1C 3KAAA 4PWJA 1GC1C 4NDMA 3MI6A 2YXFA 4I0CC 1MDTA 1RPKA 4JFZH 4C8XA 3RWCB 1VESA 3VD1A 4I48B 4N2FA 4YHLL 4XPGL 1FL3A 2H2PC 4HIQA 4OLVH 2XQYG 5BOJA 3DTXB 2GEEA 4OZIF 5JXED 3S8FB 2Z91B 5E56A 3QAQA 4PGEB 1MWOA 1KB5A 1XR9B 5T5NG 1T80A 3TTYA 2P5EE 4NO0D 3C8KA 3UTTD 5FYJL 3IU4L 1CGSH 1JMXA 2R1YA 4NNXA 1PG7X 1K3ZA 1KOAA 15C8L 4KROC 4AMWA 2PF6A 2ITCA 1EHLH 1T5WB 1S4IA 1BQHG 4L3EA 1NSNH 3FSAA 4LLYA 4MA3B 1FGNH 4AL8L 2ZXGA 4OZHE 4OT1H 5C07A 1KCVL 1KXQE 3JXAA 4MQ7B 3H3BC 3T8VA 1QRNE 2EIKB 1J05B 1K6QL 3D4ZA 4IGBD 4HUCA 3WUWB 2A9MH 4A1RA 1GPOH 2CR0A 2BCMA 4ATTA 4KU1A 1AXTH 2F5AL 3NQIA 5DHVA 2KQMA 2CDGA 5F0JB 1AC6A 5F97E 5AYUL 4GO9A 5DXWA 1MFBH 4EEEA 3A23A 2HT2D 1HXMB 2WP3T 2QKIB 2ZWSA 4YFDB 3EJUA 4G5ZL 4H8WL 5GRXG 2DTSA 2KL6A 1NGYA 3MMEB 4P46D 3TU6A 5IBTL 3ARBD 4R8WL 3WXVH 3QNFA 1L6PA 5KN5B 3AITA 2YSTA 1WG3A 1H5BA 1U8KB 4J6RL 2C9PA 4B41A 3VXQA 5KJRH 5I1HL 2YXVA 3QNYB 2IADB 4X9GA 1MIEH 5I8EA 1A4KA 4ZOEA 2AAVA 3C75A 5D2LB 5F7EH 4Y7OC 3RB7A 1AHWC 2XTJD 5AW9B 2VDML 4MZ2A 1N5YL 3BW9A 1RJLB 4MSWB 3GXFA 5K33A 3KM2A 3VFVA 5JMOC 4IRJD 4YUEH 2APFA 4LLYB 4OGAD 1GXEA 5AZ2L 5DEGA 2X4SA 3G04B 3WXVL 1N0XL 4NWUH 2JJSA 3P40A 1OCRB 2L3BA 4OJCA 4WU5B 3X3GH 4XNBA 1G9ML 3UAJD 3K5SA 4JY6A 3B2VH 3JUZA 4AGPA 2DS4A 3O3BA 4GMTL 2R0LL 3JV4A 1BXAA 5LAXA 5JW4M 3MUZ1 5F96H 2FEEL 5FKPA 4BCYA 1CF1A 2APXA 4EI0A 3W9EB 2J56A 4KH2A 3UYOD 4TQIA 4AMKH 1G7MB 3VWJD 2XBDA 3KDMA 2R1XB 3MROA 1QSEB 5F71A 4DGYH 1RZ8A 2YLKA 3CFMA 4E9TA 4FQCL 2K3HA 3OBAA 4APQA 3DBXB 3LX9A 2WIIA 4E42A 2AQQA 1VKXB 3W3BA 1HNYA 4QJ3B 4Y19B 5CJBA 4M8UA 3MQIA 1KZQA 4PP1D 4KK9C 4TL5A 4BUQA 4QHLA 2HUEA 5DRWB 2JTYA 1GZQA 2GJ6B 3OMAB 3EG9B 25C8H 3APMA 1F8TH 3L5XH 1IGIL 4XI5C 4DKEL 2AJVH 3EO0A 2C3GA 4LOUD 2JQZA 1SPDA 2VO8A 1CGTA 1UT9A 2E7DA 5C9JB 1JYVA 2RB8A 3INUL