2OMWB

Crystal structure of inla s192n y369s/mec1 complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
GPLGSWVIPPISCPENEKGEFPKNLVQIKSNRDKETKVFYSITGQGADKPPVGVFIIERETGWLKVTQPLDREAIAKYILYSHAVSSNGNAVEDPMEIVITVTDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Extending the host range of Listeria monocytogenes by rational protein design.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Cell invasion/cell adhesion
molecule keywords Internalin-A
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2omwB00
4ZMZA 4ZMVA 2QVIA 3UBHA 3Q2LA 3LNEA 4ZMWA 4OY9A 2OMTB 2A4CA 3Q2VA 1NCJA 4QD2E 4AQAA 2OMVB 4AQ8A 1WUZA 3LNIA 4AQ8C 4ZMPA 2V37A 1Q1PA 1ZVNA 3K6IA 2WD0A 4ZMQA 4NUMA 5KJ4A 2WHVA 4AQEB 3PPEA 1SUHA 1ZXKA 5JYMA 4APXB 4ZTEA 1NCIA 4ZMLA 5CZRA 2O72A 5DZVA 1O6SB 3Q2WA 2YQGA 2QVFB 3LNDA 4ZMYA 2X2UA 3FF8A 3K6DA 4NQQA 4ZMXA 3Q2NA 1EDHA 4AXWB 3UBGA 4ZI8A 2WBXA 3K5RA 4APXA 4XXWA 3K6FA 1L3WA 2OMZB 3K5SA 4ZMOA 2WCPA 4XXWC 2OMXB 4ZMTA 3FF7A 1WYJA 2EE0A 1OP4A 2OMYB 4ZT1A 2OMUB 4AQAB 2OMWB 4NUQA 3LNGA 3MVSA 1NCHA 4AK1A 4AXWA 4NUPA 3LNHA 4AQEA 5JYLA 3QRBA 3UBFA 5CO1A 2YSTA 1NCGA 3LNFA 4ZMNA 1FF5A 2A4EA
chains in the Genus database with same CATH superfamily
2WTPA 5H8DA 3MRFB 3L6FA 5I0DA 5FB8B 3HZKA 4NN5C 3OLIA 5H4YA 1BIHA 1L6ZA 1WZKA 3RNQB 4BH8A 1MCWM 1S78D 2D3NA 1Q9LA 1T6WA 1J5OH 1JGLL 12E8L 5DJZA 4PTTB 3ULUC 1A6PA 3OHXB 5GS1C 1BOGB 2J73A 3MNVA 3APFA 1X4XA 3BXNA 5E8EB 1LQSR 5CHNB 4Q6IC 2YGOA 1HTYA 2ADFH 1E30A 3GSRB 4LLDB 4LZKA 5D7LA 4P23B 4G3YH 5HHMD 4A66A 3ZT6A 3RKDC 1MFNA 2EADA 1F97A 2EE3A 1OGTA 1IAOA 4NO0D 4HMEA 4XE5B 5E6IA 3P4LA 2VDOB 3PP3H 4D0CB 1YEIH 1MIMH 2B9AA 3KXFB 3HPLB 1O6VA 1CLYL 4N86A 5KVGL 3D4GA 4JKMA 3I2CL 1CK0H 4P3DB 3CVIL 5IV2A 4I9XA 3SCMC 4TUJA 1XR8A 2BNRB 3U4AA 4YBQD 4X6EB 4J8QA 5D7IE 2X38A 4JY5L 2B20A 1EO8L 3BRFA 5FYLH 2WBXA 2GYSA 5AB1A 5CCHE 5GGQH 3K5RA 4B9GA 4XP6H 2D2OA 1BXUA 4FOMA 3GI9H 2XC8A 1YEGL 2CUMA 1FUNA 1IKOP 4WI0B 4AYFB 3WTUA 3WTYA 1WC7B 3WD5H 4XVTH 2B14A 1T5XA 4NQCE 3P0YL 2BDNL 4HWZA 4H25B 3LEXB 5ID0B 2F1BA 5AVTB 1F4AA 2XQBH 2YD9A 4G8GE 4YFEA 1HKLH 2J1WA 2ZCZA 4KROD 3WIIL 3BUQA 5C3TA 3KWVA 4FFZL 4F3FB 1RUPH 2JF1A 3L4TA 4YL9A 2L7UA 1AXTH 2CO4A 3EYQC 4HEMA 2GY5A 3QUKA 4JRYD 5HY9A 3OAZK 2PETA 5DEGA 1IEBB 4J3OD 1R46A 3MUUA 4FQXD 1NWPA 4MX7B 2Q8BH 1PG7L 1UH3A 3N55A 1B2WL 4CNIB 4UB0H 4HH9B 2WP3O 1S7XA 1KC5L 2PWHA 2R2HA 3MUGA 3LPFA 4POZD 2AXGA 2FX7H 5HGAB 5EPMB 2NY4D 4PGEA 1BQHA 3ENEA 3DA0A 4WI7A 5DCCA 3L5XH 4FFYA 4L3AA 1MJ8H 5J6HA 2AJXL 5BS0B 3EJCA 4D0BA 5EEZA 1U41A 4WUKL 4EDXB 1N10A 5EORH 2IOIA 2VRQA 1IGFH 3NBNA 5EF0A 3HMWH 4BFJA 2FQFA 3PL6A 2FIRT 3B2UC 3PNWB 5IVXA 1RUKL 4OZGB 4LIQE 4AL8C 1IKNC 3VXPB 4ATTA 1DEEA 1KGUA 4J3OF 1QI3A 4I89A 2I5YL 2YKKA 4FTDA 1AG0A 4TL5A 4N0FB 4PPTA 3FFCA 2WSPA 4QRRE 5J8OA 3D9AH 2X12A 4LLVB 1EJ8A 3IU4H 2DBLL 1W2KT 1V3MA 3M86A 1EHKB 4C4UA 3LZFL 4LPUA 3FMGL 3TNMB 5ADOH 4YDLC 3L7FB 3ZDYE 1JV2B 3OAYK 2ZXGA 1DFXA 3JVFC 1T1ZA 1QZ1A 3W3BA 4PJHF 1XGYH 2CK0H 3WNIA 3ZPDA 2HYMA 1QUNA 1MY5A 4XOEA 5GJTH 1DBKL 4P5TD 3RDTD 2GBUA 2XA3A 3MV7B 5DVLA 2R29L 3UJTL 1VA9A 1I7TA 1NBZA 3MCG1 4R96B 5C0EB 4IRSD 4K0OA 5ESQA 4EZJA 2VSDA 5D5ME 7PAZA 1TJGL 2XTSA 3P73B 3UAJA 3CVCA 5GRUH 1TO4A 4CGUB 5EFIB 4HOZA 3K5SA 2W9EL 1H5BC 4MMXA 4OD3L 3O9WA 4UTBA 1A02N 4GAFB 5DZNA 2Q8BL 4CN4A 4P2CG 2EXWD 1ZE3H 4BUGA 2V7NA 3GHBH 2ZIDA 3VD5A 2PP9A 4J3SA 3T3MB 3BLKA 4GP4B 4EDWL 3D2UA 2KZ1B 2P8MA 1ECZA 3L3GA 2N7AA 3C6SB 4I9WD 3CH1B 4XOCA 2VXQH 3ATBA 3PGCA 2WQRA 3QPQC 4JHWH 2WCGA 2QVMA 1INQB 4HMDA 1CQYA 4HWBA 1WBXA 3WOVA 2UX7A 4N2EA 4QHUB 3CC5B 1UFUA 3B7RL 3H2QA 4K94H 1HXYA 4PB9L 5F7YC 5FWRA 4QRPE 3BAYA 1L3NA 4MJIE 4ZPVA 4AG4H 1KULA 1JUFA 3QHZL 3FQWB 3FTSA 4KVCH 2QFPA 3DUUA 2GCYB 3NESA 2BP8B 3ARTA 2OMBA 2OTUB 3FCSB 1ZHNB 3ZL2A 3HPJB 3V6FA 4ZNEA 4OLUL 5KN5B 4M1DL 3ZKNC 4M5SA 2H32H 4ZD3L 4YXLH 1UB5A 3EO9H 3PWNB 5AOLA 1IM9A 4BV1A 1RZ7L 1VFUA 4TNWK 5HYJB 3L1OL 5BO1L 3HJEA 2RIKA 2B16A 4LLMA 4J7RA 1JV5A 2ZPKH 1C5DA 2UXFA 1NFIB 1Q90A 4NZFA 4UQEA 5T3XH 4Z5RB 5EO0B 1OE2A 3HR5A 3DROB 4IDLA 5KSBA 1EFXD 2NZ1A 4Z9KB 2CCVA 3N1MC 1E8YA 3FB5B 2P7TB 3B9EA 1JZ3A 3M17A 5LJYH 5JPMB 1TEGA 3ZYZA 4QO1B 4CADB 1JN6A 1TKWB 5E08L 4NO2B 1H6TA 4X80H 1PYWB 1SEQL 1JYVA 1ETZB 2J6EA 3GKWL 4PAZA 3D33A 5ICXA 2UUDK 3KYNA 3TPKA 5IMMA 3QPXH 4UZUA 2Y7QA 4XP4H 2H0FA 3NCMA 2XV0A 3O6KH 2X4TB 5DURD 5D70H 2B08A 3QI9C 5LCVH 1VKXB 3L4ZA 2OMUA 4NZRH 2DIBA 2DM2A 2JI2A 4OIIH 2J1XA 5EU6B 1GAFL 4DNLA 3ULUH 5D8JH 1YLBB 2CJUH 2A6DB 1E4XH 3S35X 4YSOA 1LDPH 4JG1L 4LKCA 4QRRD 5E0QA 5EZIL 1SJHA 1CL7H 4FHKA 2FUQA 4ZXBB 5DMKA 4FRWA 3RL2A 2PYEA 2ZOWA 4JFZL 3CFBB 4N5ED 5I1DA 4R6UA 2FECI 2I7OA 2WTOA 2XTJD 4N2MA 4XZUB 1MVUB 5F97E 3GSWB 2YD2A 4N2DA 1KPVA 3HI6H 5IHBA 1RULH 4DF9A 1A9VA 3CZUB 2J8UA 3QNXA 1FDLL 1KPUB 1P1ZA 2GK0A 4M00A 3TU6A 4DGYH 2WXGA 2E7MA 1FP5A 4B95C 4I88A 4K7PY 3UTSB 5CLWA 4F8PA 4OBSA 4F58H 5TQ2L 2B77A 5IM7A 1IGTB 4CMHC 4OZ4A 1IFHL 1ECYA 3MRMB 4Z95L 1HSAB 4ZYKB 1NCGA 3GHPA 5KJ7E 1FYTD 2C7UB 4NI6A 4LRIA 3UYOD 3RZCA 1QSEB 4OAWA 2L4OA 4P49A 1N0XH 1QRNB 2XWXA 3FZUD 4OFYD 5CLTA 1DQDH 4I3SL 1EANA 1AH1A 2E74C 4B9KC 5SX4H 3U7YL 1CFTA 4LNVA 3STZB 4JQVA 4GJTB 3QIUA 3OKMB 2Y9RT 3GXTA 4QIRA 1OLLA 1MI5E 1UM4L 3H85A 4WUUB 3K6SA 4OY9A 1BQKA 1WF5A 4PJ8A 3RHWK 1KXQA 4WW1A 2IPUG 3OGCA 3T2OA 3JV5A 2Q86A 4KZEL 1P4IH 2EIZA 1HEZA 2Z1KA 1SMDA 4BSVB 2GAZA 4GQRA 1FNEB 4N5UA 5T8IA 4ISVA 3PXLA 3VVVA 4AQEB 4XBEH 4MA3B 1MWAA 3FZUC 1BP3B 4G8GD 3FCBA 4OZHA 4PG9A 4DKAA 4ELME 4L05A 4OBRA 4Y4KB 3MCKA 5D2LA 3WBDA 1EEYA 4ECNA 2VMJA 1T7ZA 3MRCA 3IFNL 2O5YL 1NFDF 1O5PA 2XV2A 1PQZA 4NP9A 3ARRA 4PGJA 4PRDB 1A4BA 3LNDA 1AC6A 3VTAA 1I9IL 1WIOA 2WCSA 4LDOB 5J12B 1A7QH 1ZSDB 2AJVL 3OAUH 3ZMRA 4WY7H 4EOWH 4MNHB 1CBJA 1BDYA 1NQBA 1T04A 4M02A 4D9LL 3S9DB 4K5MA 3QHFL 1E8WA 1N4XH 3HNVH 3MRLB 7PCYA 4QY8A 3NK4A 4R7NA 1A8JH 1HL5A 4U7KA 3HI1B 3OMZA 2D7OA 3VWKA 2ODIA 3MODH 2R1WA 3HUJE 2I9TA 1JGIA 4ZSOE 1OCCB 2OMXB 3U0TA 3I9AA 1UWFA 5CFHA 3FQUA 1J8HB 1UWXH 4Z76A 1D5ZB 3IGLA 3BYTA 3QJXA 4IOIA 3O2WH 4OJFL 3SJVE 2VDRB 5IESL 1W72A 2EE2A 1QW9A 5IHUL 2EIBA 3ARGD 2KQNA 3TVMD 1IKFL 1YSOA 2MNUA 4NDMB 2FIKA 3QUZD 3QO1B 2J4WL 1XBRA 4J8RB 2QVKA 3DHPA 4ENZA 2MSPA 1P7QD 2FJUB 4N6QA 4NI3A 1OGAD 2ZCHL 4L4VE 5BZWB 4JFFE 2HWZL 1DLFH 3D30A 4GS7B 3UJJH 1AHWA 1ZGLP 1RFDH 2BX5A 5ALCL 1I3GH 3MCLL 1G7HB 1NBVH 4Q0XH 4DKFH 3CSBA 4UBDD 4ZPTA 1X9QA 5JORB 4NJAL 2G5BB 1CDGA 1FF5A 1WGOA 5HYQA 3QZPA 2DMGA 3IFPA 2R7EB 2OMWA 3DUSB 3OKEA 4H26B 4JM2C 4L3CB 4MSWB 5DJCA 1UWGH 2D03L 1XH1A 4ELKA 3WTXA 1HQRB 4HD5A 2ZICA 4KNSA 5K9QG 2CDEB 4N2NA 3OQRA 3D3VE 4OGZA 3X13B 3AJ7A 3VACA 3VDCA 4YXHH 2X9WA 2VDOH 3ZY7A 1LMIA 2VLRB 4HWUA 1IQWH 1TITA 2YIHA 3K80A 3AG1B 1SNRA 2VQ1B 3Q6FB 3F58L 4MWFB 5T5NG 4E9LA 4HKJB 2GI0A 2HFEB 3ZTNL 5C0DB 5JW5A 1ZVSB 1EUUA 4NQDB 4PREB 1IBFA 5DZLA 3O6ML 3UYPA 2XOTA 5IZ7A 4N1EA 1N70A 1M05B 3HHSA 2ESVA 2WXOA 5IROD 1OARL 2APFA 2ZUWA 3LN5A 4WJKB 2BY3A 2BVUA 5B3NA 2PW1B 4N2AA 4QRSB 1J12A 3FO1B 3SYOA 4TSAL 1KIQB 4KHXH 3M45A 4L48A 3SYQA 2X2UA 3FO0H 4HC1H 4UDUB 3BFOA 4AKOA 1CGYA 1C5CL 1JHTA 2Y2WA 4HJTA 4PJ7A 4UOW1 1KJVA 1P4BH 3MAWA 3PXHA 1SFDA 1T1YB 1KIUB 2WQSA 3KPSB 5DSCA 3UIYA 1QFPA 3GPEA 4WFGE 4L8CA 4N2FA 1PZBA 2R4RL 3F12B 1JK9A 3ZE0B 2LTQB 1KTRL 2RAMA 1KLUB 2VXQL 4JHWL 4WFFE 5F1SA 1UZ6F 1ZCRA 4PBXA 4M8QB 1KPRB 2AV7A 5KOMC 4Y8DC 1Q9WA 4JW3A 2XETA 2BC4B 3M1CA 4N2HA 2Z7UA 4XAKE 1SM3H 3U82B 1CE6B 4PBDA 5CP7B 5FGBC 3PWPA 5SWZB 3TO2B 2CK0L 3HRPA 2FEJA 4JFHE 5LAPA 3UJIL 3ECUA 1BD2A 1YPZB 2ZX9A 4AEHL 2XTLA 3OXSB 3SDAD 5GGTH 4FFZH 2OZNA 1A22B 5DD1H 4XO5A 4ZAKB 1RK7A 3ISRA 5F9WB 3PWLA 3VXTB 3MXWH 3DPDA 3TCXA 5F6HJ 4XO9A 5PAZA 3SD2A 2A9NH 3GI8L 1U0QA 2G3XA 3QG7H 2W9EH 4LCWE 4EUPH 4ENED 2JKXA 3VFUA 3N9GL 1E6OH 5G4NA 2BSEA 3SZ6A 1XO8A 5I0YA 2FHFA 3QXWA 5T3ZL 5T1KA 4GW1B 2VXVL 3NCEB 2ZKHH 5JHDB 3A6BL 5EBGA 2R15A 3OF6A 4NUJA 1LO3H 3KHOA 1OB1A 2VUYA 2Z64C 2H41A 3O4OC 3UTTE 4JKWA 4KTDL 3MV8E 3TFKC 2HRLA 4IBUA 3RY6A 1UT9A 3F58H 3UTPE 4XP9L 4DK5A 4ZW3A 3SY0B 4NEHB 1NEZA 1MCOL 3P9LB 3HVNA 1BVLA 1UXLA 3LIUA 4S1RL 3MBEA 2QVIA 1X5FA 5IB1B 2CM6A 4JPQA 4GH7B 2WV3A 4MD4A 1GKEA 4JPSA 3T6WA 4OLYL 2ZSVA 5BS0E 2NTSP 2VLJA 3U6RA 2VE6A 3PE9A 4OF6A 1ANUA 1RERA 1JHKH 4JDTH 4UQ3B 4XNUH 1F3RB 5JOPD 4W9HC 1QEWB 4PY7A 4M1CC 1L9MA 5LXGH 4HGWB 3NCFB 4HHGA 3TOPA 1BYPA 3H7BB 3AC0A 5EF1A 5DGQA 1RZGA 1OZTG 3RKPA 4DGIH 2XZCH 4D7BA 4RX4D 4PJ6A 1S7XB 4OCRL 3MNWB 5IOPA 2DWXA 4D8PB 1WFMA 3S3JA 4CSSA 1W0YT 1FH2A 1LNUB 3A21A 4FULA 4TUUA 4CKVX 3MRDB 3ZL1A 3WGUB 1JCVA 4XPHL 2Q7YB 4MJIB 4NC2B 1X6NA 1L6XA 4GKSB 4BM7A 1D7BA 1FC2D 4NIKB 5AW2B 5IJVB 4ZMYA 4EDXA 4OZIF 4AEHH 4EVNA 3PP3K 4JVPA 5KG9A 2QKIA 3A23A 3OJVC 4AQZA 1ZLSL 1ACYH 4KXBA 4G7SB 3K2UH 2HRHA 1XF5A 2APTA 3K1KC 1MREH 1G7QA 5CBEA 1MREL 5F1KC 3KMDA 2XBDA 5EUOB 3B5GA 3DX4A 5GGRA 4H20L 3BEVB 1F58L 1BFVH 1LE9A 5B3JE 1D7FA 3ARDD 3EJZC 4N0FA 4ABUA 3U46B 4G59C 5FS5A 5J1AA 4FQXC 1HIML 1KNOB 2J12B 4HIHA 1ZA3A 3CH8A 2E9WA 1WJ3A 3F65A 2EH7L 5KEZA 1FBIL 5SWSA 4IRJC 2DD8L 3JTBA 3TCLB 4DOHE 4EI5B 1ZRUA 1Q9OA 3NDZE 3CVHL 4G7VH 1UT1A 1PZSA 5I1EL 4ZBJA 1YN7A 2QPDB 2N0MA 5H37A 3GBMH 1M42A 4XP6L 3RU8L 5FYJH 1UXWA 3RJOA 4E9YA 3DIDA 3LHPL 4GUPB 1I7TB 2Y24A 3KPRA 1OF2B 4N25A 2LHAA 4OVVA 3D25A 3DJZA 3P02A 3MSPA 1U8OB 3BFWA 2FZ3A 3MJ6A 5JA9A 4Z7NB 2VM9A 4S2SB 4WO4C 1JPEA 1SXBA 4OCRH 1T1WB 2CHXA 4XBMA 5C08D 2HVBA 2IANA 3W5NA 3EGSA 5B4MC 5B8CB 3Q2LA 4N0UA 1PEWA 1CIUA 2VH5L 3V5HB 5DD3H 5IMLA 4PGDA 4JJ5B 5F21B 12E8H 4LNRB 4DGWC 4JM0A 2DQIH 1BPVA 4C56E 3IJSB 2YPKA 1XV8A 4N8VA 1A7PH 3NJJA 1DN0B 2ED8A 2ZOOA 2X4UA 4WU7B 5FA4B 3V4PH 1DVFD 3OSKA 1TQWA 1QLEB 4TN9A 4F1SA 5BNXD 3D2UD 2J8UF 2Z91B 4ABWA 4DAGL 3N44B 3HG1A 1YEKL 1AO7B 2COVD 3ARFA 1AGBA 3NIGB 3EKCA 3L4UA 4ZUTA 4Z77A 3WN5B 3FW6A 3Q5OA 5I18H 5JDJA 4FNUA 4JR9L 3RDJA 1FFTB 3B3IA 1D5IH 2ZWKA 2CO2A 2Q2LA 3WS3B 2J57A 3CDGB 2OSLB 3OJMB 3TN0C 1WZMA 4OCWH 2GCYA 3AT8A 3FTGA 1IBHA 1K5NB 3OV6A 1AHKA 4IS6A 4NZ8A 1KB9K 1JGDB 3NFPB 5D2NE 3RB5A 1RJCA 2V17H 2NY3C 5L9DH 4OVUA 5CMAB 1BREA 4NT6B 1PLBA 4PJEE 4QGYA 1C12A 4ELMF 1I1AA 4QXGL 4AIOA 4F8NA 2JJSA 4EO5A 5FYLL 5IW3A 3L9EA 1JNNL 2ZCHH 5D4HA 4M6AA 2DI8A 5DD6B 1CDHA 3PY9A 3P3YA 3QG6A 5JXED 3IMUA 4U3SA 3TYGL 4HLEA 3FH8A 5CSZB 3P0YH 1IARB 3S34H 4J5VA 4WGKA 4XVTL 4UTAL 5F89A 3VXOA 1UWYA 1H3GA 1HX0A 2QGEA 3CCHB 3HBZA 1JN6B 5A2AA 4NO2A 4I0PD 5ISZE 1DO6A 1FFQA 2IOMA 4XVUD 1VGKA 1MCQA 1U8KB 3MBWB 5T1LB 5FF6A 4PJAA 1WBZB 1IAII 3MLPA 1R5IB 4YWGL 4KTEH 3OX8A 3IETB 4AENA 4M61B 5DEZA 3RYMA 3AREC 3P2TA 1NCHA 3MLTB 4U1MB 2GY7B 5E5MB 4WW2A 3VGDA 5SX5H 3D07A 5JZ7D 4BINA 3QC5X 2Q6WB 1FFPB 3QFDA 5JQ6H 3J7HA 4HIIB 4G6JL 4LP5A 4X7SH 2VDOL 3UMNA 4BK4A 3WE6A 2MTPA 1FRGH 3B43A 4K7FA 2Y2TA 1B88A 5GSRB 2DQCH 1P4LB 2ICEC 4PLJD 1A6AB 5DI8A 2OZ4L 2P5WB 1G6RL 2D3VA 3CFBA 4Z7QE 4I18B 3FQXB 3QDMA 3ZBMA 4XZUA 4EUPA 4YSSA 3SY6A 3INUH 3QEQB 4Z7WF 4C55A 1W6WA 5BRQA 3TA3B 4N22A 5EB9A 3CBKB 5J5EA 1MCEA 1XBDA 1I9RH 2NY3B 5D1QA 1E8ZA 5I8CB 4PVLA 2VQ4A 5HI5D 2FQDA 5IBUG 3U30B 2AITA 1TCMA 3KPPB 3WFHA 3CFKB 3QUHA 5EOTB 1W9XA 4M1CD 5D7KD 4HSQA 1P5VA 3DOIA 3C9NA 2J1YA 4LLYB 1U33A 3FB6A 7TAAA 3MRMA 3NZHL 1F90L 1ZXQA 2V7HA 5IMOB 2FSEB 2VDMB 2VAAB 4G70B 3CSGA 5ANMA 5E6IC 2YGNA 4GRWF 4PY8I 2CO7B 2HT4D 5E99H 2UYLB 3S37X 3VQLA 4FA8A 2D7QA 4PHZA 1OCRB 4JK0D 2VDPH 3SHSA 3IDMA 2DI7A 4P9HL 1AACA 3HCVA 2R9HD 4P9HH 4FXGB 1MCPL 2G2RA 3MRGB 1C5BH 2WSKA 3KYMB 4FZEL 4UM8B 3LPOA 4GOSA 5TPWH 1KG0A 4AX3A 4PJIF 5T33L 3WO3B 3R1GH 4P2OB 3C8HA 3DJTA 5I73B 4B5EA 5DQ9B 1KIRA 5GGTL 4ODUA 3PUUA 5ABDE 4KKZA 4H8WC 1JZGA 1FNAA 3EH5B 1TJIH 4G6MH 4JG0H 3BVWA 3LIZA 1TJIL 4JG0L 5FXCH 3IBEA 3LEYH 4M5ZH 1DUYB 4BSVA 2NY7L 1EEUA 5HGBB 1Z6JT 5K9OB 3CXFA 4G9FA 5AAMA 4KPHL 1U42A 1O7VA 3MLYL 4OD3H 5FFGA 3LXBA 4MA3A 4RRPM 2EE6A 2XX0A 3HUJB 2PCPA 1MHCB 4N24A 3RVTD 4G42B 3QI9A 3KYKL 1E5UI 1F11B 2E76C 1OHQA 4K23L 1HHIA 5IT2H 5LCVL 3WTVA 3C5ZB 2C9AA 1MXGA 3BH8B 3D6GA 3RIFF 1RZKH 1EERB 2ZUSA 4KJQC 4DP5X 2CUHA 3GSQB 1P84J 2AXWA 2AJSL 4XN8A 4ZT1A 3FOMB 3RVUD 4C83A 5A2CA 1S7RB 3QULB 4XB8A 1LQBC 4IOSD 1FVCB 3C8KB 1HJCA 5ESVB 4PJCB 3GC3A 2QADD 3PU7A 3U7WL 2NNFA 2F19H 5CEZL 1E4XL 1LK2B 1W6LA 3MGOA 4HPYL 3DTUB 3BPOB 5EZJA 3CPLB 3MOBH 5J11C 3KL5A 4WF7A 1KJ2B 3TNNA 2LGNA 1U3ZA 3O0LA 1KJMA 1KZYA 2F53E 4IRZH 3W0WA 1YJDH 4P04A 3T0EC 4BKSC 5IBTH 3DX9B 4L37B 2R1WB 3LCYA 1NAMB 5F9JA 3NGBB 5HHPA 4AQ1A 1TTBA 5D1ZC 1KFAH 4RAUB 3ZKXB 5A2JH 1HT6A 1MEXH 3NZHH 1HAWA 1M4KA 3EHBD 3REVB 1A0QL 5E2JA 3FT3A 2ZWSA 4LVHB 2NCMA 5KYXB 3PHSA 4X6DE 5CLYA 1T0OA 3VQMA 1AYRA 1NC4D 1N7ML 4JANB 3S98A 3HNSL 1M7DA 1ETB1 2Y6SC 3K91A 3PCYA 3KPNB 4PJ8D 3QH3B 1D7DA 3JUYA 2A77H 2CMRH 1U58A 3JWNH 3LB6C 4PJBA 2UY7A 2K7QA 2VDKH 3BDBA 3OJ2C 3CX2A 2XVGA 3WU1A 3U2SB 1I1FA 3E2HC 5MI0B 4PJEF 4X8XA 1CF8H 2O5XL 1QBLH 2X7LB 3S5LG 2HT3D 3QRGH 2X2JA 5DVOA 5D93C 1P5UC 2XG4B 2BCKB 3VGGA 4M3KB 2J20A 4NQUA 4A7SA 3T71A 2HX9A 2R0ZH 3O6FB 5GRJL 4KI5D 2X05A 1C08A 1U8NB 3GHBL 2ZOLB 3OJDB 3BISA 2OI9C 5FWQA 1HEJC 1HHHB 1NBCA 4L2LA 4JO3H 1WFTA 3K1DA 2HN7B 2JWYA 2F54A 1JPGB 4OQTH 2E9GA 3R4DA 1IGCH 1I3RA 3VFRA 3HG2A 2OW7A 3DXAB 3P77A 3ZOAA 3V4VH 4AMXA 5DVNA 3EGXB 1OSEA 5TTRA 3AUWB 4U1IB 4B53A 4ZFOA 5TDNB 1GW0A 4QLRA 2WKGA 8PAZA 4R7DA 4P0DA 3BW9A 2HFEA 2IXQB 3FUFA 3MJ9A 1E5CA 2QR0B 4TQIA 2R0KH 4XNQA 4D9RE 5D7JB 2XU9A 1S9XB 1Z7JA 4K94L 4KK9D 4KMTH 3W11C 3RWGB 1YAIA 5C6WH 1UH4A 3I75B 4PVNA 2PO6D 2X6CA 4Z7UB 4ONOA 2GB2A 5DVMA 3WLBA 2AQSA 4DP1X 4IMKC 2LABA 2H4EA 1R3JB 2UXGA 3VXRE 5L4FA 2AERT 4WCYH 4XNAA 3WUWG 3G5VA 4G8EB 4XRCA 5I1CH 5BV7L 1FHGA 2DQTH 2R2BB 3VA2C 1E3FA 2ORBL 4U05A 2LU4A 4QHMA 2RGSA 1YNKH 2OMVA 1EEZB 3VW3H 1EXUB 4L9LB 5I6XC 5INCB 3SDXE 4MA7H 4UI2A 4EZMA 1WGVA 4KUZH 3ZHFA 3HG4A 5FV1L 5AQ0A 4X0NA 3MLWL 5E9DA 1GS8A 1TG8A 2YARA 2VABA 4UDTB 5C71A 1DQDL 3VMOA 2P47B 1P2CB 4HZLB 3S37L 3RWJA 3BZ4A 2CBMA 5FM8A 2IGLA 1BF8A 1D5RA 1X4ZA 3VM7A 1FJ1B 4HUVA 1AS8A 2BWIA 4GBXD 5KBMA 3BP4B 3UBXA 4XCNB 5J57B 1NOAA 4FADA 1LO4H 3UC2A 5CJQH 1N26A 2L3BA 3D8MA 4ZQKA 4R2GC 3BP5A 3WIHH 3QW9A 4N87A 3OKOB 1IBGL 1SMAA 3L7EB 3EBIA 2HMID 3WY3A 2NYZA 4XBGB 2HLAB 4FQXB 3NP4A 3IDIB 2JCCB 2NY1B 3I6KA 1KTLA 1U91A 4W9JC 3B9KA 3DETD 4GNKB 4O2EB 5MEND 5F44A 2VZUA 1J5OL 2V0AA 1W8NA 1LO0L 4NX0A 5IQ9A 1MFDH 3H9HB 3DTDA 4HHWA 1B90A 2GJ6B 4TNEA 5DJZB 4YOKA 3U83A 3RUGE 2AKRB 4Y5VA 3EFOA 1PZ5A 1O0VA 1I9IH 2BDNH 2XG5A 2FO4A 3P9MB 3H9ZA 2KHAA 1YN6B 1CYXA 3BVNB 2XQBL 3KBPA 4ODTL 4GINA 5BS0D 4ZMXA 4JLRB 1LO2H 2CRIA 3GSRA 4HAGA 1I3UA 4LLDA 1M9SA 2GEQA 1R17A 1BIIB 4PY7B 4OF7A 3QJRB 5E95B 3TBBA 1I75A 2P5EE 5I6MA 1KCLA 4Z3EA 2NNRA 1KCKA 4Y5YC 3BRDA 3CHXA 1AGEA 1QWNA 3QFJD 3KEDA 5JHMA 2EJ1A 3QDJD 1G6RA 1T0NB 3QXDA 2BMKA 4KHXL 1K5WA 3MRDA 4U6VH 2OFQA 2YD0A 4FFZA 4K7PH 3S96A 2H8PB 1ZAGA 1WD9A 2Y1AA 2R56H 3GHEL 4Q52A 4QXGH 3RGVC 2D7TH 4JGNA 3S5LA 1KXTB 4DZ8A 4CN6A 4AJWA 1R3KB 3QK0A 3TEWA 2LU7A 1JFQL 2J7LA 2RHEA 1EO7A 4ACTA 2YMXH 5KSUB 4X4XA 4LHQB 5LO7A 4ZTOH 4FQQB 4N85A 4NWUH 4G8IA 4I0CC 2BY2A 4AYFA 4YGAB 1A3QA 1Q38A 4PRBB 4E41B 5GGRB 4FC3E 2P5PA 1WS8A 1DVSA 1M71A 3L3JB 3OTTA 3WEXB 1L0YA 1L9OA 4O2CB 3CDYA 1RCYA 1CG9A 4BQCA 2WKLA 3S5YA 3OC8A 5HPOA 1MAKA 4JKPL 4JQIH 3VXQA 4CSPA 3T0DA 4YHNB 1T4KB 4YDNA 5T3ZE 2VLLB 5MHSE 3N41B 2WIMA 1KYOJ 3ARDA 3RGHA 2J6WA 2LR4A 3U36A 3V7MA 3GIZH 3LRMA 1G9MC 4KO6A 4R4BB 5I16A 2VMCA 1FVEB 1HL4A 2BY0A 1VLXA 5F7DA 5LXVA 1KLFB 2OPCA 3D08A 3V9FA 4Y19A 4X9GA 4EXPX 1N2RA 1GXEA 4JFDE 1AIFB 4ODTH 3KPRB 4PJAF 1THAA 3TT3L 3UBXG 2FYVA 4XVUC 4M48L 4ZODA 4AYMC 1URIA 1HKFA 1ZXKA 2VDRL 2TRHA 1B0RB 1YG9A 4DHLA 3E6FB 4PRHB 2NUTA 1BM3H 2WNWA 3HS9A 4XMWA 1ZV2A 3TM6A 3RTQD 1NKGA 1WQVT 2AQ2A 2P5WE 3QJUB 2YGQA 2H1PH 1R0AL 3ZRSA 4Y4HC 1BFTA 3KYAA 4OKVA 2ZWLT 3ECBB 2BSRA 3ASOB 4X6BA 4E5XG 4Y9FA 2KERA 3T3MF 1AR1C 1OM3H 2X9YA 3HE7C 5KBLA 2C34A 1HHJB 2E3VA 3ULUF 4XNMA 5D7LB 4LHUD 4D9RD 2Z91A 1IVLA 4XPHH 2ED7A 5ADOL 4YHYC 3GQFA 1H19A 5F8QC 1I8AA 1SM3L 4K7PX 2D4DA 1E5YA 4P5RA 3RFZB 2KI6A 1HINL 3CNKA 1LILA 1RZ8A 2AHIA 2FDBP 2V4LA 4D0CA 3KJ6L 2YOCA 1T83C 4NKMB 1W72H 4IGBC 1NFDE 5E4EC 1AY1H 2WZAA 5FIEA 1TZOA 5FOBA 2EYSB 1SYSA 1AKJB 1X7TA 4P59H 5AWNH 4PJXE 4IKKA 2MNJB 1QYGH 5DLLA 3C6LA 3EJYC 5CZXD 1JP5A 2ZQKA 4QOKD 4U1JA 5C0NC 4GEIA 5IREA 5DD5H 5ALBL 1P9MC 4MJHA 1N8OE 4LF3A 2XUWA 5AVXB 5GQBA 1KTJA 4NQVB 5KS9F 1AR1B 3FSOA 1CICB 5CGYD 1Y07A 1A7OH 4X99B 5EU6D 1JTPA 3OVUB 4E9VA 3NCWA 3T6QC 3O6FC 4KKPA 1EDYA 5FGSA 4WI0A 4PJ5D 5E2WH 4ZW7A 1VB9A 2B3IA 3GZOA 5DS8A 5KWYC 4GRLC 4LCUB 4Z0XB 4JHAL 4X7TB 4Y5XA 3ZYOA 5JHLA 4XPAL 1FPTL 2E75C 4FS0A 3DVGA 4FNTA 4Z78A 4ZMVA 3H9SA 2P80A 3S3CB 1CFMA 2XZQL 3QZLA 3K4AA 6PAZA 3VFOB 1GKOA 3CZKA 3QZBA 4UQ2B 5AW4B 2CHNA 3G04B 4YHPA 4QRQA 5C0CB 5DMYA 5BUAA 4JRXE 4Y4KC 1PMYA 3WNOA 1HESA 3ULSA 2BVPB 1Q1PA 1CXLA 4GLRI 1HDMA 1ZVYA 4MX7A 3IAQA 5D72L 2EEAA 5FA3A 1TYJA 2DI9A 4PYHA 4ICXA 2Q6WA 1UHVA 3RLSA 2EC9U 3C12A 4ZS6C 2BP8A 4F8LA 4UT6H 3QQ9C 2OTUA 1I31A 2AXGB 3H3PL 4XN2A 4YPGB 5CJXA 3WE6B 3PWJA 4W93A 1DP0A 4PGEB 1A4AA 1KB5B 4TSBL 3R0NA 2VDPL 4PJDB 4FQIL 4RWHA 4TQEL 4OI8A 5CCKL 3E9TA 1FLTX 2HVKA 4XMXA 1QRND 1CD9B 5HHNA 4R3SA 2D0GA 1T1XA 3V0DA 1USZA 2NX5B 4JHVA 3UJIH 3VVWA 2X4OB 4HF5L 4YDKL 4HF5H 2NQDA 4RIRB 4B5ZA 2MQGA 2ATPB 1IE5A 2UUDH 1A1OB 3QO0A 2Y7OA 5D7SL 5CKGA 1R3IH 1GZHA 3MZTA 1QBLL 2ADIB 3X12A 3KPSE 5F9OL 4OLXH 1ILUA 1NKOA 4OV6F 4QO1A 4E9TA 1F00I 4MQTB 2QGDA 1CD1B 4I13B 4QHPA 5C0IB 4HS6A 3WKPA 2CHWA 2GFBA 5J56B 7FABL 3VXRD 3SJVB 2NXYD 1KCVH 2BSTA 2DMBA 2CO7A 2K70A 1UB6B 3P4MB 2P46B 1RJYB 4ZOEA 3IPEA 3RGVB 3SOBH 3CHSA 3LS5L 1SDDB 4MQ7A 3ZTJG 4TVPE 3F7VB 3BZEB 4Y4KD 3B7SA 3TTSA 1BZ7B 2B15A 4JM2F 4KK8C 1CFVH 3QSKB 1E4HA 1XD0A 1DQKA 2O6FA 3FONB 5L2KD 3S0PA 4S1QH 4B9CA 4ZS7L 4P2OA 1N5YL 1RUMH 2A6DA 5D1QD 4Y4FC 1P9MA 1C1EH 3BAXA 3MV7A 4QYAA 3VFPA 3WS6A 3LRLA 4X7CC 4B7LA 2DQDH 2MJWA 3QP3A 2WC7A 4KKNA 1XCTA 5A3IC 1SY6A 3GMMA 4HG4K 3DX6A 3DGGB 3VGAC 5KSVB 3GXFA 4G9FB 3O9WB 3ZDZE 2HJFB 1F6LL 3DX7B 3L3IA 4C59B 4KI5E 3DNKA 2YJQA 1USQA 3CSPA 4XX1E 2WLLA 3QI9B 3ESVF 3MA9L 4FQ1L 2DQTL 4BH7B 3EG9B 1T6VN 4Z7IA 1CDUA 3L08A 4LFHD 4QWWD 2VDKB 5GSVA 1XB3A 3FN3A 2H1XA 5AAPA 5EZLB 3KCWA 4PJ8C 3L1OH 3ZE1B 1MFVA 3QUZB 3QUMH 4ZYKA 1N19A 4EN3B 5LGJB 4FXKB 2HB0A 4GXVH 4JZJC 1AZUA 5B3SB 1CFTB 1OP9A 2OXHA 2W65B 4X9BA 2HUEA 3OKMA 3K72A 1BCIA 1E5BA 2V2TB 4FMFA 2BP5M 4LL4A 4RAUA 4Z7QF 3V4VB 4AGQA 5HHXH 4LQFL 2QHRL 2HVJA 3AQDA 5DVKA 5I17A 2JK5A 1TMCB 4MRBA 3CVIH 4NZUH 5LQBL 5FC9A 2LLGA 3R06A 3HVDA 5IESH 1ETA1 3Q3GB 4F33B 4Y4HD 1UB5B 4LAQL 3BPNC 2VDNH 4TVPH 1CLVA 3LH2H 3MC0A 2VL5B 4O00A 2Y7NA 4OZHB 3FQ1A 4PG9B 3Q2CA 5C09A 3VFMB 4OGQC 3IXAB 4HUCA 4PJ9B 4L3EB 4PJBB 3MRCB 2LU5A 4FQCL 1AZCA 2GI7A 4RQQA 4JFZH 1OANA 2P7TA 2DDQH 3CD4A 3HE6C 1KDIA 5GHWH 3WJMA 3RWIB 4CADA 2P44B 4YDJB 3IPBA 4WY7L 2XG4A 1G87A 1QLFB 2A9AA 5SWZE 4JFQA 2WTRA 4TRPL 3T0ED 1QATA 1OSZB 3X14A 4PRHD 3GBDA 4R26L 2HPOA 3DVFA 3MRHA 4IMLB 1PFCA 3IFLL 3ZKND 5CJ5A 3R8QA 2BM3A 3TBCA 2D03H 3BAWA 2IPKB 1G1OA 2QJDA 3DIFA 2Y4SA 5CN1A 2BRRL 1IGIL 2C9XA 3NEOA 4P2QA 1WVZA 1M1XB 5H35B 2AGJL 4XC3L 1CL7I 5F7KC 4Y4FD 1A4JA 3EGXA 2VT0A 1FYTA 4Z76B 2E4TA 2UX6A 3IB4A 3NFNA 3R18A 1A4KA 1CZ8L 5AOKA 4ZXBA 1HN1A 2H6PB 2XN9B 4P4RA 5FW6A 2IGFL 4XPBL 3W0WD 2O5ZH 2XQYG 3DSFH 3ISYA 1R75A 4BZYA 3FPYA 3NPSC 3TBWB 1U9KA 4J23A 3AAZB 4LARL 4Y4FA 1KPVB 1DLFL 1EUTA 3I75A 4PRID 1UM4H 4WHYG 4WSJA 3VRIA 1RZIB 1E3ZA 4V1DA 3O8XC 1QMUA 2Y69B 4YSEA 5I75B 4MDJB 4HVBA 2OLDA 1O6TA 2IPTH 1YO4A 4P2YA 4I3GA 3BT0A 2O30A 1YYLL 5I26A 4M8UA 1QBML 5D7IA 4V11A 1IIKA 1O9ZA 1OSPL 4J1UA 5C08E 1IGTA 4GRLA 5HD8C 2EDBA 4BKTC 1E0OB 1EXUA 1TCRA 4L9LA 2WXFA 2WO2B 1QR4A 3LOWA 2HFFB 3KDPB 4X6DF 1IAKA 3AGWA 1E9OB 3T77A 5MEOB 1EO8H 1PTZA 2AEIT 3OM3B 3POCA 1JNNH 4YR6B 1EBAA 2OR9H 4PBVC 4OCSH 4JAMA 1K85A 1KDJA 5GS3A 2RACA 5AG8A 1P2CA 1JGEA 1ETJA 4WK0B 4K5LA 1BLNA 1CS6A 3OR7A 4MA8L 4FQJH 3AWEA 5IUSA 2VYRE 2AJVH 3OAUL 2VITB 3S8GB 1NGPL 3ZU8A 2BNUB 1K4CB 4FFVC 1IC7L 2QEJA 3MV9E 3V0WL 1UT2A 5HHOD 1TZAA 1NUDA 1BZ9A 3QORB 2Q86B 3QIWB 4ZFFA 2XKNA 3ZL4H 5I76B 2DB8A 1ZVSA 3CXDL 2X4NB 4RFNB 1FNEA 4PW3A 3D52A 2ZOKA 4ISVB 5F72S 3ZJAA 1LD9B 3RAJL 3WJJA 2WXJA 4WHTB 5E1AA 5LBSH 2V9TA 3HZ3A 4FQXA 5GZND 1DQVA 2AQ1A 2VZ3A 4WENB 3MJ7B 4GFTB 1U8LA 3BAIA 4OQ1A 3DBSA 2CLZB 3L5WA 3MCYA 4X7SL 1YQVH 4P06A 1ZDQA 1A7OL 3H9HA 3LKPA 3O45B 1CZ8H 2EDFA 1PQZB 1D9KD 2H1LM 5LN4A 4JFUA 2P8PB 5EUKA 1OEZW 3H56A 4N0CC 1P7QA 4JFOB 3ZT7A 3CMOH 4OZGF 4YBQC 4P99A 3V2AR 3OKNB 1K8DA 3SBQA 2ZAGA 3FFDA 2FNBA 3H7LA 2AJYH 4NWUL 5B22A 2HRPH 4NQTA 1DQJB 3D2TA 4PG2A 1JHKL 4JDTL 1B4JL 3GBNH 4CU7A 3GINA 4OZFH 3TO2A 2EACA 1U3YA 4HULB 1EHXA 3IN2A 3ILEA 3Q6GH 4A6YA 5E2UL 2OK0H 3GSOA 5DO8A 1AGEB 2PWEA 2V8MA 4PJFE 4MXQD 1CTOA 2CHDA 2M83A 1XZ0B 1OPGH 5E94B 3ARFC 4HIJB 4DUWA 1IGJA 1A0QH 2P5ED 4FAAB 4H8QA 1JD7A 2WQXA 2DEWX 3KVQA 1XX9C 3V6ZB 3P40A 4H1LH 4XN1A 3F84A 4RA3A 3B2MA 4UQDA 2DWSA 3WDJA 3ELQA 4DO4A 3LXUX 1XEUA 4WTWA 4KVNL 2OSWA 1T22B 4QRRB 3NIFF 1KTCA 1K8IB 2LAGB 2YFNA 2JKSA 1IFGA 2YBRB 4Y16C 1I7RA 4K73A 5A43C 2R27A 1P7KA 3CXDH 1NEZG 4H20H 2X4QA 1JNHA 3NIDB 4M7ZC 5T3XD 4Q2ZA 4HPOH 3LVEA 1A9BB 4HPOL 3H8NA 3QWOB 5HYJD 4BFNA 4KHTL 4MSWA 1U8HA 3O8XD 4P48A 1JZIA 2BERA 1CGUA 4HGWA 4KZCA 4H0IA 3BSZA 5D70L 1AP2A 3SGEI 4LBEA 3SPGA 2KZWA 5IR1B 1EFXB 1ZS8B 4NJ9L 5EOQH 3KAAA 4ABVA 3Q1EA 3LSOB 1WUNT 1U8MB 5CZVL 3VWJB 2GIXA 3BEWB 3FT4A 5GGVL 3VXMB 3L8QA 3L9RB 5GS2D 5GPRA 4KTGA 2DL2A 4TTDD 4BFFA 1L7TL 2PPAA 4JZNB 4MZ3A 1TSRA 5E9AA 3VXSE 1R33A 2Q7YA 2B59B 4CC4A 3DX3A 3ME0B 3NACH 5ISZB 3IXTB 1KGJA 2WXLA 5C6TL 2ZXQA 2EECA 1T83A 3U4EB 3F05A 3MN8A 1L9TA 2QKIB 4TMPA 3QNFA 1JZ8A 4F5CE 1NDGA 4QTFA 4WUUE 1CD0A 2EDRA 1G7QB 1AMXA 1MWOA 4M4RA 4ZAKC 3T1WA 3VFGH 1ORQA 4XCEB 5TE6H 2QZ5A 4MS6A 3NSJA 2WLHA 5T3ZH 2NW3A 3RIAF 1SMOA 4DVRH 4A7UA 1FO0H 2DTMH 4HFUL 2CPUA 4LPVA 2QGCA 2YC1B 1FG2B 5J1AB 4O4YH 4WEEA 2FGWL 4I5BB 3H55A 3KH4A 4Y16B 4IJ3B 5SWSB 5BVPL 1LGVA 3DK2A 1Q9WB 4XX5A 2BC4A 3NAAL 3UYRL 3QA3B 4Z18A 5CP7A 3VD7A 1IT9L 5D9SA 1V7ML 4AYDC 1ZLVH 3VI4A 1DVYA 4F2MA 4TTGA 4NQEB 1JF1B 5FYJL 4UT6A 2X4PB 1DFBH 4M93C 4TVSa 3AVEA 3GXNA 4YHKL 3KPLA 4XNXL 1GVIA 1OTTD 3QT2A 3RQ3A 4AYEC 3TWCL 4JO1L 5DFWH 1QFHA 3ARGC 3ATAA 1IBGH 5I19L 3DV6B 4ZUVB 1UWEH 2AEQL 2HFGL 2N7SA 3ZE1E 4U1JB 3BUTA 1HK6A 1K3ZA 1UA7A 5EBMA 3SCMA 1JGUH 2ICES 4YSCA 3CFUA 4PCKA 4DTGL 3P0VL 5E70A 3EOAA 3KH3A 2C8NA 5AZEL 2WZPD 25C8H 2H26A 4JCMA 4B97A 1T7VA 3HZKB 4MXQC 4XR8C 3FUNA 4BH8B 4GEJA 4FQIH 5IMLB 4F2EA 1NEZB 4UTBL 1TQCC 3F01A 4UAOC 1K6QL 3MKGA 1SGKA 5EIIA 2F74B 4I1RA 4G9DB 4LLQB 4M1GH 1A66A 2X4RA 1YMMB 3MNVB 1TSHA 4YLCA 4KY1L 2WXIA 2BVTA 5ELIA 1J8RA 4QHNA 1AXIB 4GG6E 1Y6MR 1G7IA 3J2PA 2HMIC 3KLQA 4ATWA 4YHPB 1AO7A 5IFAL 1YHPA 3MLZL 3B3IB 4EIUA 4F8QA 3U4BL 1PLGH 1G9NL 4Q9QL 4RMRA 3VQ1C 3FSZA 2YEZA 2F68X 5IVZB 3HZVB 5AVQB 2P52A 3QQ4B 4NWTL 2KLTA 1J0YA 3R19A 1W8OA 1GJIA 4KKBC 3GDCA 2V9RA 5AZ2H 4O51B 3MKKA 1JD9A 3GF8A 4M29A 2OJZL 2PKDA 1F2XK 3IGUA 3ZDWA 1WSST 5BZZA 3HA0A 4X6EA 3EYUL 3E7JA 4XC1H 3BN9D 1MOEA 3JT2A 3BWAB 1MLCA 3O3BA 1MIEL 1ITBB 2BP0A 4X50A 1VIWA 3NK3A 3MVSA 4KMQA 2E7CA 3QR0A 4ERSH 1PCXA 3S5ZA 3VD1A 1DQLH 3OB0K 4ONFH 2LLNA 1NBQA 1K2DA 4JPKH 4RIRA 1I9RL 1RFDL 5CBEB 1HCFX 1NCBH 4U3SB 3UEZA 3ZDXB 4OLZH 1MPAH 1A3RL 3FXIC 3KDMA 4CUCA 2YAEA 1N3NB 2ZWZA 4HWZB 2ZX7A 4LVNC 2JCCF 5EZOH 4HH8A 2VB5A 4X5LA 2FQGA 3DVNA 3KM1A 4U0RC 2NNAB 3F7QA 1FYHB 2FT6A 2Y06H 2Y1VA 2XWBB 4RISL 4HLJA 4WVRA 3S36L 2ZG1A 2BSSB 5DK0B 3ZE1F 3K74B 3N43F 5HJBA 4IBZA 2VERN 1RUQL 3QUXB 3GSUB 2ROYA 3D39A 3LQAC 4EI5A 3BJLA 2WKOF 5HPMA 2VZVA 2BVEA 3JTSA 1EZLA 4IRZA 3BUYB 4MDIB 3D12B 1VHPA 1B4RA 2VISB 1PG7X 1J5IA 4MXWH 1EIBA 2X6AA 3GRWA 4GW4A 1LM8V 1OAQH 1DBJL 4ZS6D 3OKLB 2O5ZL 3DSFL 4FHBD 5FUCC 4D9LH 3MYJB 4R4FH 1L9PA 1A9EA 2O6CA 3ARBB 2WZ0A 5TDPA 1P6FA 3PAUA 5DFVC 4A04A 1J1OH 4W9EC 1DVZA 1MRCL 3SPHA 5E5LA 3MODL 3P30H 4PS7A 1ZT4A 5HHXL 2HT3C 1ZTXH 2YAHA 3ILDA 4DN3L 2EKSA 3EGSB 3WY1A 2VLRD 1VCAA 2ZUYA 1HYSD 5F7EL 2MOQA 2AEOA 3VDBA 4K23H 4EEEA 4BWWA 4XPTL 2KPNA 2PXYD 1Z9SA 3DXAE 5BRZA 2VXTL 2VNCA 1MJ7H 3WEOA 1BAFL 5JIIA 1KV3A 2F19L 5CEZH 2UXTA 1XSKA 3DETC 3WENA 1SDAB 3G5WA 2DYPB 2EICA 3ARFB 4L4VD 4M62L 4M62H 1AGBB 5I0VA 4Z77B 3UTQA 4J6IA 3OKKA 2N7BA 4Y9EA 5K69A 1YY9D 5LCVA 1P7BA 1YPZE 1OCWL 3D0LA 3UAAA 1QFOA 5E7FA 2WUBH 4XVJH 4YAQA 4MTMA 2CHZA 2GBVA 3W81A 1L9RA 5IBTL 1TU2A 4BA8A 4FD0A 1FIGL 5ANHA 4EZLA 1JZHA 3CE1A 4WEMB 1NBZB 4KJPD 3L6FB 4AQAB 1WLHA 1MEXL 1I53A 2RH0A 2BSDA 3QWRA 4XO4A 5ICZA 3GEWB 1BQUA 2XFXB 1UOLA 2JI3A 2NY7H 4R0LA 1Q0YH 1YEJH 4NENA 5JW4Q 3QS3A 2YRLA 3QUYC 5B1KA 2V7NB 2WMPB 4AKPA 1MHCA 1NDTA 4AYID 1FI8C 3T3PB 3EH4B 1F11A 1FAKT 3BGFC 3FNKA 2FQEA 4NERA 1AR2A 1RURH 1CFVL 5T3XL 3GSNB 5HGDA 5EU4B 4OGYH 1O75A 2PUQT 4TOYL 4HFWA 1TTCA 1FVCA 4IRJB 4EI5C 3NG5A 1QLFA 3CH1A 4ZMAT 3MBWA 5T1LA 4QXVA 3PGCB 5I2IB 1FLRH 3U2JA 1BXAA 2B1OA 2HAZA 4KOCA 4S1DD 2DOCA 2NXZB 1UXMA 4P3DA 1XVSA 2F7PA 1IM3A 3IJHB 2IDSA 5L88H 4F1ZA 5I66A 1NTDA 3JWDH 4FERA 3HS8A 1AS6A 4NZRL 3IE9A 4AQ1B 2AQRA 3BPOC 3DUUB 1T66D 3TBYB 1PX3A 1CBVL 5EU3A 3RY4A 1AS7A 1Q1JL 3STBA 1A6UH 3K0YA 4X42A 2R9HC 2BHZA 3FO2A 4E9SA 3BD5A 4HOMA 3G5YA 3AWFA 1CL7L 1PFOA 2LVEA 4N20A 4JDZA 2V2WB 1O7DE 2GABA 1XF3B 5D1XA 3AAZA 4IW4C 3SKMA 1UZ6E 2Z4QA 3VRIB 4UYQA 2J55A 3HI6L 3VRLF 2FGZA 2WVUA 2Z92A 5AW3B 4ALAL 2PYFA 4R8WH 3TV8A 3VD9A 3OZKA 5KYUB 3ZE0E 3FU7B 4LCWA 3MV9B 1YNTB 2V2XA 4OFIA 1OAUH 1WZ1L 3QB7C 3TN0A 2X9XA 2JJVA 4M43L 2QTEA 4LLYA 2NDFA 3CN2A 4XNYL 5BW7A 2DKSA 1YEJL 2E47A 1LLAA 2YKLH 7FABH 2R2HB 2FSEA 1DYZA 3BGFB 1QX1A 3AW5A 1D2PA 3QEUB 3S8WA 5F0PB 2O61A 4DOHB 5A16B 3B2DC 1TFHA 1VFOA 5GRVK 4Y2DB 4GG8A 3W2DL 3KM2A 2IQAA 4FXKC 1GJWA 1V05A 2O5NA 4OTXL 1I3RB 1TNNA 2YN3A 4M5YH 4NFCA 4DUXA 4L8SA 3WL9B 1WO2A 5IB3A 2X42A 1ZLEA 2IJ0C 3LZRA 2DMKA 2MKLC 5CGTA 5JW4R 5HYIA 4AIEA 4U1IA 3LHPH 3VMPA 1C1EL 3IJEB 2EDXA 3ZE2F 2IO5A 2GJZB 2FTAA 2I07B 4FYRA 5B38B 3SKNA 5L4JA 4M7LH 3WS6C 3FH7A 3BP6A 3BPCA 3E8UH 4Q7DA 5I6LA 4G6KH 3NZ8A 2OMZA 4MNGE 4MDRA 5IKCA 5EEYA 2L7JA 4IU3B 5C07E 1B6UA 1JGUL 3EGDB 4H0GA 4LCIH 2CG9X 1RSYA 2GK0B 2Y36H 1KYOK 5LGHL 4PJFB 2DQMA 5FHBH 4PWIA 4LRNL 5AVYB 1R5VB 5J6GB 5IHLB 5TQ2H 5DHVA 1HCYA 3GSQA 4J3WA 4PRAA 1CU4L 2EZ0D 3AG3B 3IEAA 3LN9A 4TQEH 5KVEE 2OMVB 3MJ9L 3EBAA 3L45A 3ALWA 1T1ZB 4FYQA 2XV6B 4JFDB 3T8MA 3AADB 3V4PL 1ZVNA 2FYYB 5HHOA 2LVCA 1FA4A 3MRRA 1F4WL 1H3TA 3QCTL 2BWQA 2ZG2A 1ZV9A 3L4WA 3DOSA 4OFDA 5L8JB 2GSMB 4WNJA 5IJKC 3ABMB 2OKMA 4JR9H 4APXB 3BZ4B 2YXWA 5KS9B 3HB3C 4L37A 5I71C 4GRLD 3FL7A 1BFVL 1GGTA 4I18C 5HHPB 1IQDB 2K9UA 2WSDA 2XY2A 5DRWA 1CGSH 3S4SA 2X70A 1QRNE 4U31A 2Z31D 5HJ3A 4E9RA 1DVFB 3UGUA 1AGCB 3BP5B 5E9NA 2MRYA 4JCLA 3CFDA 3NJIA 3EO0B 5L9DL 5AUMB 2EH7H 2WAHA 3IDNB 3WTSA 2AK4E 1MCIA 2PW2A 4Z23A 2JIXA 1UZ8B 3MX0B 3HTLX 1TQSA 4J27A 4AXWB 3RWEB 1M7DB 3TBTB 3HFMH 3QC6X 4QXUL 4K3JH 4NQXA 4WK4B 2NY4C 3UGEA 4FLRA 1D5XB 1BQLH 4DWHA 3B9KB 5T3ZD 1U92B 5JMRA 5L2JA 3QJFB 1WBXB 2BXZA 1Q0EA 2WCPA 5TFSH 1YEGH 5TE4L 3JV6B 1TVHA 4FL4C 1I8KB 4OFQA 4FYTA 4K8RL 1BSIA 1PEZA 2AJZB 5K9JH 1I7RB 3GWJA 3ARSA 4UNVA 2NY0B 1QSVA 1ZEAL 2RD0A 2Z4TA 3P9MA 1H8SA 1ZEAH 3FQWA 3QEQE 4NJAH 3VXNB 2OTWB 2IANE 4R84A 2KPWA 4YSQA 3NP3A 1WIPA 4GMSH 4PP1C 4YWGH 2EXYD 3P69A 3J07A 4W6YB 3RJQB 2XWTA 5G55A 4PJ5E 1KY7A 4PS3A 2EVHA 4IBTA 4DH2A 5JR1H 2EDDA 1GSKA 4KX9A 4JRXB 2NXYC 1JPGA 4MA1B 4PI2A 1CXKA 2C4FT 4E42B 1B2WH 4Z3FA 3QYCA 2OMXA 3IRPX 3U0TB 5HYJA 2BZCA 1T0MA 3OAZH 1G84A 1OE3A 4G6JH 2EVIA 2OI9B 1GGIH 4YSAA 5FEBA 1PNDA 3CN3A 5HVHC 2CO1A 3WSQH 4Z5RA 4KGJA 1GCYA 4W9ZA 1TYEB 3R0MA 4UBDC 3V55A 3VI3A 3AM8C 3MRNA 2FIKB 1KXTA 4DZ8B 2K4WA 3CN1A 3MJWA 3SKUD 5CLXA 1NL0H 3QFJA 4R4FL 4LL9A 3B7UX 4IJTA 5BZWA 2MHAA 1DFBL 4M4PA 4NRXA 4RFNC 1BVKB 4HIPA 3LRHA 5EWIH 2WVSA 2EUWA 1BM3L 3QAQA 3KLDA 4IK6A 3E3QC 4Y5YB 2YZ1A 1S3KL 1KBKA 1XGUB 5ICYB 3P1VA 4ODWA 1QR1A 5DUJA 2EO7A 2B4CC 4P5MA 3AZUA 1E9PA 2VR9A 2N1TE 4HEPG 2VN6A 2Y5EA 5ICUA 5INCA 3ULAB 5ILTL 2J56A 5IEHB 3IFPB 2IDCA 5HHQA 3UG5A 3ZGIA 5CINL 3ES6A 1ZWIB 3G6AA 1CXIA 4UM9D 2YXVA 4L0ZA 3U79A 1QSFB 5L4IA 3VD2A 2VABB 4I77H 3IDUA 2AEPL 5C9JB 2LU3A 4A7TA 5HDRA 3M8OH 5ITFB 2I60L 4GO6B 2BVYA 5F7DB 1FJ1A 3GSWA 4U2YA 4OCYH 2VIRA 2J8UB 4Z7UF 5BJTA 1YPZF 3SDCB 2EXYC 1IEHA 1KB5H 3RNKA 3K8LA 2G9KA 2ZCKL 3B2VH 4IMKA 4A55A 2B5IB 3KYOA 5DC0A 3SEPA 1F13A 2COQA 4APQB 2O26U 2OZ4A 4XXWA 4NAJA 4WI5A 1SJEB 1TLKA 1NKRA 1QASA 3FN0L 4OZ4B 32C2B 3U4KA 2XSKA 3EOAB 2AGJH 3ZDZB 5I0XA 1O6SA 2H26B 4AT6B 1MUJB 1LO3L 1AMYA 1P5UB 2CA3A 3FO0L 1JPSH 1DBML 1OO2A 3N06B 4KTDH 3RDTB 2GJ6A 1FZJB 4X9HA 1JHTB 3GZPA 4YSPA 2GHWB 2O6PA 4L1TA 2F74A 5KJRH 3TFKD 5DEFB 1KTBA 1J8SA 3U7WH 5E5RB 3ET9F 4JQXA 5IVOA 3QIUB 1OTSC 2VW4A 1LEGA 2C1PB 2C4FU 2Y5TB 4PJ8B 3UMTA 1H3XA 3DGCR 1CDIA 5DU7A 1GY2A 3VXUA 2VDML 1ED3B 1NANH 1OM9A 2B0SL 3UBFA 1F56A 1XH3B 2GJPA 2Z35B 1RPQA 4FFYH 2X5PA 1RZJH 3NPZB 4QT5B 4K3DH 3ZDXE 5GGSY 3BT2H 4JREB 3HBGA 4WFEE 1B4LA 5F6HI 2CXGA 4NKDB 1SN2A 1WS7A 2ICCA 4OCXL 5KVMC 2QADB 1VF5C 3E2HB 2W0KA 2J8UE 2EIJB 2EYSA 2YPLE 2OTPA 1RY7B 3L95A 3QR1A 4LL1A 4LSSH 3VGAB 1Q1JH 3A3YB 1LHZA 3O3EB 4O58H 4TVUA 3KWWB 3HMXL 3H9YA 1KJ3L 1QI4A 2XN1A 4L4TE 4TLTA 3ATEA 4CW1B 1A6TA 1Z5YD 2MMXA 2YQ3A 1MLCB 3O3BB 4YHOL 3TH2T 1R3KA 5EUOF 5L6YH 2PCYA 2EZ0C 4F7PA 3H4FA 1TJMA 5MP6L 2APBA 1IQWL 2QHLA 1G1CA 3CLEL 3UG3A 1R19A 1MCLA 1JWUB 4FQHA 1ML0A 1D5MB 4DP8X 4LPTA 3O0RL 1CCZA 3WIAA 3AGVA 3K2UL 3SY0A 5CEZD 4WWKA 2WQVA 4FJ6A 5DS8B 1FG9C 5CR8A 5TD4A 5AAWA 3HI1A 1M7XA 3L3JA 5IB1A 4PRPD 2QELA 1K9TA 2QL1A 2XWBA 3U6RB 4BXSV 3A5VA 3MLUL 4HCRL 4LVOB 2KC0A 3SGDH 1L9QA 4B0MB 2ZKWA 3ULVD 2LOEA 3T0AA 3W56A 3AU0A 5GRZA 3QUYD 3C2AL 3H7BA 4RLDA 1HDMB 2FJHA 2G75A 3QO1A 2K78A 4MYWB 4Q58C 1WAAA 3K2MC 3N1QC 4IU2A 4WRLA 3UBGA 1XCQA 3QISA 5CEYB 1Z1WA 1VRSA 2EKJA 3BESR 3KBFA 4J28A 1LNUA 4KNQA 2X9ZA 4HDIB 3IDXH 1RJLA 4L29B 3ZE2B 4YHML 5IIEB 4NUGH 1VADB 4EF3A 4OZGE 4U0QB 4PJDA 4MJIA 4OF3A 2HSIA 3D3VD 5FW7A 1MF2H 1ET5A 1T1XB 4NQCB 1KGXA 1QHPA 5EA0H 3C08H 3Q06A 1FIGH 2Q20A 2Y22A 4PJIB 2FATL 3AQZA 3LRKA 1RU9L 2EAEA 2OMWB 3DUSA 1QABA 3NZUA 2BJML 4X6DA 5I1CL 1OAUL 1XR9A 2WNKA 2ZT9C 4GI8A 4RZKA 5HVWA 3ECBA 1HQRA 4RMVA 4LXFA 4E0RB 5BRZB 2DF3A 4YXLL 4ZD3H 1MVYA 1NMAH 5KSAC 3R7QA 4XPGH 3GDBA 3UTZB 5D1QC 4GIPD 1TZHB 1HZLA 4D0DB 3I3DA 1HSBA 3RVUC 3P4MA 3RGVA 4UMGA 3WELA 1WG3A 1AI1L 4MQ7B 3GJFH 2ZTBA 4HKJA 3SYCA 4PJ9D 3HEIB 4WQOA 3DKHA 4U2ZA 5EEWA 4OF0A 3H9SD 5HYFA 1LK3L 1E7VA 2C3WA 1H9DA 4P5KA 2HKHH 2UZXB 1RK1B 2H0PA 4NLAA 4M6OL 4XNXH 1DDHB 1PZ3A 4L4VA 1DVXA 2JQMA 1BLIA 2D31A 3QE5A 5CFAA 5E4OA 1OF2A 2H3KA 4GW5B 4NM4H 3MROA 3E8UL 5GRJH 2DLTA 2PWDA 2G9HB 3C6LB 3ULUE 4F8OA 1BVZA 4NQDD 4HK3J 3MRBA 3W9EA 1OTSD 3WFCL 4I2XA 4DTGH 4DP4X 4XBPB 2VR3A 1OP5H 3MFGB 4Z7OF 2PPDA 3ZTDC 1NA8A 4Z7UE 4LEOA 4M03A 1C8QA 1GAFH 3F00A 5DQJA 2Y23A 1SLWA 2K6YA 2PYEE 2CUAA 2OP4H 4KK6C 1LDPL 3IWVA 4MCMA 4N0UB 1IMHC 1KGWA 1NGQH 2A6KA 2NLJA 4OI9A 3HI5L 3IS0X 4Z0XA 1CE6A 3DO4A 4PEEA 3TEZA 3PAZA 3WEBA 1UD5A 3DVGB 3LXAA 2YA0A 4LU5H 5KOVC 1DN0A 4Z78B 1TVDA 3CK0L 3CHQA 3KR3H 2ARJA 2M26A 2VR5A 4KRPB 4P5TC 4UOW0 2GC7C 3GIVB 3TH3T 1CYGA 1H0DA 2A9CA 2CRZA 3O3AB 5I2IA 2D3LA 1CC3A 3RPKA 1SYVB 3ESNA 4X98B 1NIBA 3BIKA 2R8SL 2CNZA 3HG1B 5C0CA 5FLVA 1CIDA 1U8PB 1IJ9A 1UUNA 1UWXK 2AXJA 2IQ9L 2OL3L 3RVVD 3WI9A 4Q9QH 3L4CA 3QJZA 3U4BH 1PPIA 4XXWC 1MFCL 1AJ7L 1KF9B 2W60A 5I5IA 4ZUUA 4IS6B 1U8IA 1THCA 3VXSB 4WKXA 3FTXA 5FB8A 3QNYB 1NUFA 4LPCA 1PD6A 3V0FA 4NZJA 3MLWH 5CMAA 3FU5A 1XB8A 1KJ2L 4JFFD 3W9DA 3TASA 4WV1C 2ATAA 1C7TA 5JW4M 2ZUUA 4DP9X 2J5WA 4JZOA 1JPFB 3D4ZA 4IHOA 1F5WA 1ZGLM 2YMXL 3GZQA 4HUUB 1CO1A 4FE9A 1PSKH 5C09B 2X4OA 4MAZA 3ZZLA 2PYFB 4AJYV 2JLLA 4GBXA 3EOBA 4Z3HA 3HE6D 2ATPA 1QEWA 4W68A 5AB2A 1ZSHA 3S34L 4OLVL 4HV8A 3RURA 2PTTB 4JREC 2AQQA 4OW6A 1P4IL 5E8PB 2APWA 1INEH 1RZGB 5F89B 2WXMA 3B56A 3DBXB 3CZJA 4IM8A 3LRGA 2C9PA 4G6FB 4URTB 3GJEA 5JW4N 2C7FA 3EOTH 1EHNA 1VGKB 3M6DA 5JNYB 4YUEL 3PHOB 5AYTA 1Z5LA 4JFEE 1WBZA 3N1GC 5D2LE 3KXFA 4ODSL 1J5DA 4HS3B 1S9VB 4JJOA 2I85A 4Q14A 5IW1B 4BSWB 4UV4L 5LBGA 4G82A 3CFIC 1SDDA 1EJOH 3C5XA 3S36X 3WV0A 4ODHH 2XYBA 4ODHL 4WHYH 3ZXAC 3RFRA 3WNJA 3EJQA 4MAYB 4JDVB 1C5BL 3KWXA 4FZEH 4NAMA 2PLTA 2HTLD 4OGAC 4DP7X 2OX5B 3T2NL 1DVUA 2OCCB 5LB1A 3B37A 2Z93B 1X7QB 4UNIA 1ND0B 1A6AA 2GJZA 2I07A 3PLYA 5DI8B 5B38A 2H6PA 4FG6C 3TT3H 4GQPH 2NTFB 3DGGA 5KSVA 1DE4B 3QDMB 1TJGH 1TQTA 2VWEE 1NGWB 1SJVA 3BZFB 1J1XH 1U8QB 3TZVB 2SODB 3UAJC 4LLWB 1RL1A 4L1DA 1I4FA 1QFUH 1MFCH 4ETQA 4MCYA 2CBPA 2WLLB 4F3FA 5KSAB 5J6SA 4PI0A 5I8CA 4BFEA 1ZA3B 2NNCA 4YSDA 5JHLL 3WFHB 1G9HA 1NC4A 4JL2A 4TVPD 1WP6A 2AJ3B 3WJLA 3IF1B 2I5YH 1D6EA 4PRIA 1UCBL 4JHUA 2P5EB 5DRXA 4KJWD 4ZJ9A 5I30L 2Z3FA 1MJJA 4K71B 1MI5B 1REIA 2V7HB 3QJTB 3UZEA 1IAKB 5MEOA 1P6WA 2GTWA 3MUGB 1AR1D 4AM0B 1JNLL 1YEFH 3GEFA 3US1A 2FYYA 1CICD 2TAAA 3B3BA 3FQYA 3LKQB 1XGTB 2AI0H 1K72A 3IVKB 3FDWA 3D48R 4PM1A 3L5HA 5A3ID 4EQ2A 3THML 3VH8G 2NY5C 2VZTA 2GJRA 1BLNB 2VOTA 3DX8A 3PV7A 4RA0C 3TEYA 3CSYB 3SPVA 1ZLUK 3HJ0A 1PDKB 2VITA 3CVHA 1MW3A 3KJ6H 4ELMB 2BNUA 5AB9A 4F7MA 4YO0B 4KITB 1O9WA 2EC8A 4PJHB 4QI3A 1ADWA 4UT9A 4PQXA 1LL1A 4ZFFB 4XMUA 2XXCB 3RNQA 3BQUB 4DP6X 4KXZH 1I9JH 4CSTA 4FTVA 1AGFA 1AXSA 5HGHA 5EO9B 3REWB 3TO4C 2BLFA 2DQFA 2IAMA 1UZ8A 3GI8H 1TQBB 3MLVH 4KPHH 4POUB 4QXTA 2DLIA 5F7LB 4AXWA 1XFPA 5DD5L 5ALBH 4RDBA 2P24A 4PGCA 4UUJA 1OTUC 5FKPA 1YMHA 4FDWA 5JQ6L 3QIBD 5JPNC 1AAJA 4NQXB 4X9IA 1EHLL 3BXNB 1X9RA 2QMJA 2Z31A 2F7IA 3MJ7A 2W8CA 1GGIL 4WTXA 4MKMA 5L2JB 2CLZA 1H3PL 4ES9A 4QR7A 5CGYC 1J9QA 2K6WA 5JIDA 3D09A 3LKPB 3O45A 4TNFA 5BVJB 1KTKE 1G1KA 2GITB 1MHHA 1N0LA 1S9WB 3LY6A 1JI2A 4LAJH 1BMZA 1A1NB 4PLKC 3NJMA 2FEEL 5KYNA 1F3DH 1WFOA 2AQTA 1MHPL 3MGOB 5ISZD 1K8DB 1CGWA 2XZQH 5IHWA 3CIQA 1QUNB 3CPLA 3V6BR 4I0KA 2R4SH 4OZIA 2B0SH 2R69L 3TNNB 4LSQL 3N0PB 1KYUA 4LSQH 3MTXA 4MQSB 4PJFF 2YPLD 2OA9A 4KO7A 4WNSA 2H47C 1JRHI 2OK0L 4XXDA 4WI8A 5C0AE 2HJKA 5FUOH 2VLKE 3KE0A 4LEXL 3FCUB 4HZAA 4WFED 3WCYA 2E4FA 2SEBB 2ZUVA 3FT3B 3PAYA 5AL0A 1FZOA 1ZT7A 2XBTA 1C8PA 2JXMA 4HC1A 4WWOA 2BNQA 4L5FE 2R2CA 3AABA 1EZUA 5HHME 1SEBA 1G9EA 3E9UA 4M93B 5MP6H 5SWSD 3THMH 2I60H 3ML8A 3M7FB 1CB4A 1XGYL 1NCAL 1J0ZA 4FNRA 1MDAA 1BVKA 4XPFL 4V1DB 3QDGA 1DQTA 4GT7A 5HTSA 1TT6A 3UP6A 4DEPB 3AFLA 2UY7B 4Z8FL 1QSZA 4HUXA 2FATH 3QDHA 2WY3B 2DRUA 1JXGA 3KLLA 1BZ8A 4UQ9A 2YBRA 3N3EA 4YHIA 2KLRA 1FN4A 1OAKL 1MAJA 1WIUA 5LAXB 4ZMOA 1XIWB 5LVEA 2XKUA 4RCAA 3Q1SH 1R5WA 2IAMC 3MLUH 1QNIA 3UZQA 2BCKA 1FFPA 5FYKU 1I8LC 2WBWB 3QFDB 3BZDA 3GXPA 4BGLA 1E42A 2CJSA 3QYNA 5DD0H 1C08B 5MENE 5HGAA 4XGZB 5SWQB 2E8ZA 8CGTA 1N0XL 4F15B 1B0IA 2NCEA 3DJ9A 5GGUB 5BS0A 5I1EH 3VFRB 3COOA 4IGBD 4EIBA 3IMRA 4AY0A 5CAYB 4URKA 3SGJC 1RUML 5IWLC 2VCOA 2VIRB 3BPNB 1N5YH 3FT4B 5E6YA 3VXMA 2HRPL 3TF4A 4LLMB 4GB9A 5IY5B 3FAWA 4C57C 3HNTH 1OAYL 5DMIL 1ZLWH 1RHHB 4MGXA 1N59B 4PB9H 3CFKA 3TC9A 3UROR 2WW8A 5INDB 4F7TA 4LKXB 2CIIB 1FC1A 4JPIA 5JHDE 3TCTA 3ULVC 3KLHC 2F1EA 3TEXA 4FGMA 4CC1A 2VO8A 3FB6B 3NSXA 5DMJB 1TKWA 4BIKA 1J8HE 1PYWA 3FFCB 3OXRA 5J0BA 5E03A 5IMOA 3VB9A 3QIWC 3MFFB 4EJ1C 3ZRCC 2QSCH 1MCFA 2GT9B 5E4AA 3L5WB 3H3PH 2YK1H 4G8EA 4K4KA 5DYOB 4NXKA 5I24A 4X0KA 4PLKD 3TPUB 4P46A 3NIDF 1LO0H 3GRGA 3VMNA 1F6AA 2BNRE 3P2BA 3HNSH 2VRKA 4A67A 1NPNA 3KYMA 5F9AC 3R8BB 3AS1A 3BKYL 4AQ8C 2VC2B 4OZFA 2VZOA 3WMPA 5DQ9A 2DQJL 2WD0A 4MZIA 4ODUB 5T5NF 3O4LE 2VDKL 4G7YL 3MBED 1XIWC 4UT9L 1GGYA 2AVFA 4A7GA 1IUZA 1NL0L 1C7SA 3P73A 4U3XA 5JYMA 4P8QA 2Y07L 2DM3A 4GPVA 1MVUA 1UOWA 2DKUA 3X1BA 1L9NA 1OW0C 3IRZA 1MFEH 3RZWA 1ES0A 4YL4A 3W11D 2R0ZL 3QNXB 1KPUA 1CLYH 1AZBA 1I1CA 2MTAA 4EE2A 4NCC1 4BD4A 3WIFB 3I2CH 4I48B 1G6VK 4ZZFA 2IH9A 1U2YA 3WNMA 4AE1A 1TQCB 4QXUH 5E8OA 3I50L 2WYTA 4MNQD 2HLAA 2ITFA 3C6SA 2DN7A 2ZJSL 4OTXH 35C8L 3EDFA 1KTLB 3MV7E 2H2SC 2ZZUT 3BDYH 1JWUA 2C7UA 1G5AA 5BUGA 4QRRA 4F91B 4H88L 3BC9A 1ZGLA 4X6CE 1QSEA 4XWGL 4K8RH 4F7EA 5ITBL 1AHWC 2CH8A 2C9VA 1SHSA 2KS0A 1MFBL 3HLKA 2YGPA 2HLFD 1YMMA 3CDCA 1XT5A 1DDTA 4DKTA 2X4QB 4JQIA 4TM9A 1JUFB 5J1SC 1NAMA 3X3FH 5F9JB 1S7TB 5TK2A 4JRYE 1KTDA 3B2VL 3MYZA 4N0UE 4WHCA 3TIDA 1T20B 5LGHH 3VFGL 3BKJH 5DS1A 1DQIA 1TEFA 3MREA 4NNPH 1IGIH 2FJHB 1R4XA 3WXVL 5G5DB 5DQDL 1EFXA 4CMMB 2NSXA 2F8IA 2JJUA 4IQHA 2V33A 2OYLA 3P2DA 4MNQE 3MJ9H 3EJZD 4GI6A 3MNDA 2AK1H 2JKRM 5BPPA 3ROLB 4U1KA 1N6QH 3WE1A 4F7CA 2BOLA 1U58B 3HZYB 1FZKB 4PV8A 3I02A 5A2KH 1GZQA 2BOBB 3UCRA 3L3HB 3PWUA 3HKZA 3ME0A 3SB3A 3L5XL 2NY1C 3M17B 1VEPA 1LK3H 4WI3A 1BVNP 1N8ZB 2UZIL 3BAEL 2X7LA 2BPBA 5DMGD 4LARH 3NJNA 2KMWA 2AJUL 4QCIA 3WAJA 2ZP0T 2QQKL 3ESUF 1FNSL 4WIQA 5EWIL 4J4PD 2AXFB 4PJIA 2GPZA 5F71A 2FBJL 4HUWB 1NBVL 3JTTA 4Q0XL 5FO7B 2FWOA 5CD3B 4KZEH 2K45A 1LEIB 1VGEH 5DZ9A 3GLZA 3NUKA 3QYMA 5JDSB 1GPOL 1T3FB 4ZUWB 3VE0B 3QUMA 1GOGA 3BT2L 1OSPH 3APNA 1BEYH 3V5DA 2HN7A 4B9IA 1WITA 5IMKA 3F04A 2VW6A 1J0KA 5KJ4A 3RIAK 1SY6L 2IAND 1TZ8A 5HD8D 5C07D 2CR0A 2X0UA 4W1TA 1NDMB 2CUIA 1ORSB 4MAUH 1SLUA 3HW7A 2IDUA 2DQEL 4UZSA 4ZTEA 3GXDA 1NCIA 1GZPB 4B96A 1IAIH 1MFDL 5DK3A 5F1NA 3RL1B 2PCFA 3LZFH 3GGWB 5C3IA 1EJ6A 1XGPA 5DURB 5TE4H 2FX9H 4XNQB 1HZHL 4TL4A 2CM5A 1KEML 4A7GF 4XMTA 4QHLB 1F8TL 2X0WA 4BRJA 3VNZA 1F4YL 4Y19B 4GQZA 4KKLD 3WLBB 1LXMA 3D39D 1P1ZB 3ELAT 1AIFA 4OD2B 1BJ1J 2D7NA 4X7EC 3TIEB 4O9HL 2C3HA 3FTVA 3GMPA 2ZP9A 3U6XS 3UTSA 4BKLB 2XPZA 1RZPA 4Z7VA 1A9EB 4LCCC 4RGOH 5JORA 1OE1A 1EXHA 3SCMB 4QHMB 5E00B 1T4WA 2DIJA 4WLCA 3MLYH 4F9PC 1U4FA 3MRIA 2EDEA 3C60B 1O7SA 1HHKA 3SGKC 5EEVA 4U1NB 2A6KB 3FCTB 4KNTA 3MA7A 2EINB 2XNAB 2BSRB 5I30H 1E40A 3C5JA 2CDGB 4X6BB 4O02L 2Y3AA 1WFUA 3QRFM 3WO4C 2X4RB 5B21A 2GQHA 3CBJB 1MG3C 2BY1A 2FE0A 3STZA 3UZVB 4AUYA 4AMWA 3JV0A 4TOYH 4HUVB 1I1RA 4NLHA 4P4KA 4XHQA 1JAEA 4TNVK 4JB9H 5JXEA 1G7IB 5I15H 2VQ1A 1LEKA 3MCLH 4QRPB 2ZXCA 4DQOH 1HEZB 4XCCH 4NKOA 1JPTL 2V6HA 2ZONA 3L7EA 3Q9QA 4R7XA 3UYPB 5AW8B 2YUXA 3EOTL 2CIKB 1QA9B 4LIQL 4NKMA 3T0XA 3PDOA 2HXAA 5FECA 2BS9A 1Z9OA 1RUQH 4CVZB 3FO1A 5AKVA 3UPRB 4A2MA 1NCCH 1R47A 1EJOL 3APDA 4QJ4B 4UDUA 1AIZA 3PHQB 5C7ZA 1HYSC 1GS7A 2HUHA 1KJVB 2L7EA 2BP0B 4K9EC 1ZLDA 4PGBA 3VD3A 3HB3B 2KH2B 1YN6A 2DYRB 3DRTA 4LLUA 2JB5L 1IGMH 2D9QB 5T33H 1K2DB 3R4RA 4X99A 1T7WA 4NN7C 2A77L 2HRGA 2AV7B 3EHBB 3KDMB 1TNMA 4JFWA 4LCUA 4S1RH 2W0PA 1MELA 3B34A 2MEJB 1V3LA 2Z7YA 1KB9J 2BW5A 3V0GA 1VENA 2I9TB 5C0GA 1MCBA 1YYML 1BZOA 3PHOA 1I3VA 2FH8A 4HCRH 1D5ZA 3NSDA 5I73C 4JMNA 5IHZA 3SOBL 1IM3B 3IJHA 3ULSB 5HPMB 4KJWC 3K6DA 1F4HA 2PXYA 5D72H 1OV8A 4RGND 1F0LA 5E8NB 3S5LB 1E6JH 1NICA 3EHBC 5FA3B 4IKLA 3CVHH 3D1MC 4G7VL 3VSVA 4BRVA 4Z6AT 3KXFD 5D4IA 2BIIA 2N0KA 3WUWA 1QTYT 4HPYH 1N18A 4JN2B 4MJ5B 2AI0L 4JFYA 4MJJA 5CM1A 1SVZA 2UWEE 2UVEA 3CC1A 1YRKA 3MYJA 3B7YA 4R4ND 3TVMB 2V2WA 1BAGA 4HIEB 4E41A 2AMGA 3VRLE 5E8DH 5HHNB 2BINA 2MKWA 4KMLB 3S48A 1M71B 3DMMC 1NGWA 3BZFA 2Z9TA 3RUGA 4Y8AA 4N9OB 1T5KA 2IADB 4DGYL 2AVGA 3FHQA 4NPJA 2K3HA 5L8LB 3VXQB 3X3GH 3ARBC 3T4AA 3DHUA 4ELKB 1UD2A 2XA8H 1V3KA 1JVLA 2ED9A 4E41D 5GRVL 2JB6B 3PNRB 2WLIA 2P5EA 2EE9A 5DRXB 3N1FC 5C0IA 4N68A 3A4FA 1FVEA 3JZYA 3US9A 1YEHH 3CDZB 1KLFA 1TXKA 2H9GB 2FX8H 2XZZA 3LNFA 3NIDE 3N91A 1F3JB 1TTGA 4ZSOA 1AFVL 4HP5A 1SZNA 2PO6B 1AANA 1YY8B 3A67H 4BZ1L 3IVKA 2F5BH 4KAQH 1WV7T 3NIFB 3CLFH 1BZ7A 5B4MD 3GS0A 3GT6A 5AVVB 5IJVA 4L8SB 3WL9A 2XWEA 1P84K 1XGRA 1ZHBB 3E6FA 5IB3B 2E7LA 5F7AA 1U3HB 3FHAA 4AGPA 1LO4L 4LO9A 5KG9B 4F24A 43CAA 4N3UA 4E68A 1XF5B 2CNYA 3QAZC 3SKNB 2XFXA 4R0LB 4CU6A 5A6LA 2QV2A 2YO3A 1AGFB 1AXSB 1CDYA 2VSMB 2WYZA 4G5ZH 5I19H 5KVDH 1LP9B 4L9DA 3BEVA 1IVTA 4H2AA 1PW3A 1J9TA 1IC0A 4G43B 2FB4L 3JV4A 3D87B 4IU3A 5E6ID 1T1YA 4TYUA 5GGSA 4ANKA 3N2JA 3G6JA 1JHLH 1PX4A 5DK2B 3ETBF 3DDGA 5EU7E 3UG4A 5D7EA 2IH8A 1CDJA 5DZAA 4A6YL 4BH7A 1DQML 4PWFA 5D71H 3RWCB 1SBSH 5J6GA 2DLGA 3CQFA 1Z2KA 1LMKA 1X5XA 5F7BA 3GSNA 3WMSA 3NFSH 4XMLL 5EU4A 1DJXA 5FAAA 5A2LH 4LSUH 1OTTC 5AVRB 4P9MH 4F57H 4M7KH 5E8DL 4BZ2L 1NSNH 3E3QE 4CILA 2VMDA 3FQ4A 3HC2A 3U1SL 1VJSA 1UJTA 5I1AB 3X3FL 1F6FB 2RALA 4G7YH 5TJWK 2WIIB 3OKDB 2WGNB 3GXUB 1J0JA 1AKJA 4X5QA 3OLDA 2CJ3A 4HX1B 3IDGA 3DOSB 5D7SH 3TN0D 1NMBL 1SXZA 3TONA 4XI5D 4APXA 4Z1PA 5I66B 4XXDB 4J4PC 2H32A 1RLBA 2HJKB 4Z0BL 4KKQA 3SDXA 1RV6X 4LCCA 1MFEL 1IGYA 1DZ0A 3ILQC 4F58L 4POYA 5ACZB 4LPWA 3QJQB 3VW3L 3N40P 1OB1B 3S4SB 1CICA 1YNLH 5DRNB 3MDJA 2V3FA 3PGFH 3FO2B 5HHMB 3KWUA 1AKJD 5JIHA 3IDYB 3EADA 2DQCL 5I1KL 3O41B 2JIXB 3DHJA 4JDZB 2OYKA 3CMGA 3DARA 3A6CH 3G08B 1S2EA 1MFAH 1FO0A 1IEAA 1QG3A 5FCUL 4YHLH 5FM5O 2B2XH 4YHLL 3WTTA 4JQXC 5CHNA 4QF1A 4L3FA 2J6EH 5JOPE 1XTMA 3G04A 2DQ6A 4OLVH 2VMEA 2WB7A 1YNTA 5M7QA 3QEGL 2IMNA 4HWEL 4W6XB 3EYVA 3QBTB 1PGRB 4MBOA 2YAPA 4OZHE 3PWPE 3QEHA 2Y06L 2XJLA 2Z0UA 5DHDA 3AY4C 4PV1C 3SCMD 4L1BA 2VC2H 4J2XA 1K5NA 5E2VL 2C9SA 4DJMA 5GS0H 4PS4L 5KAQF 2WGXA 6FABH 6FABL 4JE0A 1WTLA 2AFNA 2DJUA 3DYPA 5H35A 4JO4H 1U95A 5GS1A 4NNYB 5AD0A 2ICWB 1HOEA 3PQYA 4QRTA 5ESAB 3I9GL 3APMA 5BV7B 1JG9A 3CQQA 3DYMA 2H6OA 4G83A 3T0BA 1A4KB 3QJOA 4X5PA 3MZGB 1TDQA 1UATA 2XN9A 4M6NH 4HK0B 4IKIA 2YHGA 2I24N 1FL5B 2YQBA 4H8VA 4LSDA 1JF5A 1O7DC