2OMXB

Crystal structure of inla s192n g194s+s/hec1 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
b'PLGSWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Internalin-A
publication title Thermodynamically reengineering the listerial invasion complex InlA/E-cadherin.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Cell invasion/cell adhesion
total genus 21
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2omxB00
2YQGA 4NUMA 4AQEB 4NQQA 4NUQA 3K6IA 4AQEA 1FF5A 3LNGA 3Q2LA 5CO1A 3MVSA 4AK1A 3FF8A 3UBFA 4ZT1A 4ZMZA 4AXWA 5JYLA 4ZMTA 2WD0A 2OMZB 3K5RA 3PPEA 2WCPA 3QRBA 3UBGA 2OMTB 1ZXKA 1Q1PA 2A4EA 1WYJA 4AQAB 4ZTEA 4ZI8A 2WHVA 4ZMWA 3UBHA 5KJ4A 1OP4A 4ZMOA 3K6DA 3K5SA 2YSTA 4XXWC 2X2UA 1NCIA 5DZVA 4AQ8A 2OMYB 2V37A 4ZMXA 4XXWA 3LNHA 2OMUB 2QVFB 3Q2WA 1L3WA 3LNIA 4APXB 3LNEA 1NCJA 1WUZA 2A4CA 2EE0A 2OMVB 4ZMPA 4APXA 4AQAA 4ZMNA 3Q2NA 4QD2E 4ZMYA 4AQ8C 3Q2VA 3FF7A 4ZMQA 1EDHA 5JYMA 1NCHA 3LNDA 4ZMLA 2OMXB 1NCGA 4OY9A 1O6SB 4AXWB 2OMWB 2O72A 2WBXA 4NUPA 2QVIA 1SUHA 4ZMVA 5CZRA 3LNFA 1ZVNA 3K6FA
chains in the Genus database with same CATH superfamily
2IH3A 4AE0A 2E6QA 3DUUB 1ACZA 3PGCA 1G87A 4JJ5B 5LGYA 1A7QL 1CGUA 3OMAB 3EFDL 1JNJA 1WT5A 1PNCA 2NRDA 5DC9B 3GUFA 1QFWH 3AGWA 3US1A 2DD8L 4PS7A 4OD3H 4L4VD 3HMXH 4PTTA 5MEOB 1NWOA 4G11A 4KRPC 4L8SC 3SBPA 4DETA 2WLMA 5I1JH 1I9JL 1QTYT 4DVRL 3LY6A 4JG0H 4MAZA 2WWNA 2A73A 1ACCA 2ZOUA 2ZOKA 1ZJAA 4L1BA 4P23C 5FYKE 3EO0A 3RBGA 4AGPA 4UM8B 1KULA 4Y2DC 3VA6A 4IBUA 5CJOH 3LD8C 2G2PA 2E6JA 4QOKD 2AV7A 4GW5B 2DLEA 5FHAL 4ZBJA 4DP4X 5T3XL 4F5CA 5K69A 2H32H 4NM8L 4XNZB 4AIOA 4Z3IA 4ONGH 3H9SA 5BZDA 2BNRB 5EOCJ 1MRCL 5EOCH 1IFRA 5DD5L 3BN9D 3SGDH 3EDDA 3OKLB 1KV3A 1IGCH 2PNDA 3EOAB 5EC1A 5E7FA 3EYSL 4BE6A 1NANI 2R69H 3TBWA 5CFHA 5KG9B 3UTQA 2O93L 1MJUH 3LZRA 3CBJB 1I8KA 5FUZL 4PJEF 4N2HA 1R0AH 1SJMA 2QPSA 3VI4B 3U4BH 2ORBL 5DTFB 3L9EA 4OD1H 3UJIH 1P7KB 4QO1B 2FTAA 3PIQB 3WKNA 3DX9A 4J6RL 2YUWA 1NAKL 1A3ZA 2F08A 1N6UA 1FN4A 1T66C 3FH7A 3IJ7A 4U3SA 4MRBA 1WJ3A 4V11A 5JPMC 5KN5A 5I17B 3O8XC 3OR7B 4P2RA 5IFAH 2FUQA 4HKBA 4KJQC 4AIEA 3UZEA 3GSOA 4FQHA 4FCAA 1MWOA 4CKQA 4G82A 3R18A 1MJ8L 4G8GE 3HR6A 1CF8H 1T5XB 1ZVYA 1W72B 2VERA 3AU1B 4JDZB 1X6NA 2BW4A 4YL9A 3GMMB 4NUGL 4E9RA 5C0RL 4PVLA 4RAVA 4WUKH 1MCBA 2HT4D 1HE8A 2O72A 5D7KD 5IBTH 3UBXG 2FQEA 3NACL 1WEJH 1Z9SA 2H2PD 3VJ6A 1XO8A 2HN7B 2AV1A 4ZNCD 1YNKL 5KYXA 2GC7C 2W80C 1QO3A 4I3SL 4NO2B 4NQDE 3FQRA 5J8OA 3PAZA 2G3NA 3FO2A 3IS1X 5FO8B 1JFHA 2JJSC 3J7HA 4QRPD 3QCVL 3UG4A 1S5IL 1EXUB 4UILH 3RZCC 4G7YH 5DT1H 2CE6A 3Q8AA 2JIXB 4G6KH 2CJSA 1ETA1 3SYCA 4R3SB 5HYSG 4PJBE 2JI1A 3D0VB 4EN2A 1XCQB 1B0IA 1AHWC 2JKXA 2NXYC 3TH2T 4ZMZA 1JHLL 3NA9H 5MEQA 1UD3A 4MA7L 5LBGA 4XB7A 4MB5A 1K8DB 3BQVA 3SD5A 4P07A 3POHA 4HA1A 4HIIB 4FI6A 2ZCLH 3KHOA 1PSKH 5B22A 3PJLA 4LEEA 5EU6E 5F7YC 5D1QD 3TV3H 1PG7H 4JJOA 1QFWI 1ZT7A 4PS4H 2AJVH 3HLAA 3WJMA 2AK4E 3MRIA 2EH7L 5DVKA 1ND0B 4RFOL 5EUKA 3A24A 1I8IA 3I3DA 4KXBA 2YAMA 4F9PC 1K6QH 2FX9H 1FVEB 2WBJA 2YUXA 4ZMWA 3QIWA 4HEMA 2XWRA 1JXDA 1QBBA 1DEEB 5CWSA 3OF6D 2ICES 3K6DA 1RCYA 3CC5A 4MJIB 1H6TA 2DLFH 5CS7A 1FFTB 3FQUB 4R4FL 2FEJA 2E7DA 5L4IA 1WZKA 1I9EA 2PO6A 2BSCA 1LP9F 1OZUA 2ZUQC 1AZNA 3RTQA 5E03A 2ZWLT 4N2AA 4JG1H 4NP4H 4NWTL 3FMGL 2YPLA 5JQ6L 3SGDI 5CR1A 1CLYL 4YSSA 3LS5L 1Q9LB 2ZKMX 2D3JA 4FZ8H 3B2VH 3U1PA 3F7PC 3ZDXE 4RAHA 4TQEL 1HESA 3U7YL 4Y4KA 1XGZA 5AW2B 1ES0B 3II1A 2IF7A 1QA9B 4Q58C 3MLWH 5E8NB 4BE5A 1IAIH 4UUJA 1AGFB 1C08A 1U41A 1CD1B 5FB8A 1X7TA 3VXQA 4W81A 1F8TH 3UTSA 2NSMA 5CEXB 5ESAA 3BKCH 4HKZB 2ZKXA 3SBQA 3DK0A 3NIDF 5DI8B 4KTEH 5EG6C 2YBRB 2X6VA 2AJYH 5H94B 1J1OL 2DI7A 3HE7C 4HCIA 1I85C 1VADB 4QRFA 1GCFA 2V9RA 2GI7A 4ONHA 3CU1A 4YDKL 3T1FA 3PL6B 2RMNA 4LCWA 4OAWB 3REVA 1JG9A 2ZXDA 3NJFA 2E75C 3QZBA 4X6DF 1XF4A 2QFRA 3UC0L 4KOBA 2PKDA 4P57A 3D87B 3BP7A 5F96H 3HCVB 4PD4J 43CAA 4R7NA 1E4WH 4XH2A 3CFIC 1LO3H 4EDXB 5J11C 3ZE1E 2CKBL 1PG7X 1YDPA 3KL3A 3GIVA 4BSVB 3VWKA 5CJ8A 5A6LA 5FHBL 3W39A 1JN6B 3H7BA 4AL8L 5AAMC 3QH3A 4U1MB 4Q52A 1SXBA 1S7XB 2Y6SD 3LKNA 3ARTA 1CXLA 2VDRL 4N2GA 2F8XC 4YOKA 1U91A 3VWJD 4QNPE 2KPNA 1TVBB 4PD4K 3X1BA 4HAGA 1CICB 1I3VA 3QRBA 1JTOA 1OALA 5DC4B 1Z0NA 3PUUA 4PJAF 1J05A 2EDXA 3BP4A 5T5NG 5D7JC 3GXPA 2J8UF 3KXFD 2F54E 4M5SA 3MO1B 1TG8A 3LB6C 3IE9A 4XBEL 1A6ZA 1S9YB 1BVKB 3LRLA 5I6NA 2PYFB 1UM6L 1YPZF 4YS4A 3RPKA 4L05A 3V0IA 3WTYA 3DIDA 5FKPA 5TJWK 4Z7OF 4XC3H 1N8ZB 5D72H 4S1QL 1KCLA 1JZFA 2J56A 5HJGA 2YA1A 1S7QB 3LQAC 3DXAB 1INDH 3DX4A 3IPBA 4M4RB 3VRJB 2W38A 1JD7A 2JCCF 2XTJD 4HIXL 4L4VE 2Y4SA 4MAUH 1MI5E 2R8SH 4LHJB 3W9DB 4H8VA 4L0PB 1XGTA 1ZA6B 2ZOOA 2EIDA 4JPSA 5E9AA 4N6QA 1AFVH 1F4YH 1U8HB 5CJXA 1AGBA 3PGFH 1QFUL 1NEUA 2Q7YB 4NENB 3GXTA 3HVDA 1EH9A 1LWRA 4QGYA 4JVUA 2YRZA 5JNYA 4UOZA 3QE5A 1FYHB 4QOKE 5EEZA 2JB6A 3T3PE 3WEBA 1R5VA 3LDBB 2AERT 5T33L 3TPUA 3MJ9H 2EIEA 3EG9B 2OMXB 3C6LC 2OBGA 2CCLA 5D4IA 4JQIL 3C8KA 1LJMA 5FGCE 1U8OA 5T1LA 5DK0B 4N3TA 3FO1A 4PJ5B 1IC1A 5JW3H 1MEXL 3N3EA 3IGAA 3O3AB 3QDMD 1F02I 4OKVB 1VFAB 1RFDH 4AENA 3WLBB 5LLIC 5GS2H 1CQKA 3LV3B 2VRAA 3FU7A 3QXVA 2AQQA 3VFVA 3BZFB 5FA3A 5KJRL 3FOLA 2XBTA 2OQJB 1IAII 3G5XA 4XX5A 2NY5C 3E3QE 3AZUA 1OPGL 3NIFB 4HH9A 5DR5H 2BOCA 2ROXA 4RIRA 4KJWD 1QLRB 4JGUA 2A3TA 2QSCH 3SE8L 4A39A 1TVHB 5I0YA 4IRSD 4CC0A 1HHJA 1PJ9A 3T8XB 3MBEC 4FKKA 5AW6B 1EK3A 3TEYA 5BV7C 3MGTA 3H0TA 1I1YB 3FQTA 5HP5A 3PP3H 1A0QL 4LLWA 1HSAB 1QSFA 2OYPA 3TA3C 1OAYH 2WXMA 3ABMB 3IPFA 3ARYA 4FQ1H 5JHBA 2IV9A 2AGJH 4DGIL 1AXSB 3HR5B 3FN0H 6TAAA 2YPVH 4IHOA 1ACXA 2NNAA 2ZSWA 5DURD 5A2AA 3EGXB 4RQQA 2Y06L 1CURA 1J1XH 2VDNB 1D9KB 4OTXH 4X7DC 1HX0A 4LSTH 1X44A 2EDTA 4AW4A 4AYID 4U0QB 3FUIA 3PWVA 3KNBA 3KH4A 3POCA 1E5ZA 3HBGA 4UM9D 4WU5A 2AAAA 1I3UA 4KRPD 1S7SB 3K5SA 3FN3A 2HRPH 4XPHH 1UKTA 3ABZA 3MA7B 3SIKA 1FZMA 1UB6B 4JM2F 4L4TA 4M1GL 2MPAL 2J1XA 1PPIA 2BOLA 2ZCKH 4Y4HD 4P23D 1WD9A 4OJAA 3VX0A 1HYSD 3L4CA 3SDAB 1WFIA 3BZEA 4DJMA 2DY2A 1I7RA 2L7JA 3HNSH 3QZOA 4UF7C 1F2QA 2R4SH 5AD0A 3N42B 2OMUA 3DLQR 2MKWA 4Q4EA 2NW2A 3CFBB 4GAYA 4G7VL 4PY8I 3KLSA 4OIBA 3MLTB 2X4NA 5EIIB 1R3HB 3BVTA 4S1RH 2GY7B 2F61A 3BP5A 4ODSL 1NL0H 1ZEAH 4M7JL 2IBZY 4FNQA 5IEHB 3P11L 5IM7B 1HHIA 1ZK5A 1E28A 2V7NB 4XOBA 5KANI 4NN6C 2VDML 2XG5A 4GYBA 3AQYA 1KACB 2WLKA 2FQDA 2MQ3A 3RGVC 2IH3B 3QCTL 1YZZA 4UT6L 1L9TA 4FKHA 1FLTX 3PGCB 4XZ4A 4WHCA 4AGOA 4E36A 1FAKT 3D2TA 1H3UA 2E74C 3TTYA 4C56A 4WW2A 3VW3L 2HKAA 1AQMA 4Y9FA 3NCJL 4GIAA 4O2EA 4LRNL 3CSYA 1Y6KR 1FP5A 1NGXA 2F7RA 1T66D 4KKNA 1W8OA 2R0KL 4PTTB 2XTLA 2Y07L 3QYNA 4P5RA 3FSAA 3CN4A 5CO1A 4KJQD 4F1ZA 2IWFA 3QYCA 5I16A 3K8MA 2A73B 3TCLA 4CVWA 2ZOKB 1C8QA 3EO0B 2GBTA 2MCPH 4JQXA 4M00A 4NLAA 2WYTA 4BQCA 3BKML 1FNHA 1ZHNA 4QF1B 2AEQL 5FOJA 2AV7B 4P9HL 4PEEA 1YEDA 5AOIA 3JVFC 2ENPA 1EIBA 2X4OA 2VL5A 2P24A 3H9SB 4KK6D 4L0ZA 4ZFOL 5BZDB 1KGUA 3RY5A 2HH0H 1V7NL 1KYAA 4ABVA 3T4YA 2KLTA 4MQTB 3ULVH 2YRPA 3TVMC 5EC1B 3HBZA 1BAWA 4PJBF 4OZFH 3TBWB 4P5MA 3UTQB 1KPUA 5KBNC 3WUZA 1QFWL 2XPYA 1I8KB 1BXUA 1HWWA 5E2JA 3Q48A 3AG2B 1B0WA 4JO3H 1A02N 4JEGB 1BX2A 2JLPA 4R8WH 2DIAA 3OB0K 4NHCH 3F04A 3O9WC 3RPIA 5FKAA 4WI3A 5I1JL 4DTGH 2NXYD 1TCMA 4AM0A 3DX9B 2R83A 4JG0L 3U83A 4ZSOA 2YA2A 4OF6A 4OT1H 5D70L 4U3SB 4XNZC 4HSCX 4DKEL 3KPPA 1A9EA 4WTZG 5CJOL 5KN5B 1P7QA 3QC6X 4R5TA 4P2RB 2I25N 1CI5A 4HKBB 4N5UA 4KUZH 3UEQA 4ONGL 1L0QA 2J73A 1LO2H 2Y5QA 3FT9A 3GSOB 4FQHB 4GUCA 4UMGA 4NT6A 4PRHB 1NAMB 2BNQE 3HHRB 3D30A 1WAEA 3I2CL 1OV8A 2OI9C 1B2YA 1XR8A 5DYFA 4RAVB 1IGCL 2UUDH 5AB2A 4MDJA 1RXLA 3ZUCA 5IFHH 2XA8L 2BS8A 2R69L 4JS7A 5T3XD 1H3PL 3A4AA 5GZNA 1MJUL 3GKWH 3U2IA 1Z9SB 2MIZA 3VJ6B 3O4LA 4EOWH 1R0AL 4XE0A 5KYXB 3D4YA 4FQXD 2VYRE 2ZT9C 3U4BL 1I7ZA 2H9GB 1QO3B 3OJDA 4X7TA 1J1PL 3PXHA 3FQRB 3GZPA 3FUMA 4L2YA 3LRGA 4J23A 4OD1L 4N4YB 3FO2B 5D2LF 3UJIL 3PU7A 3WFEH 2VAAA 1TJHH 5FPIA 3GRWL 3KLQA 2LHAA 1FIEA 1HZHL 1FFRA 3GK8H 1E4XH 43C9A 1I8MA 3M7FB 1PD1A 2PCFA 1NKRA 5IFAL 5MEQB 3TS8A 2WANA 3WEXB 4MHHI 3KPQA 3ULAB 1FUNA 2WLHA 2IGLA 3TBSA 5J89A 5C92A 4O9HH 1IQWH 4WUKL 1P6AB 4XN5A 5EORH 1MAKA 2WXQA 1CTMA 1UM5L 2FT8A 1ZT7B 4NKMA 4ISVA 4TRPL 2K3TA 3HLAB 4UTCA 5I6PA 3MRIB 5LN4A 3RVXC 3VGEA 4XAWH 3WTVA 4XBPA 1WEJL 3HE7D 5DFTA 4LVOC 2X4SA 3EDFA 5EUKB 3BJLA 1ET8A 1I8IB 3IU4H 4F8OA 5C0EA 1CQYA 5AZUA 2H8PA 4HOZA 2WBJB 4A2DA 3QIWB 1RLWA 3K80A 3TFBA 5CWSB 3QDME 4B3VA 3H55A 4NBZB 2COVD 2VM9A 3ZDZB 4UILL 3CC5B 4G7YL 4JZJA 1FAIL 5DT1L 5AKVA 4G6KL 2CR0A 1TFPA 3LKRA 1E67A 4QNPF 2PO6B 1EZVY 3RTQB 4Y7OC 5AKRA 2BC4A 3DHPA 2BIOA 5DFVC 3ZGIA 5IB3A 3TGXA 1AZCA 2QMJA 3U6RA 2YPLB 2B1HH 1SY6H 3OKKA 4FMVA 4JZNA 5D6DC 2FQFA 2CKBA 3PABA 3ULSA 4TNFA 1PSKL 1L3WA 4TUKH 5E8DH 5F9OL 5J57B 3TV3L 4U6XA 5IHZB 2AJVL 1OGSA 4Y4KB 4XXCA 2XWCA 4ZMPA 5ICYA 5E9DD 4UUJB 3MSPA 4TN9A 1C08B 4ZS6C 2ZZUT 3P3UA 3UEZA 5FB8B 4ZFQA 3VXQB 3UTSB 5IFJA 5ESAB 4KMLB 2XN9B 2FIKA 2FGZA 2O26U 3MLYH 4QXUL 3KLKA 3T3MF 2Z92A 2DQDH 3HB3B 4RMTA 2HVJA 5BCAA 2V2TA 4WENB 4E41E 2OJZH 4ONHB 3C60A 1XGUB 4P3CH 3UDWC 2X89A 3T1FB 4LCWB 4OLEA 3REVB 2X9XA 1KXVA 5A2JH 3EJYC 1XF4B 3WXVH 1J8HD 1WRFA 1FIGL 3QDJE 4DGWC 3F83A 5IHLB 4MWFA 5GRUH 43CAB 3Q06A 4QIRA 3HC0A 4R7NB 1OM3H 5DRZA 1MUJA 4JG1L 4NP4L 2ITDA 3RHWK 5B3JE 3T3PF 4ESKA 3S4SA 1E6OH 4S11A 1JZ4A 2M26A 3BD5A 1PIFA 1JZDC 3GIVB 3B2VL 4JFFA 3VWKB 5F3BA 3W39B 1KWKA 3H7BB 4JM0A 2JJTA 3QH3B 4QAWA 2VDQH 3KL0A 3MVSA 2IFGA 3MLWL 2UZXA 2VKXA 4JFEA 1IAIL 3VD2A 1U91B 1JSYA 5HD8C 3QJTB 3VFGH 3BKCL 5LHDA 4F93B 1GCYA 1FO0H 4KTEL 3BC9A 3BP4B 2WLIA 5ITBL 4ABQA 3WOVA 5GPRA 1A6ZB 1E4XI 1EDQA 1PGRB 5SWSA 2HKHL 1D6EB 3D52A 5SWZA 2ZJSH 5CBEA 3DVGA 5FKPB 3VXPA 5IMOB 5LG6A 5F96L 1MCDA 2NXZD 2J43A 5ISZE 2PABA 5E6IA 4F8QA 1INEH 3ELAT 4NQCD 1RHHA 2EO1A 2VZSA 4N8CH 1BBDH 4HIPA 1NIFA 2EDOA 3MBED 1XGTB 4XCEB 3KPTA 2B08A 3FONA 1CICC 1MVYA 4X4ME 1C5BH 1AGBB 5F9DC 2AZUA 4XNAA 5F7HA 3RYMA 3TA3D 2EC9U 2CUIA 2F2HA 1I4FA 4K5PA 1ASOA 3BVNA 5KS9E 3HKZA 4M7LH 3A0OA 4FABL 1XF3A 4IS6A 1R5VB 3WL9B 1F6AB 3TPUB 1P4BH 5CU9A 1MFNA 4AJYV 2JJUA 4W4NA 4B5EA 4Y9EA 3LVTA 3FCBA 5T5FH 4XGZA 4LSRH 2VLJA 3LZFL 2J5LB 3C8KB 4ETYA 3PDDA 3F7QA 4G6AC 1BEXA 5D72L 4AGQA 2BXZA 5T1LB 1AD0A 2APVA 1OCWH 3FO1B 3OKYA 4RGNC 3ZE0E 5AAWA 1G1OA 2C7UB 4AENB 5KSBF 2ATPA 3D0AA 3GM8A 2B3RA 4UOJA 1GGCH 3FU7B 4WI7A 4YMPA 4I0PA 2CBPA 2R8SL 1EBPA 5FA3B 1ZSDA 3QWRA 2YA0A 3CC1A 3FOLB 1C9SA 1ZANH 4FG6C 3G5XB 5D4HA 3X13A 4XMVA 1JWUA 1QLEL 1F4YL 4GXUN 2C8NA 4X9YA 2FWUA 4HH9B 4B9CA 3A6CL 1BHGA 3PGFL 1YN6A 2BOCB 3WEAA 1GYWA 4RIRB 4HYTB 1OVZA 4Z7NB 1Y1UA 4PJGF 4ERSH 4G2AA 2XWZA 3L1EA 3QNFA 1FF5A 1NLDH 1HHJB 2H0EA 1M4KA 5CP7B 5C0CA 1F5WA 1HEJC 4KZ0A 4UIKH 4LDEB 1OCZB 2MHAA 2YAHA 1FH2A 4M4PA 2DI9A 1WGVA 3MGTB 4AYBA 3RFZA 4OFQA 3FQTB 4W93A 3EYQC 5IVXA 3QXWA 3VFUA 1CDGA 2QL1A 1SGKA 2SEBA 3FTUA 2YGOA 5JHLH 2AXHA 1AGCA 1OTSD 5DFWH 4NNXA 2J4WH 5CCGE 4WLCA 4IHOB 2ZXQA 1VERA 1T6WA 1G0XA 4RQQB 3AACA 4HMDA 5HYJD 5JW3L 1LWJA 3EJJX 1I7TA 3BQUD 2WJ5A 1RFDL 5IHHA 1NIDA 2I7SA 1MCPH 1F4HA 3ILEA 4C55A 3PAUA 4X83A 3BFOA 4LHQB 3PWVB 3KNBB 4MQXC 4JRWA 4WU5B 2JI2A 4UT6A 1TXKA 2P80A 3QQ4A 4OCSH 5AW8B 3ESOA 4ZG1A 3T0EC 2JWYA 2WNGA 1FZMB 3D25A 4L4TB 4A7UA 1FH5H 5ALBH 1DVTA 3M46A 5F1IA 5EWIH 3TO4A 1T7ZA 4ZUVA 3BT0A 4QJ3B 3V7MA 4HWEH 4KK5D 1LD9A 3P2TA 4TSBH 2J12B 3BZEB 5EZLA 4EVNA 3P9MA 1I7RB 1OAYL 4FQ1L 4KNSA 5AD0B 1LDPH 2OMUB 2AGJL 4GAYB 5CGBA 2G9HA 2X4NB 3FN0L 2A2QT 2AJUH 1RUPH 4JRYA 1KLGB 3VI3E 4XC1L 4J8RA 3TVMD 2FDBP 2P44B 1M05B 1HHIB 3L08A 4DVBA 1SVBA 1E28B 5BO0D 3BRDA 3KJ4B 5IGXH 3CVHH 1IRAY 4CU6A 2XG5B 3P3YA 4QTHA 3KVQA 3BPOC 3VFPA 4NHUA 1VCAA 1UCBH 1KUMA 3QUXA 4J2QA 5DDHA 4GEJA 4M56A 4GXUM 4OZFG 4Z5RA 3O9WD 2HRPL 4OV6F 3AY2A 3V4UL 5GGUA 3VG9C 4C56B 4WW2B 4YXKH 1JWMB 1QHOA 1WA1X 3KPRE 2ZCKL 4O2EB 3CSYB 2RCSH 1NGXB 3MBWA 3HMXA 4ZYKA 1PZCA 4PGDA 4OZ4B 2BNRD 3QDAA 3HNSL 5KVDE 3U9UA 5C0JA 1OAJA 5J0BA 4LCUA 3OKDA 4MJ4A 5I16B 2AK1L 3TCLB 2QGDA 5ACZA 2EZ0C 4S1RL 3L3JA 1EAPA 4U4IA 5D8JH 1NOFA 2HKFH 1NL0L 3K72B 4N0UA 1TUPA 1GTNA 3Q8BA 2H32A 5D1XD 1YEDB 5E9DE 5AOZA 4NEHB 3WLWC 1LQBC 2X4OB 4F37K 2VL5B 4JO8A 1DJWA 2P24B 4AKOA 3H4FA 4CUCA 3TNNA 4QTIH 3T4YB 5D5ME 2VDPL 1WT5C 1R17A 5I1IH 2WVVB 4XMLH 3QS2A 3SKNA 1S5HA 2R69A 2W94A 1YMMA 4P5MB 5LDSA 1EVUA 1KPUB 2ARWA 1NGQH 3TCTA 4JUTA 1V54B 1J10A 5D93B 3RL2A 1GYAA 3UO8B 1BX2B 5D7LA 4B9PA 1KIRA 3RPIB 2P42B 4OLVH 5FKAB 2Y2YA 1QNZH 4AM0B 3C5ZA 3CFKA 4ZSOB 2X4RA 4KROB 5DD3H 3U7AA 2FGWL 1KFAH 4JFVA 4UOW0 5AVXB 4X9FA 2MCPL 4HVBA 2FB4H 2HLEB 3A47A 2UY6A 3KPPB 1A9EB 2IQ9H 1IO4C 1F45A 5IJDC 1SLUA 4JFHD 4XMTA 2ZWZA 3FB8A 5DYOA 1UC6A 5E2WH 4DGVH 4GG6A 5EU3A 4U1JB 5EFIA 3IDUA 1JI2A 4NT6B 2AITA 2YMXH 4YSPA 2ETWA 3LPOA 4P2QD 5F7EL 3VNZA 4D2NA 4PS8A 3D6GA 4HUXA 1ZV9A 1U3JA 1XR8B 2G2NA 3TJEH 1OAUH 3QUGA 4PVMA 2L3BA 3NVQA 4LU5L 4Z77A 4OUOA 1W8NA 3MCLH 1T3FA 1AZZC 2DJMA 3QQ3A 1F3DJ 4JO3L 4E5XG 4NQSB 1I7ZB 1RK1A 3H2PA 1F3DH 1UWFA 2QQKH 3OJDB 4X7TB 2V3FA 1B6UA 2QFPA 1GZPA 5B7EA 3ZHLA 4LEBA 4IBVA 1MCOH 1NC2A 1QP1A 4WCYH 2H41A 3IGUA 1VZGA 3KPSA 2VAAB 1I1AB 2VUYA 3WXWH 3FQ2A 3BVXA 1MF2H 4OT1L 2UY7A 1MELA 3L17A 3MQIA 5DZNA 2VLRE 1I8MB 3ZKQD 43C9B 1HE7A 3E6FA 3L5WA 5M7QA 2PYED 4FFYH 3GC3A 1H6EA 1ESOA 2P5EA 4UNIA 4KUZL 3VM5A 3EBIA 3MAWA 5BS0E 1L9OA 1KELL 3KPQB 2X3BA 3HNTL 5LXGH 2WUCH 3S98A 3M17A 4RMVA 5CR8A 1JYWA 1KGXA 2V6HA 5T8IA 5IFHL 5F8RC 4NKMB 4A2GA 4CGTA 4ISVB 1DQML 2XOTA 3GKWL 4XBPB 4NQVA 3SPGA 2X4SB 3VXUA 2D7OA 3AB0B 5C0EB 1LK2A 2H8PB 3B3IA 3EUDA 3FW6A 1LE5A 3EADA 3LMJL 1BVOA 3UL4A 5J06A 3Q6GH 1V55B 1J8RA 2EECA 4BK5A 4HF5L 4MJ2A 4WFED 1R46A 1TJHL 2R56L 4Y19D 3WFEL 4JZJB 4LGSB 3TONA 4C8XA 4Z3TA 3H6AA 2AQNA 2NYYC 3LKRB 3GK8L 5DJ6A 4GAJL 3JV0A 3TT1H 4F7CA 3DIFA 2AEOA 2Q8AH 5I1CH 4UV4H 3GDCA 1TTGA 1SF3A 2DQUL 4M7LT 4BQ9A 2UXFA 3P9LA 3L7FA 2BC4B 2F8OA 3U6RB 1BDYA 1QW8A 5ICUA 2GJ6A 1R75A 1T2QH 1J0YA 3OKKB 2D3NA 4JZNB 3NCYS 4PJ9A 3ZYIA 2A9NH 1FDLH 2CKBB 3PABB 3ULSB 4JPWL 2R1XB 1A64A 3QO1A 4O9HL 5E2UH 3MCG1 4EI0A 5AVVB 1AACA 4GSRA 4LE8A 4PJIE 4U6XB 4J4PA 1NBCA 3HN5A 1JAEA 2VDRB 5ICYB 2WP3T 4Z78A 2GABA 3ILDA 3AXIA 3QIWC 4W9KC 3IU4L 2Y36H 2Z7UA 2UXTA 1Z66A 5E5UB 2BVYA 2FIKB 3ZDYF 5HYJE 2BP5M 1JI1A 2Z92B 1Y6NR 2JJWA 3L6FA 2HVJB 2V2TB 4FFZH 4M62H 3ZKMC 3IU3A 4M02A 1GGTA 3C60B 1DQTA 5K1JA 2LGNA 1TSRA 4FQLL 4Q9RH 4X5QA 2X28A 2WXFA 4RAUA 1A7NH 1JCKA 1WAAA 1BFSA 4YK4B 3BH8A 2Q3XA 1X7SA 3TJHC 3ZL2A 3G6JA 4ZUSB 3HC0B 5DRZB 2IAMC 1MUJB 5F93C 1GGBH 4PB9H 4M5YH 1XB8A 1SY6L 2B1HL 4HJTA 2XWBA 5C0BA 3S4SB 4PWGA 3E9UA 1P0SE 4XNDA 4AZUA 2G3MA 5E8DL 4JFFB 1QBLL 1QTPA 5F3BB 1I8LA 4F57H 1X4YA 1VHPA 2IPUK 1AI1H 1K85A 2ED8A 2UZXB 4JFEB 4XVUC 1NBYA 3HB3C 4F7TA 5E00A 4LLYA 4GBXD 1FVCA 3ZUNC 2O5ZH 2LAAA 3UCRA 3MLYL 3TZVD 4G6AD 5E6ZA 4D8OA 2BP8A 2WLIB 1E8YA 2BNUA 4OM1H 5AVWB 2XZAL 2KPWA 2OJZL 3LZPA 4P3CL 1VFUA 4RGND 5SWSB 1TJMA 1QQDA 2IOIA 3KM1A 4JFSA 4E68A 1HNFA 4BWTA 5SWZB 4N3UA 3DVGB 3UAFA 3VXPB 3ARBD 5JIIA 4I77H 4QLRA 5TE6L 1RUML 1XXFC 5GRUL 1W0YT 4FG6D 3PFQA 5E6IB 1OM3L 1HCYA 4OIAA 1BMZA 3QUZC 3LRMA 3H6JA 3VWKC 1RHHB 1E6OL 3RVTC 1E8ZA 3SCMA 1HI6A 3N40F 3SYQA 1I3GH 1KJ2H 4P2YA 1I7UB 1OAZH 4YH6A 3OWEA 2BNRE 1UGKA 1RJZA 4HDIA 4HQQH 1M6UA 4WVRA 2NYZA 3TT3H 4O4YH 1PBYA 5CGMA 1M71A 4OIFA 2HFTA 1R3KB 1XAUA 3OLGA 3MZTA 3GZKA 2EEDA 4JB9L 2O6DA 5F7BA 2VR7A 1I4FB 1FO0L 5DZVA 3TNMA 1KLFA 3BVNB 3LYRA 4IBSA 2HJLA 4IS6B 3MJ9A 2GI0A 3QG6B 3JT0A 4WKZB 4W9IC 5C09A 1EXHA 4AX3A 1K8IA 1CL7H 4D9LH 4J3WA 1FCGA 2PTVA 4XGZB 5CBAA 1U0QA 2VLJB 4X6CA 2IWGA 2K8MA 2CLVA 3GBMH 3P69A 4MB3A 4U6VH 5EN3A 3E7JA 1AD0B 3TBTA 3D2UA 3O0LA 3UO1H 4ZD3H 3JWOC 1INEL 1YNTF 3SN6N 1ILSA 5DVMA 2ZKHH 3KWTA 3LNDA 4MXWH 5JXEC 3RWJA 3ARSA 3T0ED 4N8CL 1BBDL 5CJXC 5DRXA 4I0PB 1MDAA 1SYVA 3CXFA 5DGQA 5JOEA 1CZ8L 5DRWA 4MMYA 4OBRA 3PV6A 3IB4A 3X13B 1JWUB 4EF3A 2H4EA 5F72S 3VTTA 4Q6IA 4YSEA 4Q9CA 1YN6B 1Z6JT 3Q6FA 5LWYL 3WS6A 3LKSB 4D0CA 1A1MB 3C8HA 3IETA 3VI3F 3RJQB 4A04A 4GSDH 5H37G 3SDCA 2BXYA 5MI0C 2NLJA 4C54A 3B1TA 3LOWA 5I1KH 1SLWA 4N0CD 4TMPA 4XO5A 3RFZB 2QR0A 5IVXB 2OAAA 1QSZA 4F58H 5T5FL 3MREA 5E8EA 4XMXA 3VFUB 4LSRL 3KPMA 5H2BA 3UTTD 2SEBB 4IRZH 1CD0A 1AGCB 3L3OA 4LPWA 3T0WA 4NNXB 2YPVA 1TZHA 4NPJA 3KMDA 1IKFH 1OCWL 2XZQH 2J1WA 4I2XE 4HAFA 4GRWH 3RDTA 1I7TB 1IIKA 1SN0A 3BXNA 4Z7VF 1CLOH 4I1NB 1GGCL 3UFIA 1G0YR 4H0LC 1ZANL 4R84A 1MHCA 1YY8A 3GZQA 1MQKL 5F70A 4BYHA 1U95A 3QQ4B 3JV5A 1SJVA 2QMKA 4DKFH 2D4DA 4X6BA 3MLSH 1SF5A 4K3JH 4J3OC 4ERSL 3D25B 2BVOA 2NR6A 3CZNA 3KH3A 3B9KC 2KERA 1R3JA 1JNNH 3R1GH 2P5PA 1R47A 2WB7A 5F1IB 2PYEE 2XYBA 2JLLA 4U0RB 5LG1A 3TO4B 4ZUVB 1OD9A 4AUJA 1LD9B 2QADB 1CFVH 2ZX8A 5D5MF 5EZLB 4G8EB 1R24A 4EVNB 3P9MB 2J88H 4L2LA 5IHWA 3JWDC 3K2UH 5IB2A 1WCQA 2BHYA 3QPQC 4JN1L 2LU7A 5JHLL 4KX7A 4AUUA 2G9HB 1FWXA 1ODAA 2KDGA 4HLZG 4MJIE 5I0XA 1NGYA 1TLMA 4F7KA 4JRYB 4J8RB 3SY0A 3MRLA 4DVBB 3OWRA 4N8UA 3DJTA 1OT1A 4FTDA 2HT3C 4YL4A 4QTHB 4ZX4A 1VACA 2GFBA 5KVEH 1BMWA 3DVFA 2JKNA 3IN0A 4NHUB 3VFPB 3W5NA 4K94C 4OZHE 3QUXB 1PYWA 4OZGA 5J6HA 4P5TA 2FJGA 3CFEA 4OCSL 4WFEE 4G1MA 4M9OA 4Z5RB 2AAVA 3DROB 5GGUB 2QPFA 2ZOLA 1FH5L 1DP0A 4HIEB 5ALBL 4AG4H 5CZVL 1XZ0A 5EWIL 4R96B 3KW8A 4HWEL 4YE0A 1QACA 4TSBL 3MBWB 1FGVH 3SHSA 1AOZA 1EJ8A 2VTFA 1CL7I 2QSQA 5C1MB 4PGDB 5E94A 5IOPA 1RUKH 3U9UB 2NX5D 3DMMA 1RHFA 3SO5A 2C7FA 5KOMC 4LCUB 1LDPL 3TEXA 3NJHA 3M6DA 4RWYL 5ACZB 1UT9A 4Y8AA 4ZNEE 3L3JB 1EAPB 1SEBA 2MRYA 3KJ4C 4FHJA 4EDWL 2AJUL 3VXSA 2ICEC 5EU5A 4NM4H 5L2KA 4N0UB 2H32B 3GHBL 4IKKA 3BVDB 9PCYA 3CVHL 4I1PA 3W57A 1CC3A 5SX4H 4PJHF 1ZTXH 3DNKA 5LNEA 1MFUA 3TNNB 1IBZA 1IM3D 5IP4A 4BFBD 1LO4H 4H0HB 4AZ8B 1N4XH 3NA4A 1KCVH 3MFFB 4HHGA 5AG8A 3PXJA 5JYLA 3SKNB 3QG7H 3NJXA 1S5HB 4OZFA 1YMMB 4YXKL 2RAMA 4QPEA 3LKPA 3UADA 2IDQA 2ZUYA 2W9LA 4NGHH 3RL2B 3GWJA 4XNYL 2RIKA 1W8EA 4TUUA 2CM5A 5D7LB 1KIRB 1T22A 3ILQD 4JQXC 3PWLA 5FUOL 2B77A 5AVSB 1EHLH 3C5ZB 3CFKB 1IJ9A 1RI8A 3QQXA 2G75A 1GIGH 1TZAA 3OG4B 2F53A 5KVFE 3P3SA 4Y4FA 1A6VH 3KLDA 3MLUH 3W0WD 2UY6B 2I7OA 1FZKA 4N2BA 5J3HC 4ZJ9A 3FB8B 4DP6X 2F5BH 1DQLL 4GG6B 2VJXA 5EU3B 4PU2A 4H8WC 5AW0B 5EFIB 1CJYA 4JVPA 1N2RA 3ETTA 5GHWL 3U2SA 2CAKA 1MW3A 2G5UA 3GIZH 2YJQA 3DXAE 4KNUA 1KC5H 5CIPB 4GQPH 3OAZK 4HUXB 3SGJA 4GXVH 4ES8A 4YDVA 5I1IL 1C1EH 4DEWA 2WZPD 2K9UA 3OSVA 3MRHB 1O7SA 5D93C 5D2NA 4RGNE 1DBAL 4Z77B 2WLYA 1KPVA 2HVKA 4G8IB 4H13C 1NGQL 4M8UA 4TLUA 5C0GA 3WUWG 3FC8A 3HBPA 1EFXA 1NDMA 1T3FB 3QQ3B 2B9AA 3LXUX 1RK1B 4KROC 2XX0A 5FUCC 4OLVL 1GZPB 1KJ3H 5KBPA 2YZ1A 3NZHH 1NC2B 2OTUA 4EE2A 3Q13A 1QNZL 1UD4A 4A38A 4WUUD 3CFCH 1UA6H 3KPSB 1A8ZA 4WEBH 4PJIF 5KWYC 1KFAL 2UY7B 1G9ML 4HKJA 2FB4L 3ZZ1A 2IQ9L 1C16A 3E6FB 3L5WB 2YGVA 3FU0A 1GOGA 3X1EA 1J48A 1XSIA 3V6OA 2P5EB 5E2WL 1PIGA 4DGVL 1TSHA 4DP0X 3NG5A 2ED7A 3MLZH 1QPXA 4MMXB 2IANB 3QUML 3SE4A 5GS0C 2WCSA 3MC0A 2EDEA 3M17B 1F3RB 3ZTCC 2Q76A 3CDCA 5GZNC 4FNRA 3TJEL 1HZKA 4Q6KA 4WWKA 3F6IA 5C0AA 4NQVB 4U1LA 5GXBB 3MCLL 1PX4A 3AY4A 5IJVA 5E6UB 3VXUB 3NIFE 4HJJH 4F2EA 1U21A 1LK2B 4ZT1A 3QFJB 1I1AC 3B3IB 3NH7H 4PJCF 4E5XA 2WJ7A 1MCOL 1JXFA 3GO1H 3U9WA 1BQHA 1JUFA 1E4HA 4UQBA 1WS7A 3T0EE 3ZKNC 2YN5A 4IJ3B 4W9JC 2IAMD 2YQ3A 4IK6A 1MXDA 1MF2L 4NQED 1SMDA 2XQBH 1UUSA 4F7CB 3ARXA 1X5AA 1N64H 5DJ6B 2CO2A 1HHGA 3DIFB 4XN7A 5SX4I 3W3BA 2A6IB 1UZGA 2P3YA 3IJEA 2ZP9A 1CGTA 3L7FB 1HN1A 1S7VA 3O45B 5IBLC 4LIQE 1ZE3H 4MSWA 1R6VA 3ZRSA 2XN9D 1JERA 1SY6A 2FNWA 4OF0A 4XVUD 3LIZL 2ADJA 4PJ9B 5B39A 2NNCA 1JE6A 3BO8A 4XB8A 5T5NF 3HB3D 3N43F 3QO1B 4Q6YA 2XXGA 3VSVA 4GB9A 4O02H 1GGYA 3DTDA 4F15B 2JI3A 3MNVB 5A3IC 5DZJA 1EJFA 2P26A 4N0YH 3UTTE 1RJYA 1TU2A 5I24A 3MV7B 2DKMA 3VD4A 2CBTA 2ZUWA 3CVIL 4IU3A 1BLNA 2AP2A 3DSFH 5LN8A 4GI6A 3FCGA 2FX8H 3DI3B 3IJ9A 4WEEA 3GSXA 4FA7B 3L6FB 4NNPL 2FWLB 5E4IA 3IU3B 3B9EA 1LHZA 4YHOL 2QKIA 4YDMA 1QFPA 3QUZD 3UP1A 1T21A 4RAUB 4TL4A 3ZTNH 1JTPA 2EH8H 4UCFA 3CX5K 2HCZX 3BH8B 1E50A 2P5WA 4JL2A 3G6JB 4O2CB 1XF1A 4WNSA 5KSAA 1IM9D 3BAXA 3LIUA 1T2QL 5FOBA 2XWBB 5C0BB 3RWGA 1FDLL 1T20A 4B60A 1UH4A 5HVHB 1G7LA 1TZOA 2EXYC 2I07B 4FJ6A 1NGPL 5E2UL 2JMRA 5EC2A 4JO2H 5CD5C 3IGLA 5DQJB 1OK8A 2E7MA 2BY2A 1AXTL 1H3TA 4H20H 4PJFA 3D39A 4WJKB 3NESA 2CXKA 1NBYB 4F7TB 2Y36L 1LEKA 1GPOL 4LLYB 5GGTH 1FVCB 1P9MC 3FZUC 5KVGH 1FO0A 4ZW3A 4I1RA 3C60C 4MJ5A 2BP8B 2BNUB 1T83C 4W9HC 4N9OB 5GGQL 3OMIB 1SOQA 1ECZA 5AEAA 3V2AR 2CDFA 5IUCA 4Q9RL 2V0AA 2WWKO 1QQDB 5JXED 1ANUA 1ZV5A 1I75A 2NZ1A 2DOCA 2UX6A 3R06A 6FABH 2YKLH 2IJ0C 2AJSL 1L7IH 4F8NA 1UKSA 1HCZA 4M5YL 4IKJA 2JJVA 2JJTC 1AGEA 1AY1L 2CM6A 3SCMB 4JRLA 4K4KA 5LVEA 1A4BA 4LQFL 3S88L 4RNRB 1IFHH 5AAPA 3A22A 2NX5E 1CS6A 2VR5A 4HDIB 2H3NA 4V1DA 4Z7IA 3U30C 4I0CC 4TULH 3QQ9D 2WSDA 2NY1D 3PRZA 1PZDA 5HVFB 2QVKA 3JVGA 2JQZA 1X4ZA 2O5ZL 3SJVD 3PFUA 3KVDD 4N90E 3TNMB 4C4KO 2X0UA 4RZKA 4MD5A 1KLFB 4OM1L 3FUNA 2HJLB 3NP3A 3QRGL 5JQIB 1EHXA 4MYPA 1Z1WA 5C09B 1SJEA 4Z3JA 2FJHA 4BGDA 1SEQH 1PX3A 3OAWA 1MFDH 5T5FA 1K8IB 5I75C 5E6IC 5CBAB 3L2LA 3T2NL 1MIMH 4DK5A 3QWNA 4X6CB 1DE4A 4XP5L 5IB5A 3T04D 1GS8A 2CLVB 1O7VA 4GKSA 4OFYD 4PLOB 2TSBA 4FXGA 3TBTB 3D2UB 4PVBA 3GMNA 2ADGA 2ITCB 2Y25A 3VD3A 3MLPA 1T5WA 3RWJB 3EHBB 3P0VH 5IMMA 1I3GL 1W15A 4JFQA 4J3OD 5DRXB 4BFIA 1DBKL 1VEPA 3B9KD 4AYGA 5KBLA 1AKJA 5IF0A 5DRWB 1J0JA 4GSXA 4MMYB 3PV6B 4PRHE 3SYOA 5DHYA 2WOYA 4AYFA 1SLXA 1IT9H 5GZOA 1B3IA 2ADFL 5ESVB 4HQQL 3TT3L 4O4YL 3Q6FB 2FH8A 2K4WA 3MX0B 1JMZA 2NY4D 3F7LA 1CXFA 3QPQD 4ZTOH 1G7JA 4H8QA 4RDQG 2NLJB 3E0GA 3AS1A 2FO8A 3D4GA 4JY5H 3RI5K 1GKOA 4UAOB 3AVEA 1KB5H 3BUIA 3MA9H 1BOYA 3S8GB 2F8VA 2QTEA 2PTTA 2QR0B 3BZ5A 4OZHF 1AS6A 1CGVA 2YMTA 5J13B 1CL7L 1XGPA 3K91A 3MREB 5E8EB 4D9LL 1FFNA 3KPMB 5H2BB 5JHLA 3UOAB 3C6SA 3GBML 4N8PA 4U6VL 1TZHB 1ETZA 4ABUA 3N91A 4TQHA 4ZD3L 4I0PC 1BWMA 3V52L 3RDTB 2GVYA 2ZKHL 2D73A 2VW7A 1OCOB 1MCCA 4MXWL 4YLBA 3BXNB 1UWXH 2FLMA 3QNZA 2VSKB 1XL4A 2VR6A 3MN8A 4PG2C 1F58H 4FXKC 3D18B 4OGZA 3TYGH 3GEFA 4RMWA 2WD0A 4BZYA 1MHCB 1YY8B 2Y7LA 4GINA 1AR1D 4WUUE 1E9OA 4WJG3 3MOQA 2DQHH 2QLYA 2W1NA 3GSQA 3V0AC 2H5UA 3ZIYA 1DBBH 4GSDL 4I85A 5LAXA 5HVWA 1EFQA 1R3JB 2ZICA 3BAIA 4B7IA 1N3NA 5I1KL 5JHDD 4GKZA 2C3WA 4HCRL 1QX1A 1R24B 4KXZH 3HHMA 4X5WA 4FNLH 4FADA 4F58L 4KZEL 4M7ZB 4IRZL 1N0XH 4HEME 2VH5H 1AO7A 2D03L 3VXTA 3ZDZE 3QW9A 1BSIA 1CDYA 2UXGA 2XZQL 1NGYB 1Q9WB 3UERA 2ZYHA 2HUEA 3SY0B 3T0XA 3MRLB 1QUNB 4S1DD 3CVHA 1ERNA 3EO9H 4M1CC 1VACB 4GUPA 5ID1A 2ARJA 3VMPA 4W70A 2E7CA 1CXIA 1UTDA 4OZGB 1PYWB 4YN3A 3H42H 5FYKH 3IBEA 2XXCB 4P5TB 5J6HB 1NINA 2FJGB 3CFEB 1OP5K 2J1YA 4DKFL 3U6XS 3ZY7A 4NQEE 4U0RC 3TO4C 3SDXA 4TUOA 1XIWA 2VSCA 2CHZA 3N6YA 2AS5M 1MAMH 2ZOLB 3N06B 4ZXBA 2F15A 1R9FA 1JNNL 3R1GL 4Y9BA 3QXUA 3K0WA 1XZ0B 2AQSA 3N44B 4YHPA 1MFAH 5E70A 4GUQA 2X09A 3EOBA 4FDWA 3LPGA 3QORA 5CSGA 1CFVL 1WO2A 1KXQE 3LRSB 4EXKA 2BCMA 3HG4A 5E94B 5J3HD 2J88L 2XN9E 2F0CA 1UZ6F 3TV8A 5IOPB 3DMMB 3K2UL 3PWPA 1ZLWK 4E9LA 1PVHA 2FLBT 3ZQWA 2D4FA 3EO1A 2DLHA 3NJNA 1SEBB 1G4MA 4R5VA 1YRKA 4TKWA 5IBUB 3VXSB 4JCMA 4PWIA 5EU5B 4LCWE 2UYLB 5L2KB 3JV4A 2XUWA 3CZKA 4KVCH 5DVLA 5ESQA 3QAZC 2ENQA 4FS0A 4L3EA 1UXMA 3SPHA 4BUQA 2QT6A 3QUXC 4AEHH 3D4CA 2F58L 5T1KD 3B9VA 5KBMA 2MCMA 5LCVL 2Y72A 1RY7B 4BZ2H 2NNFA 3B7RL 3MNZA 5HDRA 4ALAC 3ZMNA 4KROD 1NC4D 1A7OH 3WIIH 1VEOA 3VE0A 3F85A 4Z76A 1GAFH 3LKPB 4WV1B 1SHSA 2Y7NA 1S9KC 2BJMH 1F11A 5DD0H 5HJDA 1XSJA 3IXTA 1FHNA 1FGVL 2DL9A 2AEWA 1UWYA 1A3RL 4HT1H 1IGFH 4JUSA 4A1RA 1RIUH 1T22B 1BYPA 1RUKL 4X8CA 3TBSB 5JUEH 2AI0H 4ZQKA 2G75B 4JG5A 4M3JA 5E6YA 2HFGL 2HLFC 2F53B 2XV2A 1HHKA 2WUBH 1DVYA 2B1AH 2VLKA 3QUHA 4NZJA 4WO4C 1ADQL 3L1OH 4GRLC 4Y4FB 3UABA 5GS0D 3X14A 4WTWA 1FZKB 3F01A 4NM4L 4ZI8A 2ZP8A 2WQRA 3I9GH 4NN5B 3FFCD 2MWCA 5G55A 3VGBA 2ZUTA 2DWDA 1U3HB 4UBDD 4Y9GA 5HHOD 1ZTXL 4YSUA 1ZGLP 1IKOP 2OL3H 3U2SB 2MNJB 1UD8A 2IWKA 2V33A 2MSPA 4YHMH 4Y5VC 3FFDA 1EDYA 3U0WH 1LO4L 1VEMA 4AKPA 3NSXA 4YDVB 2NW3A 1BOGA 5ABDE 2BO0A 1GVIA 2PLTA 3KL5A 5JIKA 1N7MH 1T0MA 4RMUA 3AXLA 3DX8B 3QG7L 5D2NB 4Y5XC 2WKOF 3BZDA 1OZTG 5AW9B 1KPVB 5C0GB 3S3BB 3ZKND 4PJDA 4DGYH 1EFXB 1NDMB 3GDBA 5DJ2A 4NGHL 1OAKH 1QUPA 3QPXH 1TTRA 2ZCZA 3D51A 4KXZI 2XKSA 5ECJE 5A2IH 3C5ZC 3HZ3A 4K23H 1CFMA 2JSFA 1DJZA 2OTUB 2VMDA 1UXLA 2YGPA 4FYTA 1EHLL 4KQ0A 2UWEA 5IBLD 3FAXA 1GIGL 1ZLUK 1PD0A 4CVXA 1S7WA 1OGTA 1A6VL 2P8LA 3MLUL 4HP5A 4IRJC 5D1ZI 1J9TA 3G5YA 2TSAA 5HY9A 1GGIH 2VITB 3EZJB 1C16B 4FFYA 4X9BA 1CYWA 3HRPA 1BF8A 3DSNA 2V7HA 2BSEA 2VM4A 3OAYH 4I18C 4P46D 1HHHA 4I3RH 4YDLB 3GS4A 2WBXA 2QLVB 2CCWA 4PBWD 3PGDA 4Q56A 2AJ3A 2I85A 1XR9A 5EZPA 3GIZL 3LAFA 4ZO9A 3VDCA 5CU5A 1V3LA 1KC5L 3ARDD 2YAFA 1UVQA 3ULUC 3H9HA 2Q76B 1KWGA 3HHSA 4AT6A 1X4XA 3O2VH 5ANMA 3L8QA 4WWKB 1G7PA 2AXGA 5IZ7A 5C0AB 2R0WH 4QXWA 1HVXA 4U1LB 5IJVB 1JGUH 4V33A 5IREA 2AMGA 2N7BA 1BQLH 2Z8WC 4A7TA 5E9NA 3AQXA 2FHBA 4OZIA 3MV8D 4TQ8A 1KJ3L 4Z7NE 3S9DB 3NZHL 2C26A 5BZZA 3RIAK 3T2OA 1B4RA 1BQHB 1JUFB 4D3CH 4G8FA 4IM8A 4WEBL 2XWJA 3ZE2B 5FYJH 2XWEA 5DZPA 2COQA 3EF4A 4R0LA 3P2BA 4LHUG 2G60H 1HHGB 2EXYD 2ZF9A 3D85A 2P8MA 4MMXC 4XPBH 5ENWA 5IJCC 1LWHA 1T5KA 3CU7A 3IJEB 4IGBA 5CD5D 2OYLA 1S7VB 5HDQL 4E9QA 4MSWB 4GKLA 3MLZL 4HSAC 4MAYD 3VAEA 1A47A 1HSBB 1BQ5A 2ADJB 5B39B 5E99H 4OJEH 3BO8B 5DJCA 3RUGA 3VFRA 3VXRA 3KAAA 4L5FL 2N7AA 1C5DA 2VXTH 3Q5OA 3RDJA 3B34A 1BD2A 2XQYK 1LDSA 3FZUD 3LH9A 1E5BA 3O6FA 3KLAA 1GC1L 3RJOA 5I6OA 3OVUB 5T1JA 2E59A 1DJYA 1HEZA 2H0JA 4JFPA 1L5GA 3C2AH 1NCBH 4HJ1A 7FABH 1H6UA 1RJYB 1TU2B 2OXGA 1WH0A 3H2WA 5BO1H 3B4NA 4WU7A 4UQCA 3CMGA 5IIEA 4S0HA 4IU3B 3KCPB 2OW7A 1CN4A 4IJ3C 3NH7L 3HIZA 3GO1L 4K9EH 5E0QA 3GSXB 4G80A 2OMZA 5DO2C 3HE6A 3HOGA 5FF6A 4H25A 5LGKA 4WSKA 1H8OA 3HZYA 1EVTC 5F0MB 35C8H 5A40E 2YXVA 5FW7A 1T21B 1WUZA 5DJZA 3WELA 1N64L 3GT6A 5BRZB 2EVFA 1NDGA 3BH9A 3L5JA 2HWZL 4PJ9C 1SOSA 3RBSA 3BP6A 4UQ3A 3WE1A 4TNVF 2P5WB 3HG1A 4MD0A 5FOBB 1XH1A 1NIEA 3RWGB 1DBML 1T20B 4J4PC 4F15C 1G7LB 3GXMA 3DI2B 3WMPA 2V2XA 2Z65C 2FSEA 1N0LA 5JHDE 1W0VA 4O02L 4TPRL 5EC2B 2AEIT 2VDQB 1D5MA 1FNLA 3FSVA 1Y07A 3MRRA 3PQYA 4KMTH 4YHZL 3IMBA 3D3VA 4N0YL 5HDBB 5LBSH 4FL4C 4ZAKA 3D39B 3AS0A 3II2A 2JKLA 2HLAA 3EJPA 3QIBA 1LEKB 4JFZH 3DSFL 3GXFA 1FO0B 4JZOB 1R5IA 2FX8L 1SVCP 8PAZA 3CFJB 4MJ5B 2CHXA 3OBAA 2RD0A 4HOXA 1X5XA 4MS8D 5B1BB 2CDFB 2LABA 4GQ9H 3ZTNL 3UG3A 2EH8L 3MROA 2E9JA 1U8IB 3R06B 4BIKA 4X8JA 5EIVA 2AQ2A 2I9LB 2OULB 3BSHA 1CDHA 5HGBA 5HVHC 1NCOA 1KLUA 4A2MA 2B16A 1MLBA 1AGEB 2R7EA 1KJ2A 4X7SL 5A6MA 5IROC 3IRPX 1JPGA 5IWLA 4JO2L 3FT2B 4XHJC 2VQTA 3QJOA 3V95A 2XKUA 5JIDA 2Z35A 3BPLC 4H20L 4V1DB 3QAQA 3BLKA 2ITEA 2BHFA 3Q1SH 1JGDA 4BH7A 1YVLA 4LXFA 1SHWA 2CO6A 5PCYA 5KVGL 5MEND 1WF5A 1RZJH 2X2YA 3CIQA 1OSYA 2CNYA 1NEZA 5AL0A 1NFAA 4F2MA 4LBAA 3U79A 1SJEB 3MNDA 2FJHB 4HD5A 4U2ZA 4JQVC 6FABL 3BLBA 1KEMH 1DE4B 1QATA 1OT2A 1UOKA 3MRFA 4XZUA 2W92A 3AS2A 4KDTA 1L7IL 4KX8A 4GKSB 1A5FH 4HEPG 5FUCE 3SCMC 4FXGB 1KY6A 1EGJL 2I27N 3O2DL 2R1WA 1AIFA 3GMNB 1F41A 1HQRA 3EXLA 2ADGB 3L4XA 2C34A 3QJUB 4UT9L 1A6UH 3C5XA 4NDMA 5FM8A 1T5WB 3QEHA 5C0ND 2X9WA 3SQBA 3WFDH 5JR1L 2A4CA 3VGHA 4JFQB 2G9KA 2Z8VC 4UANA 4P06A 1AAJA 4BFIB 1AKJB 5IF0B 5KZCB 3ML8A 3BLPX 1IFHL 2HB0A 5DHYB 2HRGA 4AYFB 4X80L 4Q74A 2IO5A 3MU3A 4JFWA 4J3XA 3IWUA 4TULL 4JKNA 3QZWG 2WQAA 4X0KA 1CVRA 4BQ8A 1G7JB 1QRKA 5I9QB 4HWBH 5A2KH 5L4MA 3NDZE 4Z6AT 4HCRA 5BJTB 5HHOE 2C9PA 3ZHFA 2WBWB 2PTTB 2QSTA 2VXVL 1SEQL 4FQQA 5GRJH 3IEAA 5K9JH 1MFDL 1MG3C 3U9PL 1XGPB 2EE6A 1FFNB 1MIML 4IRZA 2CH8A 2EAEA 4M1CD 3WNKA 1KN2H 3C6SB 3RVUD 3QWQB 1DL7H 4KY1H 4RX4A 1KBPA 3EHBC 1ETZB 1Q8MA 5JZ7C 3F62A 2Q3ZA 2Y1YA 2H2SC 4HUUB 4QJ4B 2BVQB 3ECBA 4X5RA 2JNZA 3P0VL 3QNZB 5E2VH 2VGLM 5LO7A 2V5YA 1OQOA 3JZYA 3WS6C 1EJOH 3O2WL 1IT9L 5CJBA 2ERJC 3EH2A 4KVNL 2ZE0A 5BUPA 2WLLA 1IAKA 2CUHA 3GSQB 4B41A 2YOCA 2CRYA 5LAXB 4ZTOL 4CDHA 3CV5A 4NJAL 2R2CA 1WBXA 5JDSA 5J13C 1N3NB 4GKZB 1HIML 2ZXAA 4BXSV 3B37A 4UI2A 4X5WB 1RZ7H 4MZIA 4G9FA 1HCFX 4M6AA 3KDMA 4FFVD 1KV7A 1IGMH 2Z8RA 3SKMA 5EZOH 1N6QH 3GMQA 4KK9C 1AO7B 1Q38A 1C7SA 2DAVA 2XACC 3VM7A 1EAOA 3VXTB 5D9SB 5IHBA 3JXAA 5JW4R 4AGNA 4S2SA 1NCUA 3FSZA 1A6WL 3CVHB 4JDTL 2OZNA 4IMKA 1AHKA 3G7TA 4BQ6A 3K3QA 2DQFA 2YSTA 4YE4L 4GUPB 5ID1B 2XFXA 2ARJB 5KAQF 3KG5A 4I5BA 4E9WA 2BY3A 5MEPA 3BDYH 3NJKA 2YEQA 2EE2A 4YLQT 4M61A 2DQHL 3SDXB 4TUOB 1QTSA 1JK8A 1XIWB 2YD2A 1G1CA 2F74A 1DBBL 2BVPA 4HCFA 4Y5YA 2NY6C 4ZXBB 1OF2A 2GITA 4Z95H 4R90H 3VD9A 2YKKA 1FJ1A 1L6ZA 4YHPB 5IW3A 3EOBB 4N2KA 4WO4D 1LEIA 3QORB 4GRLD 4M7ZC 4CADA 3L5XL 1BFVH 4W9GC 3GS7A 1KDIA 1JK9A 4R97C 4ZMQA 1EDHA 4ADJA 1T04A 2X38A 1N0XL 2CBMA 4MQSB 2VH5L 2WO4A 3EO1B 3BIBX 3OXSA 4QDGA 5C07A 1ADQA 4PMFA 1XEDA 1KZYA 3CDYA 4A2FA 3GSNL 1A66A 4Z0XA 1S9XB 3K4ZA 2H1LM 3JV4B 2XZZA 2YFNA 2O1AA 2FAUA 1SRDA 4JKPH 4L3EB 4NRZA 2DM2A 4OI8A 3K2MC 4QI3A 3FT1A 4UTAL 3ATEA 2B0SH 2XPGA 4X7CC 1YQVL 4KO5A 1W80A 5FYKL 3H42L 3MNZB 4C47A 5CLWA 3MRJA 1AYOA 4DW2L 4UU9A 4RMBA 4F8LA 3H54A 4JFFE 4Z76B 1MAML 4NKDA 5AZEL 5K9QI 4PJ7B 1JNHA 1F11B 2DWSA 2QGBA 1MFAL 3L95A 3NT0A 3DMMC 3IXTB 5TFSL 4IRJD 3F7YA 4LRIC 1A3QA 4U1SA 2UVFA 5GRYA 4EN3B 1L0YA 1I82A 1NCWH 4ATTA 3QNXB 4NBXB 4ZQKB 4XTRD 5EO0A 1OD7A 3KPLA 1HHKB 2OCCB 4X9IA 3G6DH 5TF1L 3X14B 1KB9J 2MMXA 5SWSE 1B0RA 3ULUD 2D7TH 2E27L 3LHAA 5A1AA 5CJ5A 4KVCL 1JXKA 5F3HA 2P49B 5DMJB 1J12A 5SWZE 3U82B 2DWDB 3ULVC 5HTSA 5F44A 3WNPA 3HG2A 3FFDB 2MOVA 2FEDC 2X12A 3MJ6A 3I9PA 4IEFB 4WFHD 4BZ2L 4J3OF 4WV1C 1PS3A 1BOGB 1U3YA 2NW3B 1I53A 4WTQA 1T0MB 4MS6A 4YSTA 5F0LB 1A7OL 3VGAB 3WIIL 5IK3A 3AXLB 5JDJA 2CSPA 1KB9K 1S8DA 3DPBA 4KHXL 4PJDB 1OF0A 4PJEA 5DD0L 2X2UA 1MFMA 1ZLSH 4NKOA 5EB9A 3WD5L 3S48A 1VF5C 3HVNA 1IGFL 1RIUL 4KKZA 5A6IA 2BDNH 4LARL 2AC0A 1P4IH 1VFBA 2IAND 4Y4FC 4CVUA 2ZD0A 5JUEL 2UWEB 1F13A 2ED9A 4Z7QB 2XLLA 4Z0BH 4CVXB 1D5IH 3HAEH 4L9LA 1MCIA 2WUBL 5DVPA 1S7WB 1OGTB 2B1AL 2P8LB 4PJFF 1UH2A 1U3HC 1YUHA 1MH5A 3G5YB 4G6ML 4N2LA 5HY9B 5IW6A 1P2CA 5AQ0A 4IBWA 2VDKH 2PCYA 3DSNB 2Y1AA 2V7HB 3I9GL 2APTA 4CILA 1HHHB 1NCHA 2R27A 4RGMC 1TJIH 3SGJC 3CZSA 2OL3L 3QFJD 5TK4A 4DP5X 5MENE 3SBWC 3PGDB 4YHML 2AJ3B 1XR9B 3U0WL 4GS7B 5D2NC 4ICXA 1MSPA 3C09B 1UVQB 5LGHH 5ADOL 4F33A 1BVLB 4JM4L 3HHSB 4AT6B 5ANMB 2H7WA 3INOA 5EF2A 1MREL 1O6SA 3N41F 4NPYA 1HU8A 2AXGB 3UTZA 3BYTA 2D2OA 5DO2D 4HJEA 1KN4L 4WJ5A 4UOQA 1OY3B 3ZT6A 2BS9A 3QPXL 5I28A 2LLLA 4M03A 1CR9H 3UTOA 3LRKA 1DBJL 3NJVA 3MTRA 5D96B 3BSZH 1WV7T 2OMVA 4OZIB 2EUZA 5F97E 1H15A 2ZTBA 2JB5H 2KL6A 1YC7A 4G8FB 1RJLA 4A7QA 1JCVA 2XWJB 4K7PY 5E1IA 3AREA 4UINH 4AEIH 3D48R 3V6OC 3VX1A 4PRIA 4R0LB 3U4KA 1QI5A 2WN3A 1GHFH 3D85B 1ET7A 2P8MB 4AXWA 4XNXH 1CVSC 3RY6A 4MVBC 3P54A 4H2AA 4IGBB 1PFCA 3MV7D 4I3RL 4XCCH 3HUJF 4A7GA 1NPNA 4B9JA 5DEFA 1MWAL 1EHNA 4OLWH 5DJCB 3VFRB 3RUGB 3VXRB 4WWKC 2OSLA 4OGQC 1C5DB 5L9DL 1BD2B 4O02A 1T03H 2VZOA 3O2VL 3O6FB 2WM0A 3KLAB 4GW4A 1WAPA 5EF0A 3BRFA 4ZFGH 1HEZB 5C3LD 1L5GB 2R0WL 4CA4A 4N85A 3C12A 3HC3L 1JPEA 1JGUL 3KGRA 4Y16A 5F9WB 4ZO8A 1BQLL 1IBDA 2OXGB 1UHVA 3GLDA 4OCYH 2AFNA 2EABA 4WU7B 5IIEB 1GH7A 3GSVA 3KR3L 3C08L 2E4TA 2EXWC 4G80B 5FF6B 3SE6A 3HE6B 4NUJA 4D3CL 4H25B 2VERN 4PLKC 1M2VA 3T08A 3HZYB 3V0EA 3QCUH 4G6FD 5DJZB 1UD2A 3NSFA 1BPLB 1I8AA 1NDGB 2L4OA 2G60L 3BH9B 4N9GA 4TL5A 5GISH 1JZJA 5IROD 3DYOA 4JMNA 4QHNA 2C9QA 2W81C 3BP6B 4UQ3B 4WHYH 5SV3A 1NMBH 3HG1B 4IBYA 1OGAA 4HC1H 3GRBA 5IVOA 1HWGB 4JRYE 1UD6A 3IFNH 4OCXL 4APXA 2P7TA 4OQ1A 2VXTL 4AMXA 1QAWA 2NZ9C 2V2XB 3GSWA 2VJ8A 5B4MD 1F4XL 1N0LB 3BEVA 1W0VB 3QEQD 4QHMA 4ADGA 4Z23A 3MBXH 3PQYB 1D5MB 3MRRB 3QEGL 3C2AL 3KGTA 1NCBL 3FFOA 3D3VB 4P4KD 3QJQB 2O6EA 5F6HI 3U36A 4ZAKB 1PZSA 3NOIA 1QASA 3BAJA 3PHAA 2HLAB 3QIBB 5DLLA 5BO1L 2GJRA 5GGTA 1OO2A 4FQCH 1R5IB 2UZIH 4OZ4A 3MUGA 3QUYA 3QI9A 4K9EL 4RFNC 3QHZH 3SQOH 1WFJA 3NQIA 4GPVA 3SB3A 2B1OA 3TBCA 1PZUB 2AMUA 2HYMA 3ZL4H 3L4ZA 35C8L 5F89A 1NTDA 5I0VA 3BFWA 4X6DA 5BMFL 4Q7DA 3D08A 4TQIA 4TSAH 5E08H 4TS6A 3RKPA 4Z1PA 4JRXA 3B5TA 4X8JB 1ZS8A 3ZO0A 1TCRA 3HI1A 3D06A 2K9FB 5HGBB 5DZOA 3Q5YA 4J5VA 1IKNC 1PAMA 4UT9A 1K72A 1MLBB 1YNLH 2BRRL 2O5XL 2AVGA 3GPSA 5IMLA 1YUKB 2OA9A 4DH2A 2R7EB 1KJ2B 1PLBA 4JGMA 1JZ6A 1JPGB 1EZVX 4PW4A 4K8RC 1AMXA 1L7TL 4MCZA 4KMTL 4TV3A 1D7DA 1OSPH 5LBSL 4NP9A 4OFIA 1DVFA 5IQ7H 4ZW5A 1SM3L 2YD5A 1VGKA 3FTXA 1SVZA 4Z3GA 4JFZL 4OLXL 4BH7B 4OCRH 5JOFA 2CO6B 4MB4A 1J5OH 5CF3A 3H3PL 4QRSA 5GJSH 1OQXA 4FG0A 4XP6L 3QDGA 3I6SA 1A21A 2J8UA 1YEIH 5C7XH 1NEZB 1NM9A 1QRNA 1O6TA 5JZ7D 4F2MB 5I19L 4BBWA 2DTSA 2H2SD 3LKOA 3U7WL 3OKMA 3FCSA 4GQ9L 3HC4H 1A7QH 1YPZA 3KPOA 3N50A 2OMBA 3DVNA 1PEWA 1TMCB 3IYLW 4IMLA 4NIKB 1AR2A 4MNQA 4XZUB 1BF2A 2J20A 4HSQA 2DD8H 1WWCA 5K59F 4Q8BA 3LXBA 2R1WB 1AIFB 1N26A 2MNUA 3QIUA 4EPSA 1HQRB 2ZUSA 3AROA 2A9AA 4NDMB 1QI4A 2JCCA 3RWCA 1CFTB 1KGCD 3SQBB 1I9JH 4P2OC 2CG9X 4F9LA 8FABA 3N1MC 3LQZA 4DVRH 2D7PA 2IBGA 2PCPA 2Y5TA 2E4FA 2Z31A 3ABLB 2QQNH 3QBTB 3JVGC 4LHUD 1N9PA 4BQBA 4GT7A 3BFQG 3Q1SL 5FHAH 5HI3D 4D0DA 1XV8A 5T3XH 4NM8H 4X0KB 5F88A 4MB1A 3SDDA 4QD2E 4NXKA 1RZJL 5ANHA 3AAZA 3ULUE 1KB5A 1UT2A 1X7QA 5FFOA 5AW1B 5C2BH 5DS8B 1MRCH 3MYJA 4HK3N 2BVEA 4LLDA 4NERA 3DRTA 5DD5H 1X9QA 1TQTA 3GLAA 4FQQB 4MNGA 2X44D 4G59C 5DC2A 4EJ1C 4FXGC 3EYSH 4KO6A 1CGSH 1IVLA 1HC1A 3KPSE 1V8HA 3MV9B 4APQD 4DT2A 4PV1C 1R34A 3N85L 4EQ3A 3LPPA 3AITA 4GRWB 1DCLA 2V9UA 4ELKB 2GIYA 2FD6L 3QZLA 3ECBB 2X6MA 4JFDD 4ZMAT 1U2HA 1YJDH 3ISWA 3WFDL 1MY5A 3AG1B 4KWUA 3NIGF 1MFCH 2NY6D 1O9VA 1KF9B 1NAKH 3IAPA 1MXGA 4RCAA 3TO2A 3AG4B 2IANE 3Q2LA 2D31A 3EUUA 2WXNA 4IOSA 2DBJA 4WTXA 2QV2A 4P5KA 3N04A 1LO0L 5I9QC 1MCQA 5GIRA 3AWFA 2WLLB 1IAKB 3N40P 3DOIA 3NUKA 3QZWA 4A67A 2BY0A 5D7IB 2NY0D 3BWZA 1MJ8H 5B21A 1T7XA 1TQWA 1WBXB 1KTDA 2DYPA 1D2OA 4KV5F 3X3GH 1CK0L 5JDSB 3B2UC 5HHMB 5LUMA 1CWVA 2JXMA 3QXTA 4NUGH 5C0RH 3QFJE 2NSQA 3KDMB 4OU3A 3SKMB 3GMQB 1FSKC 2VNCA 4CSSA 4TVPD 4JGJA 4MA1B 2E5EA 4KY1L 5DWUL 4N8VG 1YNKH 1KNOA 4PWFA 3TWYA 1SOXA 3DETC 4S2SB 5D1ZA 4YUEH 1U92B 1FYTD 4I3SH 3SE3C 3X12A 1CFQA 1X5MA 3ZQXA 5E2VL 4KH9A 1OWRM 2X40A 1HK6A 5KVDH 2WVSA 1SHMA 2XFXB 1S5IH 4U33A 2L8AA 3O3UN 4I5BB 2DH2A 3ECUA 1EJOL 1OGPA 3O4OC 2ZONA 5DUPL 4WI9A 4N2EA 1XTLA 1UUNA 1FRGL 4M61B 4JM2A 1EQWA 4AGLA 2D7MA 1JHLH 1QSEB 2BVPB 2W9EL 3QQNA 4Y5YB 3GMLA 3INUL 1OF2B 1QZ1A 2GITB 4ANXA 3ARVA 4YQXL 4A2HA 2MQ0A 3FO9A 2YGQA 4FFTA 3QC5X 1FJ1B 3CFQA 5FGBA 3BIKB 1LEIB 3CFUA 3CSPA 4KU1A 2CO7A 3BUBA 3EOYG 3LVEA 3MV7E 2R1YA 4ZW6A 3S5LA 3P2DA 1WFOA 2CNZA 1JK9B 3CHSA 2N1KA 1ZGLA 4F1SA 2IGTA 1VDGA 1IGML 1T04B 4PV8A 5EZOL 5J4MA 3CGTA 3DX1A 3LQAH 4QTFA 4GP5B 5AZ2L 3OXSB 5C07B 4ODUA 2BHZA 2FEDD 4RFOH 3C5JA 2VDOH 4Z0XB 5FIEA 1AGDA 2IPUG 1HS6A 1OAQL 1WAAE 2X6AA 4NRZB 2IADA 1GW0A 2IOMA 4N2IA 4DOHB 1ZHBA 4FZEL 2BH0A 3DTXA 2X5PA 4DK6A 2XPGB 3CDZA 1FNAA 1JZ3A 3OJVC 3EH5B 4BZ2A 3KYNA 3BDYL 5CINH 3H2QA 4G8AC 4UU9B 4KX9A 1YN7A 2HX9A 3WY2A 4J39A 1LXMA 5I66A 5CCKL 3G04A 5L88L 4NKDB 4Y2NA 4YSOA 4AVKA 2QGEA 4Z95L 4R90L 4HZAA 4D7PA 3W82A 1JNHB 3L95B 1Q9KB 2CMRL 4NWTH 3RWDB 2HFFA 1AZUA 4YAQA 4G8GA 3FSWA 2CA3A 3F7YB 1CLYH 1U3HD 4AC4A 1BFVL 2KS0A 4U1SB 3LS5H 1OTTC 4JFXA 4TQEH 2DEWX 1J0KA 3HAEG 5IOKA 2DF3A 4Z7UE 2APBA 4FP8H 5EO0B 1SMAA 4HFUL 4Q9BA 3WO4B 3KPLB 1G84A 3PHSA 1CU4H 3S0PA 2VUOA 4GP8B 1TLKA 4UQDA 2PXYC 3FTZA 1B0RB 3BGMA 4FF9A 1PD6A 5F3HB 3DUSA 2PW2A 2WC7A 2NZIA 2OL3A 2BOBB 3ROLA 2B0SL 2FO1A 1J1OH 3O41A 5C6TH 1YEKH 4CDGC 1NLBL 2XA3A 5FDYA 1S78C 3NRQA 1M6OA 1CCZA 1U8NA 2DICA 2JTYA 2F7QA 1N59A 4PJBA 4OLZH 4AKQA 1KGYE 2Y7QA 5FWRA 2ZP0T 1S8DB 3DPBB 4R7XA 2D8KA 3B7UX 2WXOA 4PJEB 4PHZA 4EN3C 1YEGL 4NKOB 4B9IA 4DPBX 3D9AL 3MLXL 5F9JA 4P4RA 1VFBB 5EU6A 4HG4K 2Q7NA 2Q2EB 3LCYA 1NCWL 1KENH 3O3BA 2ZAGA 1G5GA 5J6GA 4NZ8A 2AK4A 2CJUH 4IW4C 4L9LB 1NCNA 3DECA 3G6DL 5E1HB 2F7PA 1YUHB 5SX5H 4DSYA 1P2CB 2D7TL 4PJXF 5CILH 5IW6B 2BZCA 1RPQA 3MXWL 4PP1C 4S0TD 2VR4A 4LASH 4X50A 2WSPA 5JOPE 2ICWI 4DFIA 1OXYA 1U2YA 1ZD6A 3FQWB 5C7ZA 2YOAA 4ES9A 4MKMA 1IVTA 2V9QA 3V6BR 4BK5C 2D0GA 5CSBA 4F33B 5AYQA 1FBIL 2GEEA 4N20A 1ZKAA 1O6SB 5C08D 2EXWD 2EIZB 3LQMA 4KI1A 4S1QH 3SGEH 3UTZB 5GGRY 1UURA 3ZBMA 4PCTA 4QR7A 3KWWA 4PLKD 4WJ5B 2FYYA 4BRJA 4YBHA 4YWGL 1ZLSL 3KYMA 3RIKA 2VKWA 3F7VA 2WIIA 3WDJA 3TN0A 4HIXH 2H3XC 3AS3A 1H15B 2BDNL 1P4IL 3QJZA 1WD8A 3W5MA 1CPUA 1RJLB 5JMOC 1KGCE 2A4ZA 3MYZA 4LEOA 5LB1A 1DO6A 1G6RH 1EZUA 1LM8V 4PRIB 1ASQA 4LP4A 2VDKL 5IEKA 2OM5A 1X5YA 1TNMA 3WKMH 1M56B 2ARJQ 4GS7C 4KY2A 1BJ8A 1TJIL 1N68A 5D7SH 5DEFB 3AG3B 1IBGH 3CUPA 4ZMTA 4WNJA 5LJYH 4LPUA 5LGHL 4DZBB 4KKAD 4JREB 4MXVE 1HH9A 2C3VB 4JO4H 4O02B 4ODHL 5DJAA 4NO0A 4JQIH 4GW4B 5HYFA 5BRZD 5DMIH 3TFKC 3IWVA 4NQDD 3VRLF 5F3FA 4BKSC 5I71B 3MCYA 2R2BB 5LQBL 1DQQA 1Z3RA 1CR9L 3B6SA 2WYZA 1KY7A 3BSZL 3GSVB 1DTUA 1HWHB 1SXNA 2JB5L 3L3HB 1BREA 2CRIA 5TK2A 4LNRB 5I6LA 4EZLA 4PGBB 6PAZA 5KJRH 1H6FA 2E7LA 4NUJB 3UBXI 2O4EA 1R3LA 3H9ZA 3LZLA 1M2VB 3ES6A 2DDQL 1ORSA 4UINL 5KJ4A 4AEIL 1DLHA 1WA0X 5TGBB 5HDOA 4IGBC 2CK0H 2Y1ZA 4MJ6A 4ZMOA 3RX8A 4N9GB 4PRDA 1GHFL 1F86A 2A0LD 4XNXL 1LP9B 5FA4B 3PNRB 4QHNB 4XCCL 4K8RD 4AQ8A 2B9BA 2EACA 2HTLC 2N0MA 3L54A 3CVCA 1OGAB 4OBSA 1QHQA 3O6FC 3NRFA 1AKPA 4DZ8A 2SODB 2P7TB 4APXB 1A0QH 3GSWB 3BEVB 1UXWA 2G4GA 4QHMB 5EF3A 4FG2A 2W0PA 5LBSA 1EZLA 3DRQA 5FM4A 3U36B 2Y06H 3EFFB 4OZGE 1AS8A 4RMRA 4TVPE 4OCYL 3PYCA 4XX1G 3HE6C 3NIDB 2J6WA 1WK0A 2HRLA 1OPOA 3L81A 2DQJH 3MUGB 3OX8A 3BJ91 3QUYB 4L4VA 4YDIL 2CJ3A 5HHXH 3DV6A 4ETQA 4EXPX 5FYLD 2J5WA 1USQA 2DMHA 3UCQA 1BVZA 2GUYA 2EC9T 1Q90A 1WLHA 5F89B 3GF8A 5AW7B 4P3DA 2CIIA 4FABH 2IH8A 4OQTH 4X6DB 4GH7B 4ZMVA 4P2OD 2WVUA 5B38G 4JRXB 5EPMA 3F3HA 1NMBL 1TCRB 5FS5A 4KHTH 3RG1C 1L9MA 2FH6A 3IRCA 4QOKA 2PR4L 3CLFH 2RQ8A 4RDQF 1HJBC 4HC1L 3VXSE 2W0FA 3ERXA 5BUAA 3IFNL 5IMLB 1SNRA 4AYMC 1IV8A 3SGEI 2YARA 4GAGH 4FNUA 4G7VH 5I26A 4R7DA 2YD7A 3OKOA 1CDJA 3QIBC 4MCZB 3APCA 1TYEB 4A2EA 2KZKA 3DX7A 3Q8CA 2X41A 1DVFB 2H45A 3ULVE 1I1RA 1VGKB 2WW8A 3P11H 4R9HA 3HNVH 4HALA 5IKCA 4D9RE 5JOFB 2UZIL 2VDMH 4QRSB 3A4EA 4AYSA 4PJAB 3NPSB 5IQ9A 5T1MA 3QHZL 3QDGB 4LSDA 4PWKA 4XWOC 2J8UB 2XV0A 5GSRA 4ZK8A 1QRNB 2Q7AA 3QCTH 4K3GA 1W16A 4NPKA 3LKOB 3OKMB 3FCSB 1YPZB 3KPOB 4XN9A 5BRQA 4TSAL 2CDEA 3DVNB 4IMLB 4GP4B 3KVPA 4IBLT 4Z7OB 1LEGA 3US0A 4MNQB 4EO5A 5HBBA 5ADPH 3NCJH 1AMYA 4S1SH 5DS2A 4AK2A 1PZ5A 1S7RA 2PP7A 3QIUB 1J88A 1YNLL 2Y07H 4NNYB 3ASOB 3V5HA 4AQ1A 1UXSA 2JCCB 4IIQA 3RWCB 8FABB 2H6PB 4NYLA 1TOXA 3LQZB 4Y1SA 1BIIA 5CZXC 5EIQA 2PCPB 4QCIA 3NCMA 3ARGD 3QUKA 2Y5TB 4ZUTA 3WJLA 2XETA 2Z31B 4DP9X 5KBKA 2OR9L 4QJ5B 1OSPL 4FN0A 4XCNB 2E9BA 3B2UD 1I3RA 3BKMH 3FRPG 3NGBB 3P30L 3P3RA 4GMTL 4XN4A 5CN3A 5IQ7L 3UPRA 4XXWA 1K5NB 2AEQH 2NY2B 4D0DB 5FFLA 4EEEA 3NCCB 1HILA 3ZQ9A 3H7LA 2F54D 5F88B 1J5OL 3EKCA 1OL0A 5GJSL 4UTBL 3ZGHA 3AAZB 4HWBA 1E3ZA 1WE5A 5L4FA 1KB5B 4EI5B 1YEIL 4XNMA 5C7XL 2OPCA 3MYJB 4W6WB 1LILA 4P59H 2W5PA 3O6KH 3DETD 3DRTB 4LLDB 4F7PA 3HG5A 2QGCA 4ZMYA 2ED6A 1SMOA 4QRPA 3HC4L 1WCBA 2QPUA 2LOEA 5E8OA 1Q1JL 5AVYB 1BPVA 3L3DA 4JO1H 5DHVH 4TOYH 1WICA 3L4WA 2LAGB 3WN5B 1MI5D 3PJNA 2VDLB 5KSBA 3T71A 4Y9CA 3V6OE 4YHNA 2EDHA 5GRVL 1BAGA 1NCTA 2X4TA 5D6CA 4OM0H 2XWTA 2QQNL 4N68A 1K3ZA 4LDCA 5D70H 4DKEH 5D1QA 3HPJA 4J7RA 4P5KB 5GIRB 5E4EB 2BCKA 4PJGA 1YECH 1A7RH 1NDTA 3CMOH 1G43A 3QZWB 3VFSA 1ZLUH 4RDBA 1JGLH 1ONQA 4KTDH 1XL6A 2HG5A 4LSQL 1KTDB 2DYPB 5C2BL 2B7DT 3I2CH 2D9CA 4RRPA 2JXMB 3JWNG 2GG1A 1T0PB 3AJ7A 3OF6A 3CFTA 4CC4A 2XA8H 6PCYA 1BA9A 2RGSA 1H3PH 4P99A 1CGSL 1U6AL 3PHQA 4GO9A 3IPEA 5CP3H 4L8DA 2VZ1A 5C08E 3ZE2E 5EO1A 1BM7A 5D1ZB 3CHXA 1ML0A 4QHLA 1JF5A 1J1PH 5AOJA 3X12B 1CFQB 1YJDL 1A14L 4LVNB 2ZXCA 3Q8FA 1MFCL 5F7KC 2IXQA 1QOKA 3WMSA 1WFTA 4H88H 4AIXA 4KQ4L 3GRWH 4Z7UF 3HBQA 3K81A 3QZPA 1JZ7A 4F7EB 2EKJA 2CLZA 1HZHH 2CHWA 4GJTB 2F7OA 1H5BA 2CLRB 4JM2B 3MOBL 1F6FB 2V8MA 2YBGA 1E7UA 3GMLB 1N10A 3S3CB 4G3YL 2OP4L 5D7HA 3ZTJG 2NTSP 4PI2A 3X3GL 2H26A 2I5YL 2CO7B 2V37A 3GRGA 2R1YB 3EW3B 4FG4A 2PXYD 3S5LB 1PTZA 1KGIA 4ZW8A 2DYRB 2Z7WA 4L23A 3GMRB 2BFGA 2J55A 3H9YA 3MRKA 4MA1C 1A2YA 1KIQA 1ZGLB 3NEXA 4FFWD 2NPLX 4B95C 1UM5H 4Z9KB 4TRPH 4PV8B 3Q1EA 1JGIA 2FJUB 2NTFB 4U6YA 2ZG2A 2MEJB 1CBVH 4ODUB 3APFA 3C5JB 4N2OA 4WZ9A 3TBVB 5MHSD 2EUWA 4FI7A 5K39A 1XGQA 4N5EC 3FTGA 1F3JA 4YUEL 1AGDB 5BRZE 2K78A 2FL5A 2IADB 3U46A 2FK9A 1ZHBB 3LJ3A 3DTXB 5KVDL 2P5WE 2ZCHH 1D7CA 3CDZB 5EEWA 1FAIH 1TPXC 2G0LA 4EN3D 3KYNB 2ZUVA 2E56A 3UAJC 3W9EB 1OW0C 2Q2LA 2AQRA 1EAJA 2W59A 3PAVA 4B9ZA 2C4FU 3UZQA 1OOWA 2MTAA 2QBWA 3DJRA 4FNTA 5TH2A 5I66B 2OTWA 2WY3B 3G04B 3MNWA 4TNEA 3VWJA 3CCHA 3DDFA 4NO3B 5CZRA 3TIEA 3L16A 4FAAB 4A7GF 5HDBE 4B97A 2HFFB 4OF3A 5LXGL 4G8GB 4H8HA 2BNQA 1J86A 1GRWA 4OUUA 4HJ0D 5DJXA 4NUQA 4JFXB 1U8CA 5F9OH 3NFSH 3KXFA 1ZRUA 1RPUA 1G4RA 3C75A 3LQAL 1X5HA 4WI2A 1QNIA 3IXAA 2VDOL 4W4OA 2FQGA 3BGMB 3SPJA 2HJFB 4G42B 5DWPA 5C0FB 3DUSB 1LQSR 4QXUH 2PW2B 4LPXA 5F7WC 2DI8A 3IDGA 4YR6A 1R3IH 3ROLB 1X6LA 5PAZA 3O41B 3NEOA 3V0HA 3ZU8A 4KQ3L 2X9ZA 5CINL 1M6OB 1U8NB 2P8PA 5FYLE 1AVAA 1FIGH 1N59B 4PJBB 3NCEB 2Y7QB 4H2CA 1Q1PA 5BXFA 1RP8A 4LCIL 2JKRM 1T1XA 3CHRA 5GSVA 3MOAL 3NSDA 2B59A 1WZLA 4JANA 3WO4C 2H6UA 5F9JB 5BW7A 4P4RB 4OIIL 1J7VR 5EU6B 3V0VA 3O3BB