2OMXB

Crystal structure of inla s192n g194s+s/hec1 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
PLGSWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermodynamically reengineering the listerial invasion complex InlA/E-cadherin.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Cell invasion/cell adhesion
molecule keywords Internalin-A
total genus 21
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 2omxB00
5CO1A 1NCHA 1L3WA 4AK1A 2QVFB 3FF7A 4ZMLA 5JYLA 3Q2WA 3PPEA 4XXWC 4AQAA 4ZMVA 2A4CA 5DZVA 2X2UA 3K5SA 3LNDA 2OMVB 4NQQA 5JYMA 1OP4A 3MVSA 4ZTEA 4ZMPA 2YSTA 1EDHA 4AXWA 4AQEB 4ZMWA 3K6IA 2A4EA 1NCJA 2OMTB 3UBHA 2OMWB 2V37A 2WCPA 2QVIA 2O72A 2OMZB 3K5RA 5KJ4A 4ZMXA 3LNEA 4ZMNA 3LNHA 4AQEA 4APXB 3K6DA 2OMXB 5CZRA 1ZVNA 1ZXKA 3LNIA 3UBGA 1WUZA 2WBXA 1NCGA 4OY9A 2OMUB 4XXWA 3LNGA 1O6SB 2OMYB 3UBFA 3FF8A 1NCIA 4ZMZA 4ZMQA 3Q2LA 2EE0A 4ZMYA 4NUQA 4APXA 1Q1PA 4AQ8C 3Q2VA 4AQ8A 2WD0A 3Q2NA 4ZMOA 3LNFA 4NUPA 1WYJA 4ZMTA 3QRBA 4ZI8A 4ZT1A 4NUMA 4QD2E 1FF5A 4AQAB 3K6FA 4AXWB 2WHVA 2YQGA 1SUHA
chains in the Genus database with same CATH superfamily
2UYLA 1NCBH 4PJCF 5IREA 4XCEA 1IFGA 1CU4L 4AEHH 2BHYA 3B43A 2XQYA 1OE3A 3WIAA 4JEGB 4B3VA 3S5LA 4BRJA 3K72B 3U1PA 3GLEA 3VYPA 5DC0A 5DUMH 1NDGB 3GMQA 1AQMA 5D6DA 2CAKA 2DQUL 2QMKA 3BFQG 3PABA 4EIGB 2AABH 1KEML 1Z9PA 1QW9A 4OCSH 4JB9H 4OT1L 3FUEA 4RQQA 3QIUA 3ZSSA 4LLVB 1K8DA 4MA1B 3VXRA 4IHBA 5MEQB 1CFTB 3ZY7A 3LX9A 3EO0A 5KUMA 5DO8A 4OIIH 4NBYB 1SXZA 5J13C 3KLLA 3Q1SL 1WUNT 3UTZA 5D4IA 5AVVB 1BFOB 1OE1A 3MLXH 3CLEH 4B9ZA 3BQVA 4AT6B 3KPOA 2WBJC 3V4PL 2GJ6D 1A4KB 5A2BA 2ZTBA 4ZUSB 1RIUH 4LGSB 3FU5A 2YKKA 3S2CA 4TNGA 4GSDH 3VTMA 5SV4A 2H3NA 4Q9QL 1CICD 2VN7A 3BKCH 5F2FA 3OGCA 4NPYB 3QXUA 4ORGA 2VQUA 3JT2A 3ENEA 4WK0B 4ZQTA 1DDHB 2H41A 1U8JB 2WYHA 1N4XH 3L9RA 2ADFL 3RL2B 5TE4L 2R1WB 4G72B 2CUAA 3GHBH 4HIIA 3X14A 4JZOA 4ANWA 2XPZA 3SZ6A 3L3HB 1T2JA 2NUPA 3TJEH 1T6WA 3UAFA 3QCUH 4GRLC 5EU6D 4H26B 4W6YB 4AZ8A 1FZJA 1PTZA 5CD5D 5E9NA 4M5ZL 1KB3A 3N41F 1HFUA 1M05A 5IBLC 2NCMA 1Q1PA 2CUHA 1GC1L 1UUNA 1NPUA 2VT0A 4WEUD 3GMOA 3RX9A 4UQDA 5IJCC 1IIKA 3DV4A 3DXAE 3KXFB 3LEYH 1I75A 2G5BA 4F20A 2CNYA 4LPTA 2C7UB 1AMYA 3CVHL 4RMUA 5D9SB 2APBA 4PGDB 2JLPA 3DX8B 3PYCA 1KNOA 4N4YB 4HWEL 4HCIA 2QR0A 4OBRA 3GYRA 1T0NB 1CDIA 1Y07A 1YPZF 2VQ4A 3P9MB 4TPRH 1XV8A 1KJ2H 4R4BA 1EEZB 4YOKA 1JZGA 5FC9A 4RGNB 2VDMB 4LHUD 1ZK5A 2BY0A 4PGBA 4XMVA 3HRZC 2EO9A 3D3VA 4C56D 3V6OE 2JKRM 4U6YB 5T3ZE 3DX9A 4ZFFA 2IXQB 1U8CA 2EC8A 2V6HA 3DUHA 4O9HL 4V33A 2Z9TA 2IV8A 4PJAE 1DQTA 4L29A 3BO8A 2X2UA 1OTUC 4HAFA 1G9ML 3SYAA 3UJIL 5A7EA 3U30B 4YIQA 5D1ZC 5EULV 2YPVH 4JJHA 4EQ3A 2DQCL 2ZKMX 3O3AA 1H0DB 3QZOA 1T03H 2Y69B 4L9LB 5GJTL 2JJUA 1SBSL 1ZAGA 2VXUL 1INEH 4Q6IA 5EDSA 3BYYA 3QG7L 2J7LA 3EJZD 2FJGB 1NOLA 3QEUB 2IC2A 4X2UA 2XG4B 5IOPB 1C8PA 1C7TA 4FQ1H 4KDWA 3S3JA 4RGMB 4F8OA 4O4YH 1CFQA 3ILDA 2FLRT 1G9EA 4LEXL 3CC1A 4GKSB 4HKXB 1A7NL 4EZMA 4I2XA 5BVPL 1AGCA 1X5AA 3D9AH 3RU8L 5BVJA 4KKBD 4KKAC 2TAAA 4WLCA 1AZUA 1NBCA 2DYSB 3H3KA 3SDAD 4F8PA 3U6XS 3DX0A 4HC1L 3I3BA 2CO3A 2W65B 2HP4A 2K9FB 4HK3J 3QNXA 2WGXA 1S7UB 4BCYA 1AXSB 1UFUA 4XPTL 4HWBL 2PN5A 4KKZA 3CCHA 4ONHA 1FUNA 4K3JH 1D5BB 3O9WB 2PWGA 2G2RB 4HIHB 3L1EA 4PJBF 3OJDA 3ARUA 3NRPA 4FYQA 3NP3A 3ZYZA 1U8PA 2Q0ZX 1AJ7H 1KPVA 3BKML 1RZ8B 3N85H 5I6PA 4HKBA 1MQKH 4AV4A 4E0RB 2P5EB 1OD9A 3GIZH 4Q9RL 2VW6A 4G7RB 4LLAA 4YS4A 3STZA 4FS0A 4URTB 4XVJL 4GW4B 3DJZA 5HDRA 4D0DB 1GC1C 2W59A 2XIDA 4N8VA 2EADA 4PJBA 1H8NA 1FORL 3IMBA 2WXHA 3F7PC 3KPSE 4LARL 5DMKA 2OJEB 4HC1A 3T0EE 5FA4A 1AI1L 4ZUUB 1RY7B 2D3NA 1UGNA 5D5MA 1A3LL 5D7HA 1S7VB 5JIIA 1AE6L 1WK0A 4MMXB 4JFZH 2EVJA 2RGSA 3KWWA 2X4UA 4PSPA 4U1SA 3TBWB 4OGAD 1OXYA 2P42B 1FE8L 3F12A 4JHAH 1FL5B 5AEAA 1JGVL 4ZBJA 4GG8A 3VU2A 3GO1L 1Z32X 4E9YA 1UT2A 2BOCA 3CFMA 3MUGA 5I71B 4YDNA 5C0IA 1LEIA 3VNYA 1TETH 2N59A 2W0PA 1JD7A 4JHBA 2QPFA 1EJ8A 4I0PC 2GUYA 4NIKB 1Q0YL 5TE7H 1YUKB 2OL3H 2OMXA 2YOAA 1QBBA 4M56A 4HV8B 4JO2H 2OCCB 1LGVA 4I1RA 3GT6A 4HGWB 3HUJA 1OP3H 1L0YA 1W2KT 3ZMEA 1HT6A 4GUPB 2JJWA 3A21A 5L0QC 1N68A 4ZUWB 5AW0B 1TEGA 2HRGA 3UBXI 1QRNE 4CMMA 2AJUL 1E8WA 4P2RE 4LRNH 4ZMWA 5EEUA 3B7TA 3CXDL 2OYPA 5IUCA 3L5XH 2OMTB 3LKNA 5AVTB 2DBJA 4FJ6A 2VQ1A 4G5AA 2PYEB 2E9BA 1KLGB 2CGZA 5AAMC 4EOWL 1JE6A 2HX8A 3HC0B 4DP1X 4NRZA 1IC7L 3LPOA 5EIVA 2EO1A 2DEWX 2JQAA 2NLJB 4NUGH 3GSRA 5E9DA 3I50L 1IBGH 5ANHA 1LK3L 5EOCJ 2FO4B 4HZAA 3D0VB 3VD9A 2CMRH 3TO4D 1XF1A 3DJSA 3PREA 1X9UA 5AZEL 1BV8A 4JM2A 2C9AA 2VM9A 3LMJL 3I9GL 1PD0A 4PWKA 2MOGA 2ZOKB 3T6VA 5B38A 4ERSL 2DYPD 2WYZA 3PV6A 4A7GF 5I0WA 1NTDA 3RTQD 1WFJA 1F4YH 5CFAA 4LGRB 3VFVA 3ROLB 1Q94A 4N68A 2Y4SA 1HOEA 3IJEA 4LNVA 3KBPA 5AKSA 2PPEA 4BCZA 4XN2A 2VH5L 2B9AA 3GSVA 5B8CB 2A4ZA 2CRYA 3MRCA 3DOSA 5IW6B 4QO1A 4NZFA 2WTOA 4AMXA 4X99B 4GSXA 4NRYA 1MRFH 1DUZA 3PU7A 3DJRA 1ROWA 4G6AC 5F3BA 4MS8C 2XN0A 1ZT1A 3MYZA 3GXMA 3O2DL 3OMIB 2FH6A 3LV3A 2RACA 1ZGLM 5DJAB 3X3GL 1ETZB 1NEZG 3S88H 3INUH 2FLMA 2WIIB 5FYKU 3LH8A 2EXWC 4XNYH 3N1QC 4ZXBA 5LBGA 3ZPDA 2QPEB 4LSQL 4N24A 2Q6WA 4G1EB 4UTAH 1XGTA 3NGBB 4OJAA 1OB1B 3FUDA 3TFBA 4JZJA 2X4NA 3E80A 5FUZL 4U1LB 1GKEA 4TNEA 1AXTH 2Z7UA 5AKVA 2DWEB 5C0DA 4CU8A 3OC8A 1WISA 4FL4B 4Z7WB 3VGBA 1II4E 4JRYD 2X41A 5DHXB 2BJMH 4UU9B 4Z7QE 3RVTC 3SY0B 1J8SA 2ZCKH 3NIGE 3N44F 2X4RB 2BVPB 1KN2L 5JXAL 4XHQA 5IKCB 2E9WA 4GG6F 3HPLB 4IM8A 1YY8B 2UUDH 2Y7SA 1XEUA 1OGAE 1TDQA 2P8MA 3OKEB 2Z7YA 1LP9E 5C3TA 2XTJC 3WTSA 2A6IB 3BSZA 1R1CA 1OAKH 2IXQA 4OJDH 3QDMB 4QRRD 3B1UA 1NIAA 5FO9A 1JXJA 4JPIA 5F6IB 3VFRA 1EX0A 5B3NA 4NKDB 4GY4A 3BVTA 3KGUA 4TVPH 1A1OA 2GT9A 4JPWH 5HJ3B 3I84A 4OF0A 4H20H 1TCRB 2ZZUT 2XXMB 4YX2H 1MIEL 5JHLH 3HI6H 1TJIH 1NCOA 2AI0L 2H8PA 4X0NA 1RZIB 2F9BT 3GZOA 2A77H 5DMIH 1OW0C 1MZZA 4RA0C 3S37H 4JZJC 1CICB 1D5MB 3BIAX 3NIGB 4X6DF 2XWTA 2XWXA 1UWEH 4GQ9H 4Q89A 4MDIB 1O7VA 1PG7H 2ZCHH 4PW9A 5HGHA 1JZFA 4NFCA 1AXTL 3B56A 1WBXB 2EACA 5FUZH 5D7LB 2UZPA 3BT2H 2KPWA 1JZHA 5I6XC 2DIEA 5KYUA 3HFMH 5E94B 4LSQH 2XZAL 5IJKC 1FG9C 2WVVB 2BFVL 3AGVA 2I26N 2X1WL 4XB8A 2PO6D 2R4SL 5DRNA 1CE6B 2Y22A 1P6WA 3FTWA 1HWGB 3AACA 1AGDA 2YZ1A 3HA0A 3MRNB 5E5RB 5EZOH 5FYLD 5E0FA 1KWGA 2J2ZA 2Z0UA 4EN3A 3IB4A 3MXVH 4NO3B 3HKFA 2K6ZA 3IJSB 4GT7A 2C1PA 5B3SB 4K8RC 1MFDH 4FEMA 4D0BA 2YKLH 4ECNA 5GSVA 3K4DA 3PGCA 4D2NA 1OGPA 3AG4B 4IEFB 1EQWA 3DI3B 1KCUL 1YEHL 3DETD 1DEEA 3VDBA 2LV4A 1T21B 2RFXA 1T2QH 4QCIA 3C2AL 5F9WC 4K8RL 2E4FA 3M7FB 1BG9A 1SEBA 1YNKH 4RWHA 2GYSA 2H2SC 1M7IB 3O6KH 5IT2L 1E9PA 4R6UA 4MXVF 2CGYA 1BFOA 4NGHL 4K3DL 4KUZH 5IBUB 3GMLA 1BFVH 2BNRE 1YEGH 5H8DA 1S7VA 3V4UH 2R2BA 1E5UI 5F9OL 1HYSD 3DO3A 1HU8A 5EZJB 2A6DB 1HL5A 5GRUL 2EKJA 4ZFZA 1E9QA 3EOTH 4KXBA 3I50H 1P6FA 1TVBB 4ZS6D 3AGWA 3F6JA 4M7LT 1X7SA 4KXCA 1EGJH 2X09A 4L37A 1FFTB 5DJDB 4LHJB 1QX1A 1ETB1 2GI0A 3TOPA 2I9LB 3UH8A 5J1TC 5DSCB 2A9DA 2OQJA 4B95C 3JUYA 2WUBL 2FD6H 5F3FA 2A0LC 3BKYL 3PL6C 4BHUI 1ZDQA 2I9TB 3HZVB 1FZJB 1ULVA 3L4ZA 3M07A 3LEXB 1ZVHA 3QZWB 2ZWNA 3KD4A 1FYHB 5E08H 4KKCC 3SKMA 1O7DC 3EYUH 5DTFB 5TQ0H 5EC1B 1XCQB 2RJMA 2WVTA 4UQ2A 3U2SA 1QBMH 5C0BB 2ZUVA 3ZSTA 2VC2L 2OMVA 2YFNA 3LPFA 3WHXA 1ZXKA 5L2KA 4KC3B 3TF7C 5KN5A 1Q0YH 5TE7L 3S98A 3LKPB 1HHGA 4JKPH 1HL8A 1TZGH 2ITCB 5EIQA 4ZS7H 1A9EA 3ALWA 2ZX8A 2VDRB 4YO0A 3EOAB 4V1DD 4YZWA 1VZGA 1AKJB 4LL9A 3ZKSD 2ODIA 3NRQA 4K0OA 4OAWA 4PJIB 1FRGH 2GIYA 3U0TA 3UZEA 3FT1A 1YEJH 2F8IA 5HDWA 1AS7A 5F1NB 4AWJC 1FLRH 1Q9WA 1QFHA 3FO9A 3MRBA 3HC2A 3P0GB 4JJOA 4HLJA 5EV7A 3TU6A 1J5IA 4NUQA 4OGYH 3VI4A 3CN4A 3HG2A 4AQ8C 1SRDA 8FABA 3D0LA 2DH3A 5EZIL 4WUKH 4LIQH 2BPBA 4PREB 1KJ3H 2AJVH 5A2CA 2GK0B 3OTTA 4HK3N 4JAMB 2ALAA 1HIML 3RB5A 5I1EH 4TRPL 5DK2B 1Z9SB 3SGDH 4IQHA 4N28A 4NO2A 2B16A 5EOQH 4OLUH 1K8IA 4JPVL 2JB6B 5HDBF 1GCYA 2HUHA 3GI9L 4UOZA 5IJBC 5KBDA 3B2XA 5E2WL 2PCPA 7PCYA 1X9RA 1BVKB 4XNBA 5TGBB 1I8LC 4NC1E 3A6OA 4LEOA 4X6CF 4ZQKB 3BRFA 4NKOA 1JIBA 2GJPA 3HFFA 2C9VA 3LQAC 2JNZA 3X11B 5IB4B 5HTSA 3HR5B 4G7VH 1E5ZA 1WG3A 1MDTA 4LVHC 5C0BD 3VG9C 3BVVA 3ZOAA 4DZBA 4IBUA 1V8HA 2XY2A 4O2FB 5HD8C 3B8SA 4JKPL 5JQHC 2YA1A 3OWRA 2V33A 3PDGA 3FULA 4WFGD 1R5VA 5HDQH 2PPAA 2Q6WB 4O58H 4DVRL 2VC2H 3CZFA 3KNBB 3BIBX 4MGXA 4MXQD 4MX7B 5H2BA 5FYJH 4PTTB 3H6JA 2D2OA 2D31A 3ZX1A 4QLWA 4AIOA 3UFIA 4LLWA 1DVFB 5DMGD 1PBYA 1WICA 3LZRA 2DM7A 4PJHF 1UXWB 3D2UA 5DHVH 4BZYA 1F02I 4KX8A 1H3TA 2PXYC 5IJVB 5T3ZH 2E76C 4Z76A 3QCTL 3LD8C 3Q0HA 2Z7ZA 4P2QB 3H0TA 4Q6IC 1BQHA 4X9HA 1ZDSA 1J8HB 2XV2A 2ENPA 4YLQT 3SGJC 4LHUB 4Q0XL 3JV6A 1DCEA 5JW4R 1NIBA 3UXFA 3P4LA 1BD2B 1JD9A 3ULSA 4ZTPH 3EJYC 5ADPL 4XOAA 1A6ZA 1DJYA 3E9UA 3NPSC 3IAQA 4O9HH 3QFDA 1U8QA 4PJEE 4QRUA 3FS9A 1CYWA 4YHKL 4UM8B 2JCCF 4KZ0A 1JUFA 1NFKA 1T1XA 4WCYL 1TCRA 4G6JH 4G80B 4BELD 3SO3B 4I7ZC 4YHMH 3W9EA 3UP6A 2ID5A 3TBWA 1N0LA 2XACC 5TFSH 3PXLA 3ECWA 3H9ZA 2X70A 3P4MB 5CSZB 1A6WL 2WVSA 3KM2A 3UCRA 3RFZC 4K5PA 2VL5B 1W72H 2R0LH 1IE5A 2V7HA 1UD3A 1I7UB 4UINL 4UILH 2E4TA 4LGPB 1U92A 4EI0A 1IAIM 2EXTA 1TMCB 2XWDA 3MRMA 4ZFOL 1JNNL 3KPMB 4FFTA 3MRGB 1PZ5A 5C7XH 5JOFB 1BZ7B 3V6ZA 4BH7A 1FSKC 3TNNB 3DOIA 4RISL 2O6DA 1S7SB 4XT1C 1AY1H 1GOHA 5L88H 3GTTA 3AM8A 1LILA 4IRZA 4YN3A 3UYRH 3RP1A 4RZCB 5F9JA 1GMIA 3P2BA 5EO0B 3EXJA 4GINA 3SGJA 3G04B 1V7ML 1V3MA 5IQ9A 4NNXA 2G9KA 1BEYH 2JELL 4N0YL 3O2WH 4OZGF 4TUOA 5IQ7H 3NMEA 4JVWA 3B5HA 4XN8A 2ATKB 4CADB 2CCWA 3QZLA 5DJYB 1SMOA 5IVXA 2WBJA 4A39A 4NPKA 3MRJA 4QI3A 5BRZB 1IGJB 3FRPG 4MCYA 3AAZB 2Z92A 4JG0L 1CXLA 4YL9A 4GLRI 2CDGA 5I8EA 5K33A 2FEDD 1A6AA 1RZGB 4XI5C 2GAZB 1WA0X 4GQZA 2VDKB 2WYTA 3HG1B 5IMLB 3SDCC 4JDEB 2A4EA 4ZFOA 1KYOK 2YXVA 3KLHC 1P9MC 2Z65C 4PTUA 5DHVB 3HRZB 2DQGL 3I6SA 3V7AG 1OF2B 1QATA 4RQQB 5FM8A 1B6DA 1J18A 1UATA 3KDMB 1RK0B 1NBZA 3TCLA 1XSIA 4XMUA 5DHYA 4BFJA 3Q8BA 1D9KA 4HETA 5E51A 1N0XL 4PRBB 2EXWD 4QOKD 4N9GB 2W60A 5LGHH 5JXAH 3QDJD 2F53E 3A47A 2VDQH 3QR2A 5ITFB 4OKVA 2V17H 1MLCB 4HU8A 2E3VA 4I2XB 3E9TA 5DEJA 2J8OA 3NSXA 1DBKH 1F13A 1E5CA 2DLFL 2CXGA 5H4YA 2WXFA 4OM1L 2DI8A 4HXBH 4X5PA 5L4MA 4P9HH 2XFXB 1MY5A 4GO8A 1KV3A 3MRLA 1OAYL 4U1LA 5CU5A 4LCYB 5D96B 1K5NB 3QNXB 5DYFA 5LBSH 4X9IA 4ZUTB 4DK6A 3HTLX 4M4RA 5D2NE 1NEPA 2WXQA 4YGVA 4RIRB 2FBJH 4XVSH 4L9LC 2BRQA 2XG5B 3BGMB 4LPXA 2OI9B 1BECA 4WO4C 4RAUA 3IJHA 5JOPE 3HG3A 3MLYH 1EA9C 4GUPA 5MERA 3TL5A 4WWNA 5E8EA 5HDLA 4XC1H 2K9UA 1J87A 1MH5B 2E59A 3QEGL 1JPEA 1N5AB 1ZIBA 2PYFA 3M45A 4XP9H 3R7QA 3O9WD 4GW4A 5I6MA 4V2CB 2B1OA 3SB3A 1WP6A 4YSTA 4A7QA 1U3HA 2H32A 1MFNA 2X0VA 3JZ7A 3MNDA 2NY4D 1SN2A 3S8WA 3KCWA 4OZIB 3PJNA 4MJ6A 2F8VA 3S3DB 4HVBA 2X4TA 4ODTH 4ACTA 3CK0L 2X4OB 3UP1A 4KJQD 3I9GH 1E50A 1UH2A 5D7SL 1FYTA 4D3CH 2Z4QB 2VR6A 3KZ8A 3QCVH 4XXDB 4XAKE 4W70A 2WW8A 2UXTA 3S4SG 2DQMA 5F89B 3OGOE 3APNA 1XGQB 2G4GA 4PJXF 5FR3A 4JFDA 4KTDH 1YMHB 1IC7H 1KG0A 1HILA 2VGLM 5EBLB 3IDGB 2BM3A 3TCXA 1UXLA 1GRWA 4KKNA 2L0DA 4YXLH 3EH3B 4EMZA 2Y1VA 3U7YH 4NKIL 4JY5H 4UZSA 2R29H 1M05B 4F7EA 3EFFB 4MCMA 4QHKI 1NLBL 4JKNA 1HSAB 2DRUA 4OM0H 1U3HC 3N0AA 1JZ3A 4JGJA 4H26A 2XICA 2F5BH 3CFDB 5EU7E 3LS5H 3W5MA 5KJRH 1H5BA 2DDQL 4I9WD 4WU7B 5E5LA 2NY6C 3QUYC 5GSVB 1IQDB 1QP1A 5C0AE 4PJHA 1U95B 5C0AD 5C08B 1A6VH 3LRMA 3PL6B 3MJGX 5LXVA 3QNYB 4N2MA 2HMID 3MCLH 4JRXA 1PAZA 4LOFA 5HDBE 3T0EA 4PS3A 2G5RA 4Z7NB 4XODA 1BQHG 1ZLUH 3FSZA 5E6ID 1JZEA 1BBJB 4WGVB 3FU8A 4PJ9A 4BRVA 1MCWM 2V9RA 2ZSVB 5HPOA 3DO7A 3O8XB 4LBEB 4L1BA 4JHAL 3GHEH 1FE8H 5I18L 4M1GH 3HNTL 2ITFA 3OHXC 4JFZL 2Q7YA 1VCAA 3WCYA 4RAVB 4EUPB 2ICES 2VXVL 3PIQA 2OXGA 1DP0A 1GS6X 1FQ9C 4F9PC 4WF7A 3DXAD 1AC6A 3NABH 1XMEB 3KL5A 4KRLB 4JL1A 1PFCA 3T9WA 2ESVD 3AROA 1CFTA 2X1PA 4U7MA 1QSZA 3SD5A 4DK5A 3VDCA 3HS0C 2QDVA 3L45A 2Q9OA 5IVXE 2DQHH 1IC4H 2P9RA 5B4MD 5C08E 2W9DH 3N85L 5CZXD 2H9GB 2OMYA 1B90A 3VI3E 5C70A 3FKUS 3SOBH 3HZYA 2MSPA 2MCAA 3VW3H 3KPSA 4FQJH 5GIRA 2LVEA 5GGVY 1EO8L 4IBYA 5LGJA 3EG9A 4FKHA 1U8MB 3F5WA 5FUOL 5BUAA 1I1AA 4P4KB 4P3DB 3HBQA 4M8QB 4HWBH 5TF0A 5CILH 1VFUA 3U9UA 4XNMA 4ES8A 4OD2A 2HPOA 3AY2A 2CUMA 1LD9A 2WXMA 4CSSA 5GS0H 5C1MB 2FO8A 1DJZA 3IDIB 1CTOA 2BS9A 1EZSA 3L7EB 4PJ5A 1IGML 1CL7L 1CGWA 4QXUH 3MBXL 5T5NF 5K59E 3L3DA 3SQRA 3MCLL 4CILA 1P84K 2CCVA 3PLYA 3S34H 4JE0A 2K8MA 2HRHA 2FJHB 4G7YH 2YD0A 1EZLA 3U1QA 1RURL 2V9UA 2AXGA 1J7VR 4FFZH 3RWCA 2IGFH 5BJTB 3BH9A 1EXUB 1KWKA 2BOBB 3FQXB 1EO8H 3DTXB 2A38A 4U0QB 3CDZA 4Z7AA 1UCBL 3LNHA 3U6RB 3GI8H 4ZMAT 4LLUA 1ET7A 4N20A 3V0WH 1OQXA 3LKQA 1EERB 1TTCA 4HSQA 1ZGLA 3FQ1A 2NT1A 2IEPA 4MA1C 5E99H 1KJVA 1RUML 1A6UH 1K8DB 2L04A 5L4IA 1CD8A 3DURA 3US1A 4KTDL 3MUZ1 1L9PA 3HS0A 2A9ML 2X42A 5DK2A 1MCWW 4D0DA 2YD6A 3LIZA 1NDMA 5CGMA 2IQAA 1N59B 1OCWH 5HHXH 3ML8A 4DUVA 5I1GH 3ARYA 1FPTH 2OR9L 1HQRB 3QCVL 1F18A 4R4FL 2F0CA 3ZYIA 2MRYA 5DK0B 4KPHL 4EZJA 1GGBH 4U1JB 1Y7VA 3CK0H 3MSPA 1CLOH 3ROOB 4FF9A 1Z5YD 4EUPH 5CGYD 3APDA 3UAJA 3RL1A 3VFVB 1XH0A 3J2PA 1F3RB 4ENED 3WS3A 5DEFA 2YK1H 2QADC 3CFUA 3BZDA 4I48A 4QHUA 3TT3L 1ASOA 2VZTA 3BPOC 3F62A 3SGKA 2I7OA 1OOAA 3IDNB 3IJYA 3W5NA 3N9GH 4I4WA 4WJKB 2X1XR 2XZCL 5DUJA 4AUYA 4CNIA 4A6YA 4I5BB 2DDQH 2YXFA 1MCDA 2RQ8A 5KJRL 3C12A 4H5SA 5H2BB 2BDNL 3T2QA 3W11C 2ZOLA 1QSFA 2RAMA 5HGBA 1KBVA 3LKRB 4DN4H 4YDLC 3E2HC 1BVOA 2Q10A 4YWGH 1SFHA 4XMPH 4OFYD 5LNDA 2ATPB 2R29L 2NY2B 1U8LA 3FPXA 4G5ZL 4AVKA 4NO0D 5L7XL 4X4ZA 3OHXB 4MQXD 3L3GB 1IMHC 1BQSA 1AQ8A 3ULUC 2NY6D 4QXWA 5J06A 1G9HA 5EC1A 3WSQH 3DIVA 1WWWX 4NWUH 5CP3A 1P4IL 2W38A 3ETSA 4L0YA 1SYSA 1OP4A 5D1QD 3VD2A 2VIRA 3SCMB 2UXFA 3L48A 1J5OL 3Q48A 3GLDA 2WXGA 4JKMA 1FG2B 3U4KA 5I1AB 3E2HB 3WMQA 2E6PA 1QFWI 4GPVA 4BGLA 4MMZA 3U46B 1FVCA 3LSOB 1ADWA 4G43B 3H7BB 5T8IA 1JPGA 1KZQA 3CFIC 4X9BA 1PZCA 1NMBH 4P59H 2WWKT 1DDTA 1ZV9A 3QPXL 4Q8BA 5HGAB 3Q3GA 5FHAH 5CEXB 4IMKC 4TSBH 1KXTA 2VMEA 1R6VA 3ROLA 2XWCA 2PXYA 4JPQA 4PJ7F 4QJ4B 4RFOL 2DJMA 3MYJA 3VE0B 3EJQA 5CJ8A 1F90L 3V2AR 5LNEA 5MHSE 4GXUN 4W9EC 3E6HB 5AYQA 2Y07H 4A6YH 5GHWL 4EKJA 1U3JA 4JAMA 3DI2B 2ZSWA 2APWA 5FYKL 3ZT7A 1PG7X 1BM3H 1P2CB 5FFLA 4JB9L 3EO0B 4GRWE 1QYGH 5D5MB 3WUZA 1JGIA 4ETQA 1JGEA 2DQGH 4PG2A 3STLA 3I3DA 5HYJE 3GSNA 3MODH 4WKXA 4E9SA 5D7KE 4IDJH 2UVFA 4GI6A 1IEAB 3DBXA 5A6MA 5F0JB 1ZEAH 1TOXA 1WIUA 1XT5A 1MCBA 4P9ML 5T1JA 3V0EA 2H3KA 4GNKB 1NCBL 3C60D 3MNWB 5I8OL 4X6DA 1ZT4B 2VE6B 3T4YA 3LPWA 3BHBB 3OWEA 4GG6A 5SWSE 3MRFB 1OL0A 4FXTA 4I87A 2DEYX 2WNXA 4POZC 4JM2D 1FO0B 5D7LA 4RMSA 2H1PL 1E3ZA 3NJHA 5T3XH 3DIDA 4TSCL 3R18A 5D7IF 3FMGL 1FH5L 3V4PA 3V52L 1V54B 2XETA 1DR9A 3JZYA 2MPAL 3ZL4H 1A6PA 2EVHA 3OSKA 3L8QA 4OZGA 1H15B 1D5RA 1EHLH 3WIIH 5HYJB 3HRPA 1DO5A 4UDTA 4RWYL 3CJJA 4HFWB 5C7XL 4QY8B 4X0KB 1L5GB 2ZXAA 3DDFA 4R3SA 1NAKL 1XAUA 5HGGS 3NACH 3TGXA 2C4FU 4JDTH 4IRSB 1H3XA 2BSDA 3ELAT 4A2FA 3FHQA 3ZHNA 3KPPA 4XVTL 4FAAB 4HP5A 1A1OB 2ZKXA 3STZB 4CN1A 4M5YL 1F1DA 3ARXA 4FJYA 1PZDA 4L4VB 3O4LE 1L0PA 4Q6YA 5ITBL 2NCEA 4O00A 4CBPA 3MRPA 3H3PL 1ZS8A 4R2GC 1R3JB 1Y6KR 3CMOL 3QIBC 3KPQB 2MIZA 4X4YB 2J6EL 4XO8A 3DMMD 1G7IB 4X5LA 4IRSD 2PF6A 2Z8WC 1MCLA 1Y0LA 1B4JL 1JSYA 1S7TB 5KSBA 4JKKA 2CRIA 4OFVA 1OF0A 1QA9A 1AD9A 5KYXA 3EH1A 3OD3A 3KPRB 4BEIA 1UYWL 4NM8L 3BPLC 3CLFL 1M6OB 2BOLA 4Q2ZA 4ZFFB 5HHQA 1QRND 2FUTA 5FECB 5BZDB 3GM0A 5C0GA 3VCLA 2CHWA 5IBTL 5E6ZA 3VXRE 3KEHA 4NZTL 4XP1H 4GG6E 2JKTM 1UA6H 2BNQD 4GP5B 4IIQC 2YUZA 4J8RA 1DBJL 3RBSA 4W9LC 1CE6A 2ADJB 1CGUA 3AXHA 1DQLL 4N3UA 4BFGA 1ZGLP 5EIIG 1FNEA 1OSYA 5DJZA 5I26A 5KYUB 5J5EA 4WTZA 1M4KA 2AMGA 5HHME 2P7TA 1EHKB 4WK2B 2FEEI 3ULVC 3SDCB 4OI9A 2ZE0A 2NX5E 2DQFA 2VLJB 4DESA 4BZ1H 1ZHLB 3TONA 4XB7A 3SKMB 3V0AC 3WFBH 1CPUA 5HVWA 3VWKB 3L2MA 1A9BA 1A22B 1WWAX 3KYOB 5F0PB 1QWHA 3HE6A 2IPKA 2R0LL 1EUUA 1LLAA 1MHHA 2I69A 3V4VH 1I8MA 3PXJA 4EE2A 2DY2A 2IIJA 4YH6A 4X5XA 3RVWC 1JXFA 3LTVA 2HYMA 3FOMA 3RIAK 4UT9H 1IQWH 2BS8A 2XJLA 1J1XL 4MAUH 4QRSB 4GAGL 1RFDL 3EH2A 1TITA 1NUDA 3W57A 1UVQB 3J27A 1BXUA 1NDMB 4JHWL 4K5MA 1F86A 5SV3A 5MHSD 5IKCA 4GQRA 1PKQB 2OV0A 4QHLA 1K72A 3PXHA 5AAWA 1Q0EA 2VN5A 4XPHH 4D0CA 3EHBB 1SF3A 3T65B 2W95A 1FNSH 1WZ1H 4G82A 1E27A 5I66A 3FU6A 3GBML 1EH9A 1LWJA 1TQBB 2P24A 3VFNB 2COQA 3DJ9A 1J9SA 4Z18A 5J1SC 1L9SA 1FL3B 3L6FA 3QEQA 4Z0BH 4OF5A 2H1XA 2W5PA 3OF6D 4CNIB 4D9RE 4J1UA 3UZVB 1F3JB 5I17B 3FH5A 4J3OH 1E8ZA 4L4TA 4X5WB 2HWZL 4MD0A 4NXSA 3N55A 3SPVA 3D3VE 5LHDA 3DHPA 5D2LE 5CN3A 3SDDD 3VXNB 4PCSA 1FRGL 1P4BH 4IOFC 2OYKA 3LKPA 1N18A 4DP8X 1EDHA 5I6LA 1DVFC 5JW4Q 4DEWA 3DOHA 4UB0H 3ZE0E 2XFGB 3UROR 5FF6A 1I9JH 1KTDA 1TTAA 1DL7H 1YJDH 2DMHA 2YEVB 2APXA 4PJEA 5E0QA 1QUPA 1MFCH 3VQ1C 2IBZY 1MHPL 3EYUL 5TQ0L 1MNUL 4HV8A 1AR1B 5EPMA 4LQFL 2AW2A 4L4VD 3VQ2C 5CEYA 1Q72H 3EGXA 1H3UA 3G5WA 1F2XK 1EFXA 4GBXB 4NDMA 4NZRH 3ZW3A 3R06A 2ZXCA 3ECQA 5DHVA 4JPVH 4AEIH 1S78D 4KVCH 4XHJD 1UHVA 4P2QD 1F58H 1FIGL 4KDVA 5FO2A 1UGKA 1QMUA 3DIFB 5FYJE 3BUDA 3HCVB 2PXYD 4OLVL 4OY9A 3C08L 3QDMA 3P40A 5DJ0A 1YPZE 2BSCA 5AOKA 2GCYA 4JE4B 5D7LE 4AKQA 1RPUA 4HMCA 3NJVA 1Q9KA 3GD1C 2I5YH 4GBXD 1JBJA 3QP3A 4KRMB 3MX0A 2LLNA 2CIKA 3DARA 3N1FC 3CHRA 3QNFA 5GRUH 4CMHB 4GAJL 4AE1A 4NP4H 4AV5A 1A4KA 4L9DA 4OGYL 3UC2A 1NH6A 3QSKB 5EEVA 3EYVB 3BJ91 1T4WA 4B9PA 4Z78B 5C71A 3AY4C 2QTEA 2BC4A 4MVBC 1H8OA 2QHRH 3WJLA 4YXHL 4HKJB 3DUUB 4NGHH 1QI3A 4FCHA 3ULVE 3OMAB 1BVNT 1ECZA 1TZIA 2VDNB 3WUWA 1B4RA 4M6NH 3KBEA 3K2IA 1DSWA 1YNKL 4U1HA 4ELMB 1SPDA 1OIOA 2NY5C 3KG5A 5CD3B 4TMPA 3WDJA 3V0DA 1PCSA 1FN4A 4NJAH 6TAAA 4BYHA 1DUYA 2DS4A 4Y4KA 5JLZB 1CFVH 4EQ2A 1QEWA 1N7ML 3HUJB 1FO0A 4KQ4L 2VDNH 5E8PA 4ABQA 5DRNB 2ZYSA 1K2DB 3IFLH 4CMMB 3D33A 3OM3B 3T3PB 3HN5A 3LEXA 1DQDH 3CSGA 5EZOL 4Y88A 1Z9NA 1RUQL 2NMSA 3FN0H 4GMSH 1T83C 3N1MC 4UWQB 3RURA 2WIIA 2O5YH 2X40A 2N56A 1KT2B 1CLYL 1WWCA 3FT9A 3RDTD 4MNHA 3TPUA 3ZL1A 1L5GA 4X0KA 3OAUH 3WEXA 4AEEA 4BGDA 4NQDE 1CZ8H 3IE4A 4WWKC 3CBKB 5BQ7B 1FNGA 4CGUB 4AXWA 3QDME 3D85D 3EYOA 5CHNA 1TZAA 5E4AA 2D4FA 1MF2H 1BXAA 2X4TB 3ZE1E 3IU3A 5D6CA 3QWNA 3O6FD 1F1AA 2FEEL 4TQIA 4DCQA 3FCGA 1HQRA 4KUZL 4K3DH 4HUWB 3WKML 4AYMC 1OPGL 2VDLH 2XWBA 2IMMA 3HI6L 2W9LA 4KK6C 4P3CH 3UJTL 4JPIB 4EAEA 1RP9A 3K8KA 4QTHA 2YAEA 3AC0A 4BFIA 2ZNXA 1B4LA 5GGSA 1X7QB 1HHHB 4F3FA 1KIRB 2VDLB 1MEXH 2E7BA 5E6IB 1GZQB 2JI2A 1PG7W 2JB5H 25C8L 5TH2A 3SOTA 5DZOA 3V6OC 4X6EA 2D7NA 1QAWA 3FYEB 3QUGA 4HD5A 3IT8D 4ORZC 2Z91B 2C9QA 4NFBA 4PY7A 1PW3A 3RJQB 4JDVB 4KMTL 4DERA 3W37A 3P4OA 4IKJA 2I32A 3U9PL 2F53A 2FB4L 5BVJB 1U8LB 3QRGL 1XGZA 1REIA 5A40E 4OTXH 4MSWA 2O26U 3QBTB 3S3SA 1V5JA 4GKLA 2XX0A 2HTLC 3OL2A 2VZ1A 3CFJA 5KVDL 4EXKA 5HHOB 4JX0A 2ZD0A 1WAPA 2XQYG 3SE9H 4PGEB 3FU0A 3MA7A 4KY1L 1JVKA 4XNYL 4MHHG 3ARWA 4N90E 5ANMA 1AVAA 5LWYH 1NMAL 5KTEL 2OPCA 3P11H 1YYMH 3GB7A 3IF1A 4H20L 5IHZA 5JYLA 4BKSC 3SE6A 5LNGA 5EZLA 1UD2A 1WFUA 4KXAA 2YA2A 2Q8BL 5H94A 2JIXD 2Z7WA 3RTQB 3ULVH 3B2UC 2WQ8A 4KY2A 2YGVA 2VUOA 3GSRB 5AW3B 1WC7B 2AJXH 4JR9H 4F8LA 2VLKB 3HS0B 4JQIH 5KS9A 1JPFB 2ORBL 2HVJA 5I82A 4WFGE 1XF4B 2XZZA 1G0YR 1NWPA 1K85A 1XGYH 5T1LA 4IIQA 5DRZB 3T0ED 3FBQA 3G6AA 3W1ZA 3PHQB 3PGFH 5H4ZA 2G0LA 2WK2A 5AZEH 1MKFA 1UZ6F 2G4EA 3AT8A 3F6LA 3N41B 1LP9A 3LNEA 2J1ZA 1M53A 2DMBA 3NN8A 3NZ8B 4K7PL 3WLWD 4A7GA 1ZVSB 3SE8L 1YEFH 3FH7A 4W9DC 5ENWB 1J8HE 5EA0L 1JZ7A 2PW2B 4XNUH 2VXQH 2E47A 2WINA 4FL4C 4IBLT 5B8CA 2NXYC 4PJDF 1H0DA 3NTCH 4H4NA 4U2YA 4DNLA 3RPIB 1RUQH 3Q7JA 1PZ5B 4NN5B 4NI6A 2RR3A 5ACZB 3HZVA 4XVUC 5JPMC 2D0FA 2HPTA 3QO1A 2YEZB 2UY7A 5C8JB 1TQWA 2JFCA 3EFFA 5CCKH 2OR8A 3LIZL 1GTFA 1EIBA 3LV3B 4RBPK 2MJWA 3LNGA 5C0BA 3VTTA 4BBWA 2WLHA 4Z3IA 4MMYA 5JXED 1AYRA 4XCYB 3WKYA 5HYSB 1MHCB 2XIBA 1QFWL 4ZYKA 4YDKL 2YN5A 3QZMA 4AI7A 3UAJD 1ZGLB 4QYAA 4CU6A 2AV1A 3BE1H 4JGMA 4GKOA 4N2FA 4WI0B 4WUUA 3WNLA 1KGUA 3EJYD 1L7IH 4B9FA 2F54A 2APSA 3LRLA 4PJ6A 4WWID 5B1CA 4ZMTA 2CDFB 2HTLD 5ISZB 4Z95H 4Z0XA 1ORQA 2Z4QA 3JYBA 1PIGA 3QJZA 2UZYB 5E6IC 5T1KD 5IMLA 1RZFH 4X9FA 4OCXL 1A4AA 1MCHA 3MUJA 4XPGL 3DV6A 1PEZA 4OJFH 1U8PB 3FAXA 2VSDA 2A6DA 3PIQB 4GAJH 1AE6H 5CO1A 3VRLE 4PRAA 2RBLA 3OKEA 2BFGA 2JTYA 2P26A 3SJVE 5IJKA 3VVWA 2R29A 1XD1A 4N8VG 3BMWA 2CR0A 3W2DL 1ID5I 5J3HD 3SE8H 2AK4E 2LGNA 4FLSA 2X9YA 4PRIB 4V1DA 1WAAA 1JWSB 1QSVA 4XOCA 3KPSB 5AVUB 5FO8A 2E9GA 1Q72L 1KTLA 3G5VB 3HW7A 3IFOB 2CKBL 2FLBT 3HZ3A 4M6MH 1IBDA 5IWLC 4KHXL 3E38A 2FDBP 1FL5A 4HG4K 3M46A 1JWMA 5E8PB 1UENA 1K2DA 5G2NA 1KY7A 3MLRL 1NC4D 3RY6A 4O2FA 1HSAA 5L4JA 4HQQH 1SM3L 2ICWJ 4JFHE 5B7MA 2MEJB 3V4VB 3LVTA 4PB9L 5IB4A 4A2DA 2NSXA 3KNBA 4HC1H 4MX7A 4OFPA 4JFFA 2PCXA 4NQUA 1I1AD 4YHPA 3CBJB 3TJHD 2NUPB 2ZYIA 3PAZA 4BCXA 3QFJD 3L3OC 4Q74A 4AIEA 4ZUTA 1DLHA 2VNCA 3RU8H 2EE6A 1JVOA 2AQPA 4FQIL 5E6RB 4LEXH 1AO7D 2OULB 4U7SA 4ZPTB 3VXQA 4FFWD 4F93B 1BJ1J 5DJCA 5JIPA 1NMAH 2OXGB 2FR4A 4JFEA 3CWGA 2D4DA 5KW9L 1J9CT 3NJMA 5D6CB 1LTXA 1PKQA 4QHLB 5I0DA 2UY6A 3IGFA 3P77B 5JHAA 2LLGA 1FLTX 4BUQA 1XGUA 5DRXA 4HUWA 1PS3A 3BWUC 3JWOC 3WFDL 5D1XA 1MCEA 2WLYA 2F5AL 1L9OA 3BXNA 4KZCA 3SD2A 2WLLA 3L7FA 3TO4C 3VRLF 1J5DA 2OJZL 4NQSA 1CL7I 5GJSH 2OSWA 1JI1A 4QTHB 4BKLB 1JYVA 5DS1A 1BQHB 4W9FC 3QFDB 4A55A 3QQ4A 1TQCB 3MR9B 2L7UA 2ZX5A 3SDYL 3NCJL 2WD0A 4OF3A 4AG4L 4Z23A 3ULSB 1GGIL 1HHKB 1GH7A 1J8HD 1HL9A 1S7WA 4ZFGH 2GTZA 3VXTA 2XYCA 3I9PA 4H8PA 5FWQA 3VXPA 4AJ0A 1XH1A 1X5MA 4RDQG 1MJJB 1JK9A 3FTVA 1G1OA 3DROB 4PBWD 5I73C 2PR9A 1JHLL 2DL2A 1YMME 1N5YH 5T1MB 3QUXA 3WFHA 5CBEB 1WIPA 2VABB 5LDUA 2XQBH 1E6OL 1XGQA 3B4NA 3NSJA 3WEOA 4KO5A 1HXKA 3T0DA 1VRSA 1YZZA 4N1CA 4WSJA 5FOBA 2WXOA 2EE2A 4EN3D 3O0RL 1KTDB 4BFOA 5BPPA 3QJFB 5SX4I 1VA9A 1I4FB 2NY7L 1S5IH 2Q5BA 2F15A 5KVMC 4OZIE 4I0PD 3CAFA 1C08B 4XNZB 4EN3B 15C8H 2OJ1A 4WI2A 2GHWB 4AMWA 1QSFB 2BVTA 4WHYH 1MCOL 3IXAA 4QRRE 2VXUH 2HT4C 1TMQA 1SQ2N 4GI9A 3GSQB 4PG9A 5CM1A 1J10A 1H6UA 4I2XE 2W0FA 3MV8B 5HPMB 4C4KO 1IE4A 5TE4H 2OYMA 4GRMA 2XU9A 1QLEL 5JIQA 3PE9A 4P07A 5DZLA 2C9UA 1TYJA 3EJZC 3CFCH 1LWHA 1R33A 1U3HB 3A4EA 3H42L 1L6XA 2VIRB 3JUZA 4NAMA 4NENA 2DWSA 3OKLA 1TYEB 1WJ3A 1W9XA 1WT5A 4HISA 2XKSA 3GMLB 1E4KC 4JRLA 5I19L 4LCCB 2HTKC 3NQIA 3QVAA 1CFBA 1RIUL 3H54A 4WTWA 2CDGB 2XYBA 1WHPA 5CR8A 4TVSa 3LXBA 3HAEH 3HRZA 5DD6B 1UVQA 4A7UA 1A0QL 3MV7A 1HI6B 4MWFB 1T0PB 3FUIA 4Y5XA 3HG1A 4KQ4H 3CSYA 4J2XA 4ZW5A 4R0LC 3FQNB 2FGZA 1W80A 1VLXA 2LLLA 4LK4A 5F6HJ 2D7QA 1Q9OB 4UOW0 2O5XL 1INDH 4WDIA 1R5IA 2QADD 2VISA 3B2UD 3P3TA 4LVOC 1JYNA 1PZUB 4A6YB 4Z7UE 3FQWA 3O2VL 2HJFB 3HAEB 2OR7A 3LEYL 4JJ5A 4F8TA 1JXGA 4AUUA 1HOCB 3HS8A 2W60B 3M8OH 4OFDA 2C9XA 2IH1B 2WZ0A 4WSGA 2AABL 1AR1C 2R23B 3V0VB 3Q6GH 3BDYL 4YL4A 1I1AB 3QZWA 5E4EB 3OX8A 4CVXA 4J1UB 3QCUL 1DQKA 1L9TA 1J11A 3I9IA 3NCXA 1IEAA 4UQEA 4MLIA 5I5JA 3WHXB 4DZ8A 4EDXB 3WJJC 1NFDB 4NX0A 3QUXD 2HKFL 3S3PA 4WU7A 5D7JB 4GW1A 2OX5B 5D70H 5AWNH 5TTRA 4AYBA 1QO3A 3VXSB 3F58L 4PB0L 1H9DA 4PW3A 5B4MC 4LIQE 3RVVD 4BFRA 4HIJA 1H19A 4PJGE 2MKLC 4R97C 4KX7A 1ASQA 3TO4B 3TIDA 4B53A 1HJCA 5DU7A 3ZGHA 3HUJE 4KVCL 2DLIA 1KLFA 2FL5B 3I6KB 3JV0A 3LS4H 4S0TD 3VSTA 3K6SB 1D5ZA 3D25B 5FYKE 1PPIA 2HB0A 2XTJD 2R1YB 5ES4B 2PXYB 1RP8A 4X80H 3RX8A 5D1ZI 1G7JA 4PRHA 5A43C 1G1CA 3MODL 5FIEA 4TNVK 1S9WB 3TYGL 2DQJL 2WQWA 4OZGE 1V3JA 5CEXA 2HLEB 2VDPB 4G6KH 2Q76B 1MAKA 1WZAA 3DV6B 3TBBA 2FWOA 1IKFH 4R0LA 3T6QC 2RB8A 3ZT6A 1Z9SA 3U4AA 5IESL 2J88L 1H5BC 2IADA 1LQSR 3PDOB 3H0TB 4RAHA 4ZPVB 3BAJA 2CQVA 3TIEB 3EHBC 4WW1A 3GMPA 5ID0B 5DD1H 1NPNA 4QR7A 5E1AA 1M42A 2X0WA 3SODB 1T7WA 2X9ZA 1A65A 2G0KA 1NBVH 1U58B 1WFMA 5I0VA 5T1DH 2VDPH 4RGNC 4F8NA 1P7HL 5AW1B 4LSPH 2DN7A 2MTAA 2XN9E 1R3IL 5FUCE 4FXKA 5CLTA 5HJDA 12E8L 4M6OL 1C5DA 3MO1B 4JY4A 4NN7C 5EU5B 1BOGA 2WAHA 4MA7L 4WFHD 2WXLA 1IUZA 4BFBD 2DLEA 5JUEL 3BHBA 1D2OA 2X6BA 4Z0BL 4IRSC 1QSED 4U1MA 5BS0B 4UBDD 1XGPA 1QSEE 1KG0B 1WCBA 1PX3A 4IHOA 4WTQA 1IVLA 4Y4HB 2QQKL 1YCSA 5D71L 5C0GB 2PETA 3BAEL 4D7BA 1B0RB 2D7TH 4KXDA 1IBFA 4GT0A 1A8ZA 3NAAH 4DKEH 3UGUA 1FNSL 1DSFL 2HT2C 3SBPA 2FIKB 3ETBF 2P5WB 2DKSA 1T4KA 3NA9H 5GGVH 4GXVL 3IAPA 5LO7A 3ISRA 3QQ9D 3VAEA 5IZ7A 3GXNA 2ITDA 4BQ9A 2OTWA 1OHQA 5FYJD 3DPBA 4YDJB 1GYAA 2BIOA 2A7BA 1MREL 4UQ2B 2IQ9H 2HH0H 3LN4A 5CMAA 4F7CB 5BO1H 5J6SA 3LJ3A 5E00A 4YR6A 2JJTA 5BUGA 4O2EA 1IQWL 3FO2B 4ZMOA 3HCVA 1U8IB 4PJ9C 5CUSH 2WB7A 3C5ZB 2WQSA 2OS7A 5I1KL 1XD0A 4Y4FB 3OZ9H 5BCAA 4FE9A 4P3WA 2NXYB 4IS6A 2M26A 3CV5A 1HE8A 4ZO7A 4OZIA 1E40A 2G60H 1N2RB 3FUNA 4XAWL 4PV9B 4FFWC 2GVYA 3BQUC 3KYKH 3EYOB 4R5TA 5D4QA 1GJUA 1YY8A 3CE1A 3DX7A 5F72S 5E8DL 4DFHA 3EFOB 1NBYB 5LAPA 2AFNA 4EI5C 1KXTB 3OXSA 4X9YA 5A16A 3LRKA 2OR9H 1FO0H 4XCNA 3CNKA 8FABB 4NNYB 3SJVB 1AD0B 1NDTA 4MAYB 2FJFB 3QDGD 2UWEB 4RAVA 4EI6A 5ICYA 3QORC 4ONGL 4PJAB 2BLFA 1M9WA 3ZE2B 1I9RH 4TUKH 4GJTB 3RAJH 1KUMA 4HH9B 3MZGB 4HIEB 3VD0A 2J20A 1DN0B 1ECYA 3H3BC 5DUBA 1PF3A 5C0ND 3TLRA 5JOFA 1E4HA 2ZKHH 2EYTA 4PLJC 3TBVA 1HESA 3N2JA 2XJKA 3ME0B 4JLRB 4WJG3 3BGFC 4XNMB 2YAMA 3TN0A 4L0PB 1FNEB 4MD4A 1MW0A 5DJZB 3UC0H 2XPYA 4DHLA 3MCYA 1JHTB 1JF6A 2Y6TE 4PR5B 4Y9EA 1T6BX 1SXSA 3HC3L 2FQGA 3IDIA 4KK5D 2X1OA 3EZJB 2FSEB 4JKWA 3IMSA 1MRCH 2PCYA 2WKGA 4H88L 4ZSOA 4UOW1 3JV4B 3EOBA 1RKRA 1CL7H 1AQDA 2F1EA 2YD7A 3MJ9H 2EAEA 4E42A 1AHWA 3AB0C 4P4KD 5TDNB 2OFQA 1YECH 3PWJA 3NIFF 4CVZA 1RJYA 5IHHA 1Q9LA 1DJHA 1RULL 2GTQA 2IANB 3ESMA 2VLLB 4JFWA 5F8QC 3RWGB 4LE8A 2EXYD 4Z7UF 5E5MA 3ORJA 5DD3L 4XVUD 1MRDH 3U6RA 1LO4H 4Y8AA 2CLRA 2E7HA 2V7NA 5FUOH 3T08A 3RWIA 1NZRA 5BUPA 3C8HA 2Y7NA 4FG6C 3H55A 2MPAH 3ZL4L 2VLRA 3VW3L 3BWSA 4GIOA 3C8KB 3HG5A 1WRFA 3MLSL 4XRCB 2RFXB 1I8LA 3T0VA 1BVNP 1A5FL 1EAPA 3KPPB 3L5IA 3QI9B 3Q2VA 5DLLA 3MRIB 4D0CB 3C6EA 2HVBA 4LHUA 4B0MM 3K2UH 2NZ1A 2J4WH 4XHJC 4YHZH 1M7IA 4PJGA 3CIAA 3QUML 4C47A 3WTWA 3AITA 4XBEL 2QPDB 2VLKE 1E5BA 5KVFL 1KXVA 1ZMYA 4QDGA 3W9DB 2QQLH 2Y06H 3F85A 43C9B 3EYQC 3WJMA 4LU5L 3VH8G 4HUVA 4F5CE 2A83B 2IF7A 4WEEA 6PCYA 3ILEA 3B3IA 3QZWG 1Y6MR 3DDGA 3UZVA 7FABH 5I17A 2EIDA 3FCSB 5FM4A 3AFLA 5AG9A 4LP5A 1Z66A 2E27L 2EICA 3GLAA 1YUHA 1QYGL 3VFGH 3WFCH 1AHWC 2X89D 5KSUA 5SWSA 3QA3B 4ZW7A 5AD0A 4I4WB 3T4YB 4P06A 4Q56A 4E68A 4U6HB 1K3IA 3RX7A 1C5BL 1ONQB 1YMMD 3L3DB 4RLDA 3Q2WA 4P99A 4TNFA 4EBQL 1KYUA 4I48B 5I1JL 1YMHA 1HILB 1H3VA 5LAXA 3PRZA 3PGDA 3MBED 4GH7B 3SN6N 5IJDC 3BN9D 4UZUA 3G5ZA 2BP0A 3GRWL 4Y9BA 2A1WL 3FRPA 3ATEA 4YUEL 3L95B 3M7OA 4UV4L 1QTYT 1DANT 1QTSA 2DLGA 3NT0A 2Z31B 3M17B 4FABH 5B39A 2QSVA 5KVGL 3MGOA 1J05B 2LABA 3K6IA 1XF2A 3RKDC 2M1KA 3GBDA 3S2AA 2A9NL 4RMTA 5BZWB 2QQNL 1LO5A 1YNLH 5JW3H 2ZCZA 1D6VL 4B0MB 4ZNCD 4Y0GA 2DWDB 3KL3A 4QGTA 5AVSB 3ARGD 2VKWA 1FZKA 3RWHA 2WXRA 2R2EB 2IFFH 5CGBA 3SKJL 4ADJA 4KQ0A 1RIHL 2CU9A 4WNSA 3UTQA 1P4IH 1RIHH 3P3YA 1OWRM 4G71B 4FMVA 1HINL 4NNPL 5A3IC 4AQEA 5IMOA 1S7RB 2IQAB 3E7JA 3QC5X 1TZ8A 3DGGB 3CSFA 5HGAA 1I1YA 4PJ9B 4C58B 3IDUA 2A9NH 3F7YA 4NQED 5HHMB 3IU3B 3LNIA 4LCWD 5B7EA 4UANA 3RDTA 2XWEA 3WY4A 1M1SA 4LSVL 4C59B 4JZNA 1XGRA 4YBHA 1JCVA 1X6NA 1JZIA 1JPTL 1LP9B 4AH2B 2IOOA 3L1OH 3EH4B 2EEDA 4LKXB 4HJ1A 5C09B 3VACA 1CIUA 4U6VH 4EBQH 3EUDA 2PW2A 4FEIA 3ARED 5DYOB 1BGXH 2WTRB 1IILE 2L8AA 3TT3H 1WHOA 2GSMB 2C7FA 1JI2A 3DVNA 1IM9D 5GGRB 4M9OA 2D3LA 1XB3A 1FCCA 4WENB 5BZXA 1A1MA 5TH2B 3FSOA 4UI2A 5ECGA 3LKRA 1C16B 3OJVC 3HE6C 1RV6X 4YZFF 3KBHE 2CK0L 4JM0A 5D7JD 2Q3ZA 4JDVA 4X98A 2F7RA 1BQUA 2X2JA 1FVDA 3CU7A 3GSUA 5I1GL 2O61A 5LBSL 4OD2B 3WN6A 4NCDA 4LEBA 4M5SA 1BDYA 4EI5B 3UTSD 4JN2B 3RLSA 3MTXA 2ZWLT 4WU5B 5AENA 4EJ1C 1O6SA 5J56B 4BV1A 3EYFA 2AVFA 5F70A 4LSTH 3DRTB 4PLKC 4XH2B 5EUOF 4N5ED 4L18A 2P52A 1JNHB 1IFHL 5K9OB 4UIKH 3SKNB 3VFTA 4OI7A 5DHMC 3H7BA 3GBNH 1G7PA 5AOZA 3D7PA 1IL1A 1XR8B 3MXWL 4OZHB 1BJMA 4YVNA 4EUPA 5CHNB 2JSFA 1HSBB 5JPMB 4NQQA 3WEMA 4KDTC 2NXZD 1GOGA 4GXFA 2ROXA 2XV6B 4CSTA 1XZWA 3US0A 1ET5A 5KOVC 2OI9C 4E2OA 1N5AA 3ZDXB 2WLJA 2PTUA 3FONB 3T77B 4A2GA 1UEMA 1PVHA 5I1JH 3CFEB 3MGAA 4AQOA 4LOUC 4QY8A 1WS8A 3BKJL 1M7UA 4L4VA 5D93B 4HJJL 3CN0A 1HN1A 1A6ZB 1DN2A 2DQDH 1AZVA 3HS9A 3QUZC 5IF0B 4BSWA 1E4XI 3VFOB 4I0PA 1RJLA 3B9VA 3II3A 2AITA 4K5NA 5DZJA 1KIRA 2D2CC 2Y36L 3FB7A 3VXMB 2DM2A 1T1ZB 3JVGC 1HXMA 1GS8A 3CU1A 3LKSB 4KKCD 4FTVB 1NL0L 2Y1AA 3ZU8A 2EYTB 3TBVB 1JXKA 3ATAA 4YBLB 1V7NL 5AVZB 3VFPA 3ZDZF 5ERWB 5F6IC 3TA3C 4AQ1C 3H2PA 4ZD3H 3P0YL 5HYFA 4LCWE 5DCCA 3GRBA 3ZTNL 1S3KH 1E2ZA 4KGJA 1DVUA 3VMPA 5BOZG 1ES0B 2QGEA 4LPUA 1A5FH 3HBGA 1UKSA 2R4RH 5IFHL 1UM6L 1WZMA 1NGXA 2OMWA 4Y5YC 5IB5A 1Y1UA 3KLAB 3MLSH 4PJCB 3FC8A 4UYQA 2VDKL 5C0CB 3T2LA 1FGNL 4F27A 4JKLA 2NSMA 3H6AA 4YHNA 4AYGA 3L5HA 3C75A 3PWUA 2FX7H 4FRWA 4J4PA 4W6XB 1NLDH 4QAWA 5ECJE 2BXZA 1JCKA 3UYOD 2WWMC 5ETUB 1UZ6E 2B4CH 2WKLA 3GHEL 3K8MA 4XMXA 2V5TA 1KJVB 2H45A 4YHLL 4NN6B 1Z7JA 1YEIH 2XTSA 3GKWH 1R17A 4PQXA 4WO4B 3RTQA 3DIFA 2Y23A 1OALA 3P02A 4TOYH 1MZYA 1W72L 3NVQA 1HVXA 2IADB 5ILTL 4AXWB 3O6FA 5E56A 1TYRA 4TNWF 3WN5A 4ZPVA 4E0RA 4AL8C 2W88A 2HRPL 3DO4A 4PVNA 2GCYB 2G9HA 3QUKB 2NUTA 1BZDA 2HG5B 2GUOB 3IFNL 5KEZA 4XMZA 4PWJA 4MMZB 3TPKA 3U46A 4P2RA 4AE0A 2VZSA 3O0LA 3VD5A 4IRZL 1ACYL 4EDWL 4ZFOB 4JRYE 3IFPB 5E2TH 3T6WA 4NLAA 4Q52A 3HE6D 3NOIA 4PRDB 2GHZA 3Q3GB 2ZKHL 3SDAB 4D8PB 1WA1X 2K4WA 1W91A 1CFNA 4HOZA 3O11B 4ZTPL 4Y9GA 3X12B 5MI0C 1UD8A 5ENWA 3NEEA 3CH8A 2J56A 4GKNA 4Q0XH 4TQEH 5CEZH 3IDXL 5EORH 5DQDH 3N40F 5BV7L 3SDDC 2CXKA 4XPAH 4KFMA 1Q9OA 3FTYA 3RPIA 1TIUA 2ICCA 4F7TB 4U6HA 1C1EH 2CLVB 4G9DA 3UYPB 2V3EA 3GHPA 1DBBH 4HIIB 1F3JA 1SDAB 1D7BA 1P5UA 3BH8A 4HLZH 4C8XA 4OKVB 3PY9A 4PRPA 4CBZA 3HBPA 2CDEA 3IS0X 1FL3A 3L6FB 2ESVE 3VGDA 3I74A 2AK1H 4K9JA 1I7ZB 1BF2A 1BBDL 12E8H 4LCIH 2XT1B 3IU4H 4PW4A 4WKZB 5KJ4A 3WHE0 4ABVA 1GYWA 2G60L 1HAUA 5JW4M 1NC4B 3HOGA 1NIEA 2PO6C 2IAMC 4DO5A 4IGBA 3MFFA 3IWVA 3NPSB 3OLIA 3Q8AA 4GRMB 3X13B 3W3BA 2DMCA 2A6JA 4Z9KB 4FFYA 5ESQB 3V9CA 3ARGC 4LSRH 1NQBA 5EIIA 5EUOE 4JCMA 1JS4A 1YVLA 4YXKL 1AG6A 5L8KB 5DR5H 4DKTA 4GSQA 4WQOA 1CBJA 4G42A 3V0HA 1BFSA 2KHAA 1EEZA 2AHIA 3VWKC 4X80L 3QULB 1OSPL 1DCLA 4JFEB 2P5EE 2RD0A 3IF1B 3RZWA 3JWNE 4U6YA 2BCKB 4HUMB 1A7QL 3DX9B 2E9JA 4EVNA 1B88A 5FCSH 5JDSA 4JQVC 3VMNA 3QHTC 1EFXD 3B2PA 4DGWC 3GS4A 4QUOA 3UTTA 4HS6B 4OCNC 4TRPH 5MI0B 4R0LB 2P8PA 1HIMH 5EU3A 1JF5A 5D70L 3W0WB 4PRNA 4OM1H 4WUKL 5D7IB 4FFYL 5E4EC 5I30H 1DBKL 5DVOA 2HXAA 5FO8B 4OUUA 1N6VA 1UZGA 2JE8A 5E2UH 3WU1A 4HJSA 4Y19B 1IBBA 1OAQL 1EAQA 3APMA 4Z5RA 5GS2H 3C5XA 4ODHH 4IDLA 5F9AC 1L6ZA 3VXPB 5F7NC 4I9XA 3TN0B 2QFPA 1YEJL 2V9TA 3DYOA 4EDXA 5IHLB 3HIZA 4X6DE 3V4VA 3Q5TA 4XN5A 5FGSA 3VI4F 3DUUA 3FFCE 1FN4B 3HZKA 4DQAA 3WO4C 2YEQA 3O6MH 3QDJB 3CMGA 4M4PA 4Y19D 3ZE2E 3AG2B 4PV8A 4AM0Q 4N9OB 2ARWA 3OGCB 2J8UF 4MCZA 5IESH 1GJWA 4ELMA 4JFQA 3BEWB 3OPZH 2NY1D 4I5BA 1MCSA 1NM9A 2BY3A 2CGRH 1IAKB 1U8JA 1U42A 4ZMPA 3RL2A 1CE1H 2AJYH 1TZOA 1P1ZB 2I24N 3QEQE 3VSUA 1RJZB 5EUOA 5CF3A 1EO7A 3B5TA 3ASWA 5SWQA 1SJMA 2CO1A 3QGVA 2V7NB 5AOIA 3BKYH 1I8KA 5GS1B 1NM4A 4WI7A 3GZQA 4MXWH 3WEAA 3K4AA 2AV1B 3P30L 2G75B 2HRLA 5LXGH 4F57L 2BP8B 3FUJA 3FT4B 5HYSG 4CN4A 3BVWA 4BKLA 3O4OC 1W0WB 5DJ0B 3DSNB 4U3CA 1MHHB 1TFHA 2M83A 3QS2A 3IGUA 1WEJH 5IG7B 2HKFH 4NIYE 4K3EL 3T8MA 2UV3A 2CIKB 2P46B 2Z93A 4PH8A 5JTWA 1ORQB 4NBXB 5F7FA 5K9KA 3UYRL 1AP2B 4ODSL 3IMRA 1ACCA 1U93A 1X5JA 4B7IA 1IT9H 3INOA 1EDQA 4R2GB 1AIZA 4GQQA 3E3QC 3UBXB 4S1SL 1MDAA 3LHPL 3T8XB 3GFUA 5EOCL 3UTSE 3DK0A 3PUUA 2QSCL 5I75C 2YPKA 2QEJA 1TQBC 3MV7E 5AALA 4F15C 5CD3A 1BLNB 4XWOD 2Y3NA 3OV6A 4XC3H 3FZUC 1A66A 3FFCA 5AB1A 1XSKA 1ACZA 1YPZA 3EJUA 1XIWD 3GS7A 2ZUQC 2HJFA 1QEWB 2DI9A 5CINH 5DVPA 1DFBL 5F71A 2P5WA 2QADB 5GRWA 3HJEA 4YQXL 3UMTA 1MCRA 3OKMB 3WNJA 1I7RB 4LPVA 5FHBL 3MV9A 1B2YA 1QRNA 1KGIA 3C60C 2FZ3B 1YEWA 3VSQA 2Y3AA 1GY2A 3VXNA 1J0HA 4QHKJ 4LFHG 4JPKL 3BT2L 1R19A 1IGFL 1X5IA 4UDUA 2CLZB 1WQVT 4NYLB 5D4JA 3NK4A 4N8CL 5CCJA 2WJ5A 4RDQF 4Y2OA 2OJZH 4NENB 3U0PB 3H9HA 2HVKB 5FKAB 43CAB 4Z7QB 1P7QA 3WFDH 4BIKA 4F57H 2FECI 4X6FA 4PG2C 2AV7A 1G7HA 3RIFF 3D8MA 1M3IA 3GB7B 1LVEA 4YNYB 5HYJA 3RWGA 1R47A 1Q8MA 4DETA 2NT0A 4MB4A 3VXRD 3ZZSA 5I5RA 3KXFD 3UTPD 3WV0A 2NNFA 2MNJB 3V5DA 1FFPA 2FATH 5FK9B 4Q58C 3GJFH 4JREC 3DURB 1S4IA 1YC7A 4U6TA 1HEZA 3OSVA 1X5FA 2WWNA 4PY8J 4IRJC 3QC6X 4ONFH 4X6CA 5C6PB 3KJ4B 4FQQB 1N59A 1RVFL 1EVUA 2QQQA 4OFIA 5ESVB 1A64A 1NAMH 1P9MA 1LNUB 3BZ4B 4YBLC 1G7MB 2YD9A 5EBWB 1XIWA 2YD3A 3DX6B 2YMTA 3MLVH 5AVWB 4WHDA 4PJ5D 1KTLB 3G5VA 3ZR5A 3B34A 2HVJB 1GL4B 5T1MA 4M6ML 2P5PA 3NN8B 4QTIL 2AXJA 3KPRA 4FFVD 2IPTH 4EEEA 5KBKA 1LDPL 1Z9LA 4H25A 1CDCA 1MHEA 3WJJA 2EUVA 4TLTA 1GGUA 1F4XL 1JTTA 1ZLWH 4RH4A 3NZ8A 4W9CC 3ERXA 3WNIA 5F96H 2LTQC 5KVEH 3FNKA 2QBWA 5ICXA 4FYRA 1MI5A 3BQUA 1D6EB 4OV6F 3T0BA 4UQ9A 4X8XA 3O45A 5C09D 3ARZA 4L05A 2IDCA 3DX1A 3BOVA 2CO4A 4IU2B 2KYIA 4QXGL 2N4IA 1A4BA 1PKQE 4X8JA 2X4RA 5HSFA 2R1YA 5DUPL 1CGTA 2YMXH 2OL3B 3BN3B 4IMLA 4WV1A 5EWIH 5DR5L 1KTRL 4WFED 4Y1AD 4B60A 4OSUL 4QT5B 1S9WA 1XBDA 1RHFA 1T7VA 1LO5B 3ESNA 5DRXB 2MH4A 3NIDE 1H6TA 1N10A 4GSRA 5CJBA 4LO9A 3SCMA 3C5ZA 1L7IL 3AJ7A 3MX0B 4O2CA 4OZ4B 3QFJB 4ELKB 1QQDB 1MFMA 3X1GA 2NXYD 3HZMB 5TQ2L 2QR0B 5CJQH 4LCCA 5AQ0A 4OW6A 2F7OA 1P53A 32C2A 1VEPA 3DYPA 2DWXA 1H3PL 1NGZA 1RU9L 3FQRA 2VXTH 3BJLA 4J6IA 5CCKL 1MCPH 3RGVD 2IWFA 2P80D 3THML 4AQZA 1SJEA 4LB8A 1TU2A 3MLZH 5C0JA 1MELA 5GZOD 2YC1A 1U6AH 3D12B 1LK3H 1QLFA 2NQ3A 3QPKA 1CT8A 1BQRA 3AXLB 1S9YB 2WPGA 2ZIDA 4MRCA 1KF9B 5ABZA 2KLSA 1GGYA 2WBWB 2N3JA 1U6AL 4H8VA 2IH1A 1JNJA 5FGCB 2WTPA 2XQYK 5ELIA 2F61A 1UG9A 1G7LB 1QR1B 1E9OB 1VFOA 1MCPL 4HUUA 4PRIA 3VFSB 1P0SE 3ZHLA 4PTTA 3DLQR 4WWOA 1AGDB 1NAMB 4J5VA 3GMRB 3TA4D 2OSLB 3WIFA 1BAWA 3F7QA 4H8QA 4JQIL 3SCMC 4FQCH 3EFDL 5JHDB 1Z9MA 3Q05A 3K91A 1VESA 3V95A 3N0PB 2VLME 4QF1B 1R3KB 4MJIE 5GSRB 4MJIB 3ULVL 2HRPH 1J86A 3UTQB 3EJCA 3NDYE 2A6KA 4JFXB 2B20A 2Q8BH 3CX2A 3FT4A 4TOYL 1KCUH 1YEHH 2GI7A 2OTUA 4YDZA 3MJ6A 3AWEA 4P4KC 1IAOB 3DRTA 4KK9D 1Q9LB 2IANA 4F91B 3B9KA 2YN3A 1ZTMA 1HKLL 4OLEA 4P2OB 2HKHH 2ARJQ 2UY6B 4HJ0C 2ZOKA 3EGXB 1G7PB 3PAUA 1EFXB 3EUUA 3SY0A 1JGUH 3EH5B 3DX3A 5JIMA 4UM8A 1GXEA 4MQTB 1O75A 1RLBA 1SLWA 2DBLH 2P5ED 4AEFA 5EUKA 2XVGA 3WL9A 1GOFA 2LAAA 1ZOXA 5KYWB 2NNAB 1IFRA 5AB0A 2XTJB 4N8PA 1UM4H 1WAEA 2CBMA 4HXAH 2EIZA 3L4VA 4PJ7B 5LBSA 3WLBA 3B9DA 3QAZC 4FNPA 1R4XA 3U0WL 3ECBB 2CH8A 3WS6A 3ME0A 2NY3D 1JWSA 2E7LA 5B8CC 1QTPA 2LU5A 4AIZA 2EIJB 4DUXA 3ATBA 3LRSA 2YA0A 4HIEA 1V7NH 1U3ZA 3JYCA 3VI3F 3WNMA 3IS1X 2D8KA 2R23A 3V0VA 1NL0H 1FI8C 1JWMB 2ENYA 2Y6SD 4HDIB 1I7ZA 1PY4A 4Y2DB 3QJRB 2MKWA 4TSAL 2X4SA 4H8WC 1MIEH 1TZIB 3ZTEA 4P46A 3QUZD 1PKOA 4YZFE 4QJ5B 3J7HA 3O9WC 2F74A 2XX1A 5EOTB 2R9HC 2WLZA 4Y5XC 1FGVH 2OW6A 4QTFA 3ZYOA 3P3UA 3QUYB 2GSGB 4FXGB 2IDFA 4KVPA 1J5HA 3B1TA 2BHZA 4P4RA 3BKJH 3DMMA 5CLWA 2EH8L 3WD5L 3TA3D 5AG8A 4PIBA 4F2MB 3IMTA 4P3CL 4M43L 5F7EH 1SHSA 1GW6A 2EDJA 4OZHA 3MV01 4NPJA 5L6YL 4DEPB 3O3DA 4ZAKB 2WV3A 2YPLE 2AKRB 5LWYL 1JPSL 2O5ZH 3FUKA 4L3FA 5FM5M 2FR4B 3CVBA 2J6WA 1KN2H 3N1PC 4YDJA 3WIHA 4N8UA 3MROA 1A7OH 2D7PA 3B83A 3DXAB 4ONHB 4ZW3A 2J21A 3T6XA 1MWAA 2MTPA 2WWKO 5BZWA 2AANA 1A47A 5I71C 3BUBA 2ZT9C 1N64L 4M48L 4FKEA 2NY0D 2ADIB 2FWOB 1B4TA 1SN5A 4ACPA 4CRPA 3QT2A 3EKCA 4QRBA 4PY8I 4RDBA 4G6FB 4M1DH 4U1KB 2VSKB 4ETYA 5BO0D 1HK6A 4F9LC 4UTAL 3ULUE 4DKDC 1RMFH 3CDGA 2DJUA 3QRGH 2B0SL 4NC0B 4BQ8A 2JLLA 1AS8A 4W81A 4IBQA 4AJWA 2ZWYA 1E7UA 1MJ8L 1LE5A 4ICXA 4JO4L 4EN2A 5D7JC 1ZLDA 1G6RL 7PAZA 2F8XC 4ODUB 4KI5E 5B1BB 4I18B 1DJWA 3IFLL 4LDOB 3MO1A 3O2DH 5EU5A 1SBBA 3QAQA 3WIHL 3WFEL 3GDCA 4DOHB 5I0XA 2ZAIA 1MRFL 1T7ZA 3BI9X 3C60A 1MWAL 5L2KE 5DURD 4K7FA 2VN6A 1QLRA 2DEXX 4HEME 1TO5A 4IIZA 4R7VA 1BQ5A 1NCCL 3G6JA 4YIQB 3B7YA 3TEWA 1AACA 2DQEL 3G5ZB 2QLYA 5DYOA 1R34A 4HGWA 3GS0A 3L9RB 4M6NL 3IMUA 3QJSB 2YEZA 1IM9B 4GBXC 3H9SB 5LVEA 2YGQA 4JUSA 4L4TB 3P73B 4J23A 5PAZA 4X7TB 1MQ8A 4QAMB 3SPVB 5DSCA 4HJGB 1IT9L 5FCUL 1ZT1B 1KB5H 4Y16D 1R3LB 3G6JF 4YDVB 5BS0D 1MW3A 2AGJL 3LMJH 2H2SD 1HWHB 5IQLA 2VB5A 3KVDD 3SQBB 1JN6B 2VITB 1WEJL 4BXSV 4J6RH 5DRWB 3BSGA 3SBWC 1PLBA 1HINH 5AKTA 2PP7A 3NCYP 4Z6AT 1KELL 4A1RA 3G5YB 4HBQA 4Y2DD 1WTLA 2FGWL 5E23A 2O5YL 4Z0XB 4KHTL 5DO2D 2PR4L 5ESQA 1SVBA 3PDDA 3UACA 1MJ7L 2YSSA 1V10A 3VFTB 5CEYB 2NYZA 3LD8B 2CLRB 4GP4B 3FQ4A 4FI6A 4HWZB 2OAAA 1GVIA 1UWGL 1I82A 3ZUCA 1CE1L 2AJYL 3C8KA 1UT1A 4Y1SA 5DGQA 1P7BA 3FCBA 5AYUL 2XXCB 4LASL 4DFIA 4P05A 1MHPH 2HLAA 1CFVL 2OMZB 4RMQA 2XTLA 1UB6A 3BN9C 3CHSA 5EZLB 2ZKYA 2MCPL 4ABWA 4BKTC 1OCRB 1S7QA 5AFAA 2JCCE 4MQSB 3R8BB 4JG9A 4OU3A 4HJUA 3GXIA 1A6TB 3MV7D 4AYDC 3NJFA 3SPGA 5E70A 3PWPB 3GXFA 4NQVB 4PP2A 5GGRA 1ICTA 3WE1A 2EDLA 3G5XB 4V1DB 4XTRD 2EC9U 3FFCB 3C5JB 4UB0L 1G1KA 5TPWL 4G9DB 3UYPA 4NT6B 4E41D 1Y1DA 4N0UA 3GSWA 3LPGA 2V2WB 1KEMH 5IM7A 4NZ8A 2Q86B 2J43A 4M3HA 4Z7QF 3K6NA 1E6JH 3IDGA 2QHLA 3KPMA 2ZP8A 3WFZA 4LP8A 1FVDB 1QR1A 4Y4HD 5CP7B 4FXLA 4D94A 4ZMZA 2AERT 4LLDA 4ORGB 5DEGB 1CLZH 2XBZA 4YAQA 5KVFH 2KQMA 1G4RA 3MOAH 4WSKA 4FHBD 1NCWL 1LEIB 3CSBA 1A14L 1MVUB 3C08H 4ILDA 1TTFA 4FG2A 1WBXA 4NQEA 4OFKA 2ZXBA 1F58L 1FIGH 5IHWA 4PWHA 4ALAC 4RGOL 1I9IH 1LE9B 2BNQB 2PCFA 4QHMA 1JV2B 1OP5H 1IGJA 4MCYB 5GXBB 5HHPA 5D93C 5JR1L 2XNAB 4G42B 3OAWA 1IAKA 2CM5A 4GLRH 3MA9L 2CRMA 2FAUA 3MJ7A 2XN1A 3DO7B 4M62L 5AVXB 1XR8A 4YHYC 4FZEL 1LO4L 3FO2A 4ZUVA 1WDAA 1JZ5A 1RERA 3BWAA 2X6AA 1RPQA 1KCRH 2F6AA 4GAGH 1J1XH 2YBGA 3BXNB 4PM1A 1RUAH 3V5DB 4BSJA 1JZ6A 3NEOA 4G6AD 5D9SA 4WUUB 3DX8A 6FABH 3B8YA 5IGXL 1LJMA 1I9JL 3N44B 1O5DT 1B6UA 4MJJA 3V4VL 3D48R 1KGCD 1KOAA 3PPEA 1BEXA 1T89C 2Y7OA 3NRFA 4XP5H 1J8HA 3ZRCC 1MRCL 1ZA3A 4H88H 3K5SA 4J3OD 1AANA 3ZE1F 3BZEB 4RESB 1WAAF 2VXSL 3MBEA 1SXNA 3N40P 4LCIL 3Q01A 1U33A 2YPLA 3D3VB 3T0XA 1YQ2A 4R7NA 1IEBA 2B59A 2XVBA 5KAQF 4MXQC 2HSIA 4UM9D 4W9ZA 1ADQA 4AENB 5I1LB 1INEL 2A83A 2BSTB 3AMLA 4MDIA 4RX4A 1KXHA 2RHEA 5FOBB 1NCUA 1E28A 4DZBB 1ZKAA 1WT5C 5G4NA 4GIPD 1DDHA 5EORL 5L8JB 5LQBH 3HHMA 1R5IB 4TUKL 5ALCL 3QIBD 3CVDA 1NUFA 1G9MH 1BLNA 2Y7MA 1XEDA 4WUUE 4APXB 2EXSA 4XPHL 5IK3A 4U1IA 4XP6H 5EHFA 1LDSA 3IFOA 3C9NB 3RG1C 5A2FA 3OKDA 3ARDB 3GBLA 2V2XB 5MENE 3WOVA 1FO0L 3ARFD 1WUZA 2LHAA 3A22A 2M8XA 4G9FB 4UIMB 2D7OA 4OLZH 3L3OB 1H8LA 2ESVA 4Z3GA 1S3RA 1VADA 2DIAA 1F6LL 3FK3A 3HKZA 4Z76B 3PG2A 1HH6B 2OZ4A 1HZKA 3DXAA 1NC4A 4NP9A 3NH7L 4LSDA 1MAML 1O6SB 4HWEH 4XNQA 4APQA 2QVMA 4LVHB 1HEHC 3VG9B 5GGQL 2PYEE 1R3HA 3WFBL 5DWUH 2VLKD 1OAUH 4HWBA 2VDRH 5E1QA 3H9HB 1S7RA 4E9VA 1T1YB 4HAGA 43CAA 1JNLL 1HS6A 1ZHKB 4OLZL 5D72H 2WBJB 1MPAH 1AMXA 4IRJD 3CDCA 3WIIL 2N1TE 1E9PB 4XO4A 1NDGA 3GMQB 1CMOA 3QQ9C 4LAJH 4CDHA 2GQHA 4PJFA 2P8MB 2H1LM 1KBPA 4K2UL 4K94C 2R2BB 2GBAA 1CK0L 1I9IL 4AC4A 3GJFK 3MLUL 2H1PH 1EJFA 3RTLA 3FTGB 1SUHA 4QRFA 2D7TL 1AO7B 4JFYB 3VXRB 2YS4A 1CWVA 3BPLB 4K7FB 5DGRA 1L3WA 5I28A 1U2YA 4Z7UB 1XCWA 5DEFB 3B9KD 4AYFB 1DBAL 3VXME 4ODVL 1EANA 1SHXA 3BZ5A 4L8SC 4ZJ9A 3HLKA 3D5OF 1CLZL 2AK4B 4FQXD 5GRVL 3VRJA 3OX8B 2A0LD 4NFDA 2FJUB 1I7TA 1Q1JH 2BX5A 6PAZA 3B3IB 2WQXA 5AUMA 4Y7OC 3WTXA 1JK9B 4K9EH 4DIXA 1F2QA 1L3NA 2MOVA 3BAWA 3O2DA 3L4CA 2ZOLB 3A5VA 1UH4A 3D06A 4GMTL 5HHNA 1OTSD 4BK4A 4QRTB 1KY6A 2VWEE 4X7DC 3QDGA 3W81A 4XP5L 3ZDXE 3UZQA 4QYOA 4FA8A 4PLKD 3QUMA 1NGYA 3MBWB 5ALBH 3V6BR 4E5XG 4JFVA 1KEGH 1AGEB 2C3VA 1CXEA 4LESA 2Y07L 3TNMB 4JDTL 4OZFG 3UAEA 3GUTA 1EAJA 5E94A 1HYSC 5KWYC 5CLZA 2MCPH 1EBAA 3BVNB 1PX8A 1QWUA 2ZP0T 2I27N 1K4CA 1S7XB 4M62H 3X1NA 1EHLL 3RWIB 1ACXA 4ZX3A 4TSBL 3QJTB 3L95A 5FHAL 5BOJA 3MXWH 5JR1H 5E4IA 2OW7A 2Q7YB 1KLGA 3SE3A 3IJHB 3MUY1 3WXWH 4WFEE 1MJ7H 2GK0A 4Y1AE 4F8QA 5GZOA 4HKBB 4RMRA 5FYLH 2VMCA 1OAXL 2R8SL 4UOJA 5CJXC 1F97A 2YD5A 5HHMD 1KCLA 5MEQA 1K6QL 2NLJA 2FGWH 3ZDZE 2OMUB 5I6OA 4ZAKD 2WQUA 1MW1A 1TNNA 1FFRA 3GSOB 3F58H 4R26H 3TX4A 3EF7A 3WSQL 4JFUA 2P43B 4FQ2L 3RIAF 3ECBA 3TS8A 3MLUH 3TV3H 4HOWA 4BA0A 3WMSA 3QWOA 4N2GA 4FC3E 43C9A 2VSCA 3QXTA 3PWNB 5C6TL 3GXUB 4H0LC 3EG9B 1ND0B 4QHNA 4ZRGA 4FTVA 4OCMC 1FNLA 3EIFA 3T8VA 3FCSA 1EK3A 1CFNB 2QLVB 1NFDE 1WCBB 4IHOB 2X4SB 1MVYA 2UWEA 4CKVX 1TU2B 2X9XA 1BF8A 4KX9A 5DFWH 2XZCH 3OLGA 1KBKA 3T0EC 5I1IH 2Y1ZA 2EVFA 4AJYV 4U6VL 3DJTA 3TFKD 4UT9A 2H26B 1L4IA 3ZE1B 2XOTA 1HCFX 3ISYA 1JPTH 4CKQA 1YAIA 1TLMA 1GGCH 4KGLA 1U92B 1ZHBB 5F88B 1JL8A 4JG5A 2J3SA 1SJHB 3DSFL 2NW2A 1XXDC 5IEHA 3FF7A 3NUKA 3AREB 5GS3A 3PHOA 9PCYA 3E0GA 5E8NB 5C7ZA 4ZXBB 5EG6C 4DGUA 1ZE3C 3B37A 4U1GB 3DUSA 3I75B 4D9QE 2X1QA 4F2EA 4LOEA 3F64A 3Q1EA 4G59C 2AJ3A 4HUKB 1RMFL 4JO1L 4OCYH 2GABA 2FH8A 4H1LH 3SE3C 1O7DE 3TBYB 1OOWA 2XN9D 1T21A 1UWXK 4J6RL 4AQEB 5LQBL 2AQ1A 4R4BB 2QQNH 4GO6B 1OY3B 3NBNA 1HYRC 3JV6B 2NUTB 3KLKA 3CVIH 2Y7QB 4XMPL 3MRPB 3VQLA 2AGJH 5CSBA 4DN4L 1D5BA 3VQMA 3VGAC 3QXAA 3DYMA 2OXHB 3GRWH 3K0YA 4WVRA 2XPGB 2BVPA 3SYQA 5K9QG 4B6ZA 1FJ1B 4P5KB 5K1JA 2CA3A 1SMAA 4GW5A 2LT9A 4MKMA 3BPNC 4JDZB 4OLYH 4AENA 1U8NA 2C8NA 4GO9A 4HUXA 2YHGA 1J1OL 3OG6B 4Q4IA 1UD5A 4KROC 2MHAB 2FHCA 1UM5L 2H0FA 3GNML 1BCIA 2XTJE 4O5LL 4FNTA 3BSHA 3BUYA 1T04A 5FECA 4PWIA 4I0PB 1XTMA 1IIIA 3P0VL 2CLVA 1CXKA 2DZEA 3BZ4A 1E4XH 4PD4J 1E0OB 4MD4B 1KCRL 4H5SB 4UUJB 4ZFQA 4U0RB 1RD6A 1BOGB 2NOYA 1G6RH 4FOMA 4NQCE 5GIRB 5F1KC 1SN0A 2EIBA 4J3UA 3QWQB 3TURA 5FW8A 3MRDB 1N3NB 1TQUA 4FQJL 1T5XA 3MGTA 4ODXB 2ZUYA 2P45B 3CZEA 3LNFA 2GY7B 1QFWM 3VFPB 2CO6A