2ON8A

Gbeta1 stabilization by in vitro evolution and computational design
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
56
structure length
56
Chain Sequence
MQFKLIINGKTLKGEITLEAVDAAEAEKKFKQYANDNGIDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G
publication title Optimization of the gbeta1 domain by computational design and by in vitro evolution: structural and energetic basis of stabilization.
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Protein binding
total genus 17
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2007-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2on8A00
2JU6X 2ONQA 1FD6A 2LHDA 1P7EA 1K53A 4WH4A 1F2RC 5HFYA 4IOIE 5BMIA 3V3XA 4OZCA 5HI1A 2JXTA 4GLSC 2ZW0A 1MI0A 4D2KA 2LUMA 4KGSA 2N7JA 2JSVX 1XF5L 3FILB 1K52A 1ZXHA 5HG2A 1QKZA 4HJGE 1IBXB 1HEZE 1IGCA 4IKGA 1F2RI 2JWUA 1UWXA 2LHEA 2I38A 1YNTE 1IGDA 1FCLA 1PGXA 2IGHA 2N9KA 3MP9A 2PW9A 2QMTA 5JXVA 1HZ6A 2K0PA 1XCQL 1Q10A 2IGDA 2I2YA 2QSDA 1MPEA 1FCCC 2KQ4X 1P7FA 1PGAA 2LGIA 2JZPA 2KDMA 2PTLA 2ON8A 2KN4A 2KWDA 4OZBA 1KH0A 1XCTL 1MVKA 2RMMA 2KACA 2N9LA 2GI9A 1MHXA 4MACA 2OEDA 2ZW1A 1C9FA 2RPVA 1MHHE 2J53A 1D4BA 3GB1A 4HKZE 4KGTA 1K51A 4KGRA 2J52A 2PLPA 5BMHA 1HZ5A 4OZAA 1EM7A 1YMHE 1K50A 3FILA 1GB4A 2EELA 5BMGA 2NMQA 1GB1A 1PGBA 1IBXA 2IGGA 1JMLA 2GB1A 3UI3A 5HHDG
chains in the Genus database with same CATH superfamily
2G4SA 4WJPA 1FO4A 2M8SA 2LHDA 2RDHA 3APCA 1VCBA 4GU2A 1F2RC 5G2NA 4MM3B 2KTRA 1FM0D 1ZGUB 1B9RA 1T0QC 2JY6A 1PUTA 2QDFA 2KKCA 4MJSB 4RFBA 2BPSA 1ZW7A 2NTTA 2JSVX 3TL5A 3VDZA 2LRWA 2WU2B 2LZ6A 4JGHB 1ZXIA 2WDRB 2NTSA 4A3PA 2HTME 2VZKD 2ZPNA 3QWZB 2K8CA 5TR5A 3ZDTA 5LNK1 5E6OA 2OJRA 1XLNA 2LEKA 3AECB 4W9LA 3WAMA 4MT5A 2KTRB 2O2VA 4KKIA 4MGZE 1GOZA 2KN5A 2C7HA 4M0WA 4KDLB 2J0MA 3R7RA 3DHGC 4ZRKA 2J0JA 1NI3A 2XEWA 4DDGD 1JW9D 4WIPA 1QT9A 2KFJA 4GDKB 2DZIA 3AE8B 2NCNA 4TKNA 2IY1B 3ZJTA 3HK0A 3PO0A 2O2VB 3B2GA 2DZKA 1D4BA 3GB1A 2XK5A 2RD0A 4EZJA 2BT6A 4KGRA 4KDIC 4M0WB 4HWIB 3MC0B 1FXIA 1RLFA 4K3BA 1ACCA 2JRIB 4W9IA 3UI3A 2CU3A 1C4CA 3DBRB 2RPQA 2E3TA 2L7RA 4A9AA 3U7ZA 3TUOA 3AE9B 2JXXA 4WQOB 3PPAA 1R4NB 2LMCA 1J0GA 2NS5A 1YQBA 2IO3B 2WX1A 2XK5B 4AUQC 5FR6A 4KGSA 3I63C 3KWLA 3V6EB 3Q2AC 2L1AA 1XF5L 3AE1B 4E74A 3QC8B 3H9DA 3HVDA 1PGXA 2VH2A 2N9KA 3N30A 2JT4B 2PVOD 1HZ6A 1T3QA 2LVPA 3RPFC 4FADA 1E8WA 1WY8A 3EGRA 1KTKA 5D7GA 2LUEA 1N60A 2VH1A 3DBLB 1ET9A 2ZVOA 1PDXA 2KN4A 1KF6B 3H8HA 4C00A 1AW7A 1HXYD 2V9HA 1F77A 4E3CA 2AL6A 4E71A 2LD9A 1I42A 3IT4B 3ENEA 2G1EA 3AE5B 2LASA 4N59A 1RWSA 1HQRD 2M17A 3RCZA 4XDCA 5DCNA 3VR8B 2K39A 2C60A 3FILA 1ZP0B 5G55A 2LGYA 4JWSC 1GB1A 1PGBA 2KTFA 2HJ8A 2BYFA 3ZIMA 1RRBA 3PS6A 3Q8CA 5BYSA 3Q8AA 2D3GA 5KHOA 1Z5SB 1OQQA 2DYMA 2PKOA 3WANA 3N9YC 2MBEA 5KHQA 4OZCA 5HI1A 3B2FA 3ZYYX 4YSYB 1TKEA 1L6VA 5FR3A 2LWPA 2DNFA 2IYDB 5AUKA 3TEYA 1LM8B 1BT0A 2BTEA 3NS8A 3FILB 5CHFA 3QQ8B 1RM6C 4P16A 1WRDB 2KWCA 1WGGA 2K8BA 4IUMB 1BXTA 1F1HA 3SFEB 3U7DA 1WH3A 2NVUI 3Q3MC 3T9LA 2KLCA 1DOIA 1VZ7A 2PW9A 3TEZA 4N9F4 1ZUD2 4FHJA 2I2YA 2QSDA 1WSPA 1OQYA 2WXKA 2OHFA 2PEAA 2O6VD 3AH7A 4FJVB 1V2YA 3PRZA 2KDMA 1I4XA 2KQSA 1L4DB 2BKRB 1FPYA 1V49A 1XLQA 4A3OA 1R4MI 2QCZA 1MVKA 2KVRA 2PMVA 1NVID 3DBHI 3GOEA 1XLOA 2M0XA 5D3DA 5L83A 2EKIA 3QJZA 3EFUA 1FNVA 2WQYB 2RPVA 2BQQA 3ZXVA 1SJHD 2KO3A 2REXA 1Q5WB 4DXFA 4EEWA 2XBBC 4H2AA 4I6LB 1WFYA 1AARA 1N5XA 2KNBA 2GMIC 4FLHA 3ZW3A 2MH7A 1JRUA 1V97A 4KSKC 4ZHPA 4RGTA 4GDLA 4KKJA 5H92C 1FNUA 1YJIA 2JU6X 2HD5B 3RN9C 2ONQA 3C0RB 5EE3A 1WMHA 3DBSA 3M95A 2CJOA 1K53A 4B6WA 3L17A 3V3XA 4TUUA 1XXGA 5C3JB 2QIEB 4O1NA 3GS2A 3I9V1 3AULA 3E9SA 2MBBB 4BBNF 4MGIE 4RH6A 4C56C 2PVGC 3RUIB 4LTUA 3QK0A 1WE7A 4GDLB 4W9KA 3WAPA 4ZYSA 1GG3A 3R7QA 4ANXA 4P1CC 3WCQA 1WMHB 3CSTA 1DYQA 2QC8A 2FBWB 1SE2A 4TQ1A 4R3DA 1GJZA 1PFDA 4XC2A 2VZKB 4W9EA 5AZHA 3RFZB 3NUHB 1UZXB 3BZDB 2V4LA 2BWES 3BVMA 3HUIA 1MG8A 1UGJA 3C19A 3ABVB 1RFAA 5D94A 4N6EB 2G3QB 1RYJA 2GOWA 2KFKA 1C78A 3P4SB 2G9HD 3Q3NC 1VD2A 3VFKA 3AEFB 3BVZA 2VRRB 2CR5A 4LK0M 3AM9A 5CHVC 2KACA 2IBIB 3AI5A 4US9A 1VZ8A 3UIOB 1WGHA 1XQQA 2K25A 2J53A 1TS3A 3DOWA 4KGTA 4I6PA 1E8ZA 3VR9B 2R61A 2KFKB 2N9EB 4JPSA 2WNMA 2V3NA 4K1RB 2IGGA 2FCNA 5DPWA 2NBVB 5TSSA 2KMCA 2CJNA 1QOGA 2AX5A 4EZKA 2N9PC 3UF8A 2WP9B 3N3KB 1JROA 3PSEB 2WXPA 2H88B 2INNE 1UH6A 1NYRA 2D3BA 1GAQB 1ZDXA 1V8CA 5D6JB 2OJWA 4AS1A 3TCAA 4A20A 4DHZB 4LNNA 2DZMA 2LUMA 2J7QB 1OFFA 1EF5A 1WWTA 2WDVB 5HG2A 4RM9A 2GBMA 2UWQA 1H4RA 2V1YA 2LXCA 4W9FA 4C7YA 1FRRA 3VVWB 5C23A 3PRPB 3CIRB 2INCC 3QCAA 3V62A 1C77A 1N6ZA 1SE9A 4NJ6A 1ZDVA 2N7DA 2Y5PA 3EUB2 2FE8A 3A9KB 3TIXA 1T5XD 2IGDA 1YN3A 3Q8BA 3CWIA 3W1YA 4P6VF 5AZGA 1P7FA 3IBEA 1STEA 1V6EA 4IWOA 4ZRQA 1GC6A 5DPRA 1Y8RC 2YLMA 3RZFA 1EWCA 2CU1A 3L16A 1YIWA 4MACA 1OGWA 2QJLA 1GUAB 1V80A 2ZW1A 3L4PA 2DLBA 2ICIA 3VH3B 2EMSA 2MJEA 1FFVA 4HPPA 5IN7A 3VQIA 1N61A 1WZ0A 4MELA 1IYFA 3ZXRA 4LDTB 1A70A 4G3XB 2KLGA 2GB1A 4XWTA 4A8XC 1FXAA 3IG3A 4BKTA 1I4GA 2ZCBA 3P2BA 2C5LC 5BYQA 1D5XC 3NVVA 1Z2MA 4URKA 2MHJA 4BVUC 2K22A 1WR1A 2Y5CA 1YJJA 1GC7A 2BYEA 3VHTC 2JF5A 4KSLC 2L76A 4W9CA 4HJGE 4REZA 4WQMA 5E6PA 5LXHA 3CSFA 3ML8A 3H6NA 3A9JA 3JVZX 1F52A 2O6VA 3R66C 3AEBB 4LLGM 1KRHA 3N1ZC 4KX6B 1SGHA 1YD8U 2ZCCA 4YL8A 2AQ1B 2L83A 3P4PB 3U4EG 4EFOA 3D32A 4ARIA 2W9NA 2ZNVB 3EC8A 2PE9A 3R8BA 3QA8A 3A9JB 3DHHC 4JE3B 1L0XB 1WI0A 2O6VB 3DVGX 2BB6A 5E6NA 1YX6B 3B08A 1V5OA 2WXHA 4MH8A 2X8XX 2ZEQA 4HDOA 4CO7A 3GZNB 1NI2A 3RNBC 2FAZA 2L05A 3Q3OC 1K51A 2OOBB 2KJRA 2PIAA 2KDIA 1EM7A 3KWVA 1KOTA 2WDQB 2KAJA 1SSNA 1P3QU 3LB8C 5IO9A 1CJEA 1FD6A 2GBJA 4WH4A 4USAA 3RNGC 2GLSA 2JXTA 3V05A 2FCMA 3S2AA 3DBRI 3PLVA 4B95A 2PJHA 5J17A 3SEBA 2AL3A 1QKZA 3P42A 1R4NI 4LJPB 4AWJA 2NPTA 1F2RI 2IO0B 5IA7A 2BGFA 3PZ7A 1VLBA 1I35A 3BWUD 4F7ZA 3TMPB 2L0FA 2KD0A 3MC9A 3APFA 3JSVA 2IY0B 1Q10A 4FJZA 1FMAD 2JZZA 2MQJA 2INPE 3GE3C 2JWZA 4W9DA 5CX3A 2LGDA 1WX7A 1HE8A 1QOAA 2PTLA 4ICUA 3A33B 3I57A 4BFRA 2NPTB 3AE2B 4XDDA 4XE0A 4YTPB 2PPHA 5C1ZA 2N9LA 3IVFA 1V1OA 4II2B 1L5PA 3IAM1 3DBLI 3PREA 4HCNB 4JWUC 4FHKA 1Q1OA 3KUZA 3JSVB 4EOYA 4MGYE 2PLPA 3RNFC 3HHMA 1LGRA 5EE1A 3LXFA 4OZAA 3UQBA 1K50A 2WHIA 2AYOB 4EKUA 1R7SA 2M1MA 2RDBC 5MPOA 4OW0A 5FKAC 4ARCA 1V1PA 2KC1A 2WS3B 2GBKA 3J9CA 3NHEB 2LFIA 2G4DB 1P7EA 4C4VA 1V9JA 3KYDD 4LDTD 3NVYA 1E0ZA 2CKHB 4N58A 1S1QB 2IO1B 5C2TB 3IXSA 2N7JA 5BO4B 2D3CA 1DOYA 5GXGB 1LXDA 2QILA 1RAXA 3L10B 3VUYA 1HEZE 1WGYA 4DQOC 1V1PB 4HJKA 3U2SC 1ROEA 3O13A 2Z0EB 1VRAB 2NR2A 4C4VB 3CMMB 2WXLA 1TKYA 2WYQA 4ZRPA 1UNSA 2K0PA 4HRSA 3N1XC 4IM2A 3HRDD 3ZNZB 1JALA 1EF1A 2WXFA 2V0GA 4JLCA 4S0RA 2B3AA 3SD5A 2KXJA 2GBRA 1OQRA 1T0RC 5JZEB 4PS3A 4G11A 1GPXA 4KZ0A 2G45B 1MHXA 3RD2A 2QHOA 4BKSD 1WXVA 2I1JA 1TBEA 2YEPB 2WXIA 2J52A 3H7PA 1CK1A 3M3JA 4PT5A 1YMHE 1TYGB 2NMQA 3C8YA 3KUCB 2C9WB 1FXTB 1QF6A 2ZZPB 2KANA 1JCKB 4ASWC 4YXDB 4GMVA 1Q0WB 3V6CB 2INDC 4ZRJA 5HFYA 2K8HA 2V3PA 3E56A 2ZJDA 2WXJA 2BS4B 1NBFC 3PLUA 4CQNA 3TJPA 1DGJA 3H7PB 3TSSA 4CYEA 3N20C 2W82A 4K7WA 2IO2B 1TT5B 4EUTA 4ICVA 2KJHB 1WM2A 2KZRA 3K9PB 4NQLB 5LXIB 2KVZA 1WR6E 4L2YA 2LXAA 3ZJVA 2NBUA 5JHBA 1EU3A 4DHJD 3X0WA 4PS8A 2DWQA 3PVLA 4WWOA 1QZEA 2K3UA 4I6NB 3NVWA 3VXWA 2J4XA 1T0YA 1WJNA 3L0WB 2KX3A 3EA6A 3KYCD 1T6BX 4KIKA 3PHWB 4L1BA 2MWSB 4ACFA 1K8RB 3BY4B 2M19A 2EKEC 4KVGB 4LNFA 4LCDE 3PZDA 2D2QA 2Y3AA 3WIMA 1MHHE 2CHXA 3U30A 1ENFA 1HZ5A 1TJEA 2KMAA 2YVCA 2TSSA 5BMGA 2LVQA 4FULA 3R3MA 3BK2A 1I4QA 1WJ6A 4JIOU 1YJ1A 3B0AA 4IM0A 5J18A 1XLPA 2MCNB 4ZRIA 4RNAA 2N7EA 2BBCA 4KIKB 1TS5A 3DHIC 1SIJA 4HDQA 1M94A 2KK8A 4J6IA 4FN2A 3MC8A 1WGKA 1SXTA 3U52E 2N1WA 2W55A 1M4VA 4ANUA 2JX5A 3VTUA 2MP2A 4WJQA 1B1ZA 2BF8B 2RDGA 3DVNV 2BVCA 1GNUA 4J3OD 1AYFA 1XT9B 2A4ZA 2A5UA 3NVZA 2HJ1A 3BVGA 3OG5A 4BOSC 3BYYB 4RM8A 4A55A 3BINA 3VAWA 2SEBD 2AQ2B 1XEEA 1WIAA 1JWUD 4OVZA 1IP9A 2AWTA 3O65B 2MP2B 2Z59B 2KQ4X 1P98A 1XD3B 4ANVA 5IP4D 2WU5B 4L23A 4HK2A 2KHWB 1P9DU 2EMTA 2M0AA 3APDA 4YSZB 2JRHA 1WXQA 3NOBA 1C4PA 1C1YB 4A90A 3A1QA 4M01A 4DHZE 3DDCB 1PQSA 4B0MA 2ZNVC 1CQVA 4MDKE 3ZO5B 1SB3C 1VDVA 3LYYA 3M62B 2N9XA 2D11A 3AEGB 4IM3A 1I4RA 2JYEA 4LNIA 2RGFA 2W3RA 3UIPB 2KWVB 1AN8A 1D5ZC 1L4ZB 4A6QA 1HTOA 1GB4A 2KMMA 4M00A 1P1AA 3A1QB 3WA0A 3JW0X 2C7NB 2AQ3B 3H7SA 3V61A 1BMLC 3PTFC 4IDIA 1WX9A 1WX8A 1KLGD 4PYUA 4XX5A 4IG7B 3IHPC 4NJCA 4RGMA 2D07B 1F9JA 1WRIA 2WXMA 4RF0A 4DK5A 1UGMA 4RGOS 2H89B 4K81A 3FC4A 1C79A 4IWQA 4PS7A 3P1MA 4DXGA 3SHQA 4GIVA 4GB9A 2JUOA 3W2DA 1E7UA 1SF0A 3A4RA 4GGQA 2LHEA 2V4IB 1YNTE 1J7AA 4K7UA 2JQRB 1E7PB 4Q2JA 1WGDA 3ETRA 2MW5A 2YEPF 5JHAA 4B0EA 2L8JA 3OJ4B 4WJNA 4XGAB 3PZ8A 4LJOB 4AQ7A 2WGSA 2FCSA 2LGIA 4MJSA 4OVVA 4G50A 1VR9A 4BKSA 1E10A 1JWAD 4HXDA 1E6EB 3H1UA 1VZ6A 1QILA 1JWSD 3ML9A 1H8CA 4GXBA 3QAQA 1WYWB 2L3ZA 3DVNU 1HTQA 5HKHA 3DCGA 5E6JA 3T8MA 1L0YB 1D6EC 3WAOA 3W9CB 4HKZE 2CHZA 3W1SC 4CHKA 2XN9C 3HM6X 4M02A 5BMHA 4KV2A 1TS2A 4YWGG 1QOFA 3NZSA 1UF0A 3GZNI 1JWMD 4HEA1 4BAXA 5HHDG 3PV1A 1E8XA 2IZVB 4ZDVA 4US8A 2LRUA 3IFWB 4PYZA 4DXAB 4GDKA 5BMIA 3ZRCA 1LQBA 3DQVA 2XNAC 2MBOA 3AU4A 1WM3A 2ZPYA 4W9JA 4GLSC 4YTNB 3URYA 1J8CA 2BB5A 1TS4A 1WF9A 3AEAB 2DHZA 4WJOA 4MEMA 2KJ6A 1TZ1A 2SAKA 5T8IA 2FNJB 1TY2A 5L95C 2L0TA 1FIQA 2J42A 3ZVVA 3HIZA 2WXQA 1IGDA 3PT2B 4DDID 1FCLA 2KT7A 3GE8C 3VTVA 3U8ZA 1QQRA 4II3B 3TEWA 2W54A 4AP4C 2JZ3B 5DPSA 2D10A 2FIDA 1FCCC 4KZCA 5EDSA 1I4PA 1JWBD 2RR9A 3QIJA 2WDTB 4DHJB 4DWFA 3L08A 3AE6B 1WJ4A 2ON8A 3N32A 3W1SA 2LI5A 1E9MA 3RNCC 3AEDB 3FKYA 2N4FA 3BYTB 1YOVB 5G5HA 4FA6A 4M8MA 4M8NA 2L00B 2KC2A 4P1BC 2MBQA 4ANWA 5IKCM 1MFWA 2LJIA 3RNAC 4GOCA 3M63B 4ZYNA 4LNKA 3OLMD 3NG0A 2FUG1 5J2RA 5CTRC 3NY5A 1C76A 5GMVA 5D3IB 2DAFA 1IBXA 3VRBB 3KLSX 2M4NA 1E8YA 3UINB 3MJ5A 1U4AA 3SR6A 1D5MC 4W9GA 2DYOA 3AE4B 4NNJB 1RFKA 1CZPA 1WXSA 4RGNA 1G6JA 1J7BA 4JQWC 1WYGA 4F8CB 2WLBA 1FNWA 4EE2A 4HCPB 3Q6BA 4JX1C 1OEYJ 1TIFA 4FBJB 3VH4B 5JH5C 3P4RB 3KQ4A 4OVUA 3NS1A 3RI7C 3VUXA 1IBXB 1SE3A 4NPNA 4BKGA 3Q8EA 1OEYA 2BS3B 3X23A 1TZOA 3I3TB 2X38A 2JWUA 3Q14C 4IW0A 4JL9A 3IAS1 2IGHA 2PE6B 3MP9A 2Q5WD 3ZNID 3ZGZA 1L0VB 2QMTA 5JXVA 3L54A 1XCQL 3MTNB 3K9OB 2DZJA 1VJKA 1SEBD 2CHWA 4NJ7A 3RYTA 3MJWA 1SIFA 3QHTA 3QX1A 3LDZE 4C7ZA 2N1VA 1A5RA 1L2NA 3Q3JA 1I4HA 1KLUD 1PYWD 3KW5B 4AJWA 3SU8X 4TSSA 1SBBB 1P0RA 4OZBA 4HPLB 2WXGA 4HLEA 2IPKD 2KWUB 2KOXA 4IC7B 2GI9A 1IPGA 2JVCA 3CF6E 5EE0A 4G0NB 2BWFA 3RZWC 2MJ3A 1N62A 1N5WA 2WXNA 3JYUA 4NZLB 3ZQ4A 2JPHA 2GBNA 2K1FA 4S17A 2DBYA 1XO3A 3ZTCA 3PGEA 5DPTA 4B9KA 1EO6A 2KDFB 1E7VA 5CHWA 3I5JC 4PK1A 1UWMA 5AZFA 3OAWA 1CMXB 3R2IA 1UBQA 3EHVA 1SJED 4W9HA 1EUVB 2K9XA 1C4AA 2KQ7A 3OWEB 1N63A 3ZKJC 3AE3B 2KX0A 5AEKB 1E5WA 2L52A 1YQ4B 2HDEA 3KUDB 2BYTA 3MHSD 4HPMB 2MSED 3MFGA 3W5VB 4AJYB 3TBLD 2V3SA 2HE7A 3VRAB 4MH0E 3R2TA 3IT6B 1Y56A 2LGSA 1KM7A 2FUHB 4WURA 1KJTA 3RULA 2QEJC 1MJDA 1BUIC 1OTRB 3Q8FA 3AU5A 1SE4A 2K6QA 2AEHA 1MPEA 1KFYB 4F1SA 5FK9C 1F0ZA 1R4MB 4BZAA 2ACZB 3VUWA 1PGAA 3DBHB 1I7HA 2JZPA 2ASQA 1ZPSA 3NRZA 4XYCA 1DOXA 1KH0A 1XCTL 4FJYA 5I4DA 1ZE3D 4WAFA 3B1LX 2W3SA 3P63A 1JQ4A 1FFUA 1QOBA 2BKFA 4K3CA 4WWNA 3UQAA 4BOZB 1E90A 4WAAA 3ZUNA 3AE7B 3V60A 2Z0DB 4NQKE 3ZLZA 1LFDA 3NZ3A 2DX5B 4MSMB 3PHXB 2MRPA 2RSUA 2KDEB 1HA5A 4TV3A 1JMLA 2M56B 5AUIA 1YQ3B 2FIFA 1AWDA 1WXAA 2UYZB 3N1YC 1JRPA 2HTHA 3AB5A 4EZLA 2LVOA 2MJDA 5IAAC 3EFCA 1FRDA 1WXMA 1S3SG 1MI0A 4D2KA 4ZOHC 2BW2A 2WXRA 1J19A 3ONSA 1L6UA 1ZOYB 3FAHA 4RCOA 1K52A 2LGXA 3DWGC 4TMAB 2IDYA 2I1KA 2KDBA 4C80A 3Q69A 4IKGA 2NBWB 4IWPA 4RMAA 3GP7A 1UWXA 2I38A 2R2OA 3ZDMC 2MBHA 4WWPA 3ZTDA 4NAMA 2K6DB 5H8YE 4QAYA 3TEXA 2Z8LA 4XZ4A 5LLIA 2C7MB 3ALBA 3WALA 1QLBB 4AOFA 3HVZA 1UD7A 3BIID 2WX0A 1NEKB 4DBGA 2E6XA 5IOIA 4X57B 3T3NA 1ESFA 1LO5D 3T3OA 3DWMA 3QARA 2WWZA 2RMMA 1TTNA 2BS2B 1UUPA 3AMZA 3W5UB 1TKGA 1V5TA 2L32A 1EWYC 1UBIA 2OEDA 2DAJA 2MA9B 3ZNGC 2CS4A 2K5PA 3A9KA 3AN1A 3MHZA 4NY0A 4HKQA 2WXOA 3A4SC 3ZRFA 4HROA 3ZNHB 4MGKE 2R2QA 3NJTA 1TGZB 3HM3A 3AXCA 3ECIA 1NYQA 3UGBB 1TY0A 1T0SC 4K7SA 3SDLC 2MX2A 3EECA 3KVFB 5D2MB 3P4QB 4IOIE 4TQ0A 1YX5B 5BYRA 5EE9A 2UU7A 1X1MA 1NENB 4YSXB 3L13A 2GRIA 1WJUA 1C3TA 2MLBA 1D3ZA 4UDUC 2ZW0A 1WZ3A 2ZVNA 2IJ0A 5G5GA 2B76B 2MEKA 4WWMA 1ZXHA 1UELA 1KLVA 4FXCA 1J7CA 4GSWA 1IGCA 2FCQA 4RF1A 2J0KA 1NDDA 3ZJUA 4OHJA 3BK1A 4LNOA 3AEEB 2Y5BB 2BYVE 3LJ3A 4ZHOA 4BBNC 2KYWA 1IUEA 1FEHA 2JYTA 4NAWA 1WE6A 4P7IA 1WGRA 4YTMB 2D5GA 3SFDB 2LJ5A 3OJ3A 1YN4A 2N0SB 1ISNA 1ZKHA 1EU4A 3AV8A 2D3AA 3RT3B 4YT0B 3RMKC 3PRMB 2KWDA 2DENB 4ITKA 3VTWA 1YN5A 1L7YA 4XWWA 1V86A 4MM3A 3NZUA 4GN1A 3RNEC 1C9FA 3DVGY 4NAWB 4HVBA 3Q3FA 3KH0A 1MG4A 3B9JA 2EELA 1V81A 3DPDA 1ET6A 2DYBA 4MSQB
chains in the Genus database with same CATH topology
3SR6A 1D5MC 1FO4A 1QOGA 2AX5A 4YXDB 2LHDA 2WP9B 1JROA 2RDHA 2WXPA 2H88B 2INNE 2DYOA 1F2RC 3AE4B 1NYRA 5HFYA 2V3PA 1GAQB 3E56A 4MM3B 1ZDXA 1RFKA 1V8CA 1CZPA 4AS1A 2WXJA 4RGNA 1FM0D 2BS4B 1J7BA 1B9RA 1PUTA 1WYGA 4CQNA 2WLBA 1FNWA 2LUMA 4RFBA 4EE2A 1DGJA 1OFFA 2NTTA 4JX1C 2JSVX 1WWTA 3TSSA 2WDVB 5HG2A 3P4RB 3KQ4A 3NS1A 1IBXB 1SE3A 2WU2B 2W82A 1ZXIA 2WDRB 2NTSA 3Q8EA 2BS3B 2HTME 4C7YA 2VZKD 1TZOA 1FRRA 2X38A 5LNK1 2JWUA 3CIRB 1XLNA 1C77A 2IGHA 2LEKA 3AECB 3IAS1 4L2YA 3MP9A 1ZDVA 4MT5A 2Q5WD 3EUB2 2Y5PA 3ZJVA 3ZGZA 1L0VB 2FE8A 2QMTA 5JXVA 1T5XD 1EU3A 1XCQL 2IGDA 4KKIA 1YN3A 3Q8BA 1GOZA 2DWQA 3CWIA 1VJKA 1SEBD 4P6VF 2K3UA 4M0WA 1P7FA 1STEA 4C7ZA 3NVWA 2J4XA 1NI3A 1JW9D 4ZRQA 4WIPA 1I4HA 1QT9A 1KLUD 1PYWD 3EA6A 4TSSA 1SBBB 4OZBA 2WXGA 4GDKB 1T6BX 4L1BA 2IPKD 1EWCA 3AE8B 2M19A 2GI9A 3ZJTA 4MACA 2QJLA 2ZW1A 3PO0A 2Y3AA 5EE0A 1MHHE 3B2GA 3L4PA 1D4BA 3GB1A 2MJ3A 1N62A 2DLBA 2ICIA 1N5WA 1ENFA 2WXNA 2BT6A 4KGRA 4NZLB 3ZQ4A 2MJEA 1FFVA 1HZ5A 1TJEA 2DBYA 2TSSA 3VQIA 1XO3A 1N61A 3MC0B 5BMGA 1FXIA 1A70A 3BK2A 1ACCA 1I4QA 2GB1A 4XWTA 4A8XC 3UI3A 1FXAA 1UWMA 2CU3A 1XLPA 1C4CA 4RNAA 1I4GA 2BBCA 2E3TA 3R2IA 1TS5A 3U7ZA 5BYQA 1SJED 3AE9B 3TUOA 4A9AA 1D5XC 2K9XA 1C4AA 3NVVA 1SIJA 3OWEB 1N63A 1WGKA 1SXTA 3U52E 2W55A 2LMCA 3AE3B 2K22A 1M4VA 2Y5CA 2JX5A 2L52A 1YJJA 1YQ4B 4KGSA 2HDEA 1B1ZA 3KWLA 2BYTA 2RDGA 2L1AA 1XF5L 4J3OD 3MFGA 3W5VB 3AE1B 4HJGE 4REZA 4WQMA 1AYFA 3VRAB 3R2TA 3IT6B 3NVZA 3AEBB 1Y56A 3BVGA 4A55A 3BYYB 4WURA 4LLGM 3HVDA 1KRHA 1PGXA 4KX6B 2N9KA 2SEBD 2AQ2B 1XEEA 2QEJC 2PVOD 1BUIC 1HZ6A 1JWUD 1T3QA 2AQ1B 3Q8FA 1SE4A 4OVZA 1MPEA 1KFYB 2L83A 3P4PB 5FK9C 3U4EG 3RPFC 1F0ZA 2KQ4X 3EGRA 1KTKA 2ACZB 1PGAA 5D7GA 1I7HA 1N60A 2JZPA 4ARIA 2WU5B 4L23A 1ET9A 2M0AA 1ZPSA 3NRZA 1PDXA 2KN4A 1WXQA 3R8BA 1KF6B 3H8HA 4YSZB 1DOXA 1AW7A 1HXYD 1KH0A 1XCTL 4JE3B 5I4DA 1C4PA 1L0XB 4A90A 1ZE3D 1F77A 2BB6A 4WAFA 2W3SA 2WXHA 3P63A 4MH8A 1JQ4A 1FFUA 1QOBA 4B0MA 3IT4B 1CQVA 2G1EA 1SB3C 1VDVA 3LYYA 3AE5B 3AEGB 1I4RA 2JYEA 4N59A 2W3RA 1RWSA 1HQRD 3AE7B 1K51A 4XDCA 2PIAA 3VR8B 1AN8A 1D5ZC 1L4ZB 1EM7A 3FILA 3NZ3A 4A6QA 1ZP0B 1GB4A 4JWSC 1GB1A 1PGBA 3KWVA 1HA5A 2KMMA 1JMLA 2WDQB 2KAJA 1SSNA 2M56B 3Q8CA 5AUIA 3Q8AA 1YQ3B 5BYSA 3LB8C 1CJEA 1AWDA 1OQQA 1FD6A 2DYMA 2PKOA 2AQ3B 4WH4A 4USAA 1BMLC 1JRPA 4IDIA 3N9YC 3AB5A 1KLGD 4OZCA 5HI1A 4NJCA 3B2FA 4RGMA 1WRIA 2JXTA 3ZYYX 3V05A 4YSYB 2MJDA 1TKEA 2WXMA 1L6VA 5FR3A 4RF0A 1FRDA 1MI0A 5AUKA 4D2KA 4ZOHC 3TEYA 2BW2A 2WXRA 4RGOS 1L6UA 2H89B 3FC4A 1ZOYB 1C79A 3FAHA 2BTEA 3FILB 3SEBA 4RCOA 1K52A 1RM6C 4P16A 3P1MA 1QKZA 3DWGC 4DXGA 4TMAB 3P42A 2IDYA 4C80A 3Q69A 4IKGA 3W2DA 1F2RI 1SF0A 1BXTA 3GP7A 1UWXA 2LHEA 2V4IB 2I38A 1YNTE 3PZ7A 1VLBA 1J7AA 3SFEB 3BWUD 2JQRB 1E7PB 1DOIA 4Q2JA 1VZ7A 2PW9A 4NAMA 3TEZA 1Q10A 3ETRA 5H8YE 1ZUD2 2I2YA 2QSDA 3TEXA 2Z8LA 2YEPF 1WSPA 4B0EA 2WXKA 1FMAD 2OHFA 1QLBB 3PZ8A 4AQ7A 3HVZA 2INPE 2LGIA 3BIID 3AH7A 1VR9A 1E10A 1NEKB 2E6XA 1JWAD 1QOAA 2KDMA 2PTLA 1E6EB 1I4XA 1VZ6A 3T3NA 1ESFA 1LO5D 1L4DB 3T3OA 3I57A 1QILA 1JWSD 1XLQA 3AE2B 3DWMA 4XDDA 1MVKA 4XE0A 4YTPB 2PMVA 2RMMA 1NVID 2BS2B 1UUPA 3AMZA 3W5UB 2N9LA 1XLOA 1TKGA 1V1OA 1L5PA 3IAM1 5D3DA 2EKIA 4JWUC 2L32A 1EWYC 5E6JA 2OEDA 1FNVA 2WQYB 2RPVA 1L0YB 1D6EC 1SJHD 2K5PA 4HKZE 3W9CB 2PLPA 3AN1A 3MHZA 5BMHA 2XN9C 1TS2A 2WXOA 5EE1A 3LXFA 4DXFA 4HKQA 4OZAA 1K50A 4H2AA 4HROA 1N5XA 4YWGG 1QOFA 2MH7A 1JWMD 1V97A 4ZHPA 4RGTA 4HEA1 1R7SA 4KKJA 1NYQA 5H92C 5HHDG 1TY0A 1FNUA 5MPOA 4ARCA 1YJIA 2JU6X 4OW0A 5FKAC 2ONQA 1V1PA 2WS3B 3J9CA 5EE3A 4US8A 2LFIA 1P7EA 2CJOA 1K53A 3P4QB 4IOIE 4TQ0A 5BMIA 5BYRA 5EE9A 1NENB 4YSXB 3NVYA 3V3XA 2GRIA 1E0ZA 4N58A 2XNAC 1XXGA 5C3JB 2QIEB 4O1NA 4UDUC 3GS2A 3I9V1 5C2TB 4GLSC 4YTNB 3E9SA 3IXSA 2ZW0A 3URYA 2IJ0A 2N7JA 5G5GA 2B76B 1DOYA 2MEKA 5GXGB 2BB5A 1TS4A 3AEAB 4WWMA 1ZXHA 4RH6A 4C56C 2PVGC 2QILA 4FXCA 1HEZE 1J7CA 4LTUA 2SAKA 5T8IA 1TY2A 1IGCA 4GDLB 4RF1A 1FIQA 4ZYSA 2J42A 4DQOC 1V1PB 3U2SC 3WCQA 1ROEA 4OHJA 2WXQA 3ZJUA 3O13A 1IGDA 3BK1A 3AEEB 1FCLA 1DYQA 1VRAB 2FBWB 1SE2A 2WXLA 1TKYA 4TQ1A 4R3DA 1QQRA 4ZHOA 1IUEA 1FEHA 1PFDA 1UNSA 2K0PA 2JYTA 2VZKB 4HRSA 4ZRPA 3TEWA 2W54A 3RFZB 3HRDD 3NUHB 3BZDB 4YTMB 3BVMA 3HUIA 2D5GA 1UGJA 3SFDB 1JALA 1FCCC 2WXFA 3ABVB 1I4PA 1JWBD 4N6EB 1RYJA 1YN4A 2V0GA 2N0SB 1C78A 3P4SB 1EU4A 3AV8A 4YT0B 3AE6B 2ON8A 3W1SA 2G9HD 1E9MA 2KWDA 1OQRA 3AEDB 3BYTB 3AEFB 3BVZA 5G5HA 4ITKA 1GPXA 4LK0M 3AM9A 1YN5A 4XWWA 2KACA 4US9A 1VZ8A 2LJIA 1MHXA 1C9FA 2J53A 1TS3A 4NAWB 2FUG1 2YEPB 4KGTA 2WXIA 2J52A 1CK1A 1C76A 4PT5A 3VR9B 1YMHE 2R61A 1TYGB 2EELA 3B9JA 2NMQA 5D3IB 3C8YA 1IBXA 4JPSA 2WNMA 2V3NA 3KLSX 1ET6A 2IGGA 3VRBB 5TSSA 1QF6A 2CJNA 3MJ5A 1JCKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JU6 X;  2ONQ A;  1FD6 A;  2LHD A;  1P7E A;  1K53 A;  4WH4 A;  1F2R C;  5HFY A;  4IOI E;  5BMI A;  3V3X A;  4OZC A;  5HI1 A;  2JXT A;  4GLS C;  2ZW0 A;  1MI0 A;  4D2K A;  2LUM A;  4KGS A;  2N7J A;  2JSV X;  1XF5 L;  3FIL B;  1K52 A;  1ZXH A;  5HG2 A;  1QKZ A;  4HJG E;  1IBX B;  1HEZ E;  1IGC A;  4IKG A;  1F2R I;  2JWU A;  1UWX A;  2LHE A;  2I38 A;  1YNT E;  1IGD A;  1FCL A;  1PGX A;  2IGH A;  2N9K A;  3MP9 A;  2PW9 A;  2QMT A;  5JXV A;  1HZ6 A;  2K0P A;  1XCQ L;  1Q10 A;  2IGD A;  2I2Y A;  2QSD A;  1MPE A;  1FCC C;  2KQ4 X;  1P7F A;  1PGA A;  2LGI A;  2JZP A;  2KDM A;  2PTL A;  2ON8 A;  2KN4 A;  2KWD A;  4OZB A;  1KH0 A;  1XCT L;  1MVK A;  2RMM A;  2KAC A;  2N9L A;  2GI9 A;  1MHX A;  4MAC A;  2OED A;  2ZW1 A;  1C9F A;  2RPV A;  1MHH E;  2J53 A;  1D4B A;  3GB1 A;  4HKZ E;  4KGT A;  1K51 A;  4KGR A;  2J52 A;  2PLP A;  5BMH A;  1HZ5 A;  4OZA A;  1EM7 A;  1YMH E;  1K50 A;  3FIL A;  1GB4 A;  2EEL A;  5BMG A;  2NMQ A;  1GB1 A;  1PGB A;  1IBX A;  2IGG A;  1JML A;  2GB1 A;  3UI3 A;  5HHD G; 
#chains in the Genus database with same CATH topology
 2G4S A;  4WJP A;  1FO4 A;  2M8S A;  2LHD A;  2RDH A;  3APC A;  1VCB A;  4GU2 A;  1F2R C;  5G2N A;  4MM3 B;  2KTR A;  1FM0 D;  1ZGU B;  1B9R A;  1T0Q C;  2JY6 A;  1PUT A;  2QDF A;  2KKC A;  4MJS B;  4RFB A;  2BPS A;  1ZW7 A;  2NTT A;  2JSV X;  3TL5 A;  3VDZ A;  2LRW A;  2WU2 B;  2LZ6 A;  4JGH B;  1ZXI A;  2WDR B;  2NTS A;  4A3P A;  2HTM E;  2VZK D;  2ZPN A;  3QWZ B;  2K8C A;  5TR5 A;  3ZDT A;  5LNK 1;  5E6O A;  2OJR A;  1XLN A;  2LEK A;  3AEC B;  4W9L A;  3WAM A;  4MT5 A;  2KTR B;  2O2V A;  4KKI A;  4MGZ E;  1GOZ A;  2KN5 A;  2C7H A;  4M0W A;  4KDL B;  2J0M A;  3R7R A;  3DHG C;  4ZRK A;  2J0J A;  1NI3 A;  2XEW A;  4DDG D;  1JW9 D;  4WIP A;  1QT9 A;  2KFJ A;  4GDK B;  2DZI A;  3AE8 B;  2NCN A;  4TKN A;  2IY1 B;  3ZJT A;  3HK0 A;  3PO0 A;  2O2V B;  3B2G A;  2DZK A;  1D4B A;  3GB1 A;  2XK5 A;  2RD0 A;  4EZJ A;  2BT6 A;  4KGR A;  4KDI C;  4M0W B;  4HWI B;  3MC0 B;  1FXI A;  1RLF A;  4K3B A;  1ACC A;  2JRI B;  4W9I A;  3UI3 A;  2CU3 A;  1C4C A;  3DBR B;  2RPQ A;  2E3T A;  2L7R A;  4A9A A;  3U7Z A;  3TUO A;  3AE9 B;  2JXX A;  4WQO B;  3PPA A;  1R4N B;  2LMC A;  1J0G A;  2NS5 A;  1YQB A;  2IO3 B;  2WX1 A;  2XK5 B;  4AUQ C;  5FR6 A;  4KGS A;  3I63 C;  3KWL A;  3V6E B;  3Q2A C;  2L1A A;  1XF5 L;  3AE1 B;  4E74 A;  3QC8 B;  3H9D A;  3HVD A;  1PGX A;  2VH2 A;  2N9K A;  3N30 A;  2JT4 B;  2PVO D;  1HZ6 A;  1T3Q A;  2LVP A;  3RPF C;  4FAD A;  1E8W A;  1WY8 A;  3EGR A;  1KTK A;  5D7G A;  2LUE A;  1N60 A;  2VH1 A;  3DBL B;  1ET9 A;  2ZVO A;  1PDX A;  2KN4 A;  1KF6 B;  3H8H A;  4C00 A;  1AW7 A;  1HXY D;  2V9H A;  1F77 A;  4E3C A;  2AL6 A;  4E71 A;  2LD9 A;  1I42 A;  3IT4 B;  3ENE A;  2G1E A;  3AE5 B;  2LAS A;  4N59 A;  1RWS A;  1HQR D;  2M17 A;  3RCZ A;  4XDC A;  5DCN A;  3VR8 B;  2K39 A;  2C60 A;  3FIL A;  1ZP0 B;  5G55 A;  2LGY A;  4JWS C;  1GB1 A;  1PGB A;  2KTF A;  2HJ8 A;  2BYF A;  3ZIM A;  1RRB A;  3PS6 A;  3Q8C A;  5BYS A;  3Q8A A;  2D3G A;  5KHO A;  1Z5S B;  1OQQ A;  2DYM A;  2PKO A;  3WAN A;  3N9Y C;  2MBE A;  5KHQ A;  4OZC A;  5HI1 A;  3B2F A;  3ZYY X;  4YSY B;  1TKE A;  1L6V A;  5FR3 A;  2LWP A;  2DNF A;  2IYD B;  5AUK A;  3TEY A;  1LM8 B;  1BT0 A;  2BTE A;  3NS8 A;  3FIL B;  5CHF A;  3QQ8 B;  1RM6 C;  4P16 A;  1WRD B;  2KWC A;  1WGG A;  2K8B A;  4IUM B;  1BXT A;  1F1H A;  3SFE B;  3U7D A;  1WH3 A;  2NVU I;  3Q3M C;  3T9L A;  2KLC A;  1DOI A;  1VZ7 A;  2PW9 A;  3TEZ A;  4N9F 4;  1ZUD 2;  4FHJ A;  2I2Y A;  2QSD A;  1WSP A;  1OQY A;  2WXK A;  2OHF A;  2PEA A;  2O6V D;  3AH7 A;  4FJV B;  1V2Y A;  3PRZ A;  2KDM A;  1I4X A;  2KQS A;  1L4D B;  2BKR B;  1FPY A;  1V49 A;  1XLQ A;  4A3O A;  1R4M I;  2QCZ A;  1MVK A;  2KVR A;  2PMV A;  1NVI D;  3DBH I;  3GOE A;  1XLO A;  2M0X A;  5D3D A;  5L83 A;  2EKI A;  3QJZ A;  3EFU A;  1FNV A;  2WQY B;  2RPV A;  2BQQ A;  3ZXV A;  1SJH D;  2KO3 A;  2REX A;  1Q5W B;  4DXF A;  4EEW A;  2XBB C;  4H2A A;  4I6L B;  1WFY A;  1AAR A;  1N5X A;  2KNB A;  2GMI C;  4FLH A;  3ZW3 A;  2MH7 A;  1JRU A;  1V97 A;  4KSK C;  4ZHP A;  4RGT A;  4GDL A;  4KKJ A;  5H92 C;  1FNU A;  1YJI A;  2JU6 X;  2HD5 B;  3RN9 C;  2ONQ A;  3C0R B;  5EE3 A;  1WMH A;  3DBS A;  3M95 A;  2CJO A;  1K53 A;  4B6W A;  3L17 A;  3V3X A;  4TUU A;  1XXG A;  5C3J B;  2QIE B;  4O1N A;  3GS2 A;  3I9V 1;  3AUL A;  3E9S A;  2MBB B;  4BBN F;  4MGI E;  4RH6 A;  4C56 C;  2PVG C;  3RUI B;  4LTU A;  3QK0 A;  1WE7 A;  4GDL B;  4W9K A;  3WAP A;  4ZYS A;  1GG3 A;  3R7Q A;  4ANX A;  4P1C C;  3WCQ A;  1WMH B;  3CST A;  1DYQ A;  2QC8 A;  2FBW B;  1SE2 A;  4TQ1 A;  4R3D A;  1GJZ A;  1PFD A;  4XC2 A;  2VZK B;  4W9E A;  5AZH A;  3RFZ B;  3NUH B;  1UZX B;  3BZD B;  2V4L A;  2BWE S;  3BVM A;  3HUI A;  1MG8 A;  1UGJ A;  3C19 A;  3ABV B;  1RFA A;  5D94 A;  4N6E B;  2G3Q B;  1RYJ A;  2GOW A;  2KFK A;  1C78 A;  3P4S B;  2G9H D;  3Q3N C;  1VD2 A;  3VFK A;  3AEF B;  3BVZ A;  2VRR B;  2CR5 A;  4LK0 M;  3AM9 A;  5CHV C;  2KAC A;  2IBI B;  3AI5 A;  4US9 A;  1VZ8 A;  3UIO B;  1WGH A;  1XQQ A;  2K25 A;  2J53 A;  1TS3 A;  3DOW A;  4KGT A;  4I6P A;  1E8Z A;  3VR9 B;  2R61 A;  2KFK B;  2N9E B;  4JPS A;  2WNM A;  2V3N A;  4K1R B;  2IGG A;  2FCN A;  5DPW A;  2NBV B;  5TSS A;  2KMC A;  2CJN A;  1QOG A;  2AX5 A;  4EZK A;  2N9P C;  3UF8 A;  2WP9 B;  3N3K B;  1JRO A;  3PSE B;  2WXP A;  2H88 B;  2INN E;  1UH6 A;  1NYR A;  2D3B A;  1GAQ B;  1ZDX A;  1V8C A;  5D6J B;  2OJW A;  4AS1 A;  3TCA A;  4A20 A;  4DHZ B;  4LNN A;  2DZM A;  2LUM A;  2J7Q B;  1OFF A;  1EF5 A;  1WWT A;  2WDV B;  5HG2 A;  4RM9 A;  2GBM A;  2UWQ A;  1H4R A;  2V1Y A;  2LXC A;  4W9F A;  4C7Y A;  1FRR A;  3VVW B;  5C23 A;  3PRP B;  3CIR B;  2INC C;  3QCA A;  3V62 A;  1C77 A;  1N6Z A;  1SE9 A;  4NJ6 A;  1ZDV A;  2N7D A;  2Y5P A;  3EUB 2;  2FE8 A;  3A9K B;  3TIX A;  1T5X D;  2IGD A;  1YN3 A;  3Q8B A;  3CWI A;  3W1Y A;  4P6V F;  5AZG A;  1P7F A;  3IBE A;  1STE A;  1V6E A;  4IWO A;  4ZRQ A;  1GC6 A;  5DPR A;  1Y8R C;  2YLM A;  3RZF A;  1EWC A;  2CU1 A;  3L16 A;  1YIW A;  4MAC A;  1OGW A;  2QJL A;  1GUA B;  1V80 A;  2ZW1 A;  3L4P A;  2DLB A;  2ICI A;  3VH3 B;  2EMS A;  2MJE A;  1FFV A;  4HPP A;  5IN7 A;  3VQI A;  1N61 A;  1WZ0 A;  4MEL A;  1IYF A;  3ZXR A;  4LDT B;  1A70 A;  4G3X B;  2KLG A;  2GB1 A;  4XWT A;  4A8X C;  1FXA A;  3IG3 A;  4BKT A;  1I4G A;  2ZCB A;  3P2B A;  2C5L C;  5BYQ A;  1D5X C;  3NVV A;  1Z2M A;  4URK A;  2MHJ A;  4BVU C;  2K22 A;  1WR1 A;  2Y5C A;  1YJJ A;  1GC7 A;  2BYE A;  3VHT C;  2JF5 A;  4KSL C;  2L76 A;  4W9C A;  4HJG E;  4REZ A;  4WQM A;  5E6P A;  5LXH A;  3CSF A;  3ML8 A;  3H6N A;  3A9J A;  3JVZ X;  1F52 A;  2O6V A;  3R66 C;  3AEB B;  4LLG M;  1KRH A;  3N1Z C;  4KX6 B;  1SGH A;  1YD8 U;  2ZCC A;  4YL8 A;  2AQ1 B;  2L83 A;  3P4P B;  3U4E G;  4EFO A;  3D32 A;  4ARI A;  2W9N A;  2ZNV B;  3EC8 A;  2PE9 A;  3R8B A;  3QA8 A;  3A9J B;  3DHH C;  4JE3 B;  1L0X B;  1WI0 A;  2O6V B;  3DVG X;  2BB6 A;  5E6N A;  1YX6 B;  3B08 A;  1V5O A;  2WXH A;  4MH8 A;  2X8X X;  2ZEQ A;  4HDO A;  4CO7 A;  3GZN B;  1NI2 A;  3RNB C;  2FAZ A;  2L05 A;  3Q3O C;  1K51 A;  2OOB B;  2KJR A;  2PIA A;  2KDI A;  1EM7 A;  3KWV A;  1KOT A;  2WDQ B;  2KAJ A;  1SSN A;  1P3Q U;  3LB8 C;  5IO9 A;  1CJE A;  1FD6 A;  2GBJ A;  4WH4 A;  4USA A;  3RNG C;  2GLS A;  2JXT A;  3V05 A;  2FCM A;  3S2A A;  3DBR I;  3PLV A;  4B95 A;  2PJH A;  5J17 A;  3SEB A;  2AL3 A;  1QKZ A;  3P42 A;  1R4N I;  4LJP B;  4AWJ A;  2NPT A;  1F2R I;  2IO0 B;  5IA7 A;  2BGF A;  3PZ7 A;  1VLB A;  1I35 A;  3BWU D;  4F7Z A;  3TMP B;  2L0F A;  2KD0 A;  3MC9 A;  3APF A;  3JSV A;  2IY0 B;  1Q10 A;  4FJZ A;  1FMA D;  2JZZ A;  2MQJ A;  2INP E;  3GE3 C;  2JWZ A;  4W9D A;  5CX3 A;  2LGD A;  1WX7 A;  1HE8 A;  1QOA A;  2PTL A;  4ICU A;  3A33 B;  3I57 A;  4BFR A;  2NPT B;  3AE2 B;  4XDD A;  4XE0 A;  4YTP B;  2PPH A;  5C1Z A;  2N9L A;  3IVF A;  1V1O A;  4II2 B;  1L5P A;  3IAM 1;  3DBL I;  3PRE A;  4HCN B;  4JWU C;  4FHK A;  1Q1O A;  3KUZ A;  3JSV B;  4EOY A;  4MGY E;  2PLP A;  3RNF C;  3HHM A;  1LGR A;  5EE1 A;  3LXF A;  4OZA A;  3UQB A;  1K50 A;  2WHI A;  2AYO B;  4EKU A;  1R7S A;  2M1M A;  2RDB C;  5MPO A;  4OW0 A;  5FKA C;  4ARC A;  1V1P A;  2KC1 A;  2WS3 B;  2GBK A;  3J9C A;  3NHE B;  2LFI A;  2G4D B;  1P7E A;  4C4V A;  1V9J A;  3KYD D;  4LDT D;  3NVY A;  1E0Z A;  2CKH B;  4N58 A;  1S1Q B;  2IO1 B;  5C2T B;  3IXS A;  2N7J A;  5BO4 B;  2D3C A;  1DOY A;  5GXG B;  1LXD A;  2QIL A;  1RAX A;  3L10 B;  3VUY A;  1HEZ E;  1WGY A;  4DQO C;  1V1P B;  4HJK A;  3U2S C;  1ROE A;  3O13 A;  2Z0E B;  1VRA B;  2NR2 A;  4C4V B;  3CMM B;  2WXL A;  1TKY A;  2WYQ A;  4ZRP A;  1UNS A;  2K0P A;  4HRS A;  3N1X C;  4IM2 A;  3HRD D;  3ZNZ B;  1JAL A;  1EF1 A;  2WXF A;  2V0G A;  4JLC A;  4S0R A;  2B3A A;  3SD5 A;  2KXJ A;  2GBR A;  1OQR A;  1T0R C;  5JZE B;  4PS3 A;  4G11 A;  1GPX A;  4KZ0 A;  2G45 B;  1MHX A;  3RD2 A;  2QHO A;  4BKS D;  1WXV A;  2I1J A;  1TBE A;  2YEP B;  2WXI A;  2J52 A;  3H7P A;  1CK1 A;  3M3J A;  4PT5 A;  1YMH E;  1TYG B;  2NMQ A;  3C8Y A;  3KUC B;  2C9W B;  1FXT B;  1QF6 A;  2ZZP B;  2KAN A;  1JCK B;  4ASW C;  4YXD B;  4GMV A;  1Q0W B;  3V6C B;  2IND C;  4ZRJ A;  5HFY A;  2K8H A;  2V3P A;  3E56 A;  2ZJD A;  2WXJ A;  2BS4 B;  1NBF C;  3PLU A;  4CQN A;  3TJP A;  1DGJ A;  3H7P B;  3TSS A;  4CYE A;  3N20 C;  2W82 A;  4K7W A;  2IO2 B;  1TT5 B;  4EUT A;  4ICV A;  2KJH B;  1WM2 A;  2KZR A;  3K9P B;  4NQL B;  5LXI B;  2KVZ A;  1WR6 E;  4L2Y A;  2LXA A;  3ZJV A;  2NBU A;  5JHB A;  1EU3 A;  4DHJ D;  3X0W A;  4PS8 A;  2DWQ A;  3PVL A;  4WWO A;  1QZE A;  2K3U A;  4I6N B;  3NVW A;  3VXW A;  2J4X A;  1T0Y A;  1WJN A;  3L0W B;  2KX3 A;  3EA6 A;  3KYC D;  1T6B X;  4KIK A;  3PHW B;  4L1B A;  2MWS B;  4ACF A;  1K8R B;  3BY4 B;  2M19 A;  2EKE C;  4KVG B;  4LNF A;  4LCD E;  3PZD A;  2D2Q A;  2Y3A A;  3WIM A;  1MHH E;  2CHX A;  3U30 A;  1ENF A;  1HZ5 A;  1TJE A;  2KMA A;  2YVC A;  2TSS A;  5BMG A;  2LVQ A;  4FUL A;  3R3M A;  3BK2 A;  1I4Q A;  1WJ6 A;  4JIO U;  1YJ1 A;  3B0A A;  4IM0 A;  5J18 A;  1XLP A;  2MCN B;  4ZRI A;  4RNA A;  2N7E A;  2BBC A;  4KIK B;  1TS5 A;  3DHI C;  1SIJ A;  4HDQ A;  1M94 A;  2KK8 A;  4J6I A;  4FN2 A;  3MC8 A;  1WGK A;  1SXT A;  3U52 E;  2N1W A;  2W55 A;  1M4V A;  4ANU A;  2JX5 A;  3VTU A;  2MP2 A;  4WJQ A;  1B1Z A;  2BF8 B;  2RDG A;  3DVN V;  2BVC A;  1GNU A;  4J3O D;  1AYF A;  1XT9 B;  2A4Z A;  2A5U A;  3NVZ A;  2HJ1 A;  3BVG A;  3OG5 A;  4BOS C;  3BYY B;  4RM8 A;  4A55 A;  3BIN A;  3VAW A;  2SEB D;  2AQ2 B;  1XEE A;  1WIA A;  1JWU D;  4OVZ A;  1IP9 A;  2AWT A;  3O65 B;  2MP2 B;  2Z59 B;  2KQ4 X;  1P98 A;  1XD3 B;  4ANV A;  5IP4 D;  2WU5 B;  4L23 A;  4HK2 A;  2KHW B;  1P9D U;  2EMT A;  2M0A A;  3APD A;  4YSZ B;  2JRH A;  1WXQ A;  3NOB A;  1C4P A;  1C1Y B;  4A90 A;  3A1Q A;  4M01 A;  4DHZ E;  3DDC B;  1PQS A;  4B0M A;  2ZNV C;  1CQV A;  4MDK E;  3ZO5 B;  1SB3 C;  1VDV A;  3LYY A;  3M62 B;  2N9X A;  2D11 A;  3AEG B;  4IM3 A;  1I4R A;  2JYE A;  4LNI A;  2RGF A;  2W3R A;  3UIP B;  2KWV B;  1AN8 A;  1D5Z C;  1L4Z B;  4A6Q A;  1HTO A;  1GB4 A;  2KMM A;  4M00 A;  1P1A A;  3A1Q B;  3WA0 A;  3JW0 X;  2C7N B;  2AQ3 B;  3H7S A;  3V61 A;  1BML C;  3PTF C;  4IDI A;  1WX9 A;  1WX8 A;  1KLG D;  4PYU A;  4XX5 A;  4IG7 B;  3IHP C;  4NJC A;  4RGM A;  2D07 B;  1F9J A;  1WRI A;  2WXM A;  4RF0 A;  4DK5 A;  1UGM A;  4RGO S;  2H89 B;  4K81 A;  3FC4 A;  1C79 A;  4IWQ A;  4PS7 A;  3P1M A;  4DXG A;  3SHQ A;  4GIV A;  4GB9 A;  2JUO A;  3W2D A;  1E7U A;  1SF0 A;  3A4R A;  4GGQ A;  2LHE A;  2V4I B;  1YNT E;  1J7A A;  4K7U A;  2JQR B;  1E7P B;  4Q2J A;  1WGD A;  3ETR A;  2MW5 A;  2YEP F;  5JHA A;  4B0E A;  2L8J A;  3OJ4 B;  4WJN A;  4XGA B;  3PZ8 A;  4LJO B;  4AQ7 A;  2WGS A;  2FCS A;  2LGI A;  4MJS A;  4OVV A;  4G50 A;  1VR9 A;  4BKS A;  1E10 A;  1JWA D;  4HXD A;  1E6E B;  3H1U A;  1VZ6 A;  1QIL A;  1JWS D;  3ML9 A;  1H8C A;  4GXB A;  3QAQ A;  1WYW B;  2L3Z A;  3DVN U;  1HTQ A;  5HKH A;  3DCG A;  5E6J A;  3T8M A;  1L0Y B;  1D6E C;  3WAO A;  3W9C B;  4HKZ E;  2CHZ A;  3W1S C;  4CHK A;  2XN9 C;  3HM6 X;  4M02 A;  5BMH A;  4KV2 A;  1TS2 A;  4YWG G;  1QOF A;  3NZS A;  1UF0 A;  3GZN I;  1JWM D;  4HEA 1;  4BAX A;  5HHD G;  3PV1 A;  1E8X A;  2IZV B;  4ZDV A;  4US8 A;  2LRU A;  3IFW B;  4PYZ A;  4DXA B;  4GDK A;  5BMI A;  3ZRC A;  1LQB A;  3DQV A;  2XNA C;  2MBO A;  3AU4 A;  1WM3 A;  2ZPY A;  4W9J A;  4GLS C;  4YTN B;  3URY A;  1J8C A;  2BB5 A;  1TS4 A;  1WF9 A;  3AEA B;  2DHZ A;  4WJO A;  4MEM A;  2KJ6 A;  1TZ1 A;  2SAK A;  5T8I A;  2FNJ B;  1TY2 A;  5L95 C;  2L0T A;  1FIQ A;  2J42 A;  3ZVV A;  3HIZ A;  2WXQ A;  1IGD A;  3PT2 B;  4DDI D;  1FCL A;  2KT7 A;  3GE8 C;  3VTV A;  3U8Z A;  1QQR A;  4II3 B;  3TEW A;  2W54 A;  4AP4 C;  2JZ3 B;  5DPS A;  2D10 A;  2FID A;  1FCC C;  4KZC A;  5EDS A;  1I4P A;  1JWB D;  2RR9 A;  3QIJ A;  2WDT B;  4DHJ B;  4DWF A;  3L08 A;  3AE6 B;  1WJ4 A;  2ON8 A;  3N32 A;  3W1S A;  2LI5 A;  1E9M A;  3RNC C;  3AED B;  3FKY A;  2N4F A;  3BYT B;  1YOV B;  5G5H A;  4FA6 A;  4M8M A;  4M8N A;  2L00 B;  2KC2 A;  4P1B C;  2MBQ A;  4ANW A;  5IKC M;  1MFW A;  2LJI A;  3RNA C;  4GOC A;  3M63 B;  4ZYN A;  4LNK A;  3OLM D;  3NG0 A;  2FUG 1;  5J2R A;  5CTR C;  3NY5 A;  1C76 A;  5GMV A;  5D3I B;  2DAF A;  1IBX A;  3VRB B;  3KLS X;  2M4N A;  1E8Y A;  3UIN B;  3MJ5 A;  1U4A A;  3SR6 A;  1D5M C;  4W9G A;  2DYO A;  3AE4 B;  4NNJ B;  1RFK A;  1CZP A;  1WXS A;  4RGN A;  1G6J A;  1J7B A;  4JQW C;  1WYG A;  4F8C B;  2WLB A;  1FNW A;  4EE2 A;  4HCP B;  3Q6B A;  4JX1 C;  1OEY J;  1TIF A;  4FBJ B;  3VH4 B;  5JH5 C;  3P4R B;  3KQ4 A;  4OVU A;  3NS1 A;  3RI7 C;  3VUX A;  1IBX B;  1SE3 A;  4NPN A;  4BKG A;  3Q8E A;  1OEY A;  2BS3 B;  3X23 A;  1TZO A;  3I3T B;  2X38 A;  2JWU A;  3Q14 C;  4IW0 A;  4JL9 A;  3IAS 1;  2IGH A;  2PE6 B;  3MP9 A;  2Q5W D;  3ZNI D;  3ZGZ A;  1L0V B;  2QMT A;  5JXV A;  3L54 A;  1XCQ L;  3MTN B;  3K9O B;  2DZJ A;  1VJK A;  1SEB D;  2CHW A;  4NJ7 A;  3RYT A;  3MJW A;  1SIF A;  3QHT A;  3QX1 A;  3LDZ E;  4C7Z A;  2N1V A;  1A5R A;  1L2N A;  3Q3J A;  1I4H A;  1KLU D;  1PYW D;  3KW5 B;  4AJW A;  3SU8 X;  4TSS A;  1SBB B;  1P0R A;  4OZB A;  4HPL B;  2WXG A;  4HLE A;  2IPK D;  2KWU B;  2KOX A;  4IC7 B;  2GI9 A;  1IPG A;  2JVC A;  3CF6 E;  5EE0 A;  4G0N B;  2BWF A;  3RZW C;  2MJ3 A;  1N62 A;  1N5W A;  2WXN A;  3JYU A;  4NZL B;  3ZQ4 A;  2JPH A;  2GBN A;  2K1F A;  4S17 A;  2DBY A;  1XO3 A;  3ZTC A;  3PGE A;  5DPT A;  4B9K A;  1EO6 A;  2KDF B;  1E7V A;  5CHW A;  3I5J C;  4PK1 A;  1UWM A;  5AZF A;  3OAW A;  1CMX B;  3R2I A;  1UBQ A;  3EHV A;  1SJE D;  4W9H A;  1EUV B;  2K9X A;  1C4A A;  2KQ7 A;  3OWE B;  1N63 A;  3ZKJ C;  3AE3 B;  2KX0 A;  5AEK B;  1E5W A;  2L52 A;  1YQ4 B;  2HDE A;  3KUD B;  2BYT A;  3MHS D;  4HPM B;  2MSE D;  3MFG A;  3W5V B;  4AJY B;  3TBL D;  2V3S A;  2HE7 A;  3VRA B;  4MH0 E;  3R2T A;  3IT6 B;  1Y56 A;  2LGS A;  1KM7 A;  2FUH B;  4WUR A;  1KJT A;  3RUL A;  2QEJ C;  1MJD A;  1BUI C;  1OTR B;  3Q8F A;  3AU5 A;  1SE4 A;  2K6Q A;  2AEH A;  1MPE A;  1KFY B;  4F1S A;  5FK9 C;  1F0Z A;  1R4M B;  4BZA A;  2ACZ B;  3VUW A;  1PGA A;  3DBH B;  1I7H A;  2JZP A;  2ASQ A;  1ZPS A;  3NRZ A;  4XYC A;  1DOX A;  1KH0 A;  1XCT L;  4FJY A;  5I4D A;  1ZE3 D;  4WAF A;  3B1L X;  2W3S A;  3P63 A;  1JQ4 A;  1FFU A;  1QOB A;  2BKF A;  4K3C A;  4WWN A;  3UQA A;  4BOZ B;  1E90 A;  4WAA A;  3ZUN A;  3AE7 B;  3V60 A;  2Z0D B;  4NQK E;  3ZLZ A;  1LFD A;  3NZ3 A;  2DX5 B;  4MSM B;  3PHX B;  2MRP A;  2RSU A;  2KDE B;  1HA5 A;  4TV3 A;  1JML A;  2M56 B;  5AUI A;  1YQ3 B;  2FIF A;  1AWD A;  1WXA A;  2UYZ B;  3N1Y C;  1JRP A;  2HTH A;  3AB5 A;  4EZL A;  2LVO A;  2MJD A;  5IAA C;  3EFC A;  1FRD A;  1WXM A;  1S3S G;  1MI0 A;  4D2K A;  4ZOH C;  2BW2 A;  2WXR A;  1J19 A;  3ONS A;  1L6U A;  1ZOY B;  3FAH A;  4RCO A;  1K52 A;  2LGX A;  3DWG C;  4TMA B;  2IDY A;  2I1K A;  2KDB A;  4C80 A;  3Q69 A;  4IKG A;  2NBW B;  4IWP A;  4RMA A;  3GP7 A;  1UWX A;  2I38 A;  2R2O A;  3ZDM C;  2MBH A;  4WWP A;  3ZTD A;  4NAM A;  2K6D B;  5H8Y E;  4QAY A;  3TEX A;  2Z8L A;  4XZ4 A;  5LLI A;  2C7M B;  3ALB A;  3WAL A;  1QLB B;  4AOF A;  3HVZ A;  1UD7 A;  3BII D;  2WX0 A;  1NEK B;  4DBG A;  2E6X A;  5IOI A;  4X57 B;  3T3N A;  1ESF A;  1LO5 D;  3T3O A;  3DWM A;  3QAR A;  2WWZ A;  2RMM A;  1TTN A;  2BS2 B;  1UUP A;  3AMZ A;  3W5U B;  1TKG A;  1V5T A;  2L32 A;  1EWY C;  1UBI A;  2OED A;  2DAJ A;  2MA9 B;  3ZNG C;  2CS4 A;  2K5P A;  3A9K A;  3AN1 A;  3MHZ A;  4NY0 A;  4HKQ A;  2WXO A;  3A4S C;  3ZRF A;  4HRO A;  3ZNH B;  4MGK E;  2R2Q A;  3NJT A;  1TGZ B;  3HM3 A;  3AXC A;  3ECI A;  1NYQ A;  3UGB B;  1TY0 A;  1T0S C;  4K7S A;  3SDL C;  2MX2 A;  3EEC A;  3KVF B;  5D2M B;  3P4Q B;  4IOI E;  4TQ0 A;  1YX5 B;  5BYR A;  5EE9 A;  2UU7 A;  1X1M A;  1NEN B;  4YSX B;  3L13 A;  2GRI A;  1WJU A;  1C3T A;  2MLB A;  1D3Z A;  4UDU C;  2ZW0 A;  1WZ3 A;  2ZVN A;  2IJ0 A;  5G5G A;  2B76 B;  2MEK A;  4WWM A;  1ZXH A;  1UEL A;  1KLV A;  4FXC A;  1J7C A;  4GSW A;  1IGC A;  2FCQ A;  4RF1 A;  2J0K A;  1NDD A;  3ZJU A;  4OHJ A;  3BK1 A;  4LNO A;  3AEE B;  2Y5B B;  2BYV E;  3LJ3 A;  4ZHO A;  4BBN C;  2KYW A;  1IUE A;  1FEH A;  2JYT A;  4NAW A;  1WE6 A;  4P7I A;  1WGR A;  4YTM B;  2D5G A;  3SFD B;  2LJ5 A;  3OJ3 A;  1YN4 A;  2N0S B;  1ISN A;  1ZKH A;  1EU4 A;  3AV8 A;  2D3A A;  3RT3 B;  4YT0 B;  3RMK C;  3PRM B;  2KWD A;  2DEN B;  4ITK A;  3VTW A;  1YN5 A;  1L7Y A;  4XWW A;  1V86 A;  4MM3 A;  3NZU A;  4GN1 A;  3RNE C;  1C9F A;  3DVG Y;  4NAW B;  4HVB A;  3Q3F A;  3KH0 A;  1MG4 A;  3B9J A;  2EEL A;  1V81 A;  3DPD A;  1ET6 A;  2DYB A;  4MSQ B; 
#chains in the Genus database with same CATH homology
 3SR6 A;  1D5M C;  1FO4 A;  1QOG A;  2AX5 A;  4YXD B;  2LHD A;  2WP9 B;  1JRO A;  2RDH A;  2WXP A;  2H88 B;  2INN E;  2DYO A;  1F2R C;  3AE4 B;  1NYR A;  5HFY A;  2V3P A;  1GAQ B;  3E56 A;  4MM3 B;  1ZDX A;  1RFK A;  1V8C A;  1CZP A;  4AS1 A;  2WXJ A;  4RGN A;  1FM0 D;  2BS4 B;  1J7B A;  1B9R A;  1PUT A;  1WYG A;  4CQN A;  2WLB A;  1FNW A;  2LUM A;  4RFB A;  4EE2 A;  1DGJ A;  1OFF A;  2NTT A;  4JX1 C;  2JSV X;  1WWT A;  3TSS A;  2WDV B;  5HG2 A;  3P4R B;  3KQ4 A;  3NS1 A;  1IBX B;  1SE3 A;  2WU2 B;  2W82 A;  1ZXI A;  2WDR B;  2NTS A;  3Q8E A;  2BS3 B;  2HTM E;  4C7Y A;  2VZK D;  1TZO A;  1FRR A;  2X38 A;  5LNK 1;  2JWU A;  3CIR B;  1XLN A;  1C77 A;  2IGH A;  2LEK A;  3AEC B;  3IAS 1;  4L2Y A;  3MP9 A;  1ZDV A;  4MT5 A;  2Q5W D;  3EUB 2;  2Y5P A;  3ZJV A;  3ZGZ A;  1L0V B;  2FE8 A;  2QMT A;  5JXV A;  1T5X D;  1EU3 A;  1XCQ L;  2IGD A;  4KKI A;  1YN3 A;  3Q8B A;  1GOZ A;  2DWQ A;  3CWI A;  1VJK A;  1SEB D;  4P6V F;  2K3U A;  4M0W A;  1P7F A;  1STE A;  4C7Z A;  3NVW A;  2J4X A;  1NI3 A;  1JW9 D;  4ZRQ A;  4WIP A;  1I4H A;  1QT9 A;  1KLU D;  1PYW D;  3EA6 A;  4TSS A;  1SBB B;  4OZB A;  2WXG A;  4GDK B;  1T6B X;  4L1B A;  2IPK D;  1EWC A;  3AE8 B;  2M19 A;  2GI9 A;  3ZJT A;  4MAC A;  2QJL A;  2ZW1 A;  3PO0 A;  2Y3A A;  5EE0 A;  1MHH E;  3B2G A;  3L4P A;  1D4B A;  3GB1 A;  2MJ3 A;  1N62 A;  2DLB A;  2ICI A;  1N5W A;  1ENF A;  2WXN A;  2BT6 A;  4KGR A;  4NZL B;  3ZQ4 A;  2MJE A;  1FFV A;  1HZ5 A;  1TJE A;  2DBY A;  2TSS A;  3VQI A;  1XO3 A;  1N61 A;  3MC0 B;  5BMG A;  1FXI A;  1A70 A;  3BK2 A;  1ACC A;  1I4Q A;  2GB1 A;  4XWT A;  4A8X C;  3UI3 A;  1FXA A;  1UWM A;  2CU3 A;  1XLP A;  1C4C A;  4RNA A;  1I4G A;  2BBC A;  2E3T A;  3R2I A;  1TS5 A;  3U7Z A;  5BYQ A;  1SJE D;  3AE9 B;  3TUO A;  4A9A A;  1D5X C;  2K9X A;  1C4A A;  3NVV A;  1SIJ A;  3OWE B;  1N63 A;  1WGK A;  1SXT A;  3U52 E;  2W55 A;  2LMC A;  3AE3 B;  2K22 A;  1M4V A;  2Y5C A;  2JX5 A;  2L52 A;  1YJJ A;  1YQ4 B;  4KGS A;  2HDE A;  1B1Z A;  3KWL A;  2BYT A;  2RDG A;  2L1A A;  1XF5 L;  4J3O D;  3MFG A;  3W5V B;  3AE1 B;  4HJG E;  4REZ A;  4WQM A;  1AYF A;  3VRA B;  3R2T A;  3IT6 B;  3NVZ A;  3AEB B;  1Y56 A;  3BVG A;  4A55 A;  3BYY B;  4WUR A;  4LLG M;  3HVD A;  1KRH A;  1PGX A;  4KX6 B;  2N9K A;  2SEB D;  2AQ2 B;  1XEE A;  2QEJ C;  2PVO D;  1BUI C;  1HZ6 A;  1JWU D;  1T3Q A;  2AQ1 B;  3Q8F A;  1SE4 A;  4OVZ A;  1MPE A;  1KFY B;  2L83 A;  3P4P B;  5FK9 C;  3U4E G;  3RPF C;  1F0Z A;  2KQ4 X;  3EGR A;  1KTK A;  2ACZ B;  1PGA A;  5D7G A;  1I7H A;  1N60 A;  2JZP A;  4ARI A;  2WU5 B;  4L23 A;  1ET9 A;  2M0A A;  1ZPS A;  3NRZ A;  1PDX A;  2KN4 A;  1WXQ A;  3R8B A;  1KF6 B;  3H8H A;  4YSZ B;  1DOX A;  1AW7 A;  1HXY D;  1KH0 A;  1XCT L;  4JE3 B;  5I4D A;  1C4P A;  1L0X B;  4A90 A;  1ZE3 D;  1F77 A;  2BB6 A;  4WAF A;  2W3S A;  2WXH A;  3P63 A;  4MH8 A;  1JQ4 A;  1FFU A;  1QOB A;  4B0M A;  3IT4 B;  1CQV A;  2G1E A;  1SB3 C;  1VDV A;  3LYY A;  3AE5 B;  3AEG B;  1I4R A;  2JYE A;  4N59 A;  2W3R A;  1RWS A;  1HQR D;  3AE7 B;  1K51 A;  4XDC A;  2PIA A;  3VR8 B;  1AN8 A;  1D5Z C;  1L4Z B;  1EM7 A;  3FIL A;  3NZ3 A;  4A6Q A;  1ZP0 B;  1GB4 A;  4JWS C;  1GB1 A;  1PGB A;  3KWV A;  1HA5 A;  2KMM A;  1JML A;  2WDQ B;  2KAJ A;  1SSN A;  2M56 B;  3Q8C A;  5AUI A;  3Q8A A;  1YQ3 B;  5BYS A;  3LB8 C;  1CJE A;  1AWD A;  1OQQ A;  1FD6 A;  2DYM A;  2PKO A;  2AQ3 B;  4WH4 A;  4USA A;  1BML C;  1JRP A;  4IDI A;  3N9Y C;  3AB5 A;  1KLG D;  4OZC A;  5HI1 A;  4NJC A;  3B2F A;  4RGM A;  1WRI A;  2JXT A;  3ZYY X;  3V05 A;  4YSY B;  2MJD A;  1TKE A;  2WXM A;  1L6V A;  5FR3 A;  4RF0 A;  1FRD A;  1MI0 A;  5AUK A;  4D2K A;  4ZOH C;  3TEY A;  2BW2 A;  2WXR A;  4RGO S;  1L6U A;  2H89 B;  3FC4 A;  1ZOY B;  1C79 A;  3FAH A;  2BTE A;  3FIL B;  3SEB A;  4RCO A;  1K52 A;  1RM6 C;  4P16 A;  3P1M A;  1QKZ A;  3DWG C;  4DXG A;  4TMA B;  3P42 A;  2IDY A;  4C80 A;  3Q69 A;  4IKG A;  3W2D A;  1F2R I;  1SF0 A;  1BXT A;  3GP7 A;  1UWX A;  2LHE A;  2V4I B;  2I38 A;  1YNT E;  3PZ7 A;  1VLB A;  1J7A A;  3SFE B;  3BWU D;  2JQR B;  1E7P B;  1DOI A;  4Q2J A;  1VZ7 A;  2PW9 A;  4NAM A;  3TEZ A;  1Q10 A;  3ETR A;  5H8Y E;  1ZUD 2;  2I2Y A;  2QSD A;  3TEX A;  2Z8L A;  2YEP F;  1WSP A;  4B0E A;  2WXK A;  1FMA D;  2OHF A;  1QLB B;  3PZ8 A;  4AQ7 A;  3HVZ A;  2INP E;  2LGI A;  3BII D;  3AH7 A;  1VR9 A;  1E10 A;  1NEK B;  2E6X A;  1JWA D;  1QOA A;  2KDM A;  2PTL A;  1E6E B;  1I4X A;  1VZ6 A;  3T3N A;  1ESF A;  1LO5 D;  1L4D B;  3T3O A;  3I57 A;  1QIL A;  1JWS D;  1XLQ A;  3AE2 B;  3DWM A;  4XDD A;  1MVK A;  4XE0 A;  4YTP B;  2PMV A;  2RMM A;  1NVI D;  2BS2 B;  1UUP A;  3AMZ A;  3W5U B;  2N9L A;  1XLO A;  1TKG A;  1V1O A;  1L5P A;  3IAM 1;  5D3D A;  2EKI A;  4JWU C;  2L32 A;  1EWY C;  5E6J A;  2OED A;  1FNV A;  2WQY B;  2RPV A;  1L0Y B;  1D6E C;  1SJH D;  2K5P A;  4HKZ E;  3W9C B;  2PLP A;  3AN1 A;  3MHZ A;  5BMH A;  2XN9 C;  1TS2 A;  2WXO A;  5EE1 A;  3LXF A;  4DXF A;  4HKQ A;  4OZA A;  1K50 A;  4H2A A;  4HRO A;  1N5X A;  4YWG G;  1QOF A;  2MH7 A;  1JWM D;  1V97 A;  4ZHP A;  4RGT A;  4HEA 1;  1R7S A;  4KKJ A;  1NYQ A;  5H92 C;  5HHD G;  1TY0 A;  1FNU A;  5MPO A;  4ARC A;  1YJI A;  2JU6 X;  4OW0 A;  5FKA C;  2ONQ A;  1V1P A;  2WS3 B;  3J9C A;  5EE3 A;  4US8 A;  2LFI A;  1P7E A;  2CJO A;  1K53 A;  3P4Q B;  4IOI E;  4TQ0 A;  5BMI A;  5BYR A;  5EE9 A;  1NEN B;  4YSX B;  3NVY A;  3V3X A;  2GRI A;  1E0Z A;  4N58 A;  2XNA C;  1XXG A;  5C3J B;  2QIE B;  4O1N A;  4UDU C;  3GS2 A;  3I9V 1;  5C2T B;  4GLS C;  4YTN B;  3E9S A;  3IXS A;  2ZW0 A;  3URY A;  2IJ0 A;  2N7J A;  5G5G A;  2B76 B;  1DOY A;  2MEK A;  5GXG B;  2BB5 A;  1TS4 A;  3AEA B;  4WWM A;  1ZXH A;  4RH6 A;  4C56 C;  2PVG C;  2QIL A;  4FXC A;  1HEZ E;  1J7C A;  4LTU A;  2SAK A;  5T8I A;  1TY2 A;  1IGC A;  4GDL B;  4RF1 A;  1FIQ A;  4ZYS A;  2J42 A;  4DQO C;  1V1P B;  3U2S C;  3WCQ A;  1ROE A;  4OHJ A;  2WXQ A;  3ZJU A;  3O13 A;  1IGD A;  3BK1 A;  3AEE B;  1FCL A;  1DYQ A;  1VRA B;  2FBW B;  1SE2 A;  2WXL A;  1TKY A;  4TQ1 A;  4R3D A;  1QQR A;  4ZHO A;  1IUE A;  1FEH A;  1PFD A;  1UNS A;  2K0P A;  2JYT A;  2VZK B;  4HRS A;  4ZRP A;  3TEW A;  2W54 A;  3RFZ B;  3HRD D;  3NUH B;  3BZD B;  4YTM B;  3BVM A;  3HUI A;  2D5G A;  1UGJ A;  3SFD B;  1JAL A;  1FCC C;  2WXF A;  3ABV B;  1I4P A;  1JWB D;  4N6E B;  1RYJ A;  1YN4 A;  2V0G A;  2N0S B;  1C78 A;  3P4S B;  1EU4 A;  3AV8 A;  4YT0 B;  3AE6 B;  2ON8 A;  3W1S A;  2G9H D;  1E9M A;  2KWD A;  1OQR A;  3AED B;  3BYT B;  3AEF B;  3BVZ A;  5G5H A;  4ITK A;  1GPX A;  4LK0 M;  3AM9 A;  1YN5 A;  4XWW A;  2KAC A;  4US9 A;  1VZ8 A;  2LJI A;  1MHX A;  1C9F A;  2J53 A;  1TS3 A;  4NAW B;  2FUG 1;  2YEP B;  4KGT A;  2WXI A;  2J52 A;  1CK1 A;  1C76 A;  4PT5 A;  3VR9 B;  1YMH E;  2R61 A;  1TYG B;  2EEL A;  3B9J A;  2NMQ A;  5D3I B;  3C8Y A;  1IBX A;  4JPS A;  2WNM A;  2V3N A;  3KLS X;  1ET6 A;  2IGG A;  3VRB B;  5TSS A;  1QF6 A;  2CJN A;  3MJ5 A;  1JCK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...