2ONRA

Crystal structure of a. fulgidus periplasmic binding protein moda with bound molybdate
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
314
structure length
314
Chain Sequence
GHMNVKLKVFHAGSLTEPMKAFKRAFEEKHPNVEVQTEAAGSAATIRKVTELGRKADVIATADYTLIQKMMYPEFANWTIMFAKNQIVLAYRNDSRYADEINSQNWYEILKRPDVRFGFSNPNDDPCGYRSLMAIQLAELYYNDPTIFDELVAKNSNLRFSEDNGSYVLRMPSSERIEINKSKIMIRSMEMELIHLVESGELDYFFIYKSVAKQHGFNFVELPVEIDLSSPDYAELYSKVKVVLANGKEVTGKPIVYGITIPKNAENRELAVEFVKLVISEEGQEILRELGQEPLVPPRADTAVPSLKAMVEVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an ABC transporter in complex with its binding protein.
pubmed doi rcsb
molecule keywords UPF0100 protein AF_0094
molecule tags Ligand binding protein
source organism Archaeoglobus fulgidus dsm 4304
total genus 112
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2007-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2onrA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2onrA02
3E13X 1GR2A 3OO9A 1B3GA 2DWJA 2I3WA 2ZXTA 3KOSA 3VV5A 3OEMA 1LLSA 2OWSA 5HPQA 4NEDA 5I2NA 1ANFA 5F7VA 4F2OA 2DE2A 2P2AA 2X7PA 4LA9A 3K1MA 5FHMA 4O3BA 1KWHA 2ALUA 1WDNA 1P1NA 4OEVA 2B65A 1MXXA 1CB6A 5CBRA 4QFLA 1XVXA 2Z23A 2Q88A 4YAHX 4P0GA 3SEWA 4X1BA 2F8DA 1OLCA 2O68A 3H6UA 3VDFA 1LFHA 4FEDA 1GV8A 1B3LA 4FORA 3KN3A 3KSXA 2V3TA 1VSOA 4F3BA 1B0HA 4U4XA 1IUDA 3RPWA 2DXYA 2XXRA 4FAJA 1II5A 5JTYB 2XXUA 3TTMA 2OJTA 3WAEA 1MY4A 1SQYA 4DCYA 3D4CA 4QFPA 4C1UA 3PPOA 4G8HA 1FTOA 2QL3A 4YB7A 3MW0A 3K6WA 2Y7KA 1BP5A 4KYDA 3MP1A 3HN0A 4EXLA 4ELQA 1RYXA 5IKBA 1B3HA 5ITOA 2QSXA 2RCAA 3TTKA 4Q8RA 3LR1A 4R75A 4C0RA 4WEPA 4HW8A 1VFDA 3FATA 2UXAA 3I6VA 4BDMA 4R74A 4Q0CA 3U94A 2AL5A 1AL3A 3CG3A 1MM7A 3O6GA 2GH9A 3QIMA 1JEUA 1H43A 4G68B 2GHBA 5KZTA 2XXQA 3RN8A 3PD8A 2GHAA 1JVYA 4G77A 1B05A 3ECRA 1DPPA 1M5BA 5I58B 1T0KA 1MY2A 3MBPA 4KCCA 3EF7A 5F1QA 4ELOA 3OELA 3SKPA 1MY3A 5DEXB 1NH7A 3P7IA 5HM4B 2OK2A 4ONYA 4HCYA 1TWYA 3IR1A 4U1ZA 1OVTA 3KN8A 3G3FA 1P1OA 1OVBA 1Y1ZA 3RGYA 1MXWA 4PQJA 3PV0E 3PPNA 3LSWA 3FXQA 5DVIA 5J1DA 3M8UA 3KZGA 5BUUA 3LUYA 5H8FB 4POWA 1MRPA 1MQGA 1EH3A 1YCJA 5I2KA 1UTBB 3K02A 3KG2A 4GOTA 2RC8A 1USYE 5TPAA 1B5IA 3TZAA 4YB5A 2Q9TA 3C9HA 2DS9A 3PMXA 1Y3PA 4YKIA 2V93A 1IZ1A 3A3CA 4BDOA 3TELA 1A7LA 3DELB 3ONMA 5H8NA 1POY1 2I0BA 2QJEA 2QMWA 2XD3A 1B3EA 1I69A 5HBCA 2B3BA 1QKBA 1O63A 3ZS6A 1I6BA 4NF5A 1L5TA 2Y7IA 3F11A 4RPOA 2I3VA 5CRYA 1DMBA 1Y3NA 1MXUA 2R9JA 1URDA 4OMBA 3ILTB 2P1SA 1FQEA 1OLAA 1Y4TA 3BFTA 3HCQA 5JEIA 3V5AA 2DYXA 2G93A 1N0TA 1ZLQA 5L9OA 2PT1A 3QSLA 3EN3A 4NF4B 1CE2A 3RLFE 5AA2D 2XXXA 5I56A 4LVQA 3HSTA 3UK4A 3PPQA 4LP2B 3T96B 2P0SA 5L9MA 4LONB 2H25A 1QUKA 5M2VA 3IO6A 2ABHA 1IXIA 4IY6A 5H8QA 2H9BA 3DP6A 3FVGA 3FV2A 2PYYA 1JW4A 4DIGA 3MVXA 4JSDA 1R9QA 3IORA 1MQHA 3SETA 3ZSFA 1A99A 4F3SA 3V83A 3SEVA 2UVJA 1F9BA 2ZNUA 3FXUA 3RNNA 4P0IA 5KCJA 1XHYA 5DYHA 1UTHA 3FUZA 1M5EA 3SEUA 5ICTA 4GWOA 3PU5A 3CFZA 5H8HA 2Y84A 3BKIB 4NF6A 2ZNSA 3HHFA 3Q25A 4WKMA 4OETA 4H67A 3OENA 4ZECA 4UA8A 3IOUA 3QUFA 4KCDA 2V3UA 1US4A 3CFLA 1Z7NE 3T22A 3VFJA 2XXYA 4H8JA 3TPAA 4ISUA 3TQWA 2I6EA 4UACA 1B5JA 1ATGA 1B46A 1B6HA 1FW0A 4E0XA 4YICA 2F36A 1URSA 3HPIA 4YKPA 2VGQA 4ESWA 2QS4A 3Q29A 1OQGA 4XIGQ 2OZZA 1POTA 1JEVA 1N76A 1WODA 4JBZA 1RYOA 1SW2A 4EUOA 4LQ5A 1BLFA 3K1PA 2NWJA 4GLIA 3K4UA 4QHQA 4FEBA 3K00A 4DE8A 1SD3A 4YKKA 4IO2A 3H6TA 2Y7PA 3VVDA 1IEJA 2I58A 2V25A 4DXUA 3DP4A 4KFQA 4G8NA 1RKMA 3GBAA 3FXRA 4ZEIA 4X1DA 2VHAA 3EPEA 3QAXA 3LSFB 3QYTA 5KDTB 1H44A 4QSEA 4RK2A 1SVXB 1Y4CA 4NTLA 3S2VA 3S9LC 2DE3A 4U23A 2REGA 3IAZA 4LZ8A 2DVZA 1Y9UA 4U2RA 2E1SA 5L8DA 1MDP1 3IJXB 4YU0A 1P99A 1A55A 3RY3A 4WEDA 2QS1A 3FIRA 3VXCA 4DCXA 2QPQA 4NE4A 2HCAA 3MJNA 3IL1B 3MVZA 2R71A 3LBSA 2O1LA 3MWBA 2AL4A 3G3JA 3TTRA 3GBBA 3OXNA 4EQ9A 4NF8A 2RC9A 5FHOA 4JWXA 4RA1A 3T9UA 1O7TA 2RKMA 2UYEA 4LZ5A 1A40A 3C34A 1MH4A 4POXA 2CZLA 2RINA 1D3KA 3PD9A 2OWTA 2XXTA 2LAOA 2O7IA 1BKAA 4R9GA 5CMBA 2FNCA 2E0SA 4IGTA 1M5DA 4ND9A 1UQWA 1H76A 3S9NC 4PE5B 4OHNA 5ELVA 3MC2A 4U4SA 3MAMA 3VXBA 2F7AA 1UIUA 3I5OA 3PUWE 5AA4A 2NXOA 3OO6A 5JK4A 3U8QA 3T9XB 3RTFB 3W9WA 2H5YA 4ZEDA 1FQAA 1NL5A 1VR5A 1ZBMA 5K2XA 1AOVA 1MXVA 4PFUA 3T66A 1P1UA 2GRVA 1SW1A 3T93B 1SI1A 1PBQA 2A5TA 3HO7A 4IO6A 2F97A 3FJGA 2Y7WA 2I49A 3TTNA 4EF2A 4G68A 1Y20A 3B7DA 3IB0A 5A5XA 5EHSA 2O6AA 1EU8A 5H8SA 4M4GA 2A5SA 4RK9A 1VFEA 1B1HA 3PMVA 3PUZE 2XXPA 2F78A 2XXVA 4I8CA 2O84X 4KR5A 4IB2A 4ECFA 4OYVA 5TU0A 1A8EA 3FJMA 4FIMA 2BJJX 2OBGA 3D4GA 1JETA 1B5HA 1US5A 4QRZA 4BDNA 1B7ZA 2HAVA 3QK6A 4OTEA 3FV1A 4G8MA 5TP9A 1QW0A 1QVSA 5BWJA 2DP8A 2KLFA 1M5FA 4G4PA 2G29A 3G7WA 3EHUA 4OZ9A 3O9PA 3RT8A 4KHZE 2VP1A 2QMXA 1R6ZA 1HSJA 3OOAA 2IA4A 1BIYA 2XHDA 1FTJA 4F31B 4QSDA 4I1DA 2O1MA 1LAGE 4H65A 3O28A 2THIA 3TKDA 4R2BA 4ZEKA 3KOTA 5AA2A 1N7WA 1B1XA 2RC7A 3QUJA 3UA8A 1D4NA 4XKPA 3V8XB 1MPBA 5AA3A 3MPLA 4IGRA 1PBPA 4NMYA 2F7CA 1A54A 2XD2A 3SDFA 4GD5A 4H1XA 1LAHE 4BDQA 4TQUQ 1N7XA 4KD5A 1A8FA 4R6HA 3IO4A 3TQLA 3ZKLA 1D9YA 4FECA 1JVXA 2HAUA 3VVEA 4HS7A 1QJMA 4QF9A 2Z22A 1DPEA 4N13A 1FTMA 4L17A 1FCKA 2QS2A 4F1VA 4GQOA 1Y1MA 2XX9A 3MVYA 2QS3A 4ELPA 3UN6A 1LAFE 1LB9A 1HSLA 5I2KB 2Q8JA 3E9XA 3IOVA 4LUBA 2I4CA 1SYHA 2PMSA 4RYAA 1Q1KA 4H8IA 1PB9A 3T9VA 2Q89A 4OERA 4R6YA 1NH8A 4YKJA 1MY1A 2Z8FA 1D9VA 5CM6A 2XXWA 4BLAA 3L6HA 3K0VA 5EYFA 4KPTA 5H8NB 4AB5A 1FQDA 4R2FA 2H4IA 3MZBA 1EZ9A 2Y7RA 1PB8A 1MQJA 1H3DA 3VLVA 4NF5B 1MS7A 1MY0A 3KSJA 3FGSA 3TDJA 2ONSA 1MG1A 4JWOA 5CMCA 2DWHA 5CBSA 2M8CA 1B9JA 1MXZA 2FYIA 3H7MA 4R72A 3U92A 1IQ7A 3S9MC 5AE4A 2I48A 5CI5A 5FTHA 1TT1A 2I4BA 3PMWA 4HTGA 2VD3A 3G3HA 3MZ1A 4X9TA 3C33A 5DTBA 4ZE9A 3OO8A 1HSEA 2F35A 4IO3A 4K3FA 1SBPA 3KFMA 5I56B 1XC1A 1NNKA 4ELRA 1NMUA 3CR9A 3RTWB 4KI0E 3PUXE 3H3GA 4ZE8A 4ZS9A 4QFOA 2UVHA 3IOTA 5H8QB 4R73A 2H98A 3KGCA 3FD3A 4GF8A 4PFTA 4F39A 3H06B 1TXFA 3TCHA 2QRYA 1QUIA 3O2AA 4ZEBA 4WXJA 4GXSB 1USYH 1Q35A 4MLQA 5KCJB 3FJ7A 4O3CA 3W15C 1UTHB 1MQDA 2HQ0A 2V84A 3MQ9A 1MXYA 4R6KA 1SW4A 2XXHA 4G2ZA 1B4HA 3UORA 3C32A 3CRBA 5CMMA 5H8HB 4NF6B 1EZPA 4XKNA 4E0WA 3PUYE 4THIA 2O7UA 3DP8A 1JW5A 3IK6B 3RQTA 3G3IA 1B58A 5CMKA 2GFEA 4JWYA 2RF1A 1N04A 3U1OA 4F29A 3RT6B 1NFTA 2D3IA 4EQ7A 4OFLA 4OQOA 3IX1A 1NNTA 2O69A 3TTLA 2V3QA 4OEUA 3WAFA 1GTKA 3GXAA 1P1QA 3U72A 5ITPA 1IITA 3THIA 1S7YA 4Z7EA 4IY5A 5AA1A 3KJTA 3GZGA 5I59A 3M3LA 2ONRA 5DVJA 4QFKA 1LBCA 1N3XA 3MP8A 1BTJA 3MP6A 4F3PA 2DE4A 1LFIA 2DSFA 3KEIA 3O6HA 4KYEA 4DXCA 4GFRA 4RJZA 3H6WA 1LFGA 2REJA 4LZ7A 5ICQA 2VOZA 1YAEA 3C35A 3PPRA 4I62A 3TCFA 1XS5A 3TCGA 3EHTA 3G3GA 1IXHA 1LAXA 1B3FA 2HFBA 1MPDA 4XKQA 3OSQA 4IO5A 3R7XA 4QFNA 2ZYMA 4DDDA 3OO7A 3UIFA 1UIVA 1O64A 3MPKA 1I6QA 2HZLA 4LQ2A 4DLDA 3O6IA 5JTYA 3H4ZA 4G68C 2F5XA 3B6TA 4MFIA 3N94A 3PUVE 4Q30B 5I57B 5LOMA 1TFAA 3IB1A 1MDQA 2OLBA 2I0CA 4GXAA 3H03A 3N6TA 2HXWA 1M5CA 4MH5A 4YZZA 2DOJA 1ZKBA 1DTZA 4NF8B 4IO4A 3DM0A 3TAJA 3CSGA 3HHGA 4F22A 5I2NB 3JZJA 1LGBC 2RCBA 3KBRA 4GIZA 2DXRA 4KYSA 3Q26A 3I3VA 4ESXA 1MPCA 3ILUB 2X26A 4EDPA 3K6VA 3H6VA 5L9SA 3VVFA 3K6XA 1Z7ME 4JSOA 2AIXA 4XXUA 3S9EA 4F2QA 1XT8A 1NKXA 1S9TA 4JXIA 5AA4B 3SERA 3OSRA 2UVIA 5I58A 3USDA 1B40A 4OENA 5DEXA 4MBPA 5IAIA 3CG1A 4GVOA 1IXGA 3S4UA 4M1VA 4R9FA 2FA7A 2YLNA 3LSLA 3IJOB 4JDFA 2XX8A 4GRKA 1B32A 1FQFA 4X48A 1SDXA 2R6GE 3E3KA 1P1WA 2A5TB 2PVUA 3IOWA 3W9VA 2Q2CA 5H8FA 3EQ1A 1UTBA 3U93A 2OCUA 5A5XB 1ZU0A 3O97A 3FASA 3N6UA 4F1UA 3EHSA 2D5WA 4JB7A 2Z8DA 2HZKA 2NVUB 2X7QA 1SI0A 4NWDA 1AMFA 3RUMA 3SESA 1IIWA 1QKAA 5B70A 3CI8A 3A09A 4LATA 3UP9A 4GL8A 3K2DA 4F3GA 2F6GA 4N07A 4Q5TA 4FE8A 4H6DA 1FTLA 1B51A 4MLVA 3MUQA 4DXBA 1OMPA 3C36A 4IO7A 2UYFA 4OFOA 5TP9B 3KN7A 1EZOA 2PX1A 3FVKA 3BFUA 1LCFA 3N26A 4OVJA 4U21A 4DZ1A 2XX7A 4OESA 3OEKA 3MVWA 2DVCA 4NF4A 4TLMB 3DLNA 4F19A 3O29A 1GVCA 4OWDA 3N5LA 2DQVA 4U1OA 3R26A 1NNFA 4F18A 4OFJA 5AA2B 3ODBA 2ESNA 4I9DA 2ZYOA 3SEYA 5TPAB 4EF1A 2XXIA 3CIJA 2VD2A 4XKRA 3G3KA 4Z0IA 1B7UA 1JW1A 3TFLA 4RY1A 4BDLA 1VE4A 3BBRA 4RNSA 2ZYNA 3OD7A 1PDAA 2DWAA 4GL0A 3V89B 3K6UA 1NNPA 1J1NA 2AYSA 4AB6A 1SYIA 4HCWA 4BDRA 3FVNA 4U22A 1PC3A 1S50A 1MH3A 1XVYA 4PFWA 2F6PA 1AH5A 3CSBA 3QXMA 4QSCA 1B52A 1YPNA 4FATA 3Q27A 5K2YA 5FTIA 3OMBA 2D21A 3M3FA 1N84A 3ZKKA 3FZVA 3TODA 2Q2AA 1URGA 1B4ZA 3A3UA 1DSNA 2F34A 4EQBA 2YJPA 1ZIUA 3KJ7A 1MM6A 4TLLB 1PEBA 3L6GA 4ZEFA 4N6PA 5EHMA 4PP0A 2ZNTA 3TEPA 1LBBA 3T9HB 1LCTA 5DT6A 1H45A 2O51A 1Y3QA 1N3WA 3LC8A 1DOTA 4ZZAA 2B3FA 4YMAA 1QULA 1I6AA 2CMOA 3LSXA 1GGGA 3SEXA 3R6UA 5I84A 1SW5A 2PT2A 2IEEA 1ZJLA 5CC2A 1PB7A 1JQFA 1IXCA 1FQCA 1AIVA 2ONKE 3CFXA 2ZYKA 4RXLA 1B0LA 3MZ9A 5KDTA 1DTGA 4FJPA 1ZTYA 3C31A 4XTCQ 2NUVA 3AXFA 3JV9A 5ISUA 3IB2A 3UGWA 4O3AA 2NOOA 3K1NA 1R1NA 2F7BA 1OIBA 2DWIA 1JNFA 2PBWA 3HV1A 4ZDMA 3CVGA 2WKYA 3TMGA 3FVOA 3PPPA 5B7DA 3E4RA 4F1YA 2YPNA 4ZZEA 3GLBA 4P11A 2Z8EA 3C4MA 4NWCA 4YMBA 4H0WA 4PFYA 3VE1B 4EXKA 2HEUA 3Q28A 3B6QA 4AQ4A 4H5FA 4PETA 1YTVA 1B7HA 1LSTA 3K01A 4MF3A 2ZMBA 1ZMGA 3O66A 3PGFA 1ELJA 5FHNA 1QUJA 1FQBA 1MQIA 1OQHA 1XOCA 2UVGA 3VLUA 1B2HA 3TUSA 3M3KA 2W7YA 4TOZA 5DVFA 4OXVA 3B6WA 1LB8A 4RPNA 3TYHA 3VLWA 2ANJA 3JYRA 1R9LA 4C1TA 1FTKA 2H99A 1TFDA 5I57A 1WVJA 4YB6A 4H5GA 4KQPA 5I59B
chains in the Genus database with same CATH superfamily
3E13X 1GR2A 3OO9A 1B3GA 2DWJA 4PAKA 2I3WA 2ZXTA 3KOSA 3VV5A 4GWYA 3OEMA 1LLSA 2OWSA 3IFCA 3ISPA 5HPQA 4NEDA 5I2NA 1ANFA 5F7VA 4F2OA 2DE2A 4IR8A 2P2AA 2X7PA 4LA9A 3K1MA 5FHMA 4O3BA 1KWHA 2ALUA 1WDNA 1P1NA 4OEVA 1FPGA 5IZZA 2B65A 1MXXA 1FPEA 1CB6A 5CBRA 4QFLA 1XVXA 2Z23A 2Q88A 4YAHX 4P0GA 3SEWA 4X1BA 2F8DA 1OLCA 2O68A 3H6UA 3VDFA 1LFHA 4FEDA 1GV8A 1YYZA 1FBFA 1B3LA 2GQ1A 4FORA 3KN3A 3KSXA 2V3TA 1VSOA 4F3BA 2P3VA 1B0HA 4U4XA 1IUDA 5J16A 3RPWA 4GBWA 2DXYA 4QBAA 2XXRA 4FAJA 4MCOA 1II5A 5JTYB 2XXUA 3TTMA 2OJTA 3WAEA 1MY4A 1SQYA 4DCYA 3D4CA 4QFPA 4NX1A 4C1UA 3PPOA 4G8HA 1FTOA 1LEVA 2QL3A 4YB7A 3MW0A 3K6WA 2Y7KA 4MX6A 1BP5A 4KYDA 3MP1A 3HN0A 4EXLA 4H46A 4ELQA 1RYXA 1DCUA 5IKBA 1B3HA 5ITOA 2QSXA 4OA4A 2RCAA 4N6KA 3TTKA 4Q8RA 3LR1A 4R75A 4C0RA 5EQ9A 1LBVA 2JJKA 4WEPA 4HW8A 2QVVA 1VFDA 3FATA 1EYIA 2UXAA 3I6VA 4BDMA 4R74A 4Q0CA 3U94A 2AL5A 1AL3A 3CG3A 4JVDA 1MM7A 3O6GA 3HFUA 3LV0A 2GH9A 1NV4A 3QIMA 1JEUA 1H43A 4G68B 2GHBA 5KZTA 2XXQA 3RN8A 3PD8A 1EYJA 2GHAA 1JVYA 3IFAA 4G77A 1B05A 3ECRA 1DPPA 1M5BA 2QVUA 5I58B 1T0KA 1MY2A 2XWKA 3MBPA 1XI6A 4KCCA 3EF7A 5F1QA 4ELOA 3OELA 4N4UA 3SKPA 1MY3A 5DEXB 1NH7A 3P7IA 5HM4B 2OK2A 4ONYA 4HCYA 1TWYA 3IR1A 4U1ZA 1OVTA 3KN8A 3G3FA 1P1OA 1OVBA 1Y1ZA 1NUXA 3RGYA 1MXWA 4PQJA 3PV0E 3PPNA 3LSWA 3FXQA 3MSTA 5DVIA 5J1DA 3M8UA 3KZGA 5BUUA 3LUYA 5H8FB 1JP4A 4POWA 1MRPA 1MQGA 1EH3A 1YCJA 4PAFA 5I2KA 1UTBB 3K02A 3KG2A 4GOTA 2RC8A 1USYE 5TPAA 1B5IA 3TZAA 4YB5A 2Q9TA 4MNCA 1IMBA 4P1LA 3C9HA 2DS9A 3PMXA 1Y3PA 4YKIA 2V93A 1IZ1A 3A3CA 4BDOA 1IMAA 3TELA 1A7LA 3DELB 3ONMA 5H8NA 3A29A 1POY1 2I0BA 2QJEA 2QMWA 2XD3A 1B3EA 3KBZA 1I69A 2WBDA 5HBCA 2B3BA 3ROJA 1QKBA 1O63A 3ZS6A 1I6BA 2WEFA 4NF5A 1L5TA 2Y7IA 3F11A 4RPOA 2I3VA 5CRYA 5I7IA 1DMBA 1Y3NA 1MXUA 2R9JA 1URDA 4OMBA 3ILTB 2P1SA 1FQEA 1OLAA 1Y4TA 3BFTA 3HCQA 2WYKA 5JEIA 3V5AA 2DYXA 2G93A 1N0TA 1ZLQA 5L9OA 2PT1A 3QSLA 3EN3A 4NF4B 1CE2A 3RLFE 5AA2D 2VPOA 2XXXA 3PTYA 4MEVA 5EQ7A 5I56A 4LVQA 3HSTA 3UK4A 3PPQA 1QGXA 4LP2B 3T96B 2P0SA 5L9MA 5IZ1A 4LONB 2H25A 1QUKA 5M2VA 1FBDA 3IO6A 2ABHA 1IXIA 4IY6A 1NV3A 5H8QA 1RDZA 2HHMA 2H9BA 3DP6A 3FVGA 3FV2A 2PYYA 4N15A 1JW4A 4HE1A 4DIGA 3MVXA 4JSDA 1CNQA 1R9QA 3IORA 1MQHA 3SETA 3ZSFA 1A99A 3RYDA 2MKZA 4F3SA 3V83A 3SEVA 2UVJA 1F9BA 2ZNUA 3FXUA 3RNNA 3NOHA 4P0IA 5KCJA 1XHYA 5DYHA 1UTHA 3FUZA 2QFLA 1M5EA 3SEUA 5ICTA 1IMCA 4GWOA 3PU5A 3CFZA 5H8HA 4PF8A 2Y84A 3BKIB 4NF6A 2ZNSA 3HHFA 3Q25A 4WKMA 4OETA 4H67A 3OENA 4ZECA 4UA8A 1NUYA 3IOUA 4N8YA 3QUFA 4KCDA 2V3UA 1US4A 4JVCA 3CFLA 1Z7NE 3T22A 3VFJA 2XXYA 4H8JA 3TPAA 4ISUA 3TQWA 2I6EA 4UACA 1B5JA 1ATGA 1B46A 1B6HA 4PC9A 4H45A 1FW0A 4E0XA 4YICA 2F36A 4N6DA 1URSA 1G0IA 5EYGA 3HPIA 4GWWA 4YKPA 2VGQA 4ESWA 2QS4A 3Q29A 1OQGA 4XIGQ 2OZZA 1POTA 1JEVA 1N76A 1WODA 1NV0A 4JBZA 1RYOA 1SW2A 4EUOA 4LQ5A 1BLFA 3K1PA 2NWJA 4GLIA 3K4UA 4QHQA 4FEBA 4O94A 3K00A 4DE8A 1SD3A 4AS4A 4OVSA 4YKKA 4IO2A 3H6TA 2Y7PA 4G61A 3VVDA 1IEJA 2I58A 2V25A 4DXUA 5F24A 5IZ3B 3DP4A 4KFQA 4G8NA 1RKMA 3GBAA 5ESYA 3FXRA 4ZEIA 4X1DA 2VHAA 3EPEA 3QAXA 1RDYA 3LSFB 3QYTA 5KDTB 1H44A 4X8RA 2F3DA 4QSEA 4RK2A 1SVXB 1Y4CA 5A5LA 4NTLA 1K9ZA 3S2VA 4PCDA 1FPJA 3S9LC 4PFIA 1LBXA 2DE3A 4U23A 2REGA 2PFZA 3IAZA 4LZ8A 2DVZA 1Y9UA 4U2RA 2E1SA 5L8DA 1MDP1 3IJXB 4YU0A 1P99A 1A55A 3RY3A 4WEDA 2QS1A 3FIRA 3VXCA 4DCXA 2QPQA 4NE4A 4O7MA 2HCAA 3MJNA 3IL1B 3MVZA 1NV7A 3BIHA 2R71A 3LBSA 2O1LA 3E78A 3MWBA 4KXPA 5LDZA 2AL4A 3G3JA 3TTRA 3GBBA 3OXNA 4EQ9A 4NF8A 2RC9A 5FHOA 4JWXA 4RA1A 4X04A 3T9UA 5I5PA 1O7TA 2Q8MA 2RKMA 3KC0A 2UYEA 4LZ5A 2ZZWA 1A40A 3CHGA 3C34A 1MH4A 4POXA 2CZLA 2RINA 1D3KA 3PD9A 2OWTA 2XXTA 2LAOA 2HPGA 2O7IA 1BKAA 4R9GA 5CMBA 2FNCA 2E0SA 4IGTA 1M5DA 1FPBA 4ND9A 1UQWA 1IMDA 4PFRA 1H76A 3S9NC 2R8TA 4PE5B 4OHNA 4GWSA 5ELVA 3MC2A 4U4SA 3MAMA 3VXBA 2F7AA 1UIUA 3I5OA 3PUWE 5AA4A 2NXOA 3OO6A 5JK4A 3U8QA 3T9XB 3RTFB 3W9WA 2H5YA 4ZEDA 1FQAA 5EYHA 1NL5A 4I40A 1VR5A 1ZBMA 5K2XA 1AOVA 1MXVA 4PFUA 1P1UA 3T66A 2GRVA 1SW1A 1RDXA 5IGAA 1YZ0A 4FBPA 5ET8A 3T93B 1SI1A 1PBQA 2A5TA 3HO7A 4IO6A 2Y5LA 2F97A 4MNIA 5IM2A 4NGUA 3FJGA 2Y7WA 4NHBA 2I49A 3TTNA 4EF2A 4G68A 1Y20A 3B7DA 3IB0A 5A5XA 5EHSA 2O6AA 3EKIA 1EU8A 1FBEA 1FBPA 1NV1A 5H8SA 4M4GA 2A5SA 4RK9A 4I3EA 1VFEA 1B1HA 3PMVA 3PUZE 2XXPA 2F78A 2XXVA 4I8CA 2O84X 4KR5A 4IB2A 4ECFA 4OYVA 5TU0A 1A8EA 3FJMA 4FIMA 2BJJX 2OBGA 3D4GA 3T1BA 4LN5A 1JETA 1B5HA 1US5A 4QRZA 4BDNA 1SPIA 1B7ZA 2HAVA 3QK6A 4OTEA 1LBWA 3FV1A 1AWBA 1K9YA 5EQ8A 4PDDA 4G8MA 5TP9A 1QW0A 1QVSA 5BWJA 2DP8A 2KLFA 1M5FA 4G4PA 2G29A 3G7WA 3EHUA 4OZ9A 3O9PA 3RT8A 4KHZE 2XWVA 4XFEA 2VP1A 2QMXA 1R6ZA 1HSJA 3OOAA 2IA4A 2XWIA 4PGPA 1BIYA 2PFYA 2XHDA 4GBVA 4GWUA 1FTJA 4F31B 4QSDA 4I1DA 2O1MA 1LAGE 4H65A 3O28A 2THIA 3TKDA 4R2BA 4I3YA 4ZEKA 3KOTA 5AA2A 1N7WA 1B1XA 1KA0A 2RC7A 3FXBA 3QUJA 1D4NA 4XKPA 3UA8A 3V8XB 1MPBA 5AA3A 1VDWA 3MPLA 4IGRA 1PBPA 4NMYA 4PTKA 2F7CA 1A54A 2XD2A 3SDFA 4GD5A 4H1XA 1LAHE 2QVRA 4BDQA 4TQUQ 1N7XA 4KD5A 1A8FA 4R6HA 2XXKA 4GX4A 3IO4A 1FBHA 3TQLA 3ZKLA 1D9YA 4FECA 1JVXA 2HAUA 3VVEA 4HS7A 1QJMA 4AS5A 1INPA 4QF9A 2OX3A 2Z22A 1DPEA 4N13A 1FJ6A 1FTMA 4L17A 1FCKA 2QS2A 4F1VA 4GQOA 1Y1MA 4OVTA 2XX9A 3MVYA 2QS3A 4ELPA 3UN6A 5LTCA 1LAFE 1LB9A 1HSLA 5I2KB 2Q8JA 3E9XA 3IOVA 4LUBA 3FBPA 4NAPA 2I4CA 1SYHA 2PMSA 4RYAA 1Q1KA 4H8IA 1PB9A 3T9VA 2Q89A 4OERA 4R6YA 1NH8A 2FIEA 3B8BA 4YKJA 1MY1A 2Z8FA 1D9VA 5CM6A 2XXWA 4BLAA 3L6HA 3K0VA 5EYFA 4KPTA 5H8NB 4AB5A 1FQDA 4R2FA 2H4IA 3MZBA 1EZ9A 3B50A 2Y7RA 1PB8A 4N81A 1MQJA 1H3DA 2KQZA 3VLVA 4NF5B 1MS7A 1MY0A 3KSJA 3FGSA 2CZIA 3TDJA 2ONSA 1MG1A 4JWOA 3BIGA 2DWHA 5CMCA 5CBSA 2M8CA 1B9JA 1MXZA 2FYIA 3H7MA 4N17A 4R72A 3U92A 1IQ7A 3S9MC 5AE4A 2I48A 5CI5A 5FTHA 1TT1A 2I4BA 3PMWA 4HTGA 2VD3A 3G3HA 3MZ1A 4X9TA 3C33A 3U65A 5DTBA 4ZE9A 2FVZA 3OO8A 1HSEA 2F35A 4IO3A 4K3FA 2DDKA 4P8BA 1SBPA 3KFMA 5I56B 1XC1A 2CZKA 1NNKA 4ELRA 4PFBA 1NMUA 3CR9A 3RTWB 4KI0E 3PUXE 3H3GA 3KC1A 4ZE8A 4ZS9A 1FPKA 4QFOA 2UVHA 3IOTA 5H8QB 4R73A 2H98A 3KGCA 3FD3A 4GF8A 2VT5A 4PFTA 4F39A 3H06B 1TXFA 3TCHA 2QRYA 5FBPA 1QUIA 3O2AA 4ZEBA 4WXJA 3MYUA 4GXSB 1USYH 1Q35A 4MLQA 5KCJB 3FJ7A 4O3CA 3W15C 1UTHB 4XEQA 1MQDA 2HQ0A 1NV2A 2V84A 3MQ9A 4NQ8A 1MXYA 4R6KA 4P3LA 1SW4A 2XXHA 4G2ZA 1B4HA 3UORA 3C32A 3CRBA 5CMMA 5H8HB 4NF6B 1EZPA 4XKNA 4E0WA 3PUYE 4THIA 2O7UA 3DP8A 4JVIA 1DBZA 1JW5A 3IK6B 3RQTA 3G3IA 1B58A 2ZZVA 2F3BA 5CMKA 2GFEA 4JWYA 2RF1A 1N04A 3U1OA 4F29A 3RT6B 1NFTA 2D3IA 4EQ7A 4OFLA 4OQOA 3IX1A 1NNTA 2O69A 3TTLA 2V3QA 3RPLB 4PBQA 4OEUA 3WAFA 1GTKA 3GXAA 1P1QA 3U72A 5ITPA 1IITA 3THIA 1YXIA 1S7YA 2FIXA 4Z7EA 4IY5A 2HXRA 5AA1A 3KJTA 3GZGA 5I59A 3M3LA 1FBCA 2ONRA 5DVJA 4QFKA 1LBCA 1N3XA 3MP8A 1BTJA 3MP6A 4F3PA 2DE4A 2OWZA 1LFIA 2DSFA 2P3NA 3KEIA 3O6HA 4KYEA 4DXCA 4GFRA 4RJZA 3H6WA 1LFGA 2REJA 4LZ7A 5ICQA 4GWXA 1DK4A 2VOZA 1YAEA 3C35A 3PPRA 4I62A 3TCFA 1XS5A 3TCGA 3EHTA 3G3GA 2Q74A 1IXHA 3GYYA 1LAXA 5ET5A 1B3FA 2HFBA 1MPDA 4XKQA 3OSQA 4IO5A 3R7XA 1FPFA 4QFNA 2ZYMA 4DDDA 2VPNA 3OO7A 3UIFA 1UIVA 1O64A 4LQ2A 3MPKA 1I6QA 2HZLA 4DLDA 3O6IA 5JTYA 3H4ZA 4MAGA 4G68C 2F5XA 3B6TA 4MFIA 3N94A 3PUVE 4Q30B 4N8GA 5I57B 5LOMA 1TFAA 3IB1A 1MDQA 2OLBA 4P9KA 4NN3A 3SZPA 1FPLA 2I0CA 4GXAA 3H03A 3N6TA 2HXWA 1M5CA 4MH5A 4YZZA 2DOJA 1ZKBA 1DTZA 4NF8B 4IO4A 3DM0A 3TAJA 3CSGA 3HHGA 4F22A 5I2NB 3JZJA 2BJIA 1LGBC 2RCBA 3KBRA 4GIZA 1NUWA 2DXRA 4KYSA 3Q26A 3I3VA 1KZ8A 4P1EA 4ESXA 4QXDA 1MPCA 3ILUB 2X26A 4EDPA 3K6VA 3H6VA 5L9SA 3VVFA 3K6XA 1Z7ME 4JSOA 2AIXA 4XXUA 3S9EA 4F2QA 1XT8A 1NKXA 1S9TA 4JXIA 5AA4B 3D1RA 3SERA 3OSRA 2UVIA 5I58A 3USDA 1B40A 1NUZA 4PE3A 4OENA 1FPDA 5DEXA 1D9QA 2XA5A 4MBPA 5IAIA 3CG1A 4GVOA 1IXGA 3S4UA 4M1VA 1FPIA 4MMPA 4R9FA 2FA7A 2YLNA 3LSLA 3IJOB 4JDFA 2XX8A 4GRKA 1B32A 1FQFA 4X48A 1SDXA 4OVRA 2R6GE 3E3KA 1P1WA 2A5TB 4DI4B 4GX3A 2PVUA 1NV5A 3IOWA 4XF5A 1IMEA 3W9VA 2Q2CA 5H8FA 4HXVA 3EQ1A 1UTBA 3U93A 1Q9DA 2OCUA 5A5XB 1ZU0A 3O97A 3FASA 4P56A 3N6UA 4F1UA 3EHSA 2D5WA 4JB7A 2Z8DA 2HZKA 2PCRA 4PF6A 2NVUB 2X7QA 1SI0A 3E79A 4NWDA 1NV6A 1AMFA 3RUMA 3SESA 1IIWA 1QKAA 5B70A 3CI8A 5ET7A 3A09A 4LATA 3UP9A 4GL8A 3K2DA 4F3GA 2F6GA 4N07A 4Q5TA 4DI3D 4FE8A 4H6DA 2L5VA 1FTLA 1B51A 4MLVA 3MUQA 4DXBA 1OMPA 3C36A 4IO7A 2UYFA 4OFOA 5TP9B 3KN7A 1EZOA 2PX1A 3FVKA 3BFUA 4NF0A 1LCFA 3N26A 4OVJA 1KA1A 4U21A 1G0HA 4DZ1A 2XX7A 4OESA 3OEKA 3MVWA 1FJ9A 2DVCA 4NF4A 4TLMB 3DLNA 4F19A 3O29A 1FRPA 1GVCA 4OWDA 3N5LA 2DQVA 2V4CA 4PBHA 3R26A 1NNFA 4PDHA 4P47A 4U1OA 2CEYA 4F18A 1FTAA 2WYPA 4OFJA 5AA2B 3ODBA 2KR0A 1IMFA 1BK4A 2ESNA 4I9DA 2ZYOA 3SEYA 5TPAB 4EF1A 2XXIA 4GX6A 3CIJA 2VD2A 4XKRA 3G3KA 4Z0IA 1B7UA 1JW1A 4MIJA 3TFLA 1FSAA 4RY1A 4BDLA 1VE4A 3BBRA 4RNSA 2ZYNA 3OD7A 1PDAA 2DWAA 2WX9A 4GL0A 3V89B 3K6UA 1NNPA 1J1NA 1LBZA 2ZZXA 2AYSA 4AB6A 1SYIA 4HE0A 4HCWA 4BDRA 3FVNA 4U22A 4N91A 1PC3A 4HE2A 4OVPA 1S50A 1MH3A 1XVYA 4PFWA 2F6PA 1AH5A 3CSBA 3QXMA 4QSCA 1B52A 1YPNA 4FATA 3Q27A 3T0JA 5K2YA 5FTIA 3OMBA 2D21A 3M3FA 1N84A 3ZKKA 3FZVA 3TODA 2Q2AA 1URGA 1B4ZA 3A3UA 4MNPA 1DSNA 2F34A 4EQBA 2YJPA 1EYKA 1ZIUA 3KJ7A 1MM6A 4TLLB 1PEBA 3QMFA 3L6GA 4ZEFA 3LUZA 4N6PA 5EHMA 4PP0A 2ZNTA 4PGNA 3TEPA 1LBBA 3T9HB 4MHFA 1LCTA 5DT6A 4NG7A 1H45A 5DW8A 2O51A 1Y3QA 1N3WA 3LC8A 1DOTA 4ZZAA 2B3FA 4YMAA 1QULA 1I6AA 2CMOA 3LSXA 1GGGA 4GWZA 3SEXA 3R6UA 4O8MA 5I84A 1SW5A 2PT2A 2IEEA 1ZJLA 5CC2A 2XWOA 1PB7A 1JQFA 1IXCA 1FQCA 3RPLA 1AIVA 5IZ3A 2ONKE 3CFXA 5EQAA 2ZYKA 4RXLA 1B0LA 3MZ9A 5KDTA 1DTGA 1NI9A 4FJPA 2WBBA 1ZTYA 3C31A 4XTCQ 5I3SA 2NUVA 3AXFA 3JV9A 5ISUA 3IB2A 3UGWA 4O3AA 2NOOA 3K1NA 1LBYA 1R1NA 2F7BA 1OIBA 2DWIA 5ET6A 1JNFA 5T3JA 2PBWA 3HV1A 4ZDMA 3CVGA 2WKYA 3TMGA 3FVOA 3PPPA 5B7DA 3E4RA 2FHYA 2Y5KA 4F1YA 2YPNA 4ZZEA 3GLBA 2B4MA 4P11A 2Z8EA 3C4MA 4NWCA 4YMBA 4H0WA 4PFYA 3VE1B 4UABA 4EXKA 2HEUA 3Q28A 4MJOA 3B6QA 4AQ4A 4H5FA 4PETA 1YTVA 1B7HA 1LSTA 3K01A 4MF3A 2ZMBA 1ZMGA 3O66A 3PGFA 1ELJA 5FHNA 1QUJA 1FQBA 1MQIA 1OQHA 2B4LA 1XOCA 2UVGA 3VLUA 1B2HA 3TUSA 2CEXA 4O7IA 3M3KA 4PAIA 2W7YA 4TOZA 5DVFA 4OXVA 3B6WA 2CZHA 1LB8A 4RPNA 1FBGA 3TYHA 3VLWA 2ANJA 3JYRA 1R9LA 4C1TA 1FTKA 2H99A 1TFDA 5I57A 1WVJA 2FBPA 4YB6A 4OANA 4H5GA 4KQPA 5I59B 4OVQA
chains in the Genus database with same CATH topology
3E13X 1GR2A 3OO9A 1B3GA 2DWJA 2I3WA 2ZXTA 3KOSA 3VV5A 3OEMA 1LLSA 2OWSA 5HPQA 4NEDA 5I2NA 1ANFA 5F7VA 4F2OA 2DE2A 2P2AA 2X7PA 4LA9A 3K1MA 5FHMA 4O3BA 1KWHA 2ALUA 1WDNA 1P1NA 4OEVA 2B65A 1MXXA 1CB6A 5CBRA 4QFLA 1XVXA 2Z23A 2Q88A 4YAHX 4P0GA 3SEWA 4X1BA 2F8DA 1OLCA 2O68A 3H6UA 3VDFA 1LFHA 4FEDA 1GV8A 1B3LA 4FORA 3KN3A 3KSXA 2V3TA 1VSOA 4F3BA 1B0HA 4U4XA 1IUDA 3RPWA 2DXYA 2XXRA 4FAJA 1II5A 5JTYB 2XXUA 3TTMA 2OJTA 3WAEA 1MY4A 1SQYA 4DCYA 3D4CA 4QFPA 4C1UA 3PPOA 4G8HA 1FTOA 2QL3A 4YB7A 3MW0A 3K6WA 2Y7KA 1BP5A 4KYDA 3MP1A 3HN0A 4EXLA 4ELQA 1RYXA 5IKBA 1B3HA 5ITOA 2QSXA 2RCAA 3TTKA 4Q8RA 3LR1A 4R75A 4C0RA 4WEPA 4HW8A 1VFDA 3FATA 2UXAA 3I6VA 4BDMA 4R74A 4Q0CA 3U94A 2AL5A 1AL3A 3CG3A 1MM7A 3O6GA 2GH9A 3QIMA 1JEUA 1H43A 4G68B 2GHBA 5KZTA 2XXQA 3RN8A 3PD8A 2GHAA 1JVYA 4G77A 1B05A 3ECRA 1DPPA 1M5BA 5I58B 1T0KA 1MY2A 3MBPA 4KCCA 3EF7A 5F1QA 4ELOA 3OELA 3SKPA 1MY3A 5DEXB 1NH7A 3P7IA 5HM4B 2OK2A 4ONYA 4HCYA 1TWYA 3IR1A 4U1ZA 1OVTA 3KN8A 3G3FA 1P1OA 1OVBA 1Y1ZA 3RGYA 1MXWA 4PQJA 3PV0E 3PPNA 3LSWA 3FXQA 5DVIA 5J1DA 3M8UA 3KZGA 5BUUA 3LUYA 5H8FB 4POWA 1MRPA 1MQGA 1EH3A 1YCJA 5I2KA 1UTBB 3K02A 3KG2A 4GOTA 2RC8A 1USYE 5TPAA 1B5IA 3TZAA 4YB5A 2Q9TA 3C9HA 2DS9A 3PMXA 1Y3PA 4YKIA 2V93A 1IZ1A 3A3CA 4BDOA 3TELA 1A7LA 3DELB 3ONMA 5H8NA 1POY1 2I0BA 2QJEA 2QMWA 2XD3A 1B3EA 1I69A 5HBCA 2B3BA 1QKBA 1O63A 3ZS6A 1I6BA 4NF5A 1L5TA 2Y7IA 3F11A 4RPOA 2I3VA 5CRYA 1DMBA 1Y3NA 1MXUA 2R9JA 1URDA 4OMBA 3ILTB 2P1SA 1FQEA 1OLAA 1Y4TA 3BFTA 3HCQA 5JEIA 3V5AA 2DYXA 2G93A 1N0TA 1ZLQA 5L9OA 2PT1A 3QSLA 3EN3A 4NF4B 1CE2A 3RLFE 5AA2D 2XXXA 5I56A 4LVQA 3HSTA 3UK4A 3PPQA 4LP2B 3T96B 2P0SA 5L9MA 4LONB 2H25A 1QUKA 5M2VA 3IO6A 2ABHA 1IXIA 4IY6A 5H8QA 2H9BA 3DP6A 3FVGA 3FV2A 2PYYA 1JW4A 4DIGA 3MVXA 4JSDA 1R9QA 3IORA 1MQHA 3SETA 3ZSFA 1A99A 4F3SA 3V83A 3SEVA 2UVJA 1F9BA 2ZNUA 3FXUA 3RNNA 4P0IA 5KCJA 1XHYA 5DYHA 1UTHA 3FUZA 1M5EA 3SEUA 5ICTA 4GWOA 3PU5A 3CFZA 5H8HA 2Y84A 3BKIB 4NF6A 2ZNSA 3HHFA 3Q25A 4WKMA 4OETA 4H67A 3OENA 4ZECA 4UA8A 3IOUA 3QUFA 4KCDA 2V3UA 1US4A 3CFLA 1Z7NE 3T22A 3VFJA 2XXYA 4H8JA 3TPAA 4ISUA 3TQWA 2I6EA 4UACA 1B5JA 1ATGA 1B46A 1B6HA 1FW0A 4E0XA 4YICA 2F36A 1URSA 3HPIA 4YKPA 2VGQA 4ESWA 2QS4A 3Q29A 1OQGA 4XIGQ 2OZZA 1POTA 1JEVA 1N76A 1WODA 4JBZA 1RYOA 1SW2A 4EUOA 4LQ5A 1BLFA 3K1PA 2NWJA 4GLIA 3K4UA 4QHQA 4FEBA 3K00A 4DE8A 1SD3A 4YKKA 4IO2A 3H6TA 2Y7PA 3VVDA 1IEJA 2I58A 2V25A 4DXUA 3DP4A 4KFQA 4G8NA 1RKMA 3GBAA 3FXRA 4ZEIA 4X1DA 2VHAA 3EPEA 3QAXA 3LSFB 3QYTA 5KDTB 1H44A 4QSEA 4RK2A 1SVXB 1Y4CA 4NTLA 3S2VA 3S9LC 2DE3A 4U23A 2REGA 3IAZA 4LZ8A 2DVZA 1Y9UA 4U2RA 2E1SA 5L8DA 1MDP1 3IJXB 4YU0A 1P99A 1A55A 3RY3A 4WEDA 2QS1A 3FIRA 3VXCA 4DCXA 2QPQA 4NE4A 2HCAA 3MJNA 3IL1B 3MVZA 2R71A 3LBSA 2O1LA 3MWBA 2AL4A 3G3JA 3TTRA 3GBBA 3OXNA 4EQ9A 4NF8A 2RC9A 5FHOA 4JWXA 4RA1A 3T9UA 1O7TA 2RKMA 2UYEA 4LZ5A 1A40A 3C34A 1MH4A 4POXA 2CZLA 2RINA 1D3KA 3PD9A 2OWTA 2XXTA 2LAOA 2O7IA 1BKAA 4R9GA 5CMBA 2FNCA 2E0SA 4IGTA 1M5DA 4ND9A 1UQWA 1H76A 3S9NC 4PE5B 4OHNA 5ELVA 3MC2A 4U4SA 3MAMA 3VXBA 2F7AA 1UIUA 3I5OA 3PUWE 5AA4A 2NXOA 3OO6A 5JK4A 3U8QA 3T9XB 3RTFB 3W9WA 2H5YA 4ZEDA 1FQAA 1NL5A 1VR5A 1ZBMA 5K2XA 1AOVA 1MXVA 4PFUA 3T66A 1P1UA 2GRVA 1SW1A 3T93B 1SI1A 1PBQA 2A5TA 3HO7A 4IO6A 2F97A 3FJGA 2Y7WA 2I49A 3TTNA 4EF2A 4G68A 1Y20A 3B7DA 3IB0A 5A5XA 5EHSA 2O6AA 1EU8A 5H8SA 4M4GA 2A5SA 4RK9A 1VFEA 1B1HA 3PMVA 3PUZE 2XXPA 2F78A 2XXVA 4I8CA 2O84X 4KR5A 4IB2A 4ECFA 4OYVA 5TU0A 1A8EA 3FJMA 4FIMA 2BJJX 2OBGA 3D4GA 1JETA 1B5HA 1US5A 4QRZA 4BDNA 1B7ZA 2HAVA 3QK6A 4OTEA 3FV1A 4G8MA 5TP9A 1QW0A 1QVSA 5BWJA 2DP8A 2KLFA 1M5FA 4G4PA 2G29A 3G7WA 3EHUA 4OZ9A 3O9PA 3RT8A 4KHZE 2VP1A 2QMXA 1R6ZA 1HSJA 3OOAA 2IA4A 1BIYA 2XHDA 1FTJA 4F31B 4QSDA 4I1DA 2O1MA 1LAGE 4H65A 3O28A 2THIA 3TKDA 4R2BA 4ZEKA 3KOTA 5AA2A 1N7WA 1B1XA 2RC7A 3QUJA 3UA8A 1D4NA 4XKPA 3V8XB 1MPBA 5AA3A 3MPLA 4IGRA 1PBPA 4NMYA 2F7CA 1A54A 2XD2A 3SDFA 4GD5A 4H1XA 1LAHE 4BDQA 4TQUQ 1N7XA 4KD5A 1A8FA 4R6HA 3IO4A 3TQLA 3ZKLA 1D9YA 4FECA 1JVXA 2HAUA 3VVEA 4HS7A 1QJMA 4QF9A 2Z22A 1DPEA 4N13A 1FTMA 4L17A 1FCKA 2QS2A 4F1VA 4GQOA 1Y1MA 2XX9A 3MVYA 2QS3A 4ELPA 3UN6A 1LAFE 1LB9A 1HSLA 5I2KB 2Q8JA 3E9XA 3IOVA 4LUBA 2I4CA 1SYHA 2PMSA 4RYAA 1Q1KA 4H8IA 1PB9A 3T9VA 2Q89A 4OERA 4R6YA 1NH8A 4YKJA 1MY1A 2Z8FA 1D9VA 5CM6A 2XXWA 4BLAA 3L6HA 3K0VA 5EYFA 4KPTA 5H8NB 4AB5A 1FQDA 4R2FA 2H4IA 3MZBA 1EZ9A 2Y7RA 1PB8A 1MQJA 1H3DA 3VLVA 4NF5B 1MS7A 1MY0A 3KSJA 3FGSA 3TDJA 2ONSA 1MG1A 4JWOA 5CMCA 2DWHA 5CBSA 2M8CA 1B9JA 1MXZA 2FYIA 3H7MA 4R72A 3U92A 1IQ7A 3S9MC 5AE4A 2I48A 5CI5A 5FTHA 1TT1A 2I4BA 3PMWA 4HTGA 2VD3A 3G3HA 3MZ1A 4X9TA 3C33A 5DTBA 4ZE9A 3OO8A 1HSEA 2F35A 4IO3A 4K3FA 1SBPA 3KFMA 5I56B 1XC1A 1NNKA 4ELRA 1NMUA 3CR9A 3RTWB 4KI0E 3PUXE 3H3GA 4ZE8A 4ZS9A 4QFOA 2UVHA 3IOTA 5H8QB 4R73A 2H98A 3KGCA 3FD3A 4GF8A 4PFTA 4F39A 3H06B 1TXFA 3TCHA 2QRYA 1QUIA 3O2AA 4ZEBA 4WXJA 4GXSB 1USYH 1Q35A 4MLQA 5KCJB 3FJ7A 4O3CA 3W15C 1UTHB 1MQDA 2HQ0A 2V84A 3MQ9A 1MXYA 4R6KA 1SW4A 2XXHA 4G2ZA 1B4HA 3UORA 3C32A 3CRBA 5CMMA 5H8HB 4NF6B 1EZPA 4XKNA 4E0WA 3PUYE 4THIA 2O7UA 3DP8A 1JW5A 3IK6B 3RQTA 3G3IA 1B58A 5CMKA 2GFEA 4JWYA 2RF1A 1N04A 3U1OA 4F29A 3RT6B 1NFTA 2D3IA 4EQ7A 4OFLA 4OQOA 3IX1A 1NNTA 2O69A 3TTLA 2V3QA 4OEUA 3WAFA 1GTKA 3GXAA 1P1QA 3U72A 5ITPA 1IITA 3THIA 1S7YA 4Z7EA 4IY5A 5AA1A 3KJTA 3GZGA 5I59A 3M3LA 2ONRA 5DVJA 4QFKA 1LBCA 1N3XA 3MP8A 1BTJA 3MP6A 4F3PA 2DE4A 1LFIA 2DSFA 3KEIA 3O6HA 4KYEA 4DXCA 4GFRA 4RJZA 3H6WA 1LFGA 2REJA 4LZ7A 5ICQA 2VOZA 1YAEA 3C35A 3PPRA 4I62A 3TCFA 1XS5A 3TCGA 3EHTA 3G3GA 1IXHA 1LAXA 1B3FA 2HFBA 1MPDA 4XKQA 3OSQA 4IO5A 3R7XA 4QFNA 2ZYMA 4DDDA 3OO7A 3UIFA 1UIVA 1O64A 3MPKA 1I6QA 2HZLA 4LQ2A 4DLDA 3O6IA 5JTYA 3H4ZA 4G68C 2F5XA 3B6TA 4MFIA 3N94A 3PUVE 4Q30B 5I57B 5LOMA 1TFAA 3IB1A 1MDQA 2OLBA 2I0CA 4GXAA 3H03A 3N6TA 2HXWA 1M5CA 4MH5A 4YZZA 2DOJA 1ZKBA 1DTZA 4NF8B 4IO4A 3DM0A 3TAJA 3CSGA 3HHGA 4F22A 5I2NB 3JZJA 1LGBC 2RCBA 3KBRA 4GIZA 2DXRA 4KYSA 3Q26A 3I3VA 4ESXA 1MPCA 3ILUB 2X26A 4EDPA 3K6VA 3H6VA 5L9SA 3VVFA 3K6XA 1Z7ME 4JSOA 2AIXA 4XXUA 3S9EA 4F2QA 1XT8A 1NKXA 1S9TA 4JXIA 5AA4B 3SERA 3OSRA 2UVIA 5I58A 3USDA 1B40A 4OENA 5DEXA 4MBPA 5IAIA 3CG1A 4GVOA 1IXGA 3S4UA 4M1VA 4R9FA 2FA7A 2YLNA 3LSLA 3IJOB 4JDFA 2XX8A 4GRKA 1B32A 1FQFA 4X48A 1SDXA 2R6GE 3E3KA 1P1WA 2A5TB 2PVUA 3IOWA 3W9VA 2Q2CA 5H8FA 3EQ1A 1UTBA 3U93A 2OCUA 5A5XB 1ZU0A 3O97A 3FASA 3N6UA 4F1UA 3EHSA 2D5WA 4JB7A 2Z8DA 2HZKA 2NVUB 2X7QA 1SI0A 4NWDA 1AMFA 3RUMA 3SESA 1IIWA 1QKAA 5B70A 3CI8A 3A09A 4LATA 3UP9A 4GL8A 3K2DA 4F3GA 2F6GA 4N07A 4Q5TA 4FE8A 4H6DA 1FTLA 1B51A 4MLVA 3MUQA 4DXBA 1OMPA 3C36A 4IO7A 2UYFA 4OFOA 5TP9B 3KN7A 1EZOA 2PX1A 3FVKA 3BFUA 1LCFA 3N26A 4OVJA 4U21A 4DZ1A 2XX7A 4OESA 3OEKA 3MVWA 2DVCA 4NF4A 4TLMB 3DLNA 4F19A 3O29A 1GVCA 4OWDA 3N5LA 2DQVA 4U1OA 3R26A 1NNFA 4F18A 4OFJA 5AA2B 3ODBA 2ESNA 4I9DA 2ZYOA 3SEYA 5TPAB 4EF1A 2XXIA 3CIJA 2VD2A 4XKRA 3G3KA 4Z0IA 1B7UA 1JW1A 3TFLA 4RY1A 4BDLA 1VE4A 3BBRA 4RNSA 2ZYNA 3OD7A 1PDAA 2DWAA 4GL0A 3V89B 3K6UA 1NNPA 1J1NA 2AYSA 4AB6A 1SYIA 4HCWA 4BDRA 3FVNA 4U22A 1PC3A 1S50A 1MH3A 1XVYA 4PFWA 2F6PA 1AH5A 3CSBA 3QXMA 4QSCA 1B52A 1YPNA 4FATA 3Q27A 5K2YA 5FTIA 3OMBA 2D21A 3M3FA 1N84A 3ZKKA 3FZVA 3TODA 2Q2AA 1URGA 1B4ZA 3A3UA 1DSNA 2F34A 4EQBA 2YJPA 1ZIUA 3KJ7A 1MM6A 4TLLB 1PEBA 3L6GA 4ZEFA 4N6PA 5EHMA 4PP0A 2ZNTA 3TEPA 1LBBA 3T9HB 1LCTA 5DT6A 1H45A 2O51A 1Y3QA 1N3WA 3LC8A 1DOTA 4ZZAA 2B3FA 4YMAA 1QULA 1I6AA 2CMOA 3LSXA 1GGGA 3SEXA 3R6UA 5I84A 1SW5A 2PT2A 2IEEA 1ZJLA 5CC2A 1PB7A 1JQFA 1IXCA 1FQCA 1AIVA 2ONKE 3CFXA 2ZYKA 4RXLA 1B0LA 3MZ9A 5KDTA 1DTGA 4FJPA 1ZTYA 3C31A 4XTCQ 2NUVA 3AXFA 3JV9A 5ISUA 3IB2A 3UGWA 4O3AA 2NOOA 3K1NA 1R1NA 2F7BA 1OIBA 2DWIA 1JNFA 2PBWA 3HV1A 4ZDMA 3CVGA 2WKYA 3TMGA 3FVOA 3PPPA 5B7DA 3E4RA 4F1YA 2YPNA 4ZZEA 3GLBA 4P11A 2Z8EA 3C4MA 4NWCA 4YMBA 4H0WA 4PFYA 3VE1B 4EXKA 2HEUA 3Q28A 3B6QA 4AQ4A 4H5FA 4PETA 1YTVA 1B7HA 1LSTA 3K01A 4MF3A 2ZMBA 1ZMGA 3O66A 3PGFA 1ELJA 5FHNA 1QUJA 1FQBA 1MQIA 1OQHA 1XOCA 2UVGA 3VLUA 1B2HA 3TUSA 3M3KA 2W7YA 4TOZA 5DVFA 4OXVA 3B6WA 1LB8A 4RPNA 3TYHA 3VLWA 2ANJA 3JYRA 1R9LA 4C1TA 1FTKA 2H99A 1TFDA 5I57A 1WVJA 4YB6A 4H5GA 4KQPA 5I59B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E13 X;  1GR2 A;  3OO9 A;  1B3G A;  2DWJ A;  2I3W A;  2ZXT A;  3KOS A;  3VV5 A;  3OEM A;  1LLS A;  2OWS A;  5HPQ A;  4NED A;  5I2N A;  1ANF A;  5F7V A;  4F2O A;  2DE2 A;  2P2A A;  2X7P A;  4LA9 A;  3K1M A;  5FHM A;  4O3B A;  1KWH A;  2ALU A;  1WDN A;  1P1N A;  4OEV A;  2B65 A;  1MXX A;  1CB6 A;  5CBR A;  4QFL A;  1XVX A;  2Z23 A;  2Q88 A;  4YAH X;  4P0G A;  3SEW A;  4X1B A;  2F8D A;  1OLC A;  2O68 A;  3H6U A;  3VDF A;  1LFH A;  4FED A;  1GV8 A;  1B3L A;  4FOR A;  3KN3 A;  3KSX A;  2V3T A;  1VSO A;  4F3B A;  1B0H A;  4U4X A;  1IUD A;  3RPW A;  2DXY A;  2XXR A;  4FAJ A;  1II5 A;  5JTY B;  2XXU A;  3TTM A;  2OJT A;  3WAE A;  1MY4 A;  1SQY A;  4DCY A;  3D4C A;  4QFP A;  4C1U A;  3PPO A;  4G8H A;  1FTO A;  2QL3 A;  4YB7 A;  3MW0 A;  3K6W A;  2Y7K A;  1BP5 A;  4KYD A;  3MP1 A;  3HN0 A;  4EXL A;  4ELQ A;  1RYX A;  5IKB A;  1B3H A;  5ITO A;  2QSX A;  2RCA A;  3TTK A;  4Q8R A;  3LR1 A;  4R75 A;  4C0R A;  4WEP A;  4HW8 A;  1VFD A;  3FAT A;  2UXA A;  3I6V A;  4BDM A;  4R74 A;  4Q0C A;  3U94 A;  2AL5 A;  1AL3 A;  3CG3 A;  1MM7 A;  3O6G A;  2GH9 A;  3QIM A;  1JEU A;  1H43 A;  4G68 B;  2GHB A;  5KZT A;  2XXQ A;  3RN8 A;  3PD8 A;  2GHA A;  1JVY A;  4G77 A;  1B05 A;  3ECR A;  1DPP A;  1M5B A;  5I58 B;  1T0K A;  1MY2 A;  3MBP A;  4KCC A;  3EF7 A;  5F1Q A;  4ELO A;  3OEL A;  3SKP A;  1MY3 A;  5DEX B;  1NH7 A;  3P7I A;  5HM4 B;  2OK2 A;  4ONY A;  4HCY A;  1TWY A;  3IR1 A;  4U1Z A;  1OVT A;  3KN8 A;  3G3F A;  1P1O A;  1OVB A;  1Y1Z A;  3RGY A;  1MXW A;  4PQJ A;  3PV0 E;  3PPN A;  3LSW A;  3FXQ A;  5DVI A;  5J1D A;  3M8U A;  3KZG A;  5BUU A;  3LUY A;  5H8F B;  4POW A;  1MRP A;  1MQG A;  1EH3 A;  1YCJ A;  5I2K A;  1UTB B;  3K02 A;  3KG2 A;  4GOT A;  2RC8 A;  1USY E;  5TPA A;  1B5I A;  3TZA A;  4YB5 A;  2Q9T A;  3C9H A;  2DS9 A;  3PMX A;  1Y3P A;  4YKI A;  2V93 A;  1IZ1 A;  3A3C A;  4BDO A;  3TEL A;  1A7L A;  3DEL B;  3ONM A;  5H8N A;  1POY 1;  2I0B A;  2QJE A;  2QMW A;  2XD3 A;  1B3E A;  1I69 A;  5HBC A;  2B3B A;  1QKB A;  1O63 A;  3ZS6 A;  1I6B A;  4NF5 A;  1L5T A;  2Y7I A;  3F11 A;  4RPO A;  2I3V A;  5CRY A;  1DMB A;  1Y3N A;  1MXU A;  2R9J A;  1URD A;  4OMB A;  3ILT B;  2P1S A;  1FQE A;  1OLA A;  1Y4T A;  3BFT A;  3HCQ A;  5JEI A;  3V5A A;  2DYX A;  2G93 A;  1N0T A;  1ZLQ A;  5L9O A;  2PT1 A;  3QSL A;  3EN3 A;  4NF4 B;  1CE2 A;  3RLF E;  5AA2 D;  2XXX A;  5I56 A;  4LVQ A;  3HST A;  3UK4 A;  3PPQ A;  4LP2 B;  3T96 B;  2P0S A;  5L9M A;  4LON B;  2H25 A;  1QUK A;  5M2V A;  3IO6 A;  2ABH A;  1IXI A;  4IY6 A;  5H8Q A;  2H9B A;  3DP6 A;  3FVG A;  3FV2 A;  2PYY A;  1JW4 A;  4DIG A;  3MVX A;  4JSD A;  1R9Q A;  3IOR A;  1MQH A;  3SET A;  3ZSF A;  1A99 A;  4F3S A;  3V83 A;  3SEV A;  2UVJ A;  1F9B A;  2ZNU A;  3FXU A;  3RNN A;  4P0I A;  5KCJ A;  1XHY A;  5DYH A;  1UTH A;  3FUZ A;  1M5E A;  3SEU A;  5ICT A;  4GWO A;  3PU5 A;  3CFZ A;  5H8H A;  2Y84 A;  3BKI B;  4NF6 A;  2ZNS A;  3HHF A;  3Q25 A;  4WKM A;  4OET A;  4H67 A;  3OEN A;  4ZEC A;  4UA8 A;  3IOU A;  3QUF A;  4KCD A;  2V3U A;  1US4 A;  3CFL A;  1Z7N E;  3T22 A;  3VFJ A;  2XXY A;  4H8J A;  3TPA A;  4ISU A;  3TQW A;  2I6E A;  4UAC A;  1B5J A;  1ATG A;  1B46 A;  1B6H A;  1FW0 A;  4E0X A;  4YIC A;  2F36 A;  1URS A;  3HPI A;  4YKP A;  2VGQ A;  4ESW A;  2QS4 A;  3Q29 A;  1OQG A;  4XIG Q;  2OZZ A;  1POT A;  1JEV A;  1N76 A;  1WOD A;  4JBZ A;  1RYO A;  1SW2 A;  4EUO A;  4LQ5 A;  1BLF A;  3K1P A;  2NWJ A;  4GLI A;  3K4U A;  4QHQ A;  4FEB A;  3K00 A;  4DE8 A;  1SD3 A;  4YKK A;  4IO2 A;  3H6T A;  2Y7P A;  3VVD A;  1IEJ A;  2I58 A;  2V25 A;  4DXU A;  3DP4 A;  4KFQ A;  4G8N A;  1RKM A;  3GBA A;  3FXR A;  4ZEI A;  4X1D A;  2VHA A;  3EPE A;  3QAX A;  3LSF B;  3QYT A;  5KDT B;  1H44 A;  4QSE A;  4RK2 A;  1SVX B;  1Y4C A;  4NTL A;  3S2V A;  3S9L C;  2DE3 A;  4U23 A;  2REG A;  3IAZ A;  4LZ8 A;  2DVZ A;  1Y9U A;  4U2R A;  2E1S A;  5L8D A;  1MDP 1;  3IJX B;  4YU0 A;  1P99 A;  1A55 A;  3RY3 A;  4WED A;  2QS1 A;  3FIR A;  3VXC A;  4DCX A;  2QPQ A;  4NE4 A;  2HCA A;  3MJN A;  3IL1 B;  3MVZ A;  2R71 A;  3LBS A;  2O1L A;  3MWB A;  2AL4 A;  3G3J A;  3TTR A;  3GBB A;  3OXN A;  4EQ9 A;  4NF8 A;  2RC9 A;  5FHO A;  4JWX A;  4RA1 A;  3T9U A;  1O7T A;  2RKM A;  2UYE A;  4LZ5 A;  1A40 A;  3C34 A;  1MH4 A;  4POX A;  2CZL A;  2RIN A;  1D3K A;  3PD9 A;  2OWT A;  2XXT A;  2LAO A;  2O7I A;  1BKA A;  4R9G A;  5CMB A;  2FNC A;  2E0S A;  4IGT A;  1M5D A;  4ND9 A;  1UQW A;  1H76 A;  3S9N C;  4PE5 B;  4OHN A;  5ELV A;  3MC2 A;  4U4S A;  3MAM A;  3VXB A;  2F7A A;  1UIU A;  3I5O A;  3PUW E;  5AA4 A;  2NXO A;  3OO6 A;  5JK4 A;  3U8Q A;  3T9X B;  3RTF B;  3W9W A;  2H5Y A;  4ZED A;  1FQA A;  1NL5 A;  1VR5 A;  1ZBM A;  5K2X A;  1AOV A;  1MXV A;  4PFU A;  3T66 A;  1P1U A;  2GRV A;  1SW1 A;  3T93 B;  1SI1 A;  1PBQ A;  2A5T A;  3HO7 A;  4IO6 A;  2F97 A;  3FJG A;  2Y7W A;  2I49 A;  3TTN A;  4EF2 A;  4G68 A;  1Y20 A;  3B7D A;  3IB0 A;  5A5X A;  5EHS A;  2O6A A;  1EU8 A;  5H8S A;  4M4G A;  2A5S A;  4RK9 A;  1VFE A;  1B1H A;  3PMV A;  3PUZ E;  2XXP A;  2F78 A;  2XXV A;  4I8C A;  2O84 X;  4KR5 A;  4IB2 A;  4ECF A;  4OYV A;  5TU0 A;  1A8E A;  3FJM A;  4FIM A;  2BJJ X;  2OBG A;  3D4G A;  1JET A;  1B5H A;  1US5 A;  4QRZ A;  4BDN A;  1B7Z A;  2HAV A;  3QK6 A;  4OTE A;  3FV1 A;  4G8M A;  5TP9 A;  1QW0 A;  1QVS A;  5BWJ A;  2DP8 A;  2KLF A;  1M5F A;  4G4P A;  2G29 A;  3G7W A;  3EHU A;  4OZ9 A;  3O9P A;  3RT8 A;  4KHZ E;  2VP1 A;  2QMX A;  1R6Z A;  1HSJ A;  3OOA A;  2IA4 A;  1BIY A;  2XHD A;  1FTJ A;  4F31 B;  4QSD A;  4I1D A;  2O1M A;  1LAG E;  4H65 A;  3O28 A;  2THI A;  3TKD A;  4R2B A;  4ZEK A;  3KOT A;  5AA2 A;  1N7W A;  1B1X A;  2RC7 A;  3QUJ A;  3UA8 A;  1D4N A;  4XKP A;  3V8X B;  1MPB A;  5AA3 A;  3MPL A;  4IGR A;  1PBP A;  4NMY A;  2F7C A;  1A54 A;  2XD2 A;  3SDF A;  4GD5 A;  4H1X A;  1LAH E;  4BDQ A;  4TQU Q;  1N7X A;  4KD5 A;  1A8F A;  4R6H A;  3IO4 A;  3TQL A;  3ZKL A;  1D9Y A;  4FEC A;  1JVX A;  2HAU A;  3VVE A;  4HS7 A;  1QJM A;  4QF9 A;  2Z22 A;  1DPE A;  4N13 A;  1FTM A;  4L17 A;  1FCK A;  2QS2 A;  4F1V A;  4GQO A;  1Y1M A;  2XX9 A;  3MVY A;  2QS3 A;  4ELP A;  3UN6 A;  1LAF E;  1LB9 A;  1HSL A;  5I2K B;  2Q8J A;  3E9X A;  3IOV A;  4LUB A;  2I4C A;  1SYH A;  2PMS A;  4RYA A;  1Q1K A;  4H8I A;  1PB9 A;  3T9V A;  2Q89 A;  4OER A;  4R6Y A;  1NH8 A;  4YKJ A;  1MY1 A;  2Z8F A;  1D9V A;  5CM6 A;  2XXW A;  4BLA A;  3L6H A;  3K0V A;  5EYF A;  4KPT A;  5H8N B;  4AB5 A;  1FQD A;  4R2F A;  2H4I A;  3MZB A;  1EZ9 A;  2Y7R A;  1PB8 A;  1MQJ A;  1H3D A;  3VLV A;  4NF5 B;  1MS7 A;  1MY0 A;  3KSJ A;  3FGS A;  3TDJ A;  2ONS A;  1MG1 A;  4JWO A;  5CMC A;  2DWH A;  5CBS A;  2M8C A;  1B9J A;  1MXZ A;  2FYI A;  3H7M A;  4R72 A;  3U92 A;  1IQ7 A;  3S9M C;  5AE4 A;  2I48 A;  5CI5 A;  5FTH A;  1TT1 A;  2I4B A;  3PMW A;  4HTG A;  2VD3 A;  3G3H A;  3MZ1 A;  4X9T A;  3C33 A;  5DTB A;  4ZE9 A;  3OO8 A;  1HSE A;  2F35 A;  4IO3 A;  4K3F A;  1SBP A;  3KFM A;  5I56 B;  1XC1 A;  1NNK A;  4ELR A;  1NMU A;  3CR9 A;  3RTW B;  4KI0 E;  3PUX E;  3H3G A;  4ZE8 A;  4ZS9 A;  4QFO A;  2UVH A;  3IOT A;  5H8Q B;  4R73 A;  2H98 A;  3KGC A;  3FD3 A;  4GF8 A;  4PFT A;  4F39 A;  3H06 B;  1TXF A;  3TCH A;  2QRY A;  1QUI A;  3O2A A;  4ZEB A;  4WXJ A;  4GXS B;  1USY H;  1Q35 A;  4MLQ A;  5KCJ B;  3FJ7 A;  4O3C A;  3W15 C;  1UTH B;  1MQD A;  2HQ0 A;  2V84 A;  3MQ9 A;  1MXY A;  4R6K A;  1SW4 A;  2XXH A;  4G2Z A;  1B4H A;  3UOR A;  3C32 A;  3CRB A;  5CMM A;  5H8H B;  4NF6 B;  1EZP A;  4XKN A;  4E0W A;  3PUY E;  4THI A;  2O7U A;  3DP8 A;  1JW5 A;  3IK6 B;  3RQT A;  3G3I A;  1B58 A;  5CMK A;  2GFE A;  4JWY A;  2RF1 A;  1N04 A;  3U1O A;  4F29 A;  3RT6 B;  1NFT A;  2D3I A;  4EQ7 A;  4OFL A;  4OQO A;  3IX1 A;  1NNT A;  2O69 A;  3TTL A;  2V3Q A;  4OEU A;  3WAF A;  1GTK A;  3GXA A;  1P1Q A;  3U72 A;  5ITP A;  1IIT A;  3THI A;  1S7Y A;  4Z7E A;  4IY5 A;  5AA1 A;  3KJT A;  3GZG A;  5I59 A;  3M3L A;  2ONR A;  5DVJ A;  4QFK A;  1LBC A;  1N3X A;  3MP8 A;  1BTJ A;  3MP6 A;  4F3P A;  2DE4 A;  1LFI A;  2DSF A;  3KEI A;  3O6H A;  4KYE A;  4DXC A;  4GFR A;  4RJZ A;  3H6W A;  1LFG A;  2REJ A;  4LZ7 A;  5ICQ A;  2VOZ A;  1YAE A;  3C35 A;  3PPR A;  4I62 A;  3TCF A;  1XS5 A;  3TCG A;  3EHT A;  3G3G A;  1IXH A;  1LAX A;  1B3F A;  2HFB A;  1MPD A;  4XKQ A;  3OSQ A;  4IO5 A;  3R7X A;  4QFN A;  2ZYM A;  4DDD A;  3OO7 A;  3UIF A;  1UIV A;  1O64 A;  3MPK A;  1I6Q A;  2HZL A;  4LQ2 A;  4DLD A;  3O6I A;  5JTY A;  3H4Z A;  4G68 C;  2F5X A;  3B6T A;  4MFI A;  3N94 A;  3PUV E;  4Q30 B;  5I57 B;  5LOM A;  1TFA A;  3IB1 A;  1MDQ A;  2OLB A;  2I0C A;  4GXA A;  3H03 A;  3N6T A;  2HXW A;  1M5C A;  4MH5 A;  4YZZ A;  2DOJ A;  1ZKB A;  1DTZ A;  4NF8 B;  4IO4 A;  3DM0 A;  3TAJ A;  3CSG A;  3HHG A;  4F22 A;  5I2N B;  3JZJ A;  1LGB C;  2RCB A;  3KBR A;  4GIZ A;  2DXR A;  4KYS A;  3Q26 A;  3I3V A;  4ESX A;  1MPC A;  3ILU B;  2X26 A;  4EDP A;  3K6V A;  3H6V A;  5L9S A;  3VVF A;  3K6X A;  1Z7M E;  4JSO A;  2AIX A;  4XXU A;  3S9E A;  4F2Q A;  1XT8 A;  1NKX A;  1S9T A;  4JXI A;  5AA4 B;  3SER A;  3OSR A;  2UVI A;  5I58 A;  3USD A;  1B40 A;  4OEN A;  5DEX A;  4MBP A;  5IAI A;  3CG1 A;  4GVO A;  1IXG A;  3S4U A;  4M1V A;  4R9F A;  2FA7 A;  2YLN A;  3LSL A;  3IJO B;  4JDF A;  2XX8 A;  4GRK A;  1B32 A;  1FQF A;  4X48 A;  1SDX A;  2R6G E;  3E3K A;  1P1W A;  2A5T B;  2PVU A;  3IOW A;  3W9V A;  2Q2C A;  5H8F A;  3EQ1 A;  1UTB A;  3U93 A;  2OCU A;  5A5X B;  1ZU0 A;  3O97 A;  3FAS A;  3N6U A;  4F1U A;  3EHS A;  2D5W A;  4JB7 A;  2Z8D A;  2HZK A;  2NVU B;  2X7Q A;  1SI0 A;  4NWD A;  1AMF A;  3RUM A;  3SES A;  1IIW A;  1QKA A;  5B70 A;  3CI8 A;  3A09 A;  4LAT A;  3UP9 A;  4GL8 A;  3K2D A;  4F3G A;  2F6G A;  4N07 A;  4Q5T A;  4FE8 A;  4H6D A;  1FTL A;  1B51 A;  4MLV A;  3MUQ A;  4DXB A;  1OMP A;  3C36 A;  4IO7 A;  2UYF A;  4OFO A;  5TP9 B;  3KN7 A;  1EZO A;  2PX1 A;  3FVK A;  3BFU A;  1LCF A;  3N26 A;  4OVJ A;  4U21 A;  4DZ1 A;  2XX7 A;  4OES A;  3OEK A;  3MVW A;  2DVC A;  4NF4 A;  4TLM B;  3DLN A;  4F19 A;  3O29 A;  1GVC A;  4OWD A;  3N5L A;  2DQV A;  4U1O A;  3R26 A;  1NNF A;  4F18 A;  4OFJ A;  5AA2 B;  3ODB A;  2ESN A;  4I9D A;  2ZYO A;  3SEY A;  5TPA B;  4EF1 A;  2XXI A;  3CIJ A;  2VD2 A;  4XKR A;  3G3K A;  4Z0I A;  1B7U A;  1JW1 A;  3TFL A;  4RY1 A;  4BDL A;  1VE4 A;  3BBR A;  4RNS A;  2ZYN A;  3OD7 A;  1PDA A;  2DWA A;  4GL0 A;  3V89 B;  3K6U A;  1NNP A;  1J1N A;  2AYS A;  4AB6 A;  1SYI A;  4HCW A;  4BDR A;  3FVN A;  4U22 A;  1PC3 A;  1S50 A;  1MH3 A;  1XVY A;  4PFW A;  2F6P A;  1AH5 A;  3CSB A;  3QXM A;  4QSC A;  1B52 A;  1YPN A;  4FAT A;  3Q27 A;  5K2Y A;  5FTI A;  3OMB A;  2D21 A;  3M3F A;  1N84 A;  3ZKK A;  3FZV A;  3TOD A;  2Q2A A;  1URG A;  1B4Z A;  3A3U A;  1DSN A;  2F34 A;  4EQB A;  2YJP A;  1ZIU A;  3KJ7 A;  1MM6 A;  4TLL B;  1PEB A;  3L6G A;  4ZEF A;  4N6P A;  5EHM A;  4PP0 A;  2ZNT A;  3TEP A;  1LBB A;  3T9H B;  1LCT A;  5DT6 A;  1H45 A;  2O51 A;  1Y3Q A;  1N3W A;  3LC8 A;  1DOT A;  4ZZA A;  2B3F A;  4YMA A;  1QUL A;  1I6A A;  2CMO A;  3LSX A;  1GGG A;  3SEX A;  3R6U A;  5I84 A;  1SW5 A;  2PT2 A;  2IEE A;  1ZJL A;  5CC2 A;  1PB7 A;  1JQF A;  1IXC A;  1FQC A;  1AIV A;  2ONK E;  3CFX A;  2ZYK A;  4RXL A;  1B0L A;  3MZ9 A;  5KDT A;  1DTG A;  4FJP A;  1ZTY A;  3C31 A;  4XTC Q;  2NUV A;  3AXF A;  3JV9 A;  5ISU A;  3IB2 A;  3UGW A;  4O3A A;  2NOO A;  3K1N A;  1R1N A;  2F7B A;  1OIB A;  2DWI A;  1JNF A;  2PBW A;  3HV1 A;  4ZDM A;  3CVG A;  2WKY A;  3TMG A;  3FVO A;  3PPP A;  5B7D A;  3E4R A;  4F1Y A;  2YPN A;  4ZZE A;  3GLB A;  4P11 A;  2Z8E A;  3C4M A;  4NWC A;  4YMB A;  4H0W A;  4PFY A;  3VE1 B;  4EXK A;  2HEU A;  3Q28 A;  3B6Q A;  4AQ4 A;  4H5F A;  4PET A;  1YTV A;  1B7H A;  1LST A;  3K01 A;  4MF3 A;  2ZMB A;  1ZMG A;  3O66 A;  3PGF A;  1ELJ A;  5FHN A;  1QUJ A;  1FQB A;  1MQI A;  1OQH A;  1XOC A;  2UVG A;  3VLU A;  1B2H A;  3TUS A;  3M3K A;  2W7Y A;  4TOZ A;  5DVF A;  4OXV A;  3B6W A;  1LB8 A;  4RPN A;  3TYH A;  3VLW A;  2ANJ A;  3JYR A;  1R9L A;  4C1T A;  1FTK A;  2H99 A;  1TFD A;  5I57 A;  1WVJ A;  4YB6 A;  4H5G A;  4KQP A;  5I59 B; 
#chains in the Genus database with same CATH topology
 3E13 X;  1GR2 A;  3OO9 A;  1B3G A;  2DWJ A;  4PAK A;  2I3W A;  2ZXT A;  3KOS A;  3VV5 A;  4GWY A;  3OEM A;  1LLS A;  2OWS A;  3IFC A;  3ISP A;  5HPQ A;  4NED A;  5I2N A;  1ANF A;  5F7V A;  4F2O A;  2DE2 A;  4IR8 A;  2P2A A;  2X7P A;  4LA9 A;  3K1M A;  5FHM A;  4O3B A;  1KWH A;  2ALU A;  1WDN A;  1P1N A;  4OEV A;  1FPG A;  5IZZ A;  2B65 A;  1MXX A;  1FPE A;  1CB6 A;  5CBR A;  4QFL A;  1XVX A;  2Z23 A;  2Q88 A;  4YAH X;  4P0G A;  3SEW A;  4X1B A;  2F8D A;  1OLC A;  2O68 A;  3H6U A;  3VDF A;  1LFH A;  4FED A;  1GV8 A;  1YYZ A;  1FBF A;  1B3L A;  2GQ1 A;  4FOR A;  3KN3 A;  3KSX A;  2V3T A;  1VSO A;  4F3B A;  2P3V A;  1B0H A;  4U4X A;  1IUD A;  5J16 A;  3RPW A;  4GBW A;  2DXY A;  4QBA A;  2XXR A;  4FAJ A;  4MCO A;  1II5 A;  5JTY B;  2XXU A;  3TTM A;  2OJT A;  3WAE A;  1MY4 A;  1SQY A;  4DCY A;  3D4C A;  4QFP A;  4NX1 A;  4C1U A;  3PPO A;  4G8H A;  1FTO A;  1LEV A;  2QL3 A;  4YB7 A;  3MW0 A;  3K6W A;  2Y7K A;  4MX6 A;  1BP5 A;  4KYD A;  3MP1 A;  3HN0 A;  4EXL A;  4H46 A;  4ELQ A;  1RYX A;  1DCU A;  5IKB A;  1B3H A;  5ITO A;  2QSX A;  4OA4 A;  2RCA A;  4N6K A;  3TTK A;  4Q8R A;  3LR1 A;  4R75 A;  4C0R A;  5EQ9 A;  1LBV A;  2JJK A;  4WEP A;  4HW8 A;  2QVV A;  1VFD A;  3FAT A;  1EYI A;  2UXA A;  3I6V A;  4BDM A;  4R74 A;  4Q0C A;  3U94 A;  2AL5 A;  1AL3 A;  3CG3 A;  4JVD A;  1MM7 A;  3O6G A;  3HFU A;  3LV0 A;  2GH9 A;  1NV4 A;  3QIM A;  1JEU A;  1H43 A;  4G68 B;  2GHB A;  5KZT A;  2XXQ A;  3RN8 A;  3PD8 A;  1EYJ A;  2GHA A;  1JVY A;  3IFA A;  4G77 A;  1B05 A;  3ECR A;  1DPP A;  1M5B A;  2QVU A;  5I58 B;  1T0K A;  1MY2 A;  2XWK A;  3MBP A;  1XI6 A;  4KCC A;  3EF7 A;  5F1Q A;  4ELO A;  3OEL A;  4N4U A;  3SKP A;  1MY3 A;  5DEX B;  1NH7 A;  3P7I A;  5HM4 B;  2OK2 A;  4ONY A;  4HCY A;  1TWY A;  3IR1 A;  4U1Z A;  1OVT A;  3KN8 A;  3G3F A;  1P1O A;  1OVB A;  1Y1Z A;  1NUX A;  3RGY A;  1MXW A;  4PQJ A;  3PV0 E;  3PPN A;  3LSW A;  3FXQ A;  3MST A;  5DVI A;  5J1D A;  3M8U A;  3KZG A;  5BUU A;  3LUY A;  5H8F B;  1JP4 A;  4POW A;  1MRP A;  1MQG A;  1EH3 A;  1YCJ A;  4PAF A;  5I2K A;  1UTB B;  3K02 A;  3KG2 A;  4GOT A;  2RC8 A;  1USY E;  5TPA A;  1B5I A;  3TZA A;  4YB5 A;  2Q9T A;  4MNC A;  1IMB A;  4P1L A;  3C9H A;  2DS9 A;  3PMX A;  1Y3P A;  4YKI A;  2V93 A;  1IZ1 A;  3A3C A;  4BDO A;  1IMA A;  3TEL A;  1A7L A;  3DEL B;  3ONM A;  5H8N A;  3A29 A;  1POY 1;  2I0B A;  2QJE A;  2QMW A;  2XD3 A;  1B3E A;  3KBZ A;  1I69 A;  2WBD A;  5HBC A;  2B3B A;  3ROJ A;  1QKB A;  1O63 A;  3ZS6 A;  1I6B A;  2WEF A;  4NF5 A;  1L5T A;  2Y7I A;  3F11 A;  4RPO A;  2I3V A;  5CRY A;  5I7I A;  1DMB A;  1Y3N A;  1MXU A;  2R9J A;  1URD A;  4OMB A;  3ILT B;  2P1S A;  1FQE A;  1OLA A;  1Y4T A;  3BFT A;  3HCQ A;  2WYK A;  5JEI A;  3V5A A;  2DYX A;  2G93 A;  1N0T A;  1ZLQ A;  5L9O A;  2PT1 A;  3QSL A;  3EN3 A;  4NF4 B;  1CE2 A;  3RLF E;  5AA2 D;  2VPO A;  2XXX A;  3PTY A;  4MEV A;  5EQ7 A;  5I56 A;  4LVQ A;  3HST A;  3UK4 A;  3PPQ A;  1QGX A;  4LP2 B;  3T96 B;  2P0S A;  5L9M A;  5IZ1 A;  4LON B;  2H25 A;  1QUK A;  5M2V A;  1FBD A;  3IO6 A;  2ABH A;  1IXI A;  4IY6 A;  1NV3 A;  5H8Q A;  1RDZ A;  2HHM A;  2H9B A;  3DP6 A;  3FVG A;  3FV2 A;  2PYY A;  4N15 A;  1JW4 A;  4HE1 A;  4DIG A;  3MVX A;  4JSD A;  1CNQ A;  1R9Q A;  3IOR A;  1MQH A;  3SET A;  3ZSF A;  1A99 A;  3RYD A;  2MKZ A;  4F3S A;  3V83 A;  3SEV A;  2UVJ A;  1F9B A;  2ZNU A;  3FXU A;  3RNN A;  3NOH A;  4P0I A;  5KCJ A;  1XHY A;  5DYH A;  1UTH A;  3FUZ A;  2QFL A;  1M5E A;  3SEU A;  5ICT A;  1IMC A;  4GWO A;  3PU5 A;  3CFZ A;  5H8H A;  4PF8 A;  2Y84 A;  3BKI B;  4NF6 A;  2ZNS A;  3HHF A;  3Q25 A;  4WKM A;  4OET A;  4H67 A;  3OEN A;  4ZEC A;  4UA8 A;  1NUY A;  3IOU A;  4N8Y A;  3QUF A;  4KCD A;  2V3U A;  1US4 A;  4JVC A;  3CFL A;  1Z7N E;  3T22 A;  3VFJ A;  2XXY A;  4H8J A;  3TPA A;  4ISU A;  3TQW A;  2I6E A;  4UAC A;  1B5J A;  1ATG A;  1B46 A;  1B6H A;  4PC9 A;  4H45 A;  1FW0 A;  4E0X A;  4YIC A;  2F36 A;  4N6D A;  1URS A;  1G0I A;  5EYG A;  3HPI A;  4GWW A;  4YKP A;  2VGQ A;  4ESW A;  2QS4 A;  3Q29 A;  1OQG A;  4XIG Q;  2OZZ A;  1POT A;  1JEV A;  1N76 A;  1WOD A;  1NV0 A;  4JBZ A;  1RYO A;  1SW2 A;  4EUO A;  4LQ5 A;  1BLF A;  3K1P A;  2NWJ A;  4GLI A;  3K4U A;  4QHQ A;  4FEB A;  4O94 A;  3K00 A;  4DE8 A;  1SD3 A;  4AS4 A;  4OVS A;  4YKK A;  4IO2 A;  3H6T A;  2Y7P A;  4G61 A;  3VVD A;  1IEJ A;  2I58 A;  2V25 A;  4DXU A;  5F24 A;  5IZ3 B;  3DP4 A;  4KFQ A;  4G8N A;  1RKM A;  3GBA A;  5ESY A;  3FXR A;  4ZEI A;  4X1D A;  2VHA A;  3EPE A;  3QAX A;  1RDY A;  3LSF B;  3QYT A;  5KDT B;  1H44 A;  4X8R A;  2F3D A;  4QSE A;  4RK2 A;  1SVX B;  1Y4C A;  5A5L A;  4NTL A;  1K9Z A;  3S2V A;  4PCD A;  1FPJ A;  3S9L C;  4PFI A;  1LBX A;  2DE3 A;  4U23 A;  2REG A;  2PFZ A;  3IAZ A;  4LZ8 A;  2DVZ A;  1Y9U A;  4U2R A;  2E1S A;  5L8D A;  1MDP 1;  3IJX B;  4YU0 A;  1P99 A;  1A55 A;  3RY3 A;  4WED A;  2QS1 A;  3FIR A;  3VXC A;  4DCX A;  2QPQ A;  4NE4 A;  4O7M A;  2HCA A;  3MJN A;  3IL1 B;  3MVZ A;  1NV7 A;  3BIH A;  2R71 A;  3LBS A;  2O1L A;  3E78 A;  3MWB A;  4KXP A;  5LDZ A;  2AL4 A;  3G3J A;  3TTR A;  3GBB A;  3OXN A;  4EQ9 A;  4NF8 A;  2RC9 A;  5FHO A;  4JWX A;  4RA1 A;  4X04 A;  3T9U A;  5I5P A;  1O7T A;  2Q8M A;  2RKM A;  3KC0 A;  2UYE A;  4LZ5 A;  2ZZW A;  1A40 A;  3CHG A;  3C34 A;  1MH4 A;  4POX A;  2CZL A;  2RIN A;  1D3K A;  3PD9 A;  2OWT A;  2XXT A;  2LAO A;  2HPG A;  2O7I A;  1BKA A;  4R9G A;  5CMB A;  2FNC A;  2E0S A;  4IGT A;  1M5D A;  1FPB A;  4ND9 A;  1UQW A;  1IMD A;  4PFR A;  1H76 A;  3S9N C;  2R8T A;  4PE5 B;  4OHN A;  4GWS A;  5ELV A;  3MC2 A;  4U4S A;  3MAM A;  3VXB A;  2F7A A;  1UIU A;  3I5O A;  3PUW E;  5AA4 A;  2NXO A;  3OO6 A;  5JK4 A;  3U8Q A;  3T9X B;  3RTF B;  3W9W A;  2H5Y A;  4ZED A;  1FQA A;  5EYH A;  1NL5 A;  4I40 A;  1VR5 A;  1ZBM A;  5K2X A;  1AOV A;  1MXV A;  4PFU A;  1P1U A;  3T66 A;  2GRV A;  1SW1 A;  1RDX A;  5IGA A;  1YZ0 A;  4FBP A;  5ET8 A;  3T93 B;  1SI1 A;  1PBQ A;  2A5T A;  3HO7 A;  4IO6 A;  2Y5L A;  2F97 A;  4MNI A;  5IM2 A;  4NGU A;  3FJG A;  2Y7W A;  4NHB A;  2I49 A;  3TTN A;  4EF2 A;  4G68 A;  1Y20 A;  3B7D A;  3IB0 A;  5A5X A;  5EHS A;  2O6A A;  3EKI A;  1EU8 A;  1FBE A;  1FBP A;  1NV1 A;  5H8S A;  4M4G A;  2A5S A;  4RK9 A;  4I3E A;  1VFE A;  1B1H A;  3PMV A;  3PUZ E;  2XXP A;  2F78 A;  2XXV A;  4I8C A;  2O84 X;  4KR5 A;  4IB2 A;  4ECF A;  4OYV A;  5TU0 A;  1A8E A;  3FJM A;  4FIM A;  2BJJ X;  2OBG A;  3D4G A;  3T1B A;  4LN5 A;  1JET A;  1B5H A;  1US5 A;  4QRZ A;  4BDN A;  1SPI A;  1B7Z A;  2HAV A;  3QK6 A;  4OTE A;  1LBW A;  3FV1 A;  1AWB A;  1K9Y A;  5EQ8 A;  4PDD A;  4G8M A;  5TP9 A;  1QW0 A;  1QVS A;  5BWJ A;  2DP8 A;  2KLF A;  1M5F A;  4G4P A;  2G29 A;  3G7W A;  3EHU A;  4OZ9 A;  3O9P A;  3RT8 A;  4KHZ E;  2XWV A;  4XFE A;  2VP1 A;  2QMX A;  1R6Z A;  1HSJ A;  3OOA A;  2IA4 A;  2XWI A;  4PGP A;  1BIY A;  2PFY A;  2XHD A;  4GBV A;  4GWU A;  1FTJ A;  4F31 B;  4QSD A;  4I1D A;  2O1M A;  1LAG E;  4H65 A;  3O28 A;  2THI A;  3TKD A;  4R2B A;  4I3Y A;  4ZEK A;  3KOT A;  5AA2 A;  1N7W A;  1B1X A;  1KA0 A;  2RC7 A;  3FXB A;  3QUJ A;  1D4N A;  4XKP A;  3UA8 A;  3V8X B;  1MPB A;  5AA3 A;  1VDW A;  3MPL A;  4IGR A;  1PBP A;  4NMY A;  4PTK A;  2F7C A;  1A54 A;  2XD2 A;  3SDF A;  4GD5 A;  4H1X A;  1LAH E;  2QVR A;  4BDQ A;  4TQU Q;  1N7X A;  4KD5 A;  1A8F A;  4R6H A;  2XXK A;  4GX4 A;  3IO4 A;  1FBH A;  3TQL A;  3ZKL A;  1D9Y A;  4FEC A;  1JVX A;  2HAU A;  3VVE A;  4HS7 A;  1QJM A;  4AS5 A;  1INP A;  4QF9 A;  2OX3 A;  2Z22 A;  1DPE A;  4N13 A;  1FJ6 A;  1FTM A;  4L17 A;  1FCK A;  2QS2 A;  4F1V A;  4GQO A;  1Y1M A;  4OVT A;  2XX9 A;  3MVY A;  2QS3 A;  4ELP A;  3UN6 A;  5LTC A;  1LAF E;  1LB9 A;  1HSL A;  5I2K B;  2Q8J A;  3E9X A;  3IOV A;  4LUB A;  3FBP A;  4NAP A;  2I4C A;  1SYH A;  2PMS A;  4RYA A;  1Q1K A;  4H8I A;  1PB9 A;  3T9V A;  2Q89 A;  4OER A;  4R6Y A;  1NH8 A;  2FIE A;  3B8B A;  4YKJ A;  1MY1 A;  2Z8F A;  1D9V A;  5CM6 A;  2XXW A;  4BLA A;  3L6H A;  3K0V A;  5EYF A;  4KPT A;  5H8N B;  4AB5 A;  1FQD A;  4R2F A;  2H4I A;  3MZB A;  1EZ9 A;  3B50 A;  2Y7R A;  1PB8 A;  4N81 A;  1MQJ A;  1H3D A;  2KQZ A;  3VLV A;  4NF5 B;  1MS7 A;  1MY0 A;  3KSJ A;  3FGS A;  2CZI A;  3TDJ A;  2ONS A;  1MG1 A;  4JWO A;  3BIG A;  2DWH A;  5CMC A;  5CBS A;  2M8C A;  1B9J A;  1MXZ A;  2FYI A;  3H7M A;  4N17 A;  4R72 A;  3U92 A;  1IQ7 A;  3S9M C;  5AE4 A;  2I48 A;  5CI5 A;  5FTH A;  1TT1 A;  2I4B A;  3PMW A;  4HTG A;  2VD3 A;  3G3H A;  3MZ1 A;  4X9T A;  3C33 A;  3U65 A;  5DTB A;  4ZE9 A;  2FVZ A;  3OO8 A;  1HSE A;  2F35 A;  4IO3 A;  4K3F A;  2DDK A;  4P8B A;  1SBP A;  3KFM A;  5I56 B;  1XC1 A;  2CZK A;  1NNK A;  4ELR A;  4PFB A;  1NMU A;  3CR9 A;  3RTW B;  4KI0 E;  3PUX E;  3H3G A;  3KC1 A;  4ZE8 A;  4ZS9 A;  1FPK A;  4QFO A;  2UVH A;  3IOT A;  5H8Q B;  4R73 A;  2H98 A;  3KGC A;  3FD3 A;  4GF8 A;  2VT5 A;  4PFT A;  4F39 A;  3H06 B;  1TXF A;  3TCH A;  2QRY A;  5FBP A;  1QUI A;  3O2A A;  4ZEB A;  4WXJ A;  3MYU A;  4GXS B;  1USY H;  1Q35 A;  4MLQ A;  5KCJ B;  3FJ7 A;  4O3C A;  3W15 C;  1UTH B;  4XEQ A;  1MQD A;  2HQ0 A;  1NV2 A;  2V84 A;  3MQ9 A;  4NQ8 A;  1MXY A;  4R6K A;  4P3L A;  1SW4 A;  2XXH A;  4G2Z A;  1B4H A;  3UOR A;  3C32 A;  3CRB A;  5CMM A;  5H8H B;  4NF6 B;  1EZP A;  4XKN A;  4E0W A;  3PUY E;  4THI A;  2O7U A;  3DP8 A;  4JVI A;  1DBZ A;  1JW5 A;  3IK6 B;  3RQT A;  3G3I A;  1B58 A;  2ZZV A;  2F3B A;  5CMK A;  2GFE A;  4JWY A;  2RF1 A;  1N04 A;  3U1O A;  4F29 A;  3RT6 B;  1NFT A;  2D3I A;  4EQ7 A;  4OFL A;  4OQO A;  3IX1 A;  1NNT A;  2O69 A;  3TTL A;  2V3Q A;  3RPL B;  4PBQ A;  4OEU A;  3WAF A;  1GTK A;  3GXA A;  1P1Q A;  3U72 A;  5ITP A;  1IIT A;  3THI A;  1YXI A;  1S7Y A;  2FIX A;  4Z7E A;  4IY5 A;  2HXR A;  5AA1 A;  3KJT A;  3GZG A;  5I59 A;  3M3L A;  1FBC A;  2ONR A;  5DVJ A;  4QFK A;  1LBC A;  1N3X A;  3MP8 A;  1BTJ A;  3MP6 A;  4F3P A;  2DE4 A;  2OWZ A;  1LFI A;  2DSF A;  2P3N A;  3KEI A;  3O6H A;  4KYE A;  4DXC A;  4GFR A;  4RJZ A;  3H6W A;  1LFG A;  2REJ A;  4LZ7 A;  5ICQ A;  4GWX A;  1DK4 A;  2VOZ A;  1YAE A;  3C35 A;  3PPR A;  4I62 A;  3TCF A;  1XS5 A;  3TCG A;  3EHT A;  3G3G A;  2Q74 A;  1IXH A;  3GYY A;  1LAX A;  5ET5 A;  1B3F A;  2HFB A;  1MPD A;  4XKQ A;  3OSQ A;  4IO5 A;  3R7X A;  1FPF A;  4QFN A;  2ZYM A;  4DDD A;  2VPN A;  3OO7 A;  3UIF A;  1UIV A;  1O64 A;  4LQ2 A;  3MPK A;  1I6Q A;  2HZL A;  4DLD A;  3O6I A;  5JTY A;  3H4Z A;  4MAG A;  4G68 C;  2F5X A;  3B6T A;  4MFI A;  3N94 A;  3PUV E;  4Q30 B;  4N8G A;  5I57 B;  5LOM A;  1TFA A;  3IB1 A;  1MDQ A;  2OLB A;  4P9K A;  4NN3 A;  3SZP A;  1FPL A;  2I0C A;  4GXA A;  3H03 A;  3N6T A;  2HXW A;  1M5C A;  4MH5 A;  4YZZ A;  2DOJ A;  1ZKB A;  1DTZ A;  4NF8 B;  4IO4 A;  3DM0 A;  3TAJ A;  3CSG A;  3HHG A;  4F22 A;  5I2N B;  3JZJ A;  2BJI A;  1LGB C;  2RCB A;  3KBR A;  4GIZ A;  1NUW A;  2DXR A;  4KYS A;  3Q26 A;  3I3V A;  1KZ8 A;  4P1E A;  4ESX A;  4QXD A;  1MPC A;  3ILU B;  2X26 A;  4EDP A;  3K6V A;  3H6V A;  5L9S A;  3VVF A;  3K6X A;  1Z7M E;  4JSO A;  2AIX A;  4XXU A;  3S9E A;  4F2Q A;  1XT8 A;  1NKX A;  1S9T A;  4JXI A;  5AA4 B;  3D1R A;  3SER A;  3OSR A;  2UVI A;  5I58 A;  3USD A;  1B40 A;  1NUZ A;  4PE3 A;  4OEN A;  1FPD A;  5DEX A;  1D9Q A;  2XA5 A;  4MBP A;  5IAI A;  3CG1 A;  4GVO A;  1IXG A;  3S4U A;  4M1V A;  1FPI A;  4MMP A;  4R9F A;  2FA7 A;  2YLN A;  3LSL A;  3IJO B;  4JDF A;  2XX8 A;  4GRK A;  1B32 A;  1FQF A;  4X48 A;  1SDX A;  4OVR A;  2R6G E;  3E3K A;  1P1W A;  2A5T B;  4DI4 B;  4GX3 A;  2PVU A;  1NV5 A;  3IOW A;  4XF5 A;  1IME A;  3W9V A;  2Q2C A;  5H8F A;  4HXV A;  3EQ1 A;  1UTB A;  3U93 A;  1Q9D A;  2OCU A;  5A5X B;  1ZU0 A;  3O97 A;  3FAS A;  4P56 A;  3N6U A;  4F1U A;  3EHS A;  2D5W A;  4JB7 A;  2Z8D A;  2HZK A;  2PCR A;  4PF6 A;  2NVU B;  2X7Q A;  1SI0 A;  3E79 A;  4NWD A;  1NV6 A;  1AMF A;  3RUM A;  3SES A;  1IIW A;  1QKA A;  5B70 A;  3CI8 A;  5ET7 A;  3A09 A;  4LAT A;  3UP9 A;  4GL8 A;  3K2D A;  4F3G A;  2F6G A;  4N07 A;  4Q5T A;  4DI3 D;  4FE8 A;  4H6D A;  2L5V A;  1FTL A;  1B51 A;  4MLV A;  3MUQ A;  4DXB A;  1OMP A;  3C36 A;  4IO7 A;  2UYF A;  4OFO A;  5TP9 B;  3KN7 A;  1EZO A;  2PX1 A;  3FVK A;  3BFU A;  4NF0 A;  1LCF A;  3N26 A;  4OVJ A;  1KA1 A;  4U21 A;  1G0H A;  4DZ1 A;  2XX7 A;  4OES A;  3OEK A;  3MVW A;  1FJ9 A;  2DVC A;  4NF4 A;  4TLM B;  3DLN A;  4F19 A;  3O29 A;  1FRP A;  1GVC A;  4OWD A;  3N5L A;  2DQV A;  2V4C A;  4PBH A;  3R26 A;  1NNF A;  4PDH A;  4P47 A;  4U1O A;  2CEY A;  4F18 A;  1FTA A;  2WYP A;  4OFJ A;  5AA2 B;  3ODB A;  2KR0 A;  1IMF A;  1BK4 A;  2ESN A;  4I9D A;  2ZYO A;  3SEY A;  5TPA B;  4EF1 A;  2XXI A;  4GX6 A;  3CIJ A;  2VD2 A;  4XKR A;  3G3K A;  4Z0I A;  1B7U A;  1JW1 A;  4MIJ A;  3TFL A;  1FSA A;  4RY1 A;  4BDL A;  1VE4 A;  3BBR A;  4RNS A;  2ZYN A;  3OD7 A;  1PDA A;  2DWA A;  2WX9 A;  4GL0 A;  3V89 B;  3K6U A;  1NNP A;  1J1N A;  1LBZ A;  2ZZX A;  2AYS A;  4AB6 A;  1SYI A;  4HE0 A;  4HCW A;  4BDR A;  3FVN A;  4U22 A;  4N91 A;  1PC3 A;  4HE2 A;  4OVP A;  1S50 A;  1MH3 A;  1XVY A;  4PFW A;  2F6P A;  1AH5 A;  3CSB A;  3QXM A;  4QSC A;  1B52 A;  1YPN A;  4FAT A;  3Q27 A;  3T0J A;  5K2Y A;  5FTI A;  3OMB A;  2D21 A;  3M3F A;  1N84 A;  3ZKK A;  3FZV A;  3TOD A;  2Q2A A;  1URG A;  1B4Z A;  3A3U A;  4MNP A;  1DSN A;  2F34 A;  4EQB A;  2YJP A;  1EYK A;  1ZIU A;  3KJ7 A;  1MM6 A;  4TLL B;  1PEB A;  3QMF A;  3L6G A;  4ZEF A;  3LUZ A;  4N6P A;  5EHM A;  4PP0 A;  2ZNT A;  4PGN A;  3TEP A;  1LBB A;  3T9H B;  4MHF A;  1LCT A;  5DT6 A;  4NG7 A;  1H45 A;  5DW8 A;  2O51 A;  1Y3Q A;  1N3W A;  3LC8 A;  1DOT A;  4ZZA A;  2B3F A;  4YMA A;  1QUL A;  1I6A A;  2CMO A;  3LSX A;  1GGG A;  4GWZ A;  3SEX A;  3R6U A;  4O8M A;  5I84 A;  1SW5 A;  2PT2 A;  2IEE A;  1ZJL A;  5CC2 A;  2XWO A;  1PB7 A;  1JQF A;  1IXC A;  1FQC A;  3RPL A;  1AIV A;  5IZ3 A;  2ONK E;  3CFX A;  5EQA A;  2ZYK A;  4RXL A;  1B0L A;  3MZ9 A;  5KDT A;  1DTG A;  1NI9 A;  4FJP A;  2WBB A;  1ZTY A;  3C31 A;  4XTC Q;  5I3S A;  2NUV A;  3AXF A;  3JV9 A;  5ISU A;  3IB2 A;  3UGW A;  4O3A A;  2NOO A;  3K1N A;  1LBY A;  1R1N A;  2F7B A;  1OIB A;  2DWI A;  5ET6 A;  1JNF A;  5T3J A;  2PBW A;  3HV1 A;  4ZDM A;  3CVG A;  2WKY A;  3TMG A;  3FVO A;  3PPP A;  5B7D A;  3E4R A;  2FHY A;  2Y5K A;  4F1Y A;  2YPN A;  4ZZE A;  3GLB A;  2B4M A;  4P11 A;  2Z8E A;  3C4M A;  4NWC A;  4YMB A;  4H0W A;  4PFY A;  3VE1 B;  4UAB A;  4EXK A;  2HEU A;  3Q28 A;  4MJO A;  3B6Q A;  4AQ4 A;  4H5F A;  4PET A;  1YTV A;  1B7H A;  1LST A;  3K01 A;  4MF3 A;  2ZMB A;  1ZMG A;  3O66 A;  3PGF A;  1ELJ A;  5FHN A;  1QUJ A;  1FQB A;  1MQI A;  1OQH A;  2B4L A;  1XOC A;  2UVG A;  3VLU A;  1B2H A;  3TUS A;  2CEX A;  4O7I A;  3M3K A;  4PAI A;  2W7Y A;  4TOZ A;  5DVF A;  4OXV A;  3B6W A;  2CZH A;  1LB8 A;  4RPN A;  1FBG A;  3TYH A;  3VLW A;  2ANJ A;  3JYR A;  1R9L A;  4C1T A;  1FTK A;  2H99 A;  1TFD A;  5I57 A;  1WVJ A;  2FBP A;  4YB6 A;  4OAN A;  4H5G A;  4KQP A;  5I59 B;  4OVQ A; 
#chains in the Genus database with same CATH homology
 3E13 X;  1GR2 A;  3OO9 A;  1B3G A;  2DWJ A;  2I3W A;  2ZXT A;  3KOS A;  3VV5 A;  3OEM A;  1LLS A;  2OWS A;  5HPQ A;  4NED A;  5I2N A;  1ANF A;  5F7V A;  4F2O A;  2DE2 A;  2P2A A;  2X7P A;  4LA9 A;  3K1M A;  5FHM A;  4O3B A;  1KWH A;  2ALU A;  1WDN A;  1P1N A;  4OEV A;  2B65 A;  1MXX A;  1CB6 A;  5CBR A;  4QFL A;  1XVX A;  2Z23 A;  2Q88 A;  4YAH X;  4P0G A;  3SEW A;  4X1B A;  2F8D A;  1OLC A;  2O68 A;  3H6U A;  3VDF A;  1LFH A;  4FED A;  1GV8 A;  1B3L A;  4FOR A;  3KN3 A;  3KSX A;  2V3T A;  1VSO A;  4F3B A;  1B0H A;  4U4X A;  1IUD A;  3RPW A;  2DXY A;  2XXR A;  4FAJ A;  1II5 A;  5JTY B;  2XXU A;  3TTM A;  2OJT A;  3WAE A;  1MY4 A;  1SQY A;  4DCY A;  3D4C A;  4QFP A;  4C1U A;  3PPO A;  4G8H A;  1FTO A;  2QL3 A;  4YB7 A;  3MW0 A;  3K6W A;  2Y7K A;  1BP5 A;  4KYD A;  3MP1 A;  3HN0 A;  4EXL A;  4ELQ A;  1RYX A;  5IKB A;  1B3H A;  5ITO A;  2QSX A;  2RCA A;  3TTK A;  4Q8R A;  3LR1 A;  4R75 A;  4C0R A;  4WEP A;  4HW8 A;  1VFD A;  3FAT A;  2UXA A;  3I6V A;  4BDM A;  4R74 A;  4Q0C A;  3U94 A;  2AL5 A;  1AL3 A;  3CG3 A;  1MM7 A;  3O6G A;  2GH9 A;  3QIM A;  1JEU A;  1H43 A;  4G68 B;  2GHB A;  5KZT A;  2XXQ A;  3RN8 A;  3PD8 A;  2GHA A;  1JVY A;  4G77 A;  1B05 A;  3ECR A;  1DPP A;  1M5B A;  5I58 B;  1T0K A;  1MY2 A;  3MBP A;  4KCC A;  3EF7 A;  5F1Q A;  4ELO A;  3OEL A;  3SKP A;  1MY3 A;  5DEX B;  1NH7 A;  3P7I A;  5HM4 B;  2OK2 A;  4ONY A;  4HCY A;  1TWY A;  3IR1 A;  4U1Z A;  1OVT A;  3KN8 A;  3G3F A;  1P1O A;  1OVB A;  1Y1Z A;  3RGY A;  1MXW A;  4PQJ A;  3PV0 E;  3PPN A;  3LSW A;  3FXQ A;  5DVI A;  5J1D A;  3M8U A;  3KZG A;  5BUU A;  3LUY A;  5H8F B;  4POW A;  1MRP A;  1MQG A;  1EH3 A;  1YCJ A;  5I2K A;  1UTB B;  3K02 A;  3KG2 A;  4GOT A;  2RC8 A;  1USY E;  5TPA A;  1B5I A;  3TZA A;  4YB5 A;  2Q9T A;  3C9H A;  2DS9 A;  3PMX A;  1Y3P A;  4YKI A;  2V93 A;  1IZ1 A;  3A3C A;  4BDO A;  3TEL A;  1A7L A;  3DEL B;  3ONM A;  5H8N A;  1POY 1;  2I0B A;  2QJE A;  2QMW A;  2XD3 A;  1B3E A;  1I69 A;  5HBC A;  2B3B A;  1QKB A;  1O63 A;  3ZS6 A;  1I6B A;  4NF5 A;  1L5T A;  2Y7I A;  3F11 A;  4RPO A;  2I3V A;  5CRY A;  1DMB A;  1Y3N A;  1MXU A;  2R9J A;  1URD A;  4OMB A;  3ILT B;  2P1S A;  1FQE A;  1OLA A;  1Y4T A;  3BFT A;  3HCQ A;  5JEI A;  3V5A A;  2DYX A;  2G93 A;  1N0T A;  1ZLQ A;  5L9O A;  2PT1 A;  3QSL A;  3EN3 A;  4NF4 B;  1CE2 A;  3RLF E;  5AA2 D;  2XXX A;  5I56 A;  4LVQ A;  3HST A;  3UK4 A;  3PPQ A;  4LP2 B;  3T96 B;  2P0S A;  5L9M A;  4LON B;  2H25 A;  1QUK A;  5M2V A;  3IO6 A;  2ABH A;  1IXI A;  4IY6 A;  5H8Q A;  2H9B A;  3DP6 A;  3FVG A;  3FV2 A;  2PYY A;  1JW4 A;  4DIG A;  3MVX A;  4JSD A;  1R9Q A;  3IOR A;  1MQH A;  3SET A;  3ZSF A;  1A99 A;  4F3S A;  3V83 A;  3SEV A;  2UVJ A;  1F9B A;  2ZNU A;  3FXU A;  3RNN A;  4P0I A;  5KCJ A;  1XHY A;  5DYH A;  1UTH A;  3FUZ A;  1M5E A;  3SEU A;  5ICT A;  4GWO A;  3PU5 A;  3CFZ A;  5H8H A;  2Y84 A;  3BKI B;  4NF6 A;  2ZNS A;  3HHF A;  3Q25 A;  4WKM A;  4OET A;  4H67 A;  3OEN A;  4ZEC A;  4UA8 A;  3IOU A;  3QUF A;  4KCD A;  2V3U A;  1US4 A;  3CFL A;  1Z7N E;  3T22 A;  3VFJ A;  2XXY A;  4H8J A;  3TPA A;  4ISU A;  3TQW A;  2I6E A;  4UAC A;  1B5J A;  1ATG A;  1B46 A;  1B6H A;  1FW0 A;  4E0X A;  4YIC A;  2F36 A;  1URS A;  3HPI A;  4YKP A;  2VGQ A;  4ESW A;  2QS4 A;  3Q29 A;  1OQG A;  4XIG Q;  2OZZ A;  1POT A;  1JEV A;  1N76 A;  1WOD A;  4JBZ A;  1RYO A;  1SW2 A;  4EUO A;  4LQ5 A;  1BLF A;  3K1P A;  2NWJ A;  4GLI A;  3K4U A;  4QHQ A;  4FEB A;  3K00 A;  4DE8 A;  1SD3 A;  4YKK A;  4IO2 A;  3H6T A;  2Y7P A;  3VVD A;  1IEJ A;  2I58 A;  2V25 A;  4DXU A;  3DP4 A;  4KFQ A;  4G8N A;  1RKM A;  3GBA A;  3FXR A;  4ZEI A;  4X1D A;  2VHA A;  3EPE A;  3QAX A;  3LSF B;  3QYT A;  5KDT B;  1H44 A;  4QSE A;  4RK2 A;  1SVX B;  1Y4C A;  4NTL A;  3S2V A;  3S9L C;  2DE3 A;  4U23 A;  2REG A;  3IAZ A;  4LZ8 A;  2DVZ A;  1Y9U A;  4U2R A;  2E1S A;  5L8D A;  1MDP 1;  3IJX B;  4YU0 A;  1P99 A;  1A55 A;  3RY3 A;  4WED A;  2QS1 A;  3FIR A;  3VXC A;  4DCX A;  2QPQ A;  4NE4 A;  2HCA A;  3MJN A;  3IL1 B;  3MVZ A;  2R71 A;  3LBS A;  2O1L A;  3MWB A;  2AL4 A;  3G3J A;  3TTR A;  3GBB A;  3OXN A;  4EQ9 A;  4NF8 A;  2RC9 A;  5FHO A;  4JWX A;  4RA1 A;  3T9U A;  1O7T A;  2RKM A;  2UYE A;  4LZ5 A;  1A40 A;  3C34 A;  1MH4 A;  4POX A;  2CZL A;  2RIN A;  1D3K A;  3PD9 A;  2OWT A;  2XXT A;  2LAO A;  2O7I A;  1BKA A;  4R9G A;  5CMB A;  2FNC A;  2E0S A;  4IGT A;  1M5D A;  4ND9 A;  1UQW A;  1H76 A;  3S9N C;  4PE5 B;  4OHN A;  5ELV A;  3MC2 A;  4U4S A;  3MAM A;  3VXB A;  2F7A A;  1UIU A;  3I5O A;  3PUW E;  5AA4 A;  2NXO A;  3OO6 A;  5JK4 A;  3U8Q A;  3T9X B;  3RTF B;  3W9W A;  2H5Y A;  4ZED A;  1FQA A;  1NL5 A;  1VR5 A;  1ZBM A;  5K2X A;  1AOV A;  1MXV A;  4PFU A;  3T66 A;  1P1U A;  2GRV A;  1SW1 A;  3T93 B;  1SI1 A;  1PBQ A;  2A5T A;  3HO7 A;  4IO6 A;  2F97 A;  3FJG A;  2Y7W A;  2I49 A;  3TTN A;  4EF2 A;  4G68 A;  1Y20 A;  3B7D A;  3IB0 A;  5A5X A;  5EHS A;  2O6A A;  1EU8 A;  5H8S A;  4M4G A;  2A5S A;  4RK9 A;  1VFE A;  1B1H A;  3PMV A;  3PUZ E;  2XXP A;  2F78 A;  2XXV A;  4I8C A;  2O84 X;  4KR5 A;  4IB2 A;  4ECF A;  4OYV A;  5TU0 A;  1A8E A;  3FJM A;  4FIM A;  2BJJ X;  2OBG A;  3D4G A;  1JET A;  1B5H A;  1US5 A;  4QRZ A;  4BDN A;  1B7Z A;  2HAV A;  3QK6 A;  4OTE A;  3FV1 A;  4G8M A;  5TP9 A;  1QW0 A;  1QVS A;  5BWJ A;  2DP8 A;  2KLF A;  1M5F A;  4G4P A;  2G29 A;  3G7W A;  3EHU A;  4OZ9 A;  3O9P A;  3RT8 A;  4KHZ E;  2VP1 A;  2QMX A;  1R6Z A;  1HSJ A;  3OOA A;  2IA4 A;  1BIY A;  2XHD A;  1FTJ A;  4F31 B;  4QSD A;  4I1D A;  2O1M A;  1LAG E;  4H65 A;  3O28 A;  2THI A;  3TKD A;  4R2B A;  4ZEK A;  3KOT A;  5AA2 A;  1N7W A;  1B1X A;  2RC7 A;  3QUJ A;  3UA8 A;  1D4N A;  4XKP A;  3V8X B;  1MPB A;  5AA3 A;  3MPL A;  4IGR A;  1PBP A;  4NMY A;  2F7C A;  1A54 A;  2XD2 A;  3SDF A;  4GD5 A;  4H1X A;  1LAH E;  4BDQ A;  4TQU Q;  1N7X A;  4KD5 A;  1A8F A;  4R6H A;  3IO4 A;  3TQL A;  3ZKL A;  1D9Y A;  4FEC A;  1JVX A;  2HAU A;  3VVE A;  4HS7 A;  1QJM A;  4QF9 A;  2Z22 A;  1DPE A;  4N13 A;  1FTM A;  4L17 A;  1FCK A;  2QS2 A;  4F1V A;  4GQO A;  1Y1M A;  2XX9 A;  3MVY A;  2QS3 A;  4ELP A;  3UN6 A;  1LAF E;  1LB9 A;  1HSL A;  5I2K B;  2Q8J A;  3E9X A;  3IOV A;  4LUB A;  2I4C A;  1SYH A;  2PMS A;  4RYA A;  1Q1K A;  4H8I A;  1PB9 A;  3T9V A;  2Q89 A;  4OER A;  4R6Y A;  1NH8 A;  4YKJ A;  1MY1 A;  2Z8F A;  1D9V A;  5CM6 A;  2XXW A;  4BLA A;  3L6H A;  3K0V A;  5EYF A;  4KPT A;  5H8N B;  4AB5 A;  1FQD A;  4R2F A;  2H4I A;  3MZB A;  1EZ9 A;  2Y7R A;  1PB8 A;  1MQJ A;  1H3D A;  3VLV A;  4NF5 B;  1MS7 A;  1MY0 A;  3KSJ A;  3FGS A;  3TDJ A;  2ONS A;  1MG1 A;  4JWO A;  5CMC A;  2DWH A;  5CBS A;  2M8C A;  1B9J A;  1MXZ A;  2FYI A;  3H7M A;  4R72 A;  3U92 A;  1IQ7 A;  3S9M C;  5AE4 A;  2I48 A;  5CI5 A;  5FTH A;  1TT1 A;  2I4B A;  3PMW A;  4HTG A;  2VD3 A;  3G3H A;  3MZ1 A;  4X9T A;  3C33 A;  5DTB A;  4ZE9 A;  3OO8 A;  1HSE A;  2F35 A;  4IO3 A;  4K3F A;  1SBP A;  3KFM A;  5I56 B;  1XC1 A;  1NNK A;  4ELR A;  1NMU A;  3CR9 A;  3RTW B;  4KI0 E;  3PUX E;  3H3G A;  4ZE8 A;  4ZS9 A;  4QFO A;  2UVH A;  3IOT A;  5H8Q B;  4R73 A;  2H98 A;  3KGC A;  3FD3 A;  4GF8 A;  4PFT A;  4F39 A;  3H06 B;  1TXF A;  3TCH A;  2QRY A;  1QUI A;  3O2A A;  4ZEB A;  4WXJ A;  4GXS B;  1USY H;  1Q35 A;  4MLQ A;  5KCJ B;  3FJ7 A;  4O3C A;  3W15 C;  1UTH B;  1MQD A;  2HQ0 A;  2V84 A;  3MQ9 A;  1MXY A;  4R6K A;  1SW4 A;  2XXH A;  4G2Z A;  1B4H A;  3UOR A;  3C32 A;  3CRB A;  5CMM A;  5H8H B;  4NF6 B;  1EZP A;  4XKN A;  4E0W A;  3PUY E;  4THI A;  2O7U A;  3DP8 A;  1JW5 A;  3IK6 B;  3RQT A;  3G3I A;  1B58 A;  5CMK A;  2GFE A;  4JWY A;  2RF1 A;  1N04 A;  3U1O A;  4F29 A;  3RT6 B;  1NFT A;  2D3I A;  4EQ7 A;  4OFL A;  4OQO A;  3IX1 A;  1NNT A;  2O69 A;  3TTL A;  2V3Q A;  4OEU A;  3WAF A;  1GTK A;  3GXA A;  1P1Q A;  3U72 A;  5ITP A;  1IIT A;  3THI A;  1S7Y A;  4Z7E A;  4IY5 A;  5AA1 A;  3KJT A;  3GZG A;  5I59 A;  3M3L A;  2ONR A;  5DVJ A;  4QFK A;  1LBC A;  1N3X A;  3MP8 A;  1BTJ A;  3MP6 A;  4F3P A;  2DE4 A;  1LFI A;  2DSF A;  3KEI A;  3O6H A;  4KYE A;  4DXC A;  4GFR A;  4RJZ A;  3H6W A;  1LFG A;  2REJ A;  4LZ7 A;  5ICQ A;  2VOZ A;  1YAE A;  3C35 A;  3PPR A;  4I62 A;  3TCF A;  1XS5 A;  3TCG A;  3EHT A;  3G3G A;  1IXH A;  1LAX A;  1B3F A;  2HFB A;  1MPD A;  4XKQ A;  3OSQ A;  4IO5 A;  3R7X A;  4QFN A;  2ZYM A;  4DDD A;  3OO7 A;  3UIF A;  1UIV A;  1O64 A;  3MPK A;  1I6Q A;  2HZL A;  4LQ2 A;  4DLD A;  3O6I A;  5JTY A;  3H4Z A;  4G68 C;  2F5X A;  3B6T A;  4MFI A;  3N94 A;  3PUV E;  4Q30 B;  5I57 B;  5LOM A;  1TFA A;  3IB1 A;  1MDQ A;  2OLB A;  2I0C A;  4GXA A;  3H03 A;  3N6T A;  2HXW A;  1M5C A;  4MH5 A;  4YZZ A;  2DOJ A;  1ZKB A;  1DTZ A;  4NF8 B;  4IO4 A;  3DM0 A;  3TAJ A;  3CSG A;  3HHG A;  4F22 A;  5I2N B;  3JZJ A;  1LGB C;  2RCB A;  3KBR A;  4GIZ A;  2DXR A;  4KYS A;  3Q26 A;  3I3V A;  4ESX A;  1MPC A;  3ILU B;  2X26 A;  4EDP A;  3K6V A;  3H6V A;  5L9S A;  3VVF A;  3K6X A;  1Z7M E;  4JSO A;  2AIX A;  4XXU A;  3S9E A;  4F2Q A;  1XT8 A;  1NKX A;  1S9T A;  4JXI A;  5AA4 B;  3SER A;  3OSR A;  2UVI A;  5I58 A;  3USD A;  1B40 A;  4OEN A;  5DEX A;  4MBP A;  5IAI A;  3CG1 A;  4GVO A;  1IXG A;  3S4U A;  4M1V A;  4R9F A;  2FA7 A;  2YLN A;  3LSL A;  3IJO B;  4JDF A;  2XX8 A;  4GRK A;  1B32 A;  1FQF A;  4X48 A;  1SDX A;  2R6G E;  3E3K A;  1P1W A;  2A5T B;  2PVU A;  3IOW A;  3W9V A;  2Q2C A;  5H8F A;  3EQ1 A;  1UTB A;  3U93 A;  2OCU A;  5A5X B;  1ZU0 A;  3O97 A;  3FAS A;  3N6U A;  4F1U A;  3EHS A;  2D5W A;  4JB7 A;  2Z8D A;  2HZK A;  2NVU B;  2X7Q A;  1SI0 A;  4NWD A;  1AMF A;  3RUM A;  3SES A;  1IIW A;  1QKA A;  5B70 A;  3CI8 A;  3A09 A;  4LAT A;  3UP9 A;  4GL8 A;  3K2D A;  4F3G A;  2F6G A;  4N07 A;  4Q5T A;  4FE8 A;  4H6D A;  1FTL A;  1B51 A;  4MLV A;  3MUQ A;  4DXB A;  1OMP A;  3C36 A;  4IO7 A;  2UYF A;  4OFO A;  5TP9 B;  3KN7 A;  1EZO A;  2PX1 A;  3FVK A;  3BFU A;  1LCF A;  3N26 A;  4OVJ A;  4U21 A;  4DZ1 A;  2XX7 A;  4OES A;  3OEK A;  3MVW A;  2DVC A;  4NF4 A;  4TLM B;  3DLN A;  4F19 A;  3O29 A;  1GVC A;  4OWD A;  3N5L A;  2DQV A;  4U1O A;  3R26 A;  1NNF A;  4F18 A;  4OFJ A;  5AA2 B;  3ODB A;  2ESN A;  4I9D A;  2ZYO A;  3SEY A;  5TPA B;  4EF1 A;  2XXI A;  3CIJ A;  2VD2 A;  4XKR A;  3G3K A;  4Z0I A;  1B7U A;  1JW1 A;  3TFL A;  4RY1 A;  4BDL A;  1VE4 A;  3BBR A;  4RNS A;  2ZYN A;  3OD7 A;  1PDA A;  2DWA A;  4GL0 A;  3V89 B;  3K6U A;  1NNP A;  1J1N A;  2AYS A;  4AB6 A;  1SYI A;  4HCW A;  4BDR A;  3FVN A;  4U22 A;  1PC3 A;  1S50 A;  1MH3 A;  1XVY A;  4PFW A;  2F6P A;  1AH5 A;  3CSB A;  3QXM A;  4QSC A;  1B52 A;  1YPN A;  4FAT A;  3Q27 A;  5K2Y A;  5FTI A;  3OMB A;  2D21 A;  3M3F A;  1N84 A;  3ZKK A;  3FZV A;  3TOD A;  2Q2A A;  1URG A;  1B4Z A;  3A3U A;  1DSN A;  2F34 A;  4EQB A;  2YJP A;  1ZIU A;  3KJ7 A;  1MM6 A;  4TLL B;  1PEB A;  3L6G A;  4ZEF A;  4N6P A;  5EHM A;  4PP0 A;  2ZNT A;  3TEP A;  1LBB A;  3T9H B;  1LCT A;  5DT6 A;  1H45 A;  2O51 A;  1Y3Q A;  1N3W A;  3LC8 A;  1DOT A;  4ZZA A;  2B3F A;  4YMA A;  1QUL A;  1I6A A;  2CMO A;  3LSX A;  1GGG A;  3SEX A;  3R6U A;  5I84 A;  1SW5 A;  2PT2 A;  2IEE A;  1ZJL A;  5CC2 A;  1PB7 A;  1JQF A;  1IXC A;  1FQC A;  1AIV A;  2ONK E;  3CFX A;  2ZYK A;  4RXL A;  1B0L A;  3MZ9 A;  5KDT A;  1DTG A;  4FJP A;  1ZTY A;  3C31 A;  4XTC Q;  2NUV A;  3AXF A;  3JV9 A;  5ISU A;  3IB2 A;  3UGW A;  4O3A A;  2NOO A;  3K1N A;  1R1N A;  2F7B A;  1OIB A;  2DWI A;  1JNF A;  2PBW A;  3HV1 A;  4ZDM A;  3CVG A;  2WKY A;  3TMG A;  3FVO A;  3PPP A;  5B7D A;  3E4R A;  4F1Y A;  2YPN A;  4ZZE A;  3GLB A;  4P11 A;  2Z8E A;  3C4M A;  4NWC A;  4YMB A;  4H0W A;  4PFY A;  3VE1 B;  4EXK A;  2HEU A;  3Q28 A;  3B6Q A;  4AQ4 A;  4H5F A;  4PET A;  1YTV A;  1B7H A;  1LST A;  3K01 A;  4MF3 A;  2ZMB A;  1ZMG A;  3O66 A;  3PGF A;  1ELJ A;  5FHN A;  1QUJ A;  1FQB A;  1MQI A;  1OQH A;  1XOC A;  2UVG A;  3VLU A;  1B2H A;  3TUS A;  3M3K A;  2W7Y A;  4TOZ A;  5DVF A;  4OXV A;  3B6W A;  1LB8 A;  4RPN A;  3TYH A;  3VLW A;  2ANJ A;  3JYR A;  1R9L A;  4C1T A;  1FTK A;  2H99 A;  1TFD A;  5I57 A;  1WVJ A;  4YB6 A;  4H5G A;  4KQP A;  5I59 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...