2ONTA

A swapped dimer of the hiv-1 capsid c-terminal domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
73
structure length
73
Chain Sequence
TSILDIRQGPKEPFRDYVDRFYKTLRAEQSQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Capsid protein p24
publication title Domain-swapped dimerization of the HIV-1 capsid C-terminal domain
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Viral protein
total genus 22
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2ontA01
4PH0A 1A8OA 2JO0A 2BUOA 3DS0A 3G1IA 2JYGA 3NTEA 4IPYA 2M8PA 4XFXA 5DCKA 1AUMA 2M8NA 3VRLC 3DPHA 1BAJA 3DS3A 1EOQA 5HGOA 3G28A 2M8LA 2XXMA 4U0EA 4U0DA 4XFYA 5HGLA 3DS2A 4U0AA 2L6EA 1EIAA 3DTJA 3G21A 4XFZA 4M0IA 4XROA 5HGMA 1A43A 2KODA 2XT1A 3G26A 3G29A 5I4TG 4U0BA 3H47A 4XRQA 3DS1A 3H4EA 2JYLA 3MGEA 4U0CA 3DS5A 1E6JP 3G0VA 5HGNA 3DS4A 4COCA 2XV6A 3G1GA 4U0FA 2ONTA 1QRJA 4QNBA 1D1DA 5JPAA 3LRYA 2LF4A 3P05A 2EIAA 4PH1A 4COPA 4WYMA
chains in the Genus database with same CATH superfamily
5KP8B 2GDYA 2JYGA 3CCEP 1GXHA 1ZMBA 3CC7P 3CCJP 2N50A 2KG9A 2GYKA 2XZ0D 1RO0A 3CC2P 2VLNA 1K9MQ 5F2NA 1HQBA 3G0VA 1VQOP 3EJEA 3CMEP 2Z46A 2KG6A 2PNGA 3G1IA 4XFXA 2MR8A 3B4QA 4IZ6A 2LKIA 4H2XC 1KD1Q 3CCUP 4R0MA 4U0AA 2LIUA 1N8RQ 2ERHA 3OW2O 2N5IA 2DGYA 4COCA 2ONTA 1QRJA 2JB0A 3LMOA 1NJIQ 2VSQA 2K93A 1EOQA 3CPWO 3CXCO 1VQLP 1RO2A 4U0EA 1FR2A 2XZ1C 1EIAA 2EHSA 2K2QA 3HYBA 2GZGA 2BHVA 2CQ8A 1YJ9P 1NQ4A 2XV6A 4NEOA 1D1DA 5KP7B 4WYMA 3U43A 1VQ9P 2KGCA 2ROQA 2CWOA 2JQ4A 1JJ2O 2KGDA 3G71P 4XROA 2AF8A 1Z6MA 5BS1A 1VKUA 2MF4A 2PEMA 1RNIA 5F2OA 3RG6C 5HVCA 2LPKA 3NTEA 5JPAA 3CD6P 2FVEA 2M8LA 1YJNP 3GZLA 2FHSC 1GPJA 2PEJA 1VQ8P 2K0DX 1YHQP 2M5RA 2XT1A 1L0IA 2FQ0A 2K5XA 2AFEA 3DS4A 1VQ7P 2OTLP 4QNBA 2VLOA 2KOPA 2KORA 3EJBA 2JGPA 2K94A 3EJDA 2N6YA 1K8AQ 1IMQA 1E0HA 2LL8A 2CNRA 2CG5B 2X2BA 5BS2A 2AVAA 1M1KQ 1HY8A 2JO0A 4IPYA 2L4BA 5KP6B 3DS3A 1M74A 5EW5E 2PENA 1M6NA 2FVAA 4XFZA 3I56P 1AYIA 4GR2A 3H47A 1E6JP 2L22A 1X3OA 2K0YA 2KGAA 2LF4A 3E2DA 4PH1A 1OR5A 2JBGA 2M8PA 1Q82Q 5DCKA 2PEKA 2FVFA 3CCQP 7CEIA 5HGOA 3GJNA 2Z44A 1A43A 2FAEA 1F80D 2FADA 1EMVA 2Z45A 3RG2A 2MVVA 1IUQA 2EIAA 3DPHA 3WBHA 2LIWA 5HGLA 1YI2P 1ACPA 2JU1A 4H2YC 4H2WC 1MZ8A 1VHNA 1IMPA 2OTJP 2LTEA 4PH0A 1A8OA 5HGMA 2PY8A 2GZJA 1QVGO 2LMLA 2OARA 1KQSO 4MRTC 2JU2A 2N98A 3DS1A 1Q86Q 2JYLA 3B5IA 2GDWA 1CEIA 4U0CA 1K73Q 3H0DA 1YJWP 1KC8Q 2EG5A 2MR7A 1DNYA 3DS0A 3M1MA 2M8NA 1BAJA 4BPHA 1S72P 4XFYA 2KOOA 1K30A 2EFJA 3Q20A 2VLQA 4BPFA 3G29A 3MGEA 3DS5A 4BPGA 4GR6A 2PEQA 1ZNVA 2DNWA 1W2BO 2JAZA 2KGEA 2BUOA 4PWVB 2KG8A 1BXIA 4QKOA 2K92A 2FQ2A 4XRQA 3CCSP 1KLPA 2KOQA 3NY7B 1M6EX 2GZEA 3CCRP 3VRLC 1Q81Q 2LOLA 2XXMA 2E1MA 1T8KA 4DG9A 2KW2A 4PXHB 3HZQA 3G21A 2MY5A 1UNKA 3CCVP 1M90Q 2P9XA 1UJZA 1Q7YQ 4UHPB 1VQMP 1AF8A 3P05A 5F2KA 4COPA 2FQ1A 1QVFO 1VQNP 1AUMA 3GZMA 1VQ4P 2QA4P 3CCMP 5HV8A 1VQ6P 4U0DA 2MD9A 4M0IA 2N6ZA 2MVUA 2EHTA 2N5HA 1VQPP 5I4TG 2PEOA 1DV5A 1GXGA 2L0QA 3LRYA 2FACA 2QNWA 2K0XA 3CMAP 3CE7A 4HKGA 2GZFA 3G28A 1VQ5P 3GKLC 2L6EA 2VLPA 3DTJA 4CA3A 2WPTA 2KODA 2KWLA 3G26A 1YITP 3CC4P 4U0BA 2QEXP 2PEIA 2GZIA 5HGNA 3CCLP 2NO8A 3G1GA 4U0FA 1YIJP 2GDXA 5EJDA 3G4SP 2KR5A 3I55P 3DS2A 2CGQA 2AFDA 3H4EA 1L0HA 4F37A 2L9FA 5CZDB 3G6EP 1VQKP 2KOSA
chains in the Genus database with same CATH topology
1M6EX 3NTEA 5JPAA 2JYGA 3CD6P 3CCEP 3CCRP 3VRLC 3DPHA 2M8LA 2XXMA 1YJNP 1Q81Q 1ZMBA 2E1MA 3WBHA 5HGLA 2PEJA 3CC7P 3HZQA 3CCJP 3G21A 1VQ8P 1YI2P 1YHQP 1RO0A 2XT1A 3CC2P 3CCVP 1K9MQ 1M90Q 5F2NA 3G0VA 3DS4A 2P9XA 1VQ7P 1VQOP 1Q7YQ 3CMEP 2OTLP 4QNBA 2OTJP 2Z46A 1VQMP 3P05A 5F2KA 4COPA 1QVFO 4PH0A 1A8OA 5HGMA 3G1IA 2PY8A 4XFXA 1VQNP 1AUMA 1VQ4P 2QA4P 3CCMP 1KD1Q 3CCUP 1K8AQ 1QVGO 4U0DA 1VQ6P 2OARA 4U0AA 1KQSO 4M0IA 1VQPP 1N8RQ 5I4TG 2PEOA 5BS2A 3DS1A 3OW2O 1Q86Q 2JYLA 1M1KQ 3B5IA 2DGYA 4U0CA 1K73Q 4COCA 3H0DA 1YJWP 1KC8Q 2EG5A 2ONTA 1QRJA 3LRYA 1NJIQ 3CMAP 2JO0A 3DS0A 3M1MA 4IPYA 2M8NA 1BAJA 3DS3A 1EOQA 3CPWO 1M74A 3G28A 3CXCO 2PENA 1VQLP 1VQ5P 1RO2A 4U0EA 1M6NA 1S72P 4XFYA 1K30A 2EFJA 1EIAA 2L6EA 3DTJA 4XFZA 3I56P 3Q20A 3HYBA 2KODA 1YITP 3G26A 4GR2A 3G29A 3CC4P 4U0BA 2QEXP 3H47A 3MGEA 2PEIA 2BHVA 3DS5A 1E6JP 1VQKP 1YJ9P 4GR6A 2PEQA 5HGNA 3CCLP 2XV6A 3G1GA 4U0FA 1YIJP 1D1DA 2LF4A 1W2BO 3E2DA 4PH1A 4WYMA 3G4SP 1VQ9P 2BUOA 3I55P 2M8PA 1Q82Q 5DCKA 2PEKA 3CCQP 5HGOA 2CWOA 2Z44A 3DS2A 1JJ2O 3G71P 4XROA 1A43A 4XRQA 5BS1A 3H4EA 3CCSP 2Z45A 2PEMA 3G6EP 1RNIA 1IUQA 2EIAA 5F2OA 3RG6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PH0 A;  1A8O A;  2JO0 A;  2BUO A;  3DS0 A;  3G1I A;  2JYG A;  3NTE A;  4IPY A;  2M8P A;  4XFX A;  5DCK A;  1AUM A;  2M8N A;  3VRL C;  3DPH A;  1BAJ A;  3DS3 A;  1EOQ A;  5HGO A;  3G28 A;  2M8L A;  2XXM A;  4U0E A;  4U0D A;  4XFY A;  5HGL A;  3DS2 A;  4U0A A;  2L6E A;  1EIA A;  3DTJ A;  3G21 A;  4XFZ A;  4M0I A;  4XRO A;  5HGM A;  1A43 A;  2KOD A;  2XT1 A;  3G26 A;  3G29 A;  5I4T G;  4U0B A;  3H47 A;  4XRQ A;  3DS1 A;  3H4E A;  2JYL A;  3MGE A;  4U0C A;  3DS5 A;  1E6J P;  3G0V A;  5HGN A;  3DS4 A;  4COC A;  2XV6 A;  3G1G A;  4U0F A;  2ONT A;  1QRJ A;  4QNB A;  1D1D A;  5JPA A;  3LRY A;  2LF4 A;  3P05 A;  2EIA A;  4PH1 A;  4COP A;  4WYM A; 
#chains in the Genus database with same CATH topology
 5KP8 B;  2GDY A;  2JYG A;  3CCE P;  1GXH A;  1ZMB A;  3CC7 P;  3CCJ P;  2N50 A;  2KG9 A;  2GYK A;  2XZ0 D;  1RO0 A;  3CC2 P;  2VLN A;  1K9M Q;  5F2N A;  1HQB A;  3G0V A;  1VQO P;  3EJE A;  3CME P;  2Z46 A;  2KG6 A;  2PNG A;  3G1I A;  4XFX A;  2MR8 A;  3B4Q A;  4IZ6 A;  2LKI A;  4H2X C;  1KD1 Q;  3CCU P;  4R0M A;  4U0A A;  2LIU A;  1N8R Q;  2ERH A;  3OW2 O;  2N5I A;  2DGY A;  4COC A;  2ONT A;  1QRJ A;  2JB0 A;  3LMO A;  1NJI Q;  2VSQ A;  2K93 A;  1EOQ A;  3CPW O;  3CXC O;  1VQL P;  1RO2 A;  4U0E A;  1FR2 A;  2XZ1 C;  1EIA A;  2EHS A;  2K2Q A;  3HYB A;  2GZG A;  2BHV A;  2CQ8 A;  1YJ9 P;  1NQ4 A;  2XV6 A;  4NEO A;  1D1D A;  5KP7 B;  4WYM A;  3U43 A;  1VQ9 P;  2KGC A;  2ROQ A;  2CWO A;  2JQ4 A;  1JJ2 O;  2KGD A;  3G71 P;  4XRO A;  2AF8 A;  1Z6M A;  5BS1 A;  1VKU A;  2MF4 A;  2PEM A;  1RNI A;  5F2O A;  3RG6 C;  5HVC A;  2LPK A;  3NTE A;  5JPA A;  3CD6 P;  2FVE A;  2M8L A;  1YJN P;  3GZL A;  2FHS C;  1GPJ A;  2PEJ A;  1VQ8 P;  2K0D X;  1YHQ P;  2M5R A;  2XT1 A;  1L0I A;  2FQ0 A;  2K5X A;  2AFE A;  3DS4 A;  1VQ7 P;  2OTL P;  4QNB A;  2VLO A;  2KOP A;  2KOR A;  3EJB A;  2JGP A;  2K94 A;  3EJD A;  2N6Y A;  1K8A Q;  1IMQ A;  1E0H A;  2LL8 A;  2CNR A;  2CG5 B;  2X2B A;  5BS2 A;  2AVA A;  1M1K Q;  1HY8 A;  2JO0 A;  4IPY A;  2L4B A;  5KP6 B;  3DS3 A;  1M74 A;  5EW5 E;  2PEN A;  1M6N A;  2FVA A;  4XFZ A;  3I56 P;  1AYI A;  4GR2 A;  3H47 A;  1E6J P;  2L22 A;  1X3O A;  2K0Y A;  2KGA A;  2LF4 A;  3E2D A;  4PH1 A;  1OR5 A;  2JBG A;  2M8P A;  1Q82 Q;  5DCK A;  2PEK A;  2FVF A;  3CCQ P;  7CEI A;  5HGO A;  3GJN A;  2Z44 A;  1A43 A;  2FAE A;  1F80 D;  2FAD A;  1EMV A;  2Z45 A;  3RG2 A;  2MVV A;  1IUQ A;  2EIA A;  3DPH A;  3WBH A;  2LIW A;  5HGL A;  1YI2 P;  1ACP A;  2JU1 A;  4H2Y C;  4H2W C;  1MZ8 A;  1VHN A;  1IMP A;  2OTJ P;  2LTE A;  4PH0 A;  1A8O A;  5HGM A;  2PY8 A;  2GZJ A;  1QVG O;  2LML A;  2OAR A;  1KQS O;  4MRT C;  2JU2 A;  2N98 A;  3DS1 A;  1Q86 Q;  2JYL A;  3B5I A;  2GDW A;  1CEI A;  4U0C A;  1K73 Q;  3H0D A;  1YJW P;  1KC8 Q;  2EG5 A;  2MR7 A;  1DNY A;  3DS0 A;  3M1M A;  2M8N A;  1BAJ A;  4BPH A;  1S72 P;  4XFY A;  2KOO A;  1K30 A;  2EFJ A;  3Q20 A;  2VLQ A;  4BPF A;  3G29 A;  3MGE A;  3DS5 A;  4BPG A;  4GR6 A;  2PEQ A;  1ZNV A;  2DNW A;  1W2B O;  2JAZ A;  2KGE A;  2BUO A;  4PWV B;  2KG8 A;  1BXI A;  4QKO A;  2K92 A;  2FQ2 A;  4XRQ A;  3CCS P;  1KLP A;  2KOQ A;  3NY7 B;  1M6E X;  2GZE A;  3CCR P;  3VRL C;  1Q81 Q;  2LOL A;  2XXM A;  2E1M A;  1T8K A;  4DG9 A;  2KW2 A;  4PXH B;  3HZQ A;  3G21 A;  2MY5 A;  1UNK A;  3CCV P;  1M90 Q;  2P9X A;  1UJZ A;  1Q7Y Q;  4UHP B;  1VQM P;  1AF8 A;  3P05 A;  5F2K A;  4COP A;  2FQ1 A;  1QVF O;  1VQN P;  1AUM A;  3GZM A;  1VQ4 P;  2QA4 P;  3CCM P;  5HV8 A;  1VQ6 P;  4U0D A;  2MD9 A;  4M0I A;  2N6Z A;  2MVU A;  2EHT A;  2N5H A;  1VQP P;  5I4T G;  2PEO A;  1DV5 A;  1GXG A;  2L0Q A;  3LRY A;  2FAC A;  2QNW A;  2K0X A;  3CMA P;  3CE7 A;  4HKG A;  2GZF A;  3G28 A;  1VQ5 P;  3GKL C;  2L6E A;  2VLP A;  3DTJ A;  4CA3 A;  2WPT A;  2KOD A;  2KWL A;  3G26 A;  1YIT P;  3CC4 P;  4U0B A;  2QEX P;  2PEI A;  2GZI A;  5HGN A;  3CCL P;  2NO8 A;  3G1G A;  4U0F A;  1YIJ P;  2GDX A;  5EJD A;  3G4S P;  2KR5 A;  3I55 P;  3DS2 A;  2CGQ A;  2AFD A;  3H4E A;  1L0H A;  4F37 A;  2L9F A;  5CZD B;  3G6E P;  1VQK P;  2KOS A; 
#chains in the Genus database with same CATH homology
 1M6E X;  3NTE A;  5JPA A;  2JYG A;  3CD6 P;  3CCE P;  3CCR P;  3VRL C;  3DPH A;  2M8L A;  2XXM A;  1YJN P;  1Q81 Q;  1ZMB A;  2E1M A;  3WBH A;  5HGL A;  2PEJ A;  3CC7 P;  3HZQ A;  3CCJ P;  3G21 A;  1VQ8 P;  1YI2 P;  1YHQ P;  1RO0 A;  2XT1 A;  3CC2 P;  3CCV P;  1K9M Q;  1M90 Q;  5F2N A;  3G0V A;  3DS4 A;  2P9X A;  1VQ7 P;  1VQO P;  1Q7Y Q;  3CME P;  2OTL P;  4QNB A;  2OTJ P;  2Z46 A;  1VQM P;  3P05 A;  5F2K A;  4COP A;  1QVF O;  4PH0 A;  1A8O A;  5HGM A;  3G1I A;  2PY8 A;  4XFX A;  1VQN P;  1AUM A;  1VQ4 P;  2QA4 P;  3CCM P;  1KD1 Q;  3CCU P;  1K8A Q;  1QVG O;  4U0D A;  1VQ6 P;  2OAR A;  4U0A A;  1KQS O;  4M0I A;  1VQP P;  1N8R Q;  5I4T G;  2PEO A;  5BS2 A;  3DS1 A;  3OW2 O;  1Q86 Q;  2JYL A;  1M1K Q;  3B5I A;  2DGY A;  4U0C A;  1K73 Q;  4COC A;  3H0D A;  1YJW P;  1KC8 Q;  2EG5 A;  2ONT A;  1QRJ A;  3LRY A;  1NJI Q;  3CMA P;  2JO0 A;  3DS0 A;  3M1M A;  4IPY A;  2M8N A;  1BAJ A;  3DS3 A;  1EOQ A;  3CPW O;  1M74 A;  3G28 A;  3CXC O;  2PEN A;  1VQL P;  1VQ5 P;  1RO2 A;  4U0E A;  1M6N A;  1S72 P;  4XFY A;  1K30 A;  2EFJ A;  1EIA A;  2L6E A;  3DTJ A;  4XFZ A;  3I56 P;  3Q20 A;  3HYB A;  2KOD A;  1YIT P;  3G26 A;  4GR2 A;  3G29 A;  3CC4 P;  4U0B A;  2QEX P;  3H47 A;  3MGE A;  2PEI A;  2BHV A;  3DS5 A;  1E6J P;  1VQK P;  1YJ9 P;  4GR6 A;  2PEQ A;  5HGN A;  3CCL P;  2XV6 A;  3G1G A;  4U0F A;  1YIJ P;  1D1D A;  2LF4 A;  1W2B O;  3E2D A;  4PH1 A;  4WYM A;  3G4S P;  1VQ9 P;  2BUO A;  3I55 P;  2M8P A;  1Q82 Q;  5DCK A;  2PEK A;  3CCQ P;  5HGO A;  2CWO A;  2Z44 A;  3DS2 A;  1JJ2 O;  3G71 P;  4XRO A;  1A43 A;  4XRQ A;  5BS1 A;  3H4E A;  3CCS P;  2Z45 A;  2PEM A;  3G6E P;  1RNI A;  1IUQ A;  2EIA A;  5F2O A;  3RG6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...