2ONTA

A swapped dimer of the hiv-1 capsid c-terminal domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
73
structure length
73
Chain Sequence
TSILDIRQGPKEPFRDYVDRFYKTLRAEQSQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Domain-swapped dimerization of the HIV-1 capsid C-terminal domain
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 22
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2ontA01
2XT1A 4WYMA 3H4EA 4U0AA 3G0VA 3DS1A 2M8LA 2XXMA 1QRJA 4XROA 1EOQA 3DS3A 2L6EA 4U0CA 1E6JP 3H47A 2JO0A 1D1DA 2KODA 4QNBA 5DCKA 3G29A 3P05A 4XFYA 5I4TG 2M8NA 2M8PA 1A8OA 3G1IA 4XFXA 4XRQA 4PH0A 4U0EA 4XFZA 3DS0A 4PH1A 4COCA 2ONTA 1A43A 3DS4A 4IPYA 2XV6A 2JYLA 3G28A 4U0FA 5HGLA 4COPA 3DS5A 3DPHA 3G1GA 3MGEA 4U0BA 3G26A 3DTJA 2LF4A 3LRYA 5HGOA 1EIAA 1BAJA 2EIAA 2JYGA 3NTEA 5HGNA 1AUMA 3DS2A 3G21A 4M0IA 3VRLC 4U0DA 5HGMA 5JPAA 2BUOA
chains in the Genus database with same CATH superfamily
1FR2A 1QVGO 1M74A 3NY7B 2GZFA 2MR7A 4XFZA 1L0IA 4F37A 3DPHA 1VQNP 4NEOA 2K0DX 2KGEA 1IMPA 4WYMA 1GXHA 3EJBA 2FADA 2KGCA 1M1KQ 2MVVA 4QKOA 4R0MA 2KOQA 1Q81Q 2L22A 2E1MA 2AVAA 3CC7P 5HV8A 2KOSA 1EMVA 3G26A 2LF4A 2MVUA 2K0YA 4UHPB 1K30A 1UNKA 5JPAA 2LTEA 2K5XA 1VQ9P 2CNRA 4PWVB 4COCA 1Q86Q 2L9FA 3DS5A 1ACPA 3CPWO 1VQPP 1RO2A 1Q7YQ 2GZIA 4XROA 4H2XC 2GDYA 2BHVA 2FAEA 2XZ1C 2VLNA 2FQ0A 3U43A 1UJZA 2K92A 2AFDA 3OW2O 1VQ5P 3GZMA 3NTEA 5HGNA 3DS2A 3HYBA 3LMOA 4U0DA 3E2DA 2KG9A 2JO0A 1VKUA 5KP8B 1YITP 3RG2A 2ONTA 4IPYA 1YJNP 2XV6A 5HGLA 2WPTA 2K2QA 2FQ2A 3LRYA 2FVEA 5KP7B 4BPFA 3CC2P 1YI2P 2AFEA 2LL8A 2CWOA 1W2BO 1QVFO 4BPGA 2MR8A 1A8OA 2DGYA 2JGPA 2NO8A 4H2YC 1E0HA 1ZNVA 4PXHB 3CCVP 2MD9A 1AF8A 2L4BA 3G6EP 1VQ4P 1HQBA 2PY8A 3CCSP 2PEJA 3G1IA 2KWLA 2CQ8A 1A43A 2N50A 5HVCA 2KG6A 1DV5A 2N5HA 1N8RQ 2FQ1A 5EW5E 3G4SP 5KP6B 1VQLP 4MRTC 1YJ9P 3CMEP 2GYKA 2PENA 2JU1A 2M5RA 1VQKP 2KOOA 1GPJA 3DTJA 4BPHA 2KORA 2JYGA 1S72P 1AUMA 2MF4A 2BUOA 3H4EA 2XXMA 3HZQA 2Z45A 2LKIA 1D1DA 4QNBA 3CCLP 1RO0A 4PH1A 3B4QA 2KGDA 4GR2A 2LPKA 3MGEA 4U0BA 1MZ8A 4HKGA 5HGOA 3CMAP 2EHSA 3G71P 2FVAA 1ZMBA 2JQ4A 2CG5B 4U0AA 1EOQA 1E6JP 1GXGA 1YJWP 4XFYA 2VLQA 2M8NA 2LOLA 5EJDA 2ROQA 3EJEA 1AYIA 4COPA 2AF8A 3GKLC 1VQ6P 4IZ6A 2OARA 2FACA 2JBGA 2N98A 1EIAA 2XZ0D 3CCJP 5HGMA 3CCQP 2LIUA 3GJNA 2K0XA 3CXCO 1VQ8P 5F2NA 5CZDB 1VQMP 2DNWA 1VHNA 4H2WC 3DS0A 4U0EA 2P9XA 2PNGA 2X2BA 2JYLA 1K9MQ 2EG5A 3Q20A 1T8KA 2EFJA 2QA4P 1YIJP 2CGQA 2M8LA 1QRJA 3DS3A 4U0CA 2GDXA 1Z6MA 2K94A 4XFXA 3M1MA 1NJIQ 1DNYA 3G28A 1HY8A 2N6YA 2OTJP 2JU2A 1VQOP 3CC4P 2OTLP 1IMQA 3H0DA 2PEIA 4M0IA 2PEQA 5BS1A 3GZLA 3CCMP 2L6EA 1M90Q 5I4TG 5BS2A 4XRQA 2JB0A 4CA3A 3I56P 2KGAA 1KD1Q 1F80D 1BXIA 2GZJA 4GR6A 4DG9A 1X3OA 1RNIA 3I55P 1NQ4A 2XT1A 3CCUP 2LIWA 1L0HA 3EJDA 2KG8A 2K93A 5F2KA 4PH0A 1OR5A 2L0QA 2VLOA 2FVFA 3B5IA 2ERHA 2GZEA 3CD6P 2PEOA 1KLPA 2PEKA 2KOPA 2N6ZA 2Z46A 3WBHA 2JAZA 3G0VA 1JJ2O 3H47A 1M6NA 2QEXP 2N5IA 2VLPA 2EHTA 2KW2A 2M8PA 5F2OA 2FHSC 2KR5A 1KC8Q 1K73Q 2QNWA 7CEIA 1Q82Q 1IUQA 1K8AQ 2VSQA 2Z44A 2EIAA 2MY5A 3G21A 1YHQP 2GDWA 3DS1A 1VQ7P 3CCEP 2PEMA 2KODA 5DCKA 3CE7A 3G29A 3P05A 1M6EX 2LMLA 3DS4A 4U0FA 3G1GA 3RG6C 1KQSO 1BAJA 2GZGA 3VRLC 3CCRP 1CEIA
chains in the Genus database with same CATH topology
3H4EA 3CCMP 2XXMA 3HZQA 2L6EA 2JO0A 2Z45A 1M90Q 1D1DA 4QNBA 5I4TG 1QVGO 1M74A 5BS2A 3CCLP 4XRQA 4XFZA 1RO0A 4PH1A 1YITP 2ONTA 4IPYA 1YJNP 2XV6A 4GR2A 5HGLA 3I56P 3DPHA 3MGEA 1KD1Q 4U0BA 1VQNP 4GR6A 3LRYA 1RNIA 3I55P 5HGOA 3CMAP 3CC2P 3G71P 1ZMBA 1YI2P 2XT1A 4WYMA 3CCUP 4U0AA 1EOQA 2CWOA 1E6JP 1W2BO 1M1KQ 1QVFO 1YJWP 4XFYA 2M8NA 1A8OA 5F2KA 4PH0A 1Q81Q 2DGYA 4COPA 2E1MA 3CC7P 1VQ6P 3B5IA 2OARA 3CD6P 2PEOA 3G26A 2PEKA 2LF4A 3CCVP 1EIAA 1K30A 2Z46A 3CCJP 5HGMA 5JPAA 3CCQP 3WBHA 3G0VA 3G6EP 1VQ9P 1JJ2O 3CXCO 2PY8A 3H47A 1M6NA 3CCSP 2QEXP 2PEJA 5F2NA 1VQ4P 1VQ8P 1VQMP 5F2OA 2M8PA 3G1IA 4U0EA 3DS0A 4COCA 2P9XA 1Q86Q 1K73Q 1KC8Q 1A43A 2JYLA 3DS5A 1Q82Q 1K9MQ 1IUQA 1K8AQ 3CPWO 2EG5A 2EIAA 2Z44A 3Q20A 1VQPP 1RO2A 1N8RQ 1Q7YQ 2EFJA 2QA4P 3G21A 1YIJP 1YHQP 3G4SP 2M8LA 1VQLP 3DS1A 4XROA 1QRJA 3DS3A 4U0CA 1VQ7P 3CCEP 1YJ9P 2PEMA 2KODA 5DCKA 3G29A 2BHVA 3P05A 3CMEP 1M6EX 2PENA 4XFXA 3M1MA 1NJIQ 3DS4A 4U0FA 3G28A 1VQKP 3G1GA 2OTJP 3DTJA 3RG6C 1VQOP 3OW2O 1VQ5P 3CC4P 2OTLP 1KQSO 1BAJA 2JYGA 3NTEA 3H0DA 5HGNA 2PEIA 1S72P 1AUMA 2PEQA 3DS2A 3HYBA 4M0IA 3VRLC 5BS1A 3CCRP 4U0DA 3E2DA 2BUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XT1 A;  4WYM A;  3H4E A;  4U0A A;  3G0V A;  3DS1 A;  2M8L A;  2XXM A;  1QRJ A;  4XRO A;  1EOQ A;  3DS3 A;  2L6E A;  4U0C A;  1E6J P;  3H47 A;  2JO0 A;  1D1D A;  2KOD A;  4QNB A;  5DCK A;  3G29 A;  3P05 A;  4XFY A;  5I4T G;  2M8N A;  2M8P A;  1A8O A;  3G1I A;  4XFX A;  4XRQ A;  4PH0 A;  4U0E A;  4XFZ A;  3DS0 A;  4PH1 A;  4COC A;  2ONT A;  1A43 A;  3DS4 A;  4IPY A;  2XV6 A;  2JYL A;  3G28 A;  4U0F A;  5HGL A;  4COP A;  3DS5 A;  3DPH A;  3G1G A;  3MGE A;  4U0B A;  3G26 A;  3DTJ A;  2LF4 A;  3LRY A;  5HGO A;  1EIA A;  1BAJ A;  2EIA A;  2JYG A;  3NTE A;  5HGN A;  1AUM A;  3DS2 A;  3G21 A;  4M0I A;  3VRL C;  4U0D A;  5HGM A;  5JPA A;  2BUO A; 
#chains in the Genus database with same CATH topology
 1FR2 A;  1QVG O;  1M74 A;  3NY7 B;  2GZF A;  2MR7 A;  4XFZ A;  1L0I A;  4F37 A;  3DPH A;  1VQN P;  4NEO A;  2K0D X;  2KGE A;  1IMP A;  4WYM A;  1GXH A;  3EJB A;  2FAD A;  2KGC A;  1M1K Q;  2MVV A;  4QKO A;  4R0M A;  2KOQ A;  1Q81 Q;  2L22 A;  2E1M A;  2AVA A;  3CC7 P;  5HV8 A;  2KOS A;  1EMV A;  3G26 A;  2LF4 A;  2MVU A;  2K0Y A;  4UHP B;  1K30 A;  1UNK A;  5JPA A;  2LTE A;  2K5X A;  1VQ9 P;  2CNR A;  4PWV B;  4COC A;  1Q86 Q;  2L9F A;  3DS5 A;  1ACP A;  3CPW O;  1VQP P;  1RO2 A;  1Q7Y Q;  2GZI A;  4XRO A;  4H2X C;  2GDY A;  2BHV A;  2FAE A;  2XZ1 C;  2VLN A;  2FQ0 A;  3U43 A;  1UJZ A;  2K92 A;  2AFD A;  3OW2 O;  1VQ5 P;  3GZM A;  3NTE A;  5HGN A;  3DS2 A;  3HYB A;  3LMO A;  4U0D A;  3E2D A;  2KG9 A;  2JO0 A;  1VKU A;  5KP8 B;  1YIT P;  3RG2 A;  2ONT A;  4IPY A;  1YJN P;  2XV6 A;  5HGL A;  2WPT A;  2K2Q A;  2FQ2 A;  3LRY A;  2FVE A;  5KP7 B;  4BPF A;  3CC2 P;  1YI2 P;  2AFE A;  2LL8 A;  2CWO A;  1W2B O;  1QVF O;  4BPG A;  2MR8 A;  1A8O A;  2DGY A;  2JGP A;  2NO8 A;  4H2Y C;  1E0H A;  1ZNV A;  4PXH B;  3CCV P;  2MD9 A;  1AF8 A;  2L4B A;  3G6E P;  1VQ4 P;  1HQB A;  2PY8 A;  3CCS P;  2PEJ A;  3G1I A;  2KWL A;  2CQ8 A;  1A43 A;  2N50 A;  5HVC A;  2KG6 A;  1DV5 A;  2N5H A;  1N8R Q;  2FQ1 A;  5EW5 E;  3G4S P;  5KP6 B;  1VQL P;  4MRT C;  1YJ9 P;  3CME P;  2GYK A;  2PEN A;  2JU1 A;  2M5R A;  1VQK P;  2KOO A;  1GPJ A;  3DTJ A;  4BPH A;  2KOR A;  2JYG A;  1S72 P;  1AUM A;  2MF4 A;  2BUO A;  3H4E A;  2XXM A;  3HZQ A;  2Z45 A;  2LKI A;  1D1D A;  4QNB A;  3CCL P;  1RO0 A;  4PH1 A;  3B4Q A;  2KGD A;  4GR2 A;  2LPK A;  3MGE A;  4U0B A;  1MZ8 A;  4HKG A;  5HGO A;  3CMA P;  2EHS A;  3G71 P;  2FVA A;  1ZMB A;  2JQ4 A;  2CG5 B;  4U0A A;  1EOQ A;  1E6J P;  1GXG A;  1YJW P;  4XFY A;  2VLQ A;  2M8N A;  2LOL A;  5EJD A;  2ROQ A;  3EJE A;  1AYI A;  4COP A;  2AF8 A;  3GKL C;  1VQ6 P;  4IZ6 A;  2OAR A;  2FAC A;  2JBG A;  2N98 A;  1EIA A;  2XZ0 D;  3CCJ P;  5HGM A;  3CCQ P;  2LIU A;  3GJN A;  2K0X A;  3CXC O;  1VQ8 P;  5F2N A;  5CZD B;  1VQM P;  2DNW A;  1VHN A;  4H2W C;  3DS0 A;  4U0E A;  2P9X A;  2PNG A;  2X2B A;  2JYL A;  1K9M Q;  2EG5 A;  3Q20 A;  1T8K A;  2EFJ A;  2QA4 P;  1YIJ P;  2CGQ A;  2M8L A;  1QRJ A;  3DS3 A;  4U0C A;  2GDX A;  1Z6M A;  2K94 A;  4XFX A;  3M1M A;  1NJI Q;  1DNY A;  3G28 A;  1HY8 A;  2N6Y A;  2OTJ P;  2JU2 A;  1VQO P;  3CC4 P;  2OTL P;  1IMQ A;  3H0D A;  2PEI A;  4M0I A;  2PEQ A;  5BS1 A;  3GZL A;  3CCM P;  2L6E A;  1M90 Q;  5I4T G;  5BS2 A;  4XRQ A;  2JB0 A;  4CA3 A;  3I56 P;  2KGA A;  1KD1 Q;  1F80 D;  1BXI A;  2GZJ A;  4GR6 A;  4DG9 A;  1X3O A;  1RNI A;  3I55 P;  1NQ4 A;  2XT1 A;  3CCU P;  2LIW A;  1L0H A;  3EJD A;  2KG8 A;  2K93 A;  5F2K A;  4PH0 A;  1OR5 A;  2L0Q A;  2VLO A;  2FVF A;  3B5I A;  2ERH A;  2GZE A;  3CD6 P;  2PEO A;  1KLP A;  2PEK A;  2KOP A;  2N6Z A;  2Z46 A;  3WBH A;  2JAZ A;  3G0V A;  1JJ2 O;  3H47 A;  1M6N A;  2QEX P;  2N5I A;  2VLP A;  2EHT A;  2KW2 A;  2M8P A;  5F2O A;  2FHS C;  2KR5 A;  1KC8 Q;  1K73 Q;  2QNW A;  7CEI A;  1Q82 Q;  1IUQ A;  1K8A Q;  2VSQ A;  2Z44 A;  2EIA A;  2MY5 A;  3G21 A;  1YHQ P;  2GDW A;  3DS1 A;  1VQ7 P;  3CCE P;  2PEM A;  2KOD A;  5DCK A;  3CE7 A;  3G29 A;  3P05 A;  1M6E X;  2LML A;  3DS4 A;  4U0F A;  3G1G A;  3RG6 C;  1KQS O;  1BAJ A;  2GZG A;  3VRL C;  3CCR P;  1CEI A; 
#chains in the Genus database with same CATH homology
 3H4E A;  3CCM P;  2XXM A;  3HZQ A;  2L6E A;  2JO0 A;  2Z45 A;  1M90 Q;  1D1D A;  4QNB A;  5I4T G;  1QVG O;  1M74 A;  5BS2 A;  3CCL P;  4XRQ A;  4XFZ A;  1RO0 A;  4PH1 A;  1YIT P;  2ONT A;  4IPY A;  1YJN P;  2XV6 A;  4GR2 A;  5HGL A;  3I56 P;  3DPH A;  3MGE A;  1KD1 Q;  4U0B A;  1VQN P;  4GR6 A;  3LRY A;  1RNI A;  3I55 P;  5HGO A;  3CMA P;  3CC2 P;  3G71 P;  1ZMB A;  1YI2 P;  2XT1 A;  4WYM A;  3CCU P;  4U0A A;  1EOQ A;  2CWO A;  1E6J P;  1W2B O;  1M1K Q;  1QVF O;  1YJW P;  4XFY A;  2M8N A;  1A8O A;  5F2K A;  4PH0 A;  1Q81 Q;  2DGY A;  4COP A;  2E1M A;  3CC7 P;  1VQ6 P;  3B5I A;  2OAR A;  3CD6 P;  2PEO A;  3G26 A;  2PEK A;  2LF4 A;  3CCV P;  1EIA A;  1K30 A;  2Z46 A;  3CCJ P;  5HGM A;  5JPA A;  3CCQ P;  3WBH A;  3G0V A;  3G6E P;  1VQ9 P;  1JJ2 O;  3CXC O;  2PY8 A;  3H47 A;  1M6N A;  3CCS P;  2QEX P;  2PEJ A;  5F2N A;  1VQ4 P;  1VQ8 P;  1VQM P;  5F2O A;  2M8P A;  3G1I A;  4U0E A;  3DS0 A;  4COC A;  2P9X A;  1Q86 Q;  1K73 Q;  1KC8 Q;  1A43 A;  2JYL A;  3DS5 A;  1Q82 Q;  1K9M Q;  1IUQ A;  1K8A Q;  3CPW O;  2EG5 A;  2EIA A;  2Z44 A;  3Q20 A;  1VQP P;  1RO2 A;  1N8R Q;  1Q7Y Q;  2EFJ A;  2QA4 P;  3G21 A;  1YIJ P;  1YHQ P;  3G4S P;  2M8L A;  1VQL P;  3DS1 A;  4XRO A;  1QRJ A;  3DS3 A;  4U0C A;  1VQ7 P;  3CCE P;  1YJ9 P;  2PEM A;  2KOD A;  5DCK A;  3G29 A;  2BHV A;  3P05 A;  3CME P;  1M6E X;  2PEN A;  4XFX A;  3M1M A;  1NJI Q;  3DS4 A;  4U0F A;  3G28 A;  1VQK P;  3G1G A;  2OTJ P;  3DTJ A;  3RG6 C;  1VQO P;  3OW2 O;  1VQ5 P;  3CC4 P;  2OTL P;  1KQS O;  1BAJ A;  2JYG A;  3NTE A;  3H0D A;  5HGN A;  2PEI A;  1S72 P;  1AUM A;  2PEQ A;  3DS2 A;  3HYB A;  4M0I A;  3VRL C;  5BS1 A;  3CCR P;  4U0D A;  3E2D A;  2BUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...