2ONTA

A swapped dimer of the hiv-1 capsid c-terminal domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
73
structure length
73
Chain Sequence
TSILDIRQGPKEPFRDYVDRFYKTLRAEQSQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Domain-swapped dimerization of the HIV-1 capsid C-terminal domain
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 22
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2ontA01
3LRYA 2L6EA 2M8NA 3H4EA 1A43A 2XV6A 4U0AA 4XRQA 2XXMA 2EIAA 3DS5A 4XROA 4U0BA 4U0FA 2XT1A 4XFXA 4XFYA 3VRLC 2BUOA 2ONTA 5DCKA 2M8PA 3DPHA 3DS1A 3G26A 2JYGA 2LF4A 3DTJA 3NTEA 5HGNA 5JPAA 3DS3A 4M0IA 4U0EA 1A8OA 3G1GA 3H47A 4COPA 1EIAA 4PH0A 4QNBA 1QRJA 3G21A 1BAJA 1E6JP 4U0DA 4COCA 4PH1A 5HGMA 5HGOA 4U0CA 2JYLA 3MGEA 4XFZA 2M8LA 2JO0A 1EOQA 3DS0A 3G29A 5I4TG 3DS2A 3G0VA 2KODA 1AUMA 3G1IA 3G28A 5HGLA 4WYMA 3DS4A 4IPYA 3P05A 1D1DA
chains in the Genus database with same CATH superfamily
1RO0A 2FHSC 2VSQA 5HV8A 1YHQP 2XT1A 2XZ1C 3E2DA 1K9MQ 2EHTA 3G1GA 2BHVA 1VQ9P 3G4SP 2EHSA 1UNKA 1ZMBA 1VQ4P 2JO0A 1VQNP 2K94A 5BS1A 1JJ2O 1AF8A 3P05A 2LPKA 3DS5A 2EFJA 1OR5A 2MVVA 2LIWA 2LKIA 1VQKP 4U0CA 4R0MA 3G71P 3U43A 1KQSO 2KGAA 2KODA 1M6EX 3CXCO 4U0AA 1IMPA 7CEIA 3RG2A 3DS1A 2LF4A 5JPAA 4COPA 3GZMA 2M5RA 5HGOA 1NQ4A 2JAZA 5F2KA 4XFZA 1Q86Q 3OW2O 4F37A 2KR5A 5KP7B 3CC4P 1A43A 1VQLP 2FVFA 2KWLA 2JQ4A 1KLPA 2KOQA 4U0EA 1A8OA 2CGQA 2DGYA 2JBGA 2VLQA 1ACPA 4NEOA 4MRTC 2LOLA 2N50A 1YITP 1VQ5P 5I4TG 2VLNA 2CG5B 3CCLP 5HGLA 3EJBA 1KD1Q 2L9FA 1GXGA 3I56P 5F2NA 5HVCA 2QA4P 4M0IA 1M74A 3CCSP 4HKGA 1VQPP 3CCMP 2JGPA 4PXHB 4XRQA 2Z44A 1YI2P 2K92A 3CCJP 4XFXA 2JU2A 2FVEA 2K93A 1K8AQ 3DPHA 1HY8A 2PEJA 1Q82Q 2OTLP 1VHNA 3G29A 2GZIA 2PEOA 3G1IA 2DNWA 1N8RQ 3M1MA 2XXMA 3HZQA 4XFYA 3B5IA 2M8PA 1VKUA 3EJDA 2K2QA 2GZJA 2KOSA 4U0DA 3CD6P 3CC7P 2MY5A 1IUQA 3EJEA 1X3OA 1IMQA 1GPJA 2GZEA 4IPYA 1VQOP 1M6NA 1E0HA 2LIUA 2P9XA 2BUOA 3DTJA 1KC8Q 1YJ9P 1QVFO 1YJWP 1EIAA 2FACA 1DV5A 4PH0A 4QNBA 1QRJA 3G21A 5HGMA 2FAEA 1F80D 3HYBA 2M8LA 3Q20A 2Z46A 1EOQA 2K0YA 1RO2A 5F2OA 3CMAP 1M1KQ 2KW2A 3G26A 1M90Q 1AYIA 5EJDA 4BPGA 4H2XC 2PEMA 1VQ7P 1W2BO 2VLOA 3H0DA 3DS4A 5KP8B 2GDWA 1MZ8A 4BPHA 1BXIA 1RNIA 3RG6C 2ONTA 5DCKA 3CCVP 2MR8A 1VQMP 4CA3A 1BAJA 2AF8A 3CCRP 4H2WC 5KP6B 3CMEP 2OARA 2FVAA 1HQBA 3WBHA 5EW5E 3G28A 1YJNP 2NO8A 2N6ZA 3LMOA 3LRYA 2N6YA 1CEIA 2FADA 5CZDB 2KG6A 4XROA 4GR6A 3VRLC 4UHPB 2PY8A 2KGCA 2ERHA 2L4BA 3GKLC 1E6JP 2QEXP 2VLPA 2AFEA 2JB0A 3DS2A 3G0VA 3B4QA 1Q7YQ 2GZGA 2JU1A 2L22A 1QVGO 2MF4A 1NJIQ 2KORA 3DS3A 2K5XA 3CC2P 4PH1A 2PNGA 1Q81Q 3G6EP 1AUMA 2N5HA 2K0DX 4U0BA 1GXHA 2QNWA 2KGDA 3NTEA 3GZLA 2PEQA 3CE7A 4COCA 3MGEA 2GDYA 2L0QA 4GR2A 2CWOA 3GJNA 2FQ2A 1D1DA 2L6EA 1VQ8P 2M8NA 2KOOA 3CPWO 2GZFA 4U0FA 2AVAA 2ROQA 2WPTA 2EG5A 3CCUP 1ZNVA 1K73Q 2KG8A 3I55P 2XZ0D 1UJZA 2PEIA 3CCEP 3DS0A 2PENA 2GYKA 1Z6MA 2FQ0A 2XV6A 2LTEA 4QKOA 1DNYA 2CNRA 2PEKA 2MVUA 2KG9A 1L0HA 2N5IA 2X2BA 3H47A 2KOPA 5BS2A 2MR7A 2GDXA 2OTJP 2JYLA 4IZ6A 2KGEA 2E1MA 2LL8A 1S72P 2FQ1A 4PWVB 1YIJP 2Z45A 3H4EA 4BPFA 2CQ8A 2EIAA 2LMLA 4H2YC 3NY7B 1K30A 2K0XA 5HGNA 2JYGA 3CCQP 1EMVA 1L0IA 4DG9A 2AFDA 2N98A 1FR2A 1T8KA 2MD9A 1VQ6P 4WYMA
chains in the Genus database with same CATH topology
1RO2A 5F2OA 3CMAP 1RO0A 3I56P 4U0BA 1YHQP 1M1KQ 2XT1A 3E2DA 1K9MQ 5F2NA 3G26A 3NTEA 1M90Q 2QA4P 4M0IA 2PEQA 1M74A 3G1GA 3CCSP 2BHVA 1VQ9P 4COCA 3G4SP 1VQ4P 1ZMBA 3MGEA 1VQPP 2JO0A 3CCMP 2PEMA 1VQNP 5BS1A 4GR2A 1W2BO 1JJ2O 1VQ7P 2CWOA 3H0DA 3DS4A 3P05A 1D1DA 2L6EA 1VQ8P 2M8NA 4XRQA 2Z44A 3CPWO 1YI2P 3DS5A 1RNIA 2EFJA 4U0FA 4XFXA 3CCJP 3RG6C 2EG5A 2ONTA 5DCKA 1K8AQ 3CCUP 3DPHA 1VQKP 3CCVP 1K73Q 3I55P 1VQMP 1BAJA 2PEJA 3CCRP 4U0CA 3CMEP 2PEIA 3G71P 1Q82Q 3CCEP 2OTLP 2OARA 3DS0A 3G29A 2PENA 2PEOA 3WBHA 1KQSO 2KODA 3G1IA 3G28A 1YJNP 1M6EX 3CXCO 1N8RQ 3LRYA 3M1MA 4U0AA 2XV6A 2XXMA 4XROA 3HZQA 4XFYA 3B5IA 4GR6A 3VRLC 2PEKA 2M8PA 2PY8A 3DS1A 2LF4A 5JPAA 3H47A 4COPA 5BS2A 1E6JP 4U0DA 5HGOA 2QEXP 2OTJP 2JYLA 5F2KA 3CD6P 4XFZA 1Q86Q 3CC7P 2E1MA 1S72P 3OW2O 3DS2A 1YIJP 3G0VA 1IUQA 1Q7YQ 4IPYA 1VQOP 3CC4P 1QVGO 2Z45A 3H4EA 1A43A 1M6NA 2EIAA 1VQLP 1NJIQ 2P9XA 2BUOA 1K30A 5HGNA 3CCQP 2JYGA 3DTJA 1KC8Q 1YJ9P 3DS3A 4U0EA 1A8OA 2DGYA 1EIAA 1YJWP 1QVFO 4PH0A 4QNBA 1QRJA 3G21A 3CC2P 4PH1A 5HGMA 3HYBA 2M8LA 3Q20A 2Z46A 1YITP 1EOQA 1VQ5P 1VQ6P 5I4TG 1Q81Q 3G6EP 1AUMA 3CCLP 5HGLA 4WYMA 1KD1Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LRY A;  2L6E A;  2M8N A;  3H4E A;  1A43 A;  2XV6 A;  4U0A A;  4XRQ A;  2XXM A;  2EIA A;  3DS5 A;  4XRO A;  4U0B A;  4U0F A;  2XT1 A;  4XFX A;  4XFY A;  3VRL C;  2BUO A;  2ONT A;  5DCK A;  2M8P A;  3DPH A;  3DS1 A;  3G26 A;  2JYG A;  2LF4 A;  3DTJ A;  3NTE A;  5HGN A;  5JPA A;  3DS3 A;  4M0I A;  4U0E A;  1A8O A;  3G1G A;  3H47 A;  4COP A;  1EIA A;  4PH0 A;  4QNB A;  1QRJ A;  3G21 A;  1BAJ A;  1E6J P;  4U0D A;  4COC A;  4PH1 A;  5HGM A;  5HGO A;  4U0C A;  2JYL A;  3MGE A;  4XFZ A;  2M8L A;  2JO0 A;  1EOQ A;  3DS0 A;  3G29 A;  5I4T G;  3DS2 A;  3G0V A;  2KOD A;  1AUM A;  3G1I A;  3G28 A;  5HGL A;  4WYM A;  3DS4 A;  4IPY A;  3P05 A;  1D1D A; 
#chains in the Genus database with same CATH topology
 1RO0 A;  2FHS C;  2VSQ A;  5HV8 A;  1YHQ P;  2XT1 A;  2XZ1 C;  3E2D A;  1K9M Q;  2EHT A;  3G1G A;  2BHV A;  1VQ9 P;  3G4S P;  2EHS A;  1UNK A;  1ZMB A;  1VQ4 P;  2JO0 A;  1VQN P;  2K94 A;  5BS1 A;  1JJ2 O;  1AF8 A;  3P05 A;  2LPK A;  3DS5 A;  2EFJ A;  1OR5 A;  2MVV A;  2LIW A;  2LKI A;  1VQK P;  4U0C A;  4R0M A;  3G71 P;  3U43 A;  1KQS O;  2KGA A;  2KOD A;  1M6E X;  3CXC O;  4U0A A;  1IMP A;  7CEI A;  3RG2 A;  3DS1 A;  2LF4 A;  5JPA A;  4COP A;  3GZM A;  2M5R A;  5HGO A;  1NQ4 A;  2JAZ A;  5F2K A;  4XFZ A;  1Q86 Q;  3OW2 O;  4F37 A;  2KR5 A;  5KP7 B;  3CC4 P;  1A43 A;  1VQL P;  2FVF A;  2KWL A;  2JQ4 A;  1KLP A;  2KOQ A;  4U0E A;  1A8O A;  2CGQ A;  2DGY A;  2JBG A;  2VLQ A;  1ACP A;  4NEO A;  4MRT C;  2LOL A;  2N50 A;  1YIT P;  1VQ5 P;  5I4T G;  2VLN A;  2CG5 B;  3CCL P;  5HGL A;  3EJB A;  1KD1 Q;  2L9F A;  1GXG A;  3I56 P;  5F2N A;  5HVC A;  2QA4 P;  4M0I A;  1M74 A;  3CCS P;  4HKG A;  1VQP P;  3CCM P;  2JGP A;  4PXH B;  4XRQ A;  2Z44 A;  1YI2 P;  2K92 A;  3CCJ P;  4XFX A;  2JU2 A;  2FVE A;  2K93 A;  1K8A Q;  3DPH A;  1HY8 A;  2PEJ A;  1Q82 Q;  2OTL P;  1VHN A;  3G29 A;  2GZI A;  2PEO A;  3G1I A;  2DNW A;  1N8R Q;  3M1M A;  2XXM A;  3HZQ A;  4XFY A;  3B5I A;  2M8P A;  1VKU A;  3EJD A;  2K2Q A;  2GZJ A;  2KOS A;  4U0D A;  3CD6 P;  3CC7 P;  2MY5 A;  1IUQ A;  3EJE A;  1X3O A;  1IMQ A;  1GPJ A;  2GZE A;  4IPY A;  1VQO P;  1M6N A;  1E0H A;  2LIU A;  2P9X A;  2BUO A;  3DTJ A;  1KC8 Q;  1YJ9 P;  1QVF O;  1YJW P;  1EIA A;  2FAC A;  1DV5 A;  4PH0 A;  4QNB A;  1QRJ A;  3G21 A;  5HGM A;  2FAE A;  1F80 D;  3HYB A;  2M8L A;  3Q20 A;  2Z46 A;  1EOQ A;  2K0Y A;  1RO2 A;  5F2O A;  3CMA P;  1M1K Q;  2KW2 A;  3G26 A;  1M90 Q;  1AYI A;  5EJD A;  4BPG A;  4H2X C;  2PEM A;  1VQ7 P;  1W2B O;  2VLO A;  3H0D A;  3DS4 A;  5KP8 B;  2GDW A;  1MZ8 A;  4BPH A;  1BXI A;  1RNI A;  3RG6 C;  2ONT A;  5DCK A;  3CCV P;  2MR8 A;  1VQM P;  4CA3 A;  1BAJ A;  2AF8 A;  3CCR P;  4H2W C;  5KP6 B;  3CME P;  2OAR A;  2FVA A;  1HQB A;  3WBH A;  5EW5 E;  3G28 A;  1YJN P;  2NO8 A;  2N6Z A;  3LMO A;  3LRY A;  2N6Y A;  1CEI A;  2FAD A;  5CZD B;  2KG6 A;  4XRO A;  4GR6 A;  3VRL C;  4UHP B;  2PY8 A;  2KGC A;  2ERH A;  2L4B A;  3GKL C;  1E6J P;  2QEX P;  2VLP A;  2AFE A;  2JB0 A;  3DS2 A;  3G0V A;  3B4Q A;  1Q7Y Q;  2GZG A;  2JU1 A;  2L22 A;  1QVG O;  2MF4 A;  1NJI Q;  2KOR A;  3DS3 A;  2K5X A;  3CC2 P;  4PH1 A;  2PNG A;  1Q81 Q;  3G6E P;  1AUM A;  2N5H A;  2K0D X;  4U0B A;  1GXH A;  2QNW A;  2KGD A;  3NTE A;  3GZL A;  2PEQ A;  3CE7 A;  4COC A;  3MGE A;  2GDY A;  2L0Q A;  4GR2 A;  2CWO A;  3GJN A;  2FQ2 A;  1D1D A;  2L6E A;  1VQ8 P;  2M8N A;  2KOO A;  3CPW O;  2GZF A;  4U0F A;  2AVA A;  2ROQ A;  2WPT A;  2EG5 A;  3CCU P;  1ZNV A;  1K73 Q;  2KG8 A;  3I55 P;  2XZ0 D;  1UJZ A;  2PEI A;  3CCE P;  3DS0 A;  2PEN A;  2GYK A;  1Z6M A;  2FQ0 A;  2XV6 A;  2LTE A;  4QKO A;  1DNY A;  2CNR A;  2PEK A;  2MVU A;  2KG9 A;  1L0H A;  2N5I A;  2X2B A;  3H47 A;  2KOP A;  5BS2 A;  2MR7 A;  2GDX A;  2OTJ P;  2JYL A;  4IZ6 A;  2KGE A;  2E1M A;  2LL8 A;  1S72 P;  2FQ1 A;  4PWV B;  1YIJ P;  2Z45 A;  3H4E A;  4BPF A;  2CQ8 A;  2EIA A;  2LML A;  4H2Y C;  3NY7 B;  1K30 A;  2K0X A;  5HGN A;  2JYG A;  3CCQ P;  1EMV A;  1L0I A;  4DG9 A;  2AFD A;  2N98 A;  1FR2 A;  1T8K A;  2MD9 A;  1VQ6 P;  4WYM A; 
#chains in the Genus database with same CATH homology
 1RO2 A;  5F2O A;  3CMA P;  1RO0 A;  3I56 P;  4U0B A;  1YHQ P;  1M1K Q;  2XT1 A;  3E2D A;  1K9M Q;  5F2N A;  3G26 A;  3NTE A;  1M90 Q;  2QA4 P;  4M0I A;  2PEQ A;  1M74 A;  3G1G A;  3CCS P;  2BHV A;  1VQ9 P;  4COC A;  3G4S P;  1VQ4 P;  1ZMB A;  3MGE A;  1VQP P;  2JO0 A;  3CCM P;  2PEM A;  1VQN P;  5BS1 A;  4GR2 A;  1W2B O;  1JJ2 O;  1VQ7 P;  2CWO A;  3H0D A;  3DS4 A;  3P05 A;  1D1D A;  2L6E A;  1VQ8 P;  2M8N A;  4XRQ A;  2Z44 A;  3CPW O;  1YI2 P;  3DS5 A;  1RNI A;  2EFJ A;  4U0F A;  4XFX A;  3CCJ P;  3RG6 C;  2EG5 A;  2ONT A;  5DCK A;  1K8A Q;  3CCU P;  3DPH A;  1VQK P;  3CCV P;  1K73 Q;  3I55 P;  1VQM P;  1BAJ A;  2PEJ A;  3CCR P;  4U0C A;  3CME P;  2PEI A;  3G71 P;  1Q82 Q;  3CCE P;  2OTL P;  2OAR A;  3DS0 A;  3G29 A;  2PEN A;  2PEO A;  3WBH A;  1KQS O;  2KOD A;  3G1I A;  3G28 A;  1YJN P;  1M6E X;  3CXC O;  1N8R Q;  3LRY A;  3M1M A;  4U0A A;  2XV6 A;  2XXM A;  4XRO A;  3HZQ A;  4XFY A;  3B5I A;  4GR6 A;  3VRL C;  2PEK A;  2M8P A;  2PY8 A;  3DS1 A;  2LF4 A;  5JPA A;  3H47 A;  4COP A;  5BS2 A;  1E6J P;  4U0D A;  5HGO A;  2QEX P;  2OTJ P;  2JYL A;  5F2K A;  3CD6 P;  4XFZ A;  1Q86 Q;  3CC7 P;  2E1M A;  1S72 P;  3OW2 O;  3DS2 A;  1YIJ P;  3G0V A;  1IUQ A;  1Q7Y Q;  4IPY A;  1VQO P;  3CC4 P;  1QVG O;  2Z45 A;  3H4E A;  1A43 A;  1M6N A;  2EIA A;  1VQL P;  1NJI Q;  2P9X A;  2BUO A;  1K30 A;  5HGN A;  3CCQ P;  2JYG A;  3DTJ A;  1KC8 Q;  1YJ9 P;  3DS3 A;  4U0E A;  1A8O A;  2DGY A;  1EIA A;  1YJW P;  1QVF O;  4PH0 A;  4QNB A;  1QRJ A;  3G21 A;  3CC2 P;  4PH1 A;  5HGM A;  3HYB A;  2M8L A;  3Q20 A;  2Z46 A;  1YIT P;  1EOQ A;  1VQ5 P;  1VQ6 P;  5I4T G;  1Q81 Q;  3G6E P;  1AUM A;  3CCL P;  5HGL A;  4WYM A;  1KD1 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...