2ONTA

A swapped dimer of the hiv-1 capsid c-terminal domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
73
structure length
73
Chain Sequence
b'TSILDIRQGPKEPFRDYVDRFYKTLRAEQSQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Capsid protein p24
publication title Domain-swapped dimerization of the HIV-1 capsid C-terminal domain
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Viral protein
total genus 22
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2ontA01
2M8LA 4U0DA 2JYGA 3LRYA 4QNBA 2M8PA 5HGNA 4M0IA 1EIAA 3NTEA 2BUOA 3DS4A 3DS0A 5HGLA 3H47A 3DTJA 5JPAA 1D1DA 3G26A 3P05A 1E6JP 2XT1A 1BAJA 2XXMA 3DS3A 3DS2A 3VRLC 2LF4A 3G28A 3DS1A 3DS5A 3G1GA 4XRQA 5HGOA 4IPYA 1AUMA 1EOQA 1QRJA 1A8OA 3G1IA 3MGEA 3DPHA 4XFYA 2L6EA 2M8NA 3G0VA 4XFXA 2ONTA 5DCKA 4COCA 5I4TG 2EIAA 4U0CA 4COPA 4U0EA 2KODA 4WYMA 4XFZA 2XV6A 4PH0A 5HGMA 3G29A 4U0BA 2JYLA 3H4EA 4XROA 1A43A 4PH1A 4U0AA 3G21A 2JO0A 4U0FA
chains in the Genus database with same CATH superfamily
1Q82Q 1YIJP 3I56P 2N5HA 1EMVA 1VQ7P 2AFEA 4BPFA 1ZMBA 1AYIA 3CCLP 1YI2P 2FVAA 1QVGO 5BS1A 4XFYA 2N98A 2MD9A 1JJ2O 3HZQA 2OARA 1VKUA 1NJIQ 2KGAA 5HVCA 1E6JP 1ZNVA 2KORA 3VRLC 2GYKA 1QVFO 4IPYA 1QRJA 2ROQA 2GDXA 1VQMP 2ERHA 3GZMA 5HGMA 1S72P 1NQ4A 2AFDA 2LMLA 1YHQP 3OW2O 2EG5A 1M6NA 1IMQA 2M8LA 1VHNA 3NTEA 3NY7B 4H2YC 2CWOA 3G26A 2CGQA 4IZ6A 3CCSP 2OTJP 1W2BO 1RNIA 3I55P 1FR2A 3EJBA 1M6EX 5DCKA 4U0CA 2MVUA 3LMOA 3CC7P 2KOQA 1K30A 4U0DA 2WPTA 2N6ZA 2FVEA 2K2QA 5JPAA 1BAJA 2KGCA 1IUQA 2XXMA 1VQOP 3CMEP 3G28A 5HGOA 3RG6C 1KD1Q 1KLPA 4U0AA 1YJ9P 2JO0A 1Q86Q 2CNRA 5CZDB 1EIAA 2PEMA 5KP7B 3CD6P 3HYBA 3DS3A 1KC8Q 2GZGA 2PEQA 2EHSA 2Z44A 4U0EA 2KODA 2PY8A 4PH0A 1K9MQ 4PXHB 4BPGA 2NO8A 2M8PA 1VQPP 2N5IA 2Z45A 3CCEP 5HGLA 3P05A 3CC2P 1M1KQ 3CPWO 2LF4A 4DG9A 2QA4P 4XRQA 1ACPA 4XFXA 1L0IA 1N8RQ 3H0DA 2KGDA 1VQNP 1A8OA 1VQKP 1VQ8P 3DTJA 1F80D 3CCMP 2VLPA 2Z46A 3EJEA 3EJDA 1M74A 2MF4A 1VQ5P 1GXGA 3G0VA 4COPA 3M1MA 2K0DX 4XROA 3G71P 3B5IA 4QKOA 2VLOA 2K93A 2LPKA 2M5RA 2KOPA 2GZEA 2XT1A 2JB0A 3E2DA 5F2KA 2DGYA 1VQ9P 1MZ8A 2N6YA 1CEIA 2FACA 4QNBA 4CA3A 3DS4A 5BS2A 3CCUP 2VLQA 3CXCO 1VQ6P 2PEKA 2JAZA 4GR2A 1UNKA 2XZ1C 1VQLP 2FHSC 2FVFA 5HGNA 2ONTA 1AF8A 1L0HA 3CCQP 1K8AQ 1E0HA 2KG6A 3CCJP 2N50A 2K94A 2KR5A 3DS1A 2L4BA 7CEIA 4PWVB 3DPHA 2M8NA 2MY5A 5EW5E 2CG5B 2GZJA 4UHPB 2JYLA 2PEJA 2KOSA 2QNWA 2VLNA 4M0IA 4GR6A 2JBGA 1Z6MA 3CCRP 3DS2A 2X2BA 3G1GA 3G1IA 5EJDA 4U0BA 1HQBA 2JU2A 4R0MA 5F2OA 4F37A 2LOLA 2KOOA 3G6EP 3CE7A 1D1DA 2AVAA 2L0QA 2LIUA 2QEXP 2FAEA 2K5XA 2EIAA 1KQSO 3WBHA 2KG8A 2XZ0D 3G4SP 2OTLP 2PENA 2PNGA 1YJWP 1T8KA 4MRTC 2EFJA 2LKIA 3H47A 3GJNA 2LL8A 2GDWA 2AF8A 2JGPA 1DNYA 1YJNP 1GPJA 1RO0A 4H2XC 3U43A 2FQ2A 2L6EA 2LTEA 4H2WC 1YITP 1M90Q 1GXHA 3RG2A 3G29A 2GZFA 5HV8A 1X3OA 2JU1A 4PH1A 3G21A 4U0FA 1UJZA 3GZLA 3Q20A 2BUOA 2VSQA 4HKGA 2K92A 3CC4P 3GKLC 2KGEA 4NEOA 2CQ8A 1EOQA 1DV5A 2DNWA 3MGEA 1IMPA 4WYMA 5F2NA 2KW2A 1A43A 3B4QA 2EHTA 2FQ1A 2K0YA 2GDYA 2GZIA 2K0XA 2JQ4A 1Q7YQ 1VQ4P 1BXIA 2MVVA 3DS5A 1K73Q 1HY8A 1AUMA 2LIWA 2L22A 5I4TG 2BHVA 2L9FA 2XV6A 4XFZA 3H4EA 4COCA 2MR7A 4BPHA 3CCVP 2JYGA 3LRYA 2E1MA 3DS0A 1RO2A 5KP6B 2PEOA 2P9XA 2FQ0A 5KP8B 2FADA 2KG9A 1Q81Q 1OR5A 2PEIA 2KWLA 3CMAP 2MR8A
chains in the Genus database with same CATH topology
1YJWP 1Q82Q 4QNBA 1Q86Q 1YIJP 3I56P 1EIAA 2PEMA 1VQ7P 2EFJA 3DS4A 5BS2A 3H47A 3CCUP 3CD6P 1ZMBA 3CXCO 3HYBA 1VQ6P 3CCLP 3DS3A 1YI2P 1YJNP 1RO0A 1KC8Q 1QVGO 2PEKA 5BS1A 4GR2A 2PEQA 4XFYA 2L6EA 1YITP 2Z44A 1M90Q 4U0EA 2KODA 2PY8A 4PH0A 1VQLP 3G29A 1K9MQ 1JJ2O 3HZQA 4PH1A 2OARA 5HGNA 3G21A 2ONTA 4U0FA 2M8PA 3CCQP 1VQPP 1K8AQ 2Z45A 3CCJP 3Q20A 3CCEP 2BUOA 5HGLA 1NJIQ 3P05A 3CC2P 3CC4P 1E6JP 1M1KQ 3CPWO 3VRLC 2LF4A 3DS1A 2QA4P 1QVFO 4XRQA 4IPYA 1EOQA 1QRJA 3MGEA 3DPHA 2M8NA 4XFXA 1VQMP 1N8RQ 3H0DA 4WYMA 5HGMA 1S72P 5F2NA 2JYLA 2PEJA 1YHQP 3OW2O 1A43A 1VQNP 2EG5A 1M6NA 1A8OA 2M8LA 1VQKP 1VQ8P 4M0IA 3NTEA 4GR6A 3DTJA 2CWOA 3CCMP 2Z46A 3G26A 1Q7YQ 3CCRP 1VQ4P 3DS2A 3CCSP 2OTJP 3DS5A 3G1GA 1W2BO 1K73Q 1AUMA 1M74A 1RNIA 3G1IA 3I55P 1VQ5P 3G0VA 1M6EX 5DCKA 5I4TG 4U0CA 4COPA 3M1MA 2BHVA 4XFZA 2XV6A 4U0BA 3H4EA 3CC7P 4XROA 4COCA 3G71P 1K30A 5F2OA 3CCVP 3B5IA 4U0DA 2JYGA 3LRYA 2E1MA 3DS0A 3G6EP 5JPAA 1RO2A 1D1DA 2XT1A 1BAJA 2XXMA 1IUQA 2PEOA 1VQOP 4U0AA 3CMEP 2P9XA 3G28A 3E2DA 5HGOA 3RG6C 2QEXP 5F2KA 1Q81Q 2EIAA 1KQSO 2DGYA 3WBHA 1VQ9P 2PEIA 3G4SP 2OTLP 1KD1Q 3CMAP 2PENA 1YJ9P 2JO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M8L A;  4U0D A;  2JYG A;  3LRY A;  4QNB A;  2M8P A;  5HGN A;  4M0I A;  1EIA A;  3NTE A;  2BUO A;  3DS4 A;  3DS0 A;  5HGL A;  3H47 A;  3DTJ A;  5JPA A;  1D1D A;  3G26 A;  3P05 A;  1E6J P;  2XT1 A;  1BAJ A;  2XXM A;  3DS3 A;  3DS2 A;  3VRL C;  2LF4 A;  3G28 A;  3DS1 A;  3DS5 A;  3G1G A;  4XRQ A;  5HGO A;  4IPY A;  1AUM A;  1EOQ A;  1QRJ A;  1A8O A;  3G1I A;  3MGE A;  3DPH A;  4XFY A;  2L6E A;  2M8N A;  3G0V A;  4XFX A;  2ONT A;  5DCK A;  4COC A;  5I4T G;  2EIA A;  4U0C A;  4COP A;  4U0E A;  2KOD A;  4WYM A;  4XFZ A;  2XV6 A;  4PH0 A;  5HGM A;  3G29 A;  4U0B A;  2JYL A;  3H4E A;  4XRO A;  1A43 A;  4PH1 A;  4U0A A;  3G21 A;  2JO0 A;  4U0F A; 
#chains in the Genus database with same CATH topology
 1Q82 Q;  1YIJ P;  3I56 P;  2N5H A;  1EMV A;  1VQ7 P;  2AFE A;  4BPF A;  1ZMB A;  1AYI A;  3CCL P;  1YI2 P;  2FVA A;  1QVG O;  5BS1 A;  4XFY A;  2N98 A;  2MD9 A;  1JJ2 O;  3HZQ A;  2OAR A;  1VKU A;  1NJI Q;  2KGA A;  5HVC A;  1E6J P;  1ZNV A;  2KOR A;  3VRL C;  2GYK A;  1QVF O;  4IPY A;  1QRJ A;  2ROQ A;  2GDX A;  1VQM P;  2ERH A;  3GZM A;  5HGM A;  1S72 P;  1NQ4 A;  2AFD A;  2LML A;  1YHQ P;  3OW2 O;  2EG5 A;  1M6N A;  1IMQ A;  2M8L A;  1VHN A;  3NTE A;  3NY7 B;  4H2Y C;  2CWO A;  3G26 A;  2CGQ A;  4IZ6 A;  3CCS P;  2OTJ P;  1W2B O;  1RNI A;  3I55 P;  1FR2 A;  3EJB A;  1M6E X;  5DCK A;  4U0C A;  2MVU A;  3LMO A;  3CC7 P;  2KOQ A;  1K30 A;  4U0D A;  2WPT A;  2N6Z A;  2FVE A;  2K2Q A;  5JPA A;  1BAJ A;  2KGC A;  1IUQ A;  2XXM A;  1VQO P;  3CME P;  3G28 A;  5HGO A;  3RG6 C;  1KD1 Q;  1KLP A;  4U0A A;  1YJ9 P;  2JO0 A;  1Q86 Q;  2CNR A;  5CZD B;  1EIA A;  2PEM A;  5KP7 B;  3CD6 P;  3HYB A;  3DS3 A;  1KC8 Q;  2GZG A;  2PEQ A;  2EHS A;  2Z44 A;  4U0E A;  2KOD A;  2PY8 A;  4PH0 A;  1K9M Q;  4PXH B;  4BPG A;  2NO8 A;  2M8P A;  1VQP P;  2N5I A;  2Z45 A;  3CCE P;  5HGL A;  3P05 A;  3CC2 P;  1M1K Q;  3CPW O;  2LF4 A;  4DG9 A;  2QA4 P;  4XRQ A;  1ACP A;  4XFX A;  1L0I A;  1N8R Q;  3H0D A;  2KGD A;  1VQN P;  1A8O A;  1VQK P;  1VQ8 P;  3DTJ A;  1F80 D;  3CCM P;  2VLP A;  2Z46 A;  3EJE A;  3EJD A;  1M74 A;  2MF4 A;  1VQ5 P;  1GXG A;  3G0V A;  4COP A;  3M1M A;  2K0D X;  4XRO A;  3G71 P;  3B5I A;  4QKO A;  2VLO A;  2K93 A;  2LPK A;  2M5R A;  2KOP A;  2GZE A;  2XT1 A;  2JB0 A;  3E2D A;  5F2K A;  2DGY A;  1VQ9 P;  1MZ8 A;  2N6Y A;  1CEI A;  2FAC A;  4QNB A;  4CA3 A;  3DS4 A;  5BS2 A;  3CCU P;  2VLQ A;  3CXC O;  1VQ6 P;  2PEK A;  2JAZ A;  4GR2 A;  1UNK A;  2XZ1 C;  1VQL P;  2FHS C;  2FVF A;  5HGN A;  2ONT A;  1AF8 A;  1L0H A;  3CCQ P;  1K8A Q;  1E0H A;  2KG6 A;  3CCJ P;  2N50 A;  2K94 A;  2KR5 A;  3DS1 A;  2L4B A;  7CEI A;  4PWV B;  3DPH A;  2M8N A;  2MY5 A;  5EW5 E;  2CG5 B;  2GZJ A;  4UHP B;  2JYL A;  2PEJ A;  2KOS A;  2QNW A;  2VLN A;  4M0I A;  4GR6 A;  2JBG A;  1Z6M A;  3CCR P;  3DS2 A;  2X2B A;  3G1G A;  3G1I A;  5EJD A;  4U0B A;  1HQB A;  2JU2 A;  4R0M A;  5F2O A;  4F37 A;  2LOL A;  2KOO A;  3G6E P;  3CE7 A;  1D1D A;  2AVA A;  2L0Q A;  2LIU A;  2QEX P;  2FAE A;  2K5X A;  2EIA A;  1KQS O;  3WBH A;  2KG8 A;  2XZ0 D;  3G4S P;  2OTL P;  2PEN A;  2PNG A;  1YJW P;  1T8K A;  4MRT C;  2EFJ A;  2LKI A;  3H47 A;  3GJN A;  2LL8 A;  2GDW A;  2AF8 A;  2JGP A;  1DNY A;  1YJN P;  1GPJ A;  1RO0 A;  4H2X C;  3U43 A;  2FQ2 A;  2L6E A;  2LTE A;  4H2W C;  1YIT P;  1M90 Q;  1GXH A;  3RG2 A;  3G29 A;  2GZF A;  5HV8 A;  1X3O A;  2JU1 A;  4PH1 A;  3G21 A;  4U0F A;  1UJZ A;  3GZL A;  3Q20 A;  2BUO A;  2VSQ A;  4HKG A;  2K92 A;  3CC4 P;  3GKL C;  2KGE A;  4NEO A;  2CQ8 A;  1EOQ A;  1DV5 A;  2DNW A;  3MGE A;  1IMP A;  4WYM A;  5F2N A;  2KW2 A;  1A43 A;  3B4Q A;  2EHT A;  2FQ1 A;  2K0Y A;  2GDY A;  2GZI A;  2K0X A;  2JQ4 A;  1Q7Y Q;  1VQ4 P;  1BXI A;  2MVV A;  3DS5 A;  1K73 Q;  1HY8 A;  1AUM A;  2LIW A;  2L22 A;  5I4T G;  2BHV A;  2L9F A;  2XV6 A;  4XFZ A;  3H4E A;  4COC A;  2MR7 A;  4BPH A;  3CCV P;  2JYG A;  3LRY A;  2E1M A;  3DS0 A;  1RO2 A;  5KP6 B;  2PEO A;  2P9X A;  2FQ0 A;  5KP8 B;  2FAD A;  2KG9 A;  1Q81 Q;  1OR5 A;  2PEI A;  2KWL A;  3CMA P;  2MR8 A; 
#chains in the Genus database with same CATH homology
 1YJW P;  1Q82 Q;  4QNB A;  1Q86 Q;  1YIJ P;  3I56 P;  1EIA A;  2PEM A;  1VQ7 P;  2EFJ A;  3DS4 A;  5BS2 A;  3H47 A;  3CCU P;  3CD6 P;  1ZMB A;  3CXC O;  3HYB A;  1VQ6 P;  3CCL P;  3DS3 A;  1YI2 P;  1YJN P;  1RO0 A;  1KC8 Q;  1QVG O;  2PEK A;  5BS1 A;  4GR2 A;  2PEQ A;  4XFY A;  2L6E A;  1YIT P;  2Z44 A;  1M90 Q;  4U0E A;  2KOD A;  2PY8 A;  4PH0 A;  1VQL P;  3G29 A;  1K9M Q;  1JJ2 O;  3HZQ A;  4PH1 A;  2OAR A;  5HGN A;  3G21 A;  2ONT A;  4U0F A;  2M8P A;  3CCQ P;  1VQP P;  1K8A Q;  2Z45 A;  3CCJ P;  3Q20 A;  3CCE P;  2BUO A;  5HGL A;  1NJI Q;  3P05 A;  3CC2 P;  3CC4 P;  1E6J P;  1M1K Q;  3CPW O;  3VRL C;  2LF4 A;  3DS1 A;  2QA4 P;  1QVF O;  4XRQ A;  4IPY A;  1EOQ A;  1QRJ A;  3MGE A;  3DPH A;  2M8N A;  4XFX A;  1VQM P;  1N8R Q;  3H0D A;  4WYM A;  5HGM A;  1S72 P;  5F2N A;  2JYL A;  2PEJ A;  1YHQ P;  3OW2 O;  1A43 A;  1VQN P;  2EG5 A;  1M6N A;  1A8O A;  2M8L A;  1VQK P;  1VQ8 P;  4M0I A;  3NTE A;  4GR6 A;  3DTJ A;  2CWO A;  3CCM P;  2Z46 A;  3G26 A;  1Q7Y Q;  3CCR P;  1VQ4 P;  3DS2 A;  3CCS P;  2OTJ P;  3DS5 A;  3G1G A;  1W2B O;  1K73 Q;  1AUM A;  1M74 A;  1RNI A;  3G1I A;  3I55 P;  1VQ5 P;  3G0V A;  1M6E X;  5DCK A;  5I4T G;  4U0C A;  4COP A;  3M1M A;  2BHV A;  4XFZ A;  2XV6 A;  4U0B A;  3H4E A;  3CC7 P;  4XRO A;  4COC A;  3G71 P;  1K30 A;  5F2O A;  3CCV P;  3B5I A;  4U0D A;  2JYG A;  3LRY A;  2E1M A;  3DS0 A;  3G6E P;  5JPA A;  1RO2 A;  1D1D A;  2XT1 A;  1BAJ A;  2XXM A;  1IUQ A;  2PEO A;  1VQO P;  4U0A A;  3CME P;  2P9X A;  3G28 A;  3E2D A;  5HGO A;  3RG6 C;  2QEX P;  5F2K A;  1Q81 Q;  2EIA A;  1KQS O;  2DGY A;  3WBH A;  1VQ9 P;  2PEI A;  3G4S P;  2OTL P;  1KD1 Q;  3CMA P;  2PEN A;  1YJ9 P;  2JO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...