2ONTA

A swapped dimer of the hiv-1 capsid c-terminal domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
73
structure length
73
Chain Sequence
TSILDIRQGPKEPFRDYVDRFYKTLRAEQSQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Capsid protein p24
publication title Domain-swapped dimerization of the HIV-1 capsid C-terminal domain
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Viral protein
total genus 22
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2ontA01
3DS2A 5HGOA 3DTJA 4U0DA 1AUMA 1EIAA 3DS0A 1QRJA 2JO0A 5JPAA 4XFXA 4IPYA 3MGEA 1A43A 3G1GA 5HGLA 1BAJA 2EIAA 4XFYA 2JYGA 3DS5A 1EOQA 3LRYA 4U0BA 4COCA 4U0EA 3G29A 3DPHA 4XFZA 3G21A 4QNBA 3VRLC 2ONTA 3DS4A 4U0FA 3P05A 2JYLA 5I4TG 3G1IA 1A8OA 4U0AA 2KODA 2LF4A 2XT1A 4M0IA 5DCKA 4XRQA 4PH0A 3G0VA 2M8PA 2BUOA 3DS1A 3DS3A 3G28A 3G26A 3H47A 3NTEA 1E6JP 4U0CA 4XROA 5HGNA 1D1DA 2XV6A 4WYMA 2M8NA 2XXMA 5HGMA 2M8LA 4PH1A 3H4EA 2L6EA 4COPA
chains in the Genus database with same CATH superfamily
5KP6B 3CPWO 2JU1A 1VQ8P 1M90Q 1YJ9P 1MZ8A 3WBHA 2JB0A 5EJDA 2XZ1C 3CCQP 1AYIA 2K0XA 3LMOA 3CCRP 2K5XA 3CE7A 2GZJA 2JBGA 1KD1Q 1VQNP 4XROA 1JJ2O 2KWLA 4PH1A 2ROQA 5HGOA 3I55P 1GPJA 1EIAA 2N50A 3MGEA 2KOQA 2FQ0A 2JYGA 1EOQA 2PEJA 1YJWP 1VQ7P 1DNYA 2MVUA 1IMQA 3RG6C 2FHSC 4H2XC 4IZ6A 1E0HA 2LF4A 4PH0A 1L0HA 5HGNA 4BPGA 2JAZA 2L0QA 2QEXP 5CZDB 5JPAA 2GDYA 2GYKA 3G1GA 4U0EA 2MVVA 2AFDA 2PNGA 2KOOA 3HYBA 2Z45A 2KG6A 3CC4P 2K2QA 5BS1A 1VQKP 1ZNVA 2CNRA 1NJIQ 1E6JP 3OW2O 3EJDA 5F2NA 3RG2A 2EIAA 3GJNA 3DPHA 1T8KA 2EG5A 4GR6A 2CGQA 3Q20A 3G71P 2FVFA 2LKIA 5EW5E 1N8RQ 3CD6P 3NTEA 3CXCO 2JU2A 2AF8A 3DTJA 2X2BA 2KGDA 1OR5A 5F2KA 2L9FA 2N5HA 1YI2P 2JQ4A 3G29A 2LIUA 3B4QA 1VQ5P 2L4BA 2MF4A 2AVAA 2FAEA 1F80D 3DS1A 3G28A 1EMVA 1D1DA 4BPHA 4QKOA 1Q7YQ 2PEOA 4PXHB 2EHSA 2LMLA 2OTJP 2KOPA 1X3OA 1YHQP 4XFZA 3VRLC 2PEMA 4F37A 3P05A 5KP7B 1A8OA 1VQOP 1VKUA 3M1MA 2XV6A 2M8NA 3E2DA 3CMEP 2L6EA 1Q82Q 2K93A 2K0YA 1K73Q 1QVFO 3GZLA 2XZ0D 4XFYA 2DNWA 3NY7B 1VQMP 4CA3A 1Z6MA 3G21A 2QNWA 4QNBA 3CMAP 2GZFA 5DCKA 2M8PA 2BUOA 1M1KQ 1HY8A 2VLOA 1VQ6P 4IPYA 2OTLP 1VQLP 3CC7P 4UHPB 2NO8A 1UNKA 4DG9A 2QA4P 2JYLA 3G1IA 2AFEA 3CCSP 3CC2P 2FVAA 1IUQA 2FQ2A 3G6EP 2CG5B 4U0DA 1KC8Q 1NQ4A 1A43A 2CQ8A 1VHNA 2Z44A 3CCLP 4U0BA 2EHTA 2KGEA 4COCA 2VLNA 2CWOA 2N6YA 2FADA 3U43A 3EJEA 2PEQA 2DGYA 3G4SP 4M0IA 4XRQA 2FACA 3G0VA 1K9MQ 2E1MA 5HGMA 2GDWA 2MR7A 3DS2A 1M6NA 4R0MA 1K8AQ 3B5IA 5HGLA 1M74A 2OARA 5I4TG 2VSQA 2K94A 5HVCA 2K92A 4MRTC 3G26A 2PENA 2GZGA 4HKGA 3CCVP 5KP8B 5HV8A 2KGAA 1KQSO 3DS5A 2N98A 1VQ4P 7CEIA 5BS2A 1S72P 1QVGO 2XT1A 4PWVB 1YJNP 4GR2A 1RO2A 3DS3A 4U0CA 1IMPA 4BPFA 2P9XA 1GXGA 3H4EA 1DV5A 2KGCA 1AUMA 1QRJA 2VLPA 3DS4A 2PEKA 2MY5A 2BHVA 2KODA 2MR8A 2VLQA 3HZQA 4WYMA 3GKLC 1ZMBA 2PEIA 1FR2A 4NEOA 3DS0A 2L22A 3CCMP 1M6EX 1BAJA 1YIJP 2WPTA 4H2WC 3GZMA 2LOLA 1AF8A 2FVEA 2KG9A 3CCJP 2ERHA 4XFXA 3CCUP 1YITP 2Z46A 3LRYA 1ACPA 1Q81Q 2KW2A 2KG8A 1RO0A 2JGPA 3I56P 2EFJA 2K0DX 2KORA 2LPKA 1VQPP 1K30A 2JO0A 1UJZA 1VQ9P 2GDXA 1HQBA 2KOSA 2LL8A 2LTEA 1Q86Q 1RNIA 2MD9A 1CEIA 4U0FA 5F2OA 2N5IA 4U0AA 2N6ZA 2PY8A 1L0IA 1BXIA 2M5RA 3CCEP 2GZEA 2XXMA 2KR5A 3H0DA 2GZIA 4H2YC 1GXHA 2FQ1A 1KLPA 2ONTA 1W2BO 3H47A 3EJBA 2M8LA 2LIWA 4COPA
chains in the Genus database with same CATH topology
3G6EP 3DTJA 3CPWO 4U0DA 1KC8Q 3DS0A 5F2KA 1YI2P 1VQ8P 3CCMP 1M90Q 1A43A 1M6EX 1YJ9P 1BAJA 2Z44A 1YIJP 3CCLP 4U0BA 4COCA 3G29A 3WBHA 2CWOA 1VQ5P 3CCQP 2PEQA 2DGYA 3CCRP 3G4SP 1KD1Q 4M0IA 4XRQA 3G0VA 1VQNP 3DS1A 3G28A 4XROA 1K9MQ 1D1DA 2E1MA 5HGMA 1JJ2O 4PH1A 3DS2A 5HGOA 1M6NA 1Q7YQ 3I55P 1EIAA 3CCJP 1K8AQ 2PEOA 4XFXA 3CCUP 1YITP 3MGEA 2OTJP 3B5IA 5HGLA 2Z46A 1YJWP 2JYGA 3LRYA 1EOQA 2PEJA 1VQ7P 1YHQP 4XFZA 3VRLC 3RG6C 1Q81Q 1M74A 2OARA 2PEMA 3P05A 5I4TG 1A8OA 2LF4A 1RO0A 4PH0A 3G26A 1VQOP 5HGNA 2PENA 3M1MA 3I56P 2EFJA 2XV6A 2M8NA 3E2DA 1VQPP 2QEXP 3CMEP 2L6EA 1Q82Q 1K30A 3CCVP 2JO0A 5JPAA 1VQ9P 1K73Q 1QVFO 1KQSO 3G1GA 4XFYA 3DS5A 1VQMP 4U0EA 1Q86Q 1VQ4P 3G21A 1RNIA 4QNBA 3CMAP 4U0FA 3HYBA 2Z45A 5F2OA 5BS2A 1S72P 1QVGO 3CC4P 4U0AA 2XT1A 1YJNP 2PY8A 5DCKA 4GR2A 5BS1A 2M8PA 2BUOA 1RO2A 3DS3A 1M1KQ 1NJIQ 1VQKP 3CCEP 1E6JP 4U0CA 3OW2O 2P9XA 2XXMA 3H4EA 1VQ6P 4IPYA 2OTLP 1AUMA 1QRJA 1VQLP 3H0DA 3CC7P 5F2NA 2EIAA 3DPHA 2ONTA 3DS4A 2EG5A 2QA4P 4GR6A 2PEKA 2JYLA 3Q20A 3G1IA 3G71P 2BHVA 1W2BO 2KODA 3CCSP 3CC2P 1N8RQ 3CD6P 3NTEA 3H47A 3HZQA 3CXCO 1IUQA 4WYMA 2M8LA 1ZMBA 2PEIA 4COPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DS2 A;  5HGO A;  3DTJ A;  4U0D A;  1AUM A;  1EIA A;  3DS0 A;  1QRJ A;  2JO0 A;  5JPA A;  4XFX A;  4IPY A;  3MGE A;  1A43 A;  3G1G A;  5HGL A;  1BAJ A;  2EIA A;  4XFY A;  2JYG A;  3DS5 A;  1EOQ A;  3LRY A;  4U0B A;  4COC A;  4U0E A;  3G29 A;  3DPH A;  4XFZ A;  3G21 A;  4QNB A;  3VRL C;  2ONT A;  3DS4 A;  4U0F A;  3P05 A;  2JYL A;  5I4T G;  3G1I A;  1A8O A;  4U0A A;  2KOD A;  2LF4 A;  2XT1 A;  4M0I A;  5DCK A;  4XRQ A;  4PH0 A;  3G0V A;  2M8P A;  2BUO A;  3DS1 A;  3DS3 A;  3G28 A;  3G26 A;  3H47 A;  3NTE A;  1E6J P;  4U0C A;  4XRO A;  5HGN A;  1D1D A;  2XV6 A;  4WYM A;  2M8N A;  2XXM A;  5HGM A;  2M8L A;  4PH1 A;  3H4E A;  2L6E A;  4COP A; 
#chains in the Genus database with same CATH topology
 5KP6 B;  3CPW O;  2JU1 A;  1VQ8 P;  1M90 Q;  1YJ9 P;  1MZ8 A;  3WBH A;  2JB0 A;  5EJD A;  2XZ1 C;  3CCQ P;  1AYI A;  2K0X A;  3LMO A;  3CCR P;  2K5X A;  3CE7 A;  2GZJ A;  2JBG A;  1KD1 Q;  1VQN P;  4XRO A;  1JJ2 O;  2KWL A;  4PH1 A;  2ROQ A;  5HGO A;  3I55 P;  1GPJ A;  1EIA A;  2N50 A;  3MGE A;  2KOQ A;  2FQ0 A;  2JYG A;  1EOQ A;  2PEJ A;  1YJW P;  1VQ7 P;  1DNY A;  2MVU A;  1IMQ A;  3RG6 C;  2FHS C;  4H2X C;  4IZ6 A;  1E0H A;  2LF4 A;  4PH0 A;  1L0H A;  5HGN A;  4BPG A;  2JAZ A;  2L0Q A;  2QEX P;  5CZD B;  5JPA A;  2GDY A;  2GYK A;  3G1G A;  4U0E A;  2MVV A;  2AFD A;  2PNG A;  2KOO A;  3HYB A;  2Z45 A;  2KG6 A;  3CC4 P;  2K2Q A;  5BS1 A;  1VQK P;  1ZNV A;  2CNR A;  1NJI Q;  1E6J P;  3OW2 O;  3EJD A;  5F2N A;  3RG2 A;  2EIA A;  3GJN A;  3DPH A;  1T8K A;  2EG5 A;  4GR6 A;  2CGQ A;  3Q20 A;  3G71 P;  2FVF A;  2LKI A;  5EW5 E;  1N8R Q;  3CD6 P;  3NTE A;  3CXC O;  2JU2 A;  2AF8 A;  3DTJ A;  2X2B A;  2KGD A;  1OR5 A;  5F2K A;  2L9F A;  2N5H A;  1YI2 P;  2JQ4 A;  3G29 A;  2LIU A;  3B4Q A;  1VQ5 P;  2L4B A;  2MF4 A;  2AVA A;  2FAE A;  1F80 D;  3DS1 A;  3G28 A;  1EMV A;  1D1D A;  4BPH A;  4QKO A;  1Q7Y Q;  2PEO A;  4PXH B;  2EHS A;  2LML A;  2OTJ P;  2KOP A;  1X3O A;  1YHQ P;  4XFZ A;  3VRL C;  2PEM A;  4F37 A;  3P05 A;  5KP7 B;  1A8O A;  1VQO P;  1VKU A;  3M1M A;  2XV6 A;  2M8N A;  3E2D A;  3CME P;  2L6E A;  1Q82 Q;  2K93 A;  2K0Y A;  1K73 Q;  1QVF O;  3GZL A;  2XZ0 D;  4XFY A;  2DNW A;  3NY7 B;  1VQM P;  4CA3 A;  1Z6M A;  3G21 A;  2QNW A;  4QNB A;  3CMA P;  2GZF A;  5DCK A;  2M8P A;  2BUO A;  1M1K Q;  1HY8 A;  2VLO A;  1VQ6 P;  4IPY A;  2OTL P;  1VQL P;  3CC7 P;  4UHP B;  2NO8 A;  1UNK A;  4DG9 A;  2QA4 P;  2JYL A;  3G1I A;  2AFE A;  3CCS P;  3CC2 P;  2FVA A;  1IUQ A;  2FQ2 A;  3G6E P;  2CG5 B;  4U0D A;  1KC8 Q;  1NQ4 A;  1A43 A;  2CQ8 A;  1VHN A;  2Z44 A;  3CCL P;  4U0B A;  2EHT A;  2KGE A;  4COC A;  2VLN A;  2CWO A;  2N6Y A;  2FAD A;  3U43 A;  3EJE A;  2PEQ A;  2DGY A;  3G4S P;  4M0I A;  4XRQ A;  2FAC A;  3G0V A;  1K9M Q;  2E1M A;  5HGM A;  2GDW A;  2MR7 A;  3DS2 A;  1M6N A;  4R0M A;  1K8A Q;  3B5I A;  5HGL A;  1M74 A;  2OAR A;  5I4T G;  2VSQ A;  2K94 A;  5HVC A;  2K92 A;  4MRT C;  3G26 A;  2PEN A;  2GZG A;  4HKG A;  3CCV P;  5KP8 B;  5HV8 A;  2KGA A;  1KQS O;  3DS5 A;  2N98 A;  1VQ4 P;  7CEI A;  5BS2 A;  1S72 P;  1QVG O;  2XT1 A;  4PWV B;  1YJN P;  4GR2 A;  1RO2 A;  3DS3 A;  4U0C A;  1IMP A;  4BPF A;  2P9X A;  1GXG A;  3H4E A;  1DV5 A;  2KGC A;  1AUM A;  1QRJ A;  2VLP A;  3DS4 A;  2PEK A;  2MY5 A;  2BHV A;  2KOD A;  2MR8 A;  2VLQ A;  3HZQ A;  4WYM A;  3GKL C;  1ZMB A;  2PEI A;  1FR2 A;  4NEO A;  3DS0 A;  2L22 A;  3CCM P;  1M6E X;  1BAJ A;  1YIJ P;  2WPT A;  4H2W C;  3GZM A;  2LOL A;  1AF8 A;  2FVE A;  2KG9 A;  3CCJ P;  2ERH A;  4XFX A;  3CCU P;  1YIT P;  2Z46 A;  3LRY A;  1ACP A;  1Q81 Q;  2KW2 A;  2KG8 A;  1RO0 A;  2JGP A;  3I56 P;  2EFJ A;  2K0D X;  2KOR A;  2LPK A;  1VQP P;  1K30 A;  2JO0 A;  1UJZ A;  1VQ9 P;  2GDX A;  1HQB A;  2KOS A;  2LL8 A;  2LTE A;  1Q86 Q;  1RNI A;  2MD9 A;  1CEI A;  4U0F A;  5F2O A;  2N5I A;  4U0A A;  2N6Z A;  2PY8 A;  1L0I A;  1BXI A;  2M5R A;  3CCE P;  2GZE A;  2XXM A;  2KR5 A;  3H0D A;  2GZI A;  4H2Y C;  1GXH A;  2FQ1 A;  1KLP A;  2ONT A;  1W2B O;  3H47 A;  3EJB A;  2M8L A;  2LIW A;  4COP A; 
#chains in the Genus database with same CATH homology
 3G6E P;  3DTJ A;  3CPW O;  4U0D A;  1KC8 Q;  3DS0 A;  5F2K A;  1YI2 P;  1VQ8 P;  3CCM P;  1M90 Q;  1A43 A;  1M6E X;  1YJ9 P;  1BAJ A;  2Z44 A;  1YIJ P;  3CCL P;  4U0B A;  4COC A;  3G29 A;  3WBH A;  2CWO A;  1VQ5 P;  3CCQ P;  2PEQ A;  2DGY A;  3CCR P;  3G4S P;  1KD1 Q;  4M0I A;  4XRQ A;  3G0V A;  1VQN P;  3DS1 A;  3G28 A;  4XRO A;  1K9M Q;  1D1D A;  2E1M A;  5HGM A;  1JJ2 O;  4PH1 A;  3DS2 A;  5HGO A;  1M6N A;  1Q7Y Q;  3I55 P;  1EIA A;  3CCJ P;  1K8A Q;  2PEO A;  4XFX A;  3CCU P;  1YIT P;  3MGE A;  2OTJ P;  3B5I A;  5HGL A;  2Z46 A;  1YJW P;  2JYG A;  3LRY A;  1EOQ A;  2PEJ A;  1VQ7 P;  1YHQ P;  4XFZ A;  3VRL C;  3RG6 C;  1Q81 Q;  1M74 A;  2OAR A;  2PEM A;  3P05 A;  5I4T G;  1A8O A;  2LF4 A;  1RO0 A;  4PH0 A;  3G26 A;  1VQO P;  5HGN A;  2PEN A;  3M1M A;  3I56 P;  2EFJ A;  2XV6 A;  2M8N A;  3E2D A;  1VQP P;  2QEX P;  3CME P;  2L6E A;  1Q82 Q;  1K30 A;  3CCV P;  2JO0 A;  5JPA A;  1VQ9 P;  1K73 Q;  1QVF O;  1KQS O;  3G1G A;  4XFY A;  3DS5 A;  1VQM P;  4U0E A;  1Q86 Q;  1VQ4 P;  3G21 A;  1RNI A;  4QNB A;  3CMA P;  4U0F A;  3HYB A;  2Z45 A;  5F2O A;  5BS2 A;  1S72 P;  1QVG O;  3CC4 P;  4U0A A;  2XT1 A;  1YJN P;  2PY8 A;  5DCK A;  4GR2 A;  5BS1 A;  2M8P A;  2BUO A;  1RO2 A;  3DS3 A;  1M1K Q;  1NJI Q;  1VQK P;  3CCE P;  1E6J P;  4U0C A;  3OW2 O;  2P9X A;  2XXM A;  3H4E A;  1VQ6 P;  4IPY A;  2OTL P;  1AUM A;  1QRJ A;  1VQL P;  3H0D A;  3CC7 P;  5F2N A;  2EIA A;  3DPH A;  2ONT A;  3DS4 A;  2EG5 A;  2QA4 P;  4GR6 A;  2PEK A;  2JYL A;  3Q20 A;  3G1I A;  3G71 P;  2BHV A;  1W2B O;  2KOD A;  3CCS P;  3CC2 P;  1N8R Q;  3CD6 P;  3NTE A;  3H47 A;  3HZQ A;  3CXC O;  1IUQ A;  4WYM A;  2M8L A;  1ZMB A;  2PEI A;  4COP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...