2ONYA

Structure of hpnmt with inhibitor 7-(n-4-chlorophenylaminosulfonyl)-thiq and adohcy
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enzyme Adaptation to Inhibitor Binding: A Cryptic Binding Site in Phenylethanolamine N-Methyltransferase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
total genus 89
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2007-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2onyA00
4R6XA 4PNEA 4OQDA 4BLUA 3JWHA 4HGZA 3HVJA 3MCZA 3P97A 4QVGA 1EAMA 4KIFA 1VBFA 5CVDA 1RI2A 5DX1A 4LWPA 2OB1A 4E70A 4L7VA 5HIKA 7MHTA 1JQDA 4M38A 2PWYA 3D2LA 3LKZA 4KRGA 3IV6A 4V0RA 3C6MA 5LQNA 1M6YA 3LGAA 3AXTA 2CL5A 1QYRA 5GM1A 4IV8A 3FUXA 3R0QA 4AZVA 1AQJA 2B3TA 3EGVA 3S68A 4HGYA 2GPYA 3OZTA 4PYNA 4EQZA 5ERGB 3NVMB 4RVGA 1M6EX 1OR8A 2QYOA 3EVCA 2ZULA 4WXHA 3ORHA 4QPNA 1Y8CA 3LPMA 3EVGA 2Z6AA 1NV8A 4POOA 4QTUB 3T7RA 2EX4A 3KHKA 3DLIA 2VP3A 5E2BA 4QPPA 5DM0A 1WXWA 3B7PA 3A7EA 3LL7A 3SXJA 4F86A 2E5WA 4GUAA 2I7CA 4PYMA 4E2XA 3DULA 1NW6A 1ZGJA 1JSXA 1P1BA 2Z6QA 4FT4A 1XCLA 3R9XB 1UFKA 4K6MA 4IWNA 3EEYA 1YZ3A 3BKWA 3FPFA 4P7FA 4X63A 5GIPE 2UYCA 4YMHA 4FT2A 5FQNA 1R18A 3HVKA 2QRVA 2CKDA 2PGXA 2YQZA 4RSRA 4DM3A 4EVIA 2VDVE 2GH1A 3DH0A 3E7PA 3SSNA 2HNKA 3EVBA 1MJFA 3C0KA 2GA9A 3EMDA 3GCZA 4BP1A 3DTNA 4EMSA 1G38A 4YUZA 2AVNA 1KPGA 3DLCA 2P3QA 4MTLA 3UJ7A 4CWAA 5CCXA 5CCBA 1ZHFA 1JQ3A 3TKAA 1TW3A 3TOSA 1R6AA 4P7KA 4M37A 2ZBRA 2GLUA 5EC8A 3NWBA 2AOTA 1X1BA 1FPQA 2AOUB 4M36A 4RTLA 2GS9A 5BXYA 2Q41A 2NXNA 2YUIA 3ID6C 3JWIA 5KYGA 3I58A 3E8SA 1IM8A 2JJQA 3MTEA 1XDUA 3KKZA 3P9NA 3NJRA 4MQ4A 3DXXA 5EEHA 5FHRA 5F2NA 1WZNA 3SMQA 5FWDA 3PLAE 2QE6A 2WK1A 2ADMA 3B5IA 3LCVB 2XBMA 4KWCA 3K6RA 2G8NA 3OPNA 5T67A 4PWYA 5EEGA 3BWMA 1XVAA 3G5LA 4HTFB 2O06A 1R8YA 5DTQA 4DCMA 5DM2A 4E30A 4YV1A 3M6WA 1L9KA 5CD1A 1DCTA 5GIOE 4RTQA 2ONYA 3I5UA 2AOUA 2IIPA 1T43A 1VLMA 3CCFA 1ORHA 3K0BA 1WG8A 1X1AA 4KDCA 3FUVA 4X41A 3G8AA 3L8DA 4RTJA 5MHTA 4UOEA 1L3CA 3CVOA 4PYIA 3KQSA 2I62A 3FYDA 5HILA 3AWIA 2VDUE 3TR6A 5JUWA 1G8AA 2IBSA 1NW3A 3DOUA 5HZMA 3PVCA 2DPMA 3HTXA 5KQSA 3SR4A 3QOXA 3SGLA 5EHGA 2EJTA 4ISCA 2YXEA 5E1DA 4KIGA 4C07A 5BW5A 1RI5A 3H2BA 2PVCA 3P8ZA 1G8SA 4XCXA 1JG2A 3GU3A 3GO4A 3U81A 4C05A 5FTWA 3QV2A 3E23A 1V39A 3MHTA 9MHTA 3KQWA 1EJ0A 3AY0A 5FCDA 1EIZA 1ZG3A 3BWBA 4P7GA 2P40A 5CM2Z 3EEOA 1TW2A 4PGGA 3TFWA 4AZWA 3KQOA 3CJRA 3RIEA 2B2CA 2FHPA 1YFJA 2CWWA 3LDGA 2VZ9A 3SX0A 4F84A 4YUXA 3UJBA 1BKYA 3P2KA 3FTCA 1QANA 2B25A 2WA1A 1NBIA 3M6VA 3O4FA 3KQVA 3B89A 1QZZA 5H02A 5D1HA 3CC8A 3I53A 3ERCA 1U2ZA 2BM8A 2OPBA 3GRZA 3ME5A 5BP7A 3SVZA 3AJDA 2PT9A 1NV9A 1EJ6A 1XJ5A 3CJQA 3HVIA 2PWPA 3M33A 3FUWA 3M6UA 2O05A 4F85A 1QAOA 3O7WA 5HIJA 3KPJA 5DM4A 3DMHA 1RI4A 4RVHA 4RX1A 5E9WA 3G7UA 3UBTA 2OZVA 1O9GA 3P2IA 2DULA 3LHDA 5FWAA 4CKCA 5IKMA 5K03A 3MCTA 2UYHA 3ELDA 2IH2A 4FSXA 2ZIEA 3OCJA 1SQFA 3HNRA 2JHCA 2A14A 2IFTA 3BKXA 5EIFA 4KDRA 2PXAA 2PSSA 3KQMA 1M0EA 5EZSA 2PXCA 1B42A 4YUWA 10MHA 4GOOD 3HA5A 3C3YA 1VP3A 1G6Q1 5EMLA 4MHTA 4LECA 5FADA 3RW9A 1BOOA 3OZRA 1XDSA 3VC2A 3KPUA 3NW9A 3T0IA 3KR2A 3OZSA 2OYRA 2PX4A 2AOVA 3BT7A 5K0EA 1HMYA 2BR5A 3TMAA 3DMFA 4E2YA 1IY9A 3CKKA 2IDJA 4PYOA 1O54A 5K0CA 5DLYA 3FTDA 2HTEA 2PX5A 3UJAA 2Y1WA 5FA8A 4RTRA 4QQNA 3MAGA 1F38A 1RJFA 5K0JA 5EMMA 1YF3A 2JHAA 2NYUA 2R3SA 4OX9Y 1JSZA 2P7IA 1PJZA 5EIWA 4RTPA 1KYWA 5DX0A 2ZW9A 2AZTA 4C06A 3UJ6A 2ZTHA 1I9GA 4ER0A 3M70A 3HCEA 4C4AA 1G60A 5P8WA 4LG1A 1FP1D 1JR4A 2PKWA 3BGIA 2ERCA 1G55A 1L1EA 3FTFA 5DPMA 3LBFA 3LX6A 5E1BA 5LQUA 1KP9A 1JG1A 2AR0A 3ER8A 4RTMA 4DMGA 2ONZA 3PB3A 2GB4A 4QDKA 1XDZA 3LSTA 5JR3A 4HG2A 1NW8A 2AOWA 3TM5A 4ZTBA 2IBTA 2ZWVA 3G2QA 4DKJA 1QAQA 2OO3A 1KIAA 2I6GA 2YXLA 5F2KA 3OE4A 5LQCA 3ELWA 2P8JA 1SG9A 1PRYA 5DT2A 1YUBA 4BY9E 4YMGA 3KR1A 2ZZMA 5LQRA 1F3LA 1KXZA 5EQJB 3FRHA 5ICEA 3HCBA 1FJXA 3FPJA 2HR1A 4E2ZA 5LQKA 3CGGA 1WY7A 4B17A 3IYLW 3F4KA 5F2OA 4AZSA 3NWEA 5HOQA 2ZBPA 3V97A 3UA4A 4GOLD 3A25A 3UFBA 3A4TA 2EJUA 4OBXA 3FRIA 5ICCA 4PCLA 3GXOA 3HA3A 3KPYA 1I4WA 5C0OE 2G70A 3G2MA 4G56A 4IKPA 5HIIA 3T7TA 1Q0SA 2KW5A 5K0NA 2B9EA 1D2GA 3FPEA 3KR9A 4AZTA 3A27A 3NDJA 4PYKA 2IH4A 3PT9A 3DXYA 4PINA 2IGTA 1SUSA 2BR3A 3OFJA 1X1CA 2NXJA 3UJ9A 1SUIA 1SVUA 4HSGA 4DF3A 5FULA 2CMGA 5DXJA 5HEKA 3G8BA 3CBGA 3FYCA 4KVZA 5DTRA 1N7IA 2O57A 5GOZA 1ZKDA 3EGIA 3LCCA 4QTTB 2FCAA 5E9JA 3LBYA 3VYWA 2YR0A 1FP2A 3MGGA 3VC1A 3UJCA 1P1CA 2V7EA 2ESRA 3PX3A 3DXZA 2H1RA 2XYQA 2OXTA 1JQEA 3ANXA 5LQAA 1AV6A 2Y1XA 1JG3A 2NNWB 5KS2A 3P9CA 2HMYB 3ELUA 3X0DA 3P2EA 4GC5A 2NXEA 1YZHA 3BGVA 3DP7A 4M7RA 1X1DA 3P9IA 4PYQA 4X61A 3GIWA 2F8LA 2PX2A 4CKBA 4ER3A 2ZBQA 3VSEA 1N2XA 3FUUA 3HEMA 4PIMA 5ICGA 3BWYA 5DX8A 3FUTA 3NTVA 4X1OA 1XTPA 4ER5A 3BUSA 4YV2A 3LDFA 5LR6A 4RTSA 1VP9A 2OKCA 1FBNA 4E31A 3TPZA 4PONA 2FK8A 2N47A 4DZRA 2BH2A 1HNNA 4RTOA 2PXXA 2AOTB 4Z2YA 4RTKA 4AX8A 3HCFA 5EKXA 4WVLA 4E33A 1H1DA 5C1IA 5IH3A 3UJDA 2JG3A 1RI3A 4KW7A 3EVZA 2P41A 3JWGA 3I9FA 1AF7A 1RJDA 5DWQA 4CXMA 1UIRA 1XXLA 3LDUA 3FPHA 4E2WA 2ZLBA 5GINE 2C7PA 4GOND 1P39A 1VPTA 5U4XA 4C04A 5CVEA 3KQYA 5EMJA 3THSA 1RJGA 1WXXA 3Q7EA 5E8RA 5E2AA 2ZWAA 5LSAA 3OU2A 1MHTA 1KPHA 5GP1A 2HWKA 1EG2A 4O29A 3UWPA 3GJYA 4NECA 4FGZA 3GRUA 3SM3A 1ZGAA 1JTEA 4OA8A 1WS6A 3HCCA 4X60A 3PS9A 4P58A 2G71A 3UA3A 2XYRA 1KHHA 3FPGA 1DUSA 1RI1A 3HP7A 4RVFA 1EQAA 3GGDA 1D2CA 4GOMD 1VE3A 5B1SA 2YXDA 2I9KA 3EVAA 2FYTA 5K0BA 1UWVA 1VL5A 5K8VA 2FRXA 4EKIA 5EPEA 3DR5A 1TPYA 5FQOA 3NDIA 4EKGA 5DTMA 2IPXA 4R6WA 5BW4A 4ER7A 5DXAA 5K05A 3B3GA 1KYZA 5EG5A 3LCUA 4QQKA 2NP7A 3BGDA 3G5TA 5DM1A 3RODA 3GRRA 2O07A 3OE5A 4PGHA 5CVVA 2IDKA 3SSOA 4E32A 1P91A 4GC9A 3EMBA 3MERA 3PX2A 5C9ZA 3EVFA 2IH5A 3MQ2A 1VQ1A 4Y2HA 4PYJA 3HA7A 3SSMA 3LKDA 5FA5A 1R00A 5EZQA 5FHQA 2C7QA 4OA5A 2AN3A 4Y30A 2G1PA 2GAFA 4A6DA 4LWOA 4U7PB 2P35A 3DUWA 5EMKA 5K0FA 3HCDA 2ZZKA 4OBWA 2XYVA 3I64A 5T64A 5CVJA 4BLWA 3ER9A 3NVKI 4QDJA 3A7DA 3G88A 2O0LA 3KPWA 2ZCJA 4JXJA 5CUQA 1L3BA 3KR0A 3MB5A 1X19A 4BP3A 1NW7A 2ZFUA 3KPVA 2B78A 2QRVB 3LECA 4P7JA 2FPOA 5EHIA 5DRYA 1I1NA 5D1NA 5KVAA 3B3JA 3R6TA 2IP2A 2ZVJA 2HV9A 3IEIA 4YUVA 3UZUA 3Q87B 4ATNA 4DCGA 3M6XA 3MTIA 3IHTA 4C08A 5GWXA 5LQJA 2PJDA 2XVAA 4RTNA 1SQGA 1KR5A 1R8XA 3GWZA 3EGEA 3HVHA 2V74B 5K09A 2H00A 4MIKA 2AN5A 3P9KA 2BM9A 2QM3A 4PCAA 5EVJA 4GF5A 2C7OA 2NP6A 2AOXA 2BR4A 5HIMA 5ICFA 4PIPA 4QVKA 2H11A 5E1OA 1Z3CA 4BLVA 5T6BA 3P71T 5K0GA 4GEKA 3EPPA 1RJEA 1SKMA 1NT2A 2UYOA 2VS1A 1JG4A 2AN4A 2P3LA 4R8SA 5E1MA 3TQSA 3BZBA 5KQRA 3EVEA 8MHTA 3PFHA 4CTJA 2UYQA 2AS0A 2PLWA 3KQTA 3REOA 2XVMA 4R05A 4DQ0A 4C03A 2ZIFA 1YFLA 3B3FA 3CJTA 2K4MA 3TKYA 4OQEA 3TM4A 4R8RA 2YVLA 2OBFA 1L3IA 4RYLA 5EOVA 4U7TB 2UZ4A 2PX8A 4GBED 1XCJA 2PV0A 4FR0A 3C3PA 1R74A 4CTKA 4YV0A 2P1DA 2P3OA 3ELYA 3JWJA 3TLJA 5DSXA 3R24A 5M5BA 2JHPA 5G02A 1Q0TA 3PTAA 2LD4A 1YB2A 2PT6A 3NMUF 4HC4A 4RV9A 4FP9A 5K0LA 3BWCA 3R3HA 1AQIA 2P7HA 2PY6A 2ORED 4HTFA 3DMGA 3FTEA 2EG5A 4DA4A 3A26A 1QAMA 3UJ8A 2FK7A 2ZSUA 3BXOA 3WSTA 3EVDA 2PBFA 5K01A 3OU6A 2C7RA 4ER6A 3PFGA 1BHJA 4RWZA 1JTFA 4CKEA 4H0NA 4XUEA 4EK9A 5GM2A 3KQPA 1DL5A 3M4XA 4HRAA 4AUKA 5E9QA 3GDHA 3T7SA 4YUYA 1N7JA 1IXKA 2ZZNA 2BZGA 3G89A 4FZVA 5E8JA 2WA2A 3KU1A 4XUDA 1INLA 2G72A 5EKUA 2AVDA 5HFJA 3C6KA 4PYLA 1D2HA 4A6EA 5CIYA 1NKVA 3GNLA 4FSDA 2OB2A 3V8VA 5FUBA 1BC5A 2VDWA 3O31A 3HM2A 1ORIA 3QOWA 4MWZA 4V0QA 5CVUA 3KQQA 3GRYA 5EGSA 2EFJA 2Z6UA 2QY6A 2ZIGA 3GRVA 5DRTA 3THRA 2NXCA 2CMHA 1NBHA 3G2OA 1VIDA 3HCAA 4HH4A 1NW5A 3OU7A 2OY0A 1KPIA 3G2PA 4RVDA 3FZGA 3TRKA 1ZQ9A 2JH8A 4GQBA 3E05A 3AXSA 2YX1A 4FS8A 1NE2A 2JH9A 3OFKA 4IV0A 5DSTA 4XUCA 1O9HA 2R6ZA 2YTZA
chains in the Genus database with same CATH superfamily
3Q15C 3N28A 3R7SA 1FFBA 5DYYA 5ETJA 2A4KA 5SYNA 2NVUB 1I4DD 1H42A 1QNFA 3G17A 4PE5B 3O4HA 2YN4A 1P4AA 1RQ7A 4BNJA 4TTJA 5JZVA 1R4MB 2X19A 2QOEA 4M38A 5CPFA 3LKZA 2GNOA 3TNFA 3C8UA 4A15A 4OLAA 3NBQA 3OFNA 4WPGA 1ZK0A 1FFXA 3DO8A 4MRVA 2YKGA 1DBIA 1WV0A 3WO1A 1IEQA 3CNOA 1WCXA 1ZN9A 3DKPA 3NOXA 2C78A 4JUAA 4HB0A 1YE3A 4PAQA 4P31A 3S68A 5CG1A 1RRCA 3DE7X 3OZTA 1EVKA 1YQXA 4HRXA 4UPVA 5KAMA 1JJFA 4RVCA 3AF0A 3LT5A 4RLQA 1DJLA 3HY4A 4ZEVA 2FLWA 3DMRA 1ULTA 3EVGA 2QB5A 2R8XA 4UBJA 2WSLA 3B9RA 1HEUA 4POOA 3DEJA 4HAZA 3ZWYA 3MHTA 1CE8A 5K4AA 3H1FA 2MR5A 4JJ7A 4U9UA 5B64A 3KSUA 4IDGA 3HJFA 4KUHA 3ONNA 1ISPA 4ZYWA 1IN1A 3ADPA 3NNDA 5B3LA 1E6WA 3TI9A 3BTSA 3I8OA 4E1VA 5KNCD 2GHTA 2HUNA 3LQ1A 4JELA 4QIHA 4MUBA 4G8BA 5LMZA 3R3UA 1JNYA 1GDTA 4NH0A 2G82A 4Q3CA 1TKRA 5BWOA 4K6MA 4Q3DA 5ADWA 1J1UA 4KO4S 4R1OA 4YDHB 1CUXA 1BNCA 4S1TA 3AHJA 2SNIE 5B58C 3GFQA 1ZRSA 2W42A 3EPJA 3GCWA 4JZKA 2PGXA 2MR6A 2YQZA 1OBHA 4H7PA 4MR7A 5D86A 4FI3C 1X38A 1L5OA 4WZZA 1E1MA 4M55A 1SOAA 2DJ5A 3K94A 4V0SA 1L5WA 5AKYA 2HNKA 2FG7C 2IY9A 3KJIA 4NBWA 4QUKA 3B1VA 1Q1QA 3ANNA 5AVWA 4N5LA 3JAWB 5FUMA 1AS0A 3HK2A 1IOZA 2HXYA 2OO7A 2R1ZA 4RZ3A 4AL4A 4BTVA 3GZJA 1P1HA 3PUZA 5ESDA 4Z9XA 1VG0B 1DCKA 1N33B 1GXSA 4LISA 3OAAD 1M6HA 3DHNA 5IKPA 3PBKA 4OV6B 3VR5D 2V7PA 5KYGA 1D0IA 2XYGA 2QW8A 4G37A 3B1FA 1BQ3A 3B38A 5HKKA 1O57A 3KVRA 4MQEB 3H83A 4MYDA 1CJBA 4DLKA 3TMKA 2WM9B 5TGDA 3OKPA 4NDNE 1TYDE 4RV5A 5FOSA 5I7SA 5FTLA 3QK7A 3SMQA 3S2EA 5A6SA 1PFUA 2XB6A 2FPMA 2LCIA 2WJ3A 4I19A 4UAJA 4Y6SA 4EITA 3AY6A 2HV8A 2G0NA 4MQMA 1WO8A 4I3FA 5FL7D 3AL0C 2Q7DA 2PJZA 3H5NA 4R2MA 5GIOE 5LYJF 1CE8B 2V6MA 1PZEA 5LL6P 2FMFA 1IY1A 1T43A 2P6OA 2J5RA 4WBSA 2O1SA 2PZKA 2RCYA 3K0BA 1WXHA 2PMEA 4XKJA 3ZX5A 4GS5A 1PQYA 3W3AA 4GPIB 3DT8A 4ECAA 3AI2A 2VHEA 1X14A 2VRWA 4C7OB 1AX9A 1MX3A 4N7RA 1MC4A 5G3YA 5HRCA 2HDHA 3FSGA 3OF3A 1BFUA 3GN2A 2F4NA 4NPCA 3RFTA 4D46A 2ZXUA 1QGUB 3ORFA 3PVCA 2QT0A 4MROA 3AVYA 4WY8A 1OUMA 3D5QA 5BNZA 2FJPA 5FR2A 1E9CA 1KYVA 4C07A 2B7BA 4PC2A 3Q4GA 4M8LA 3D4IA 1YV9A 4M7OA 2OECA 2VWHA 4RIEA 1TCVA 3VNSA 4F4UA 1CY4A 4LBWA 4X8OA 3LL4A 1VJ0A 1Z37A 3BGWA 5A05A 1GUBA 1MC8A 1E2KA 1Y9JA 2FFHA 1PGOA 2ZTVA 1XZGA 2GBCA 1YE5A 2NTNA 1TF2A 1WP4A 2I55A 4HAWA 3LLVA 4MDHA 1NJ8A 2BSAA 1JIVA 1GXSB 5DTJA 4AZWA 4FEYA 1J1ZA 2B2CA 3SYKA 1I51A 4HDAA 1JIKA 3G0GA 3QP9A 1EX7A 5EMNA 1PFVA 2JANA 1YMQA 2ZSHA 3FTCA 1CX9B 1V2GA 3GLTA 1T5SA 4HADA 3W5CA 3M6VA 4RHXA 3QPAA 3CWCA 4EX7A 1NURA 3KHTA 4C0BA 2XTJA 3GCDA 5JVDF 1RCUA 2LXNA 5HKLA 1GPNA 1ZD1A 1M83A 1CBUA 2QQ5A 3F1KA 1FMLA 1MDFA 2P6PA 3ME5A 4RHYA 3WLOA 5HG0A 1XJ5A 3OQ1A 5LKRA 1T2VA 1XTIA 1H1LA 2PZEA 3QJ5A 1AT1A 5B6JA 2HF9A 2VZ0A 3N74A 2P2SA 3LO5A 2G08A 3F6BX 1FUKA 3PUIA 4MYUA 3ZCSA 4C7VA 1MPTA 5JAOA 3IPAA 3LHDA 3AHEA 3LUJA 4QFBA 3L0DA 1JR6A 4LJ4A 2PUWA 4WKPA 4C5BA 2QSZA 3OCCA 1XMPA 2J4FA 4EHJA 3R2JA 1M0EA 4WCDA 1M1ZA 2ECFA 3FI9A 5KCZA 1M7HA 4P5PA 4IICA 4E94A 2PNFA 3JYNA 1VP3A 2H2IA 1QHHB 1EXNA 1DBVO 4EW1A 3VC2A 1L5VA 2D5IA 3DLPX 4NHEA 1EB9A 4Y9TA 4DIKA 1UWLA 2CLHB 2WFZA 1AKWA 1TKCA 4I5IA 2QQEA 4Q9AA 4JUIA 1PJRA 4J94A 2JIMA 1RYHA 5IYZB 2ZBDA 5TGZA 5JQGB 2ET6A 3P2MA 3M9WA 4PYOA 4H35A 4BMCA 4RHTA 3IHLA 2GD2A 2P65A 4MZDA 4OQQA 3VNBA 5FJJA 3MAGA 1RJFA 4N3AA 2H1SA 4F2PA 4HN9A 5JI3E 3BK1A 3QW4B 3R4VA 4EGQA 2ORIA 1E6EA 2ZS8A 4HRYA 5PNTA 1HDGO 1VIVA 3MOSA 4LGMA 5A4FS 1T2DA 2DU8A 2Y27A 4P3KA 3RTEA 4V24A 4X7MA 1Z15A 3GJ0A 4LG1A 1GLVA 4Q4LA 4GI7A 5FH9A 2QL9A 4OKIA 4HYYA 2C3OA 5L7YA 2RGEA 1MXFA 5K3EA 4Q93A 1UBMS 1KWGA 2IELA 5ILOA 4Z4GA 2O8VA 3B5EA 4D3FA 2ST1A 1SKBA 3IVGA 5D3KA 4EY7A 2ZBFA 4ZTBA 1PR5A 2GZHA 3TWOA 1CUYA 2B5WA 2ETVA 5EXXA 1OAOC 1YRBA 4C7BA 5CBPA 1QJ4A 1C4KA 2WJJA 3GFRA 4JSRA 3SC3A 4Q3NA 2BKEA 1JAZA 1FXSA 4GXNA 1X94A 2ZDQA 1DIHA 1AUXA 1EMDA 3CLTD 4J75A 1KO7A 3MWGA 4NTZA 4R1SA 4WBXC 3ZWOA 5ICEA 4QUHA 4FLMA 4E2ZA 4N7JA 4YAKA 2QRKA 2R2AA 1TCUA 1Y5RA 4FZJA 2VC2B 4IO0A 4X91A 2XT6A 1GFSA 2JFNA 3LZ6A 3WAKA 5ILGA 1LXCA 3O8CA 5AR1A 1EFPA 1XEXB 1QFYA 4N12A 5J2TF 2X1VA 1KC1A 2VSQA 2CXTA 1SIBE 1TE2A 1U1EA 2XMPA 3PNYA 2BMVA 1KL7A 1R0LA 3IT3A 3OOWA 5F4BA 2QEQA 3L92A 3VDRA 4C2BA 4F4CA 3FPEA 3B51X 4J0KA 5DM70 4H3KB 4L8LA 1RKVA 4F3KA 1COWD 1DNPA 1NE7A 2J3MA 2ZAMA 3V46A 4P9NA 2VJQA 3OJLA 1ZAKA 4RY2A 1OTYA 5AWFC 3UJ9A 2P69A 4V0KA 1XHFA 4W5HA 5I9TA 2O5EA 4FYVA 3A1EA 4WA7A 1NF8A 5DTRA 1E6MA 4TLDA 1FMTA 5EJIA 4B8ZA 1ZKDA 2DH6A 5E7IA 3GPLA 4PLPA 1ZCZA 3RWBA 1M7GA 1LA2A 1ZGGA 5EESA 3BIXA 1YOVB 2C9ZA 3NS7A 2ESRA 4ZO4A 2HI0A 4GPZA 4YP5A 1VRWA 3Q3VA 2OXTA 3TCKA 5J4HA 3AVQA 1PUJA 4K6HA 2OHGA 3QTLA 4ZCSA 2FV8A 5CRIA 1DZ3A 1SKYB 2IXTA 3QKUA 5C1OA 2HMYB 4AX4A 4GC5A 3IMFA 2P4QA 2GKGA 2X4LA 4KDFA 5L3SA 4X61A 1CEEA 2NUAB 2PX2A 4ER3A 5F35A 5C7LO 3SQNA 1MT0A 3HEMA 4PIMA 4AN1A 4TMTA 3BUSA 4BFVA 3FGOA 3QU9A 5LNK1 5TB5A 4CLEA 4XCQA 4KOAA 1NR1A 4HD8A 4PONA 1NA5A 1L0BA 3MCUA 1SXPA 1RZRD 3HKBA 2B5VA 1TZBA 2AOTB 2HA0A 1DE0A 2PRYA 2QN8A 2ZROA 4FYHA 4R8MA 5SV2A 5H1YA 4B6QA 4KXFB 5EKDA 3T8YA 1E6LA 1Y9DA 3C3CA 3EVZA 4TKVA 2XRZA 1LLFA 5EGNA 3FVVA 1PJBA 3FWPA 4Y1RB 1ZVJA 3OICA 1ISMA 2XAAA 2JLAA 5EJ6A 3R9WA 3COSA 1ORWA 2IEYA 3SC4A 3HXTA 3S81A 3H19A 4HQRA 1RJGA 1WXXA 2CKMA 3WG9A 1PIWA 3W5DA 5ILQA 4P82A 3LI2A 4G9GA 4XGKA 3GLQA 1MHTA 3RFCA 3SZOA 3P20A 2C2ZA 1MQ8B 3BHNA 3TOXA 4MRSA 1ZGAA 3WRXA 3JD1A 1Y1PA 1OHHA 3D6TB 3L46A 1E79A 2I2BA 1F0KA 1QX3A 1M1XB 1NHWA 3LBIA 3EZ7A 2O7VA 5JCXA 4KITB 2FG5A 3T38A 1NJ1A 3A06A 4IH4A 4YEDA 1BXKA 4PRKA 3ROFA 2CMFA 3X1WA 1L4UA 4BZZA 2CDNA 1PBNA 2FYTA 4M1YA 1R0YA 3HBJA 1B0UA 1O6GA 2Q27A 3RIHA 1MOQA 2PRSA 4A23A 5BVGA 5CAEA 1TTTA 2DOKA 1N75A 2QD2A 1WAMA 2B35A 2IKSA 2OVBA 2HM7A 3KAJA 3M6MD 3NHBA 3DE3X 4F45A 2PU5A 2V6GA 5DBFA 1WCIA 2XDQA 1XXHE 3EMBA 4RPHA 5FPQA 2ZDHA 3EVFA 4RBNA 4D99A 1W7AA 2QGZA 3TSYA 1E63A 3MQ2A 1YHZA 3DVAA 2D00A 3NHKA 3IIMA 3QEAZ 3JR3A 4KXVA 2VPTA 5KYYB 1HUQA 4AKSA 4DCCA 5KOIA 3DLTA 2F43A 1JT2A 3LA6A 4QBFA 4Y30A 1GY8A 2WF6A 3RSOA 2O7NA 3ICOA 2E2WA 3KXLA 4PRLA 1PS0A 4D9FA 2ZYAA 2G0TA 2ORVA 3OD5A 4KAAA 3QKRB 1OU0A 3NM4A 4BO4A 4RKFA 3B1YA 2HHAA 1O2DA 2JRCA 3LG2A 1T1IA 3ONWA 3HU2A 2H63A 4FHEA 1WZCA 3M4JA 1HG1A 5HQTA 5I5EA 1EFKA 2K87A 2VUUA 4Q1EA 4LF9B 5JWOA 1BZYA 2VPIA 3SZUA 4PBRA 4YP0A 5WRFA 1TTHA 1X8XA 1XRPA 1LWNA 1Q0ZA 4OIFA 4UMEA 2WQ7A 3WQBA 1AGYA 1CEYA 2UZ1A 4MZXA 4E51A 5JT1A 4LQCA 2C84A 1BHO1 1FDIA 2IE8A 4WFKA 1FBTA 2ERYA 5AJTA 1M1YA 3RSHA 1Q0QA 1DP4A 1C3OB 2BM9A 3GT4A 3OX3A 4TM8A 4FBGA 4GF5A 4Y67A 1YMVA 3T1OA 4TYNA 2V7VA 1T10A 3AEUA 3R3ZA 1DIAA 4QVKA 3ENNA 5BYJA 1PEKE 4FGUA 3SVLA 3PFBA 2JJYA 4UNNA 1U0BB 1A50B 2EKLA 4TWRA 4RPKA 2VS1A 5AK0A 1CCWA 2YJNA 2OCDA 3CUTA 3TOZA 3AUYA 3ABIA 1KEVA 3PFNA 4YMWA 1CFJA 1MH1A 1L2TA 1LWOA 3ZV6A 5JMPA 2PGLA 4I08A 4X1IB 1LQTA 3MINA 2QTCA 3TNDA 4B7UA 2D0OB 2BFEB 1BS2A 4IXDA 3CV3A 1LW7A 3B3FA 2UUAB 1ZW1A 4RY9A 1P5RA 1ZIOA 1E3EA 1ZMRA 4RYLA 4AAYA 3ZU3A 3VPDA 3IOYA 4HPWA 3LUKA 4B31A 2OWEA 4NATA 4OHRA 4XB6B 3K0FB 2WJVA 3HFGA 4D1YA 3JARB 3OTGA 3VO1A 3GGPA 3UT0A 2IHKA 1SVKA 3ROZA 5L6MB 3PTAA 1IOVA 3EWIA 2O54A 5E6SA 4DSNA 4Y18A 2XOKA 3BWCA 4EHHA 3SU8A 2J3JA 2QMUA 2WT9A 4MWCA 2PY6A 5F9MA 2QVLA 4FDUA 3ACBA 4QASA 3BXFA 1J0EA 4V2IA 3VR4A 2W6OA 2VH5R 1AQLA 3FKJA 3BXOA 3IKTA 1R0ZA 3PXUA 4WNAA 5A9RA 5K01A 5JAQA 3OX1A 5JD4A 4BMPB 1DEAA 1ZYUA 4H0NA 1JDJA 1R8JA 3IXLA 1H4TA 4HAUA 4NENB 1I6KA 1OV6A 1CERA 2P9FA 3C97A 4GYYA 4YUYA 5CDSA 3HUUA 2V97A 2AFHE 3LBHA 4Y6QA 4REOA 5E6UB 4C88A 4IRUB 4W9NA 3QBJA 3WLKX 1HL7A 3BD9A 4DR2B 1N0WA 4G09A 4NYIR 4INJA 2EARA 5F52A 3CVWA 1ZEJA 1M9NA 2C9OA 2OT3B 3HHEA 3NPAA 1Q14A 1K92A 1PFWA 4JH0A 3I5XA 3ZGOA 4EG6A 3KE8A 2ECPA 5FBHA 4O4IB 1P2SA 4HBGA 2I6UA 3LXRA 4XGNA 4DLSA 4K0KB 1G9TA 3I37X 2Z6UA 3KZXA 3OZCA 3FCAA 4OMFG 4IY1A 3ZU4A 5BNTA 2GEJA 4QFDA 3INRA 3PFFA 3Q7QA 4CODB 1U0FA 3GHYA 4HH4A 4YXWD 5JRDS 5TE9A 5K3AA 5C8ZA 1JEEA 1DQSA 1ZL0A 1ZQ9A 2ZUSA 8AT1A 1RAEA 3AM4A 3ANTA 3OWHA 4RETA 1YMUA 4MUIA 4RGBA 2QUIA 5FP0A 2JGKA 3R3XA 2Q3HA 2YTZA 2GBLC 3IL2A 3ANYB 1ZVMA 4W5JA 2RGAA 2RIRA 2X1LA 3CRMA 1A72A 1B0PA 2BH9A 4IL5A 421PA 4BE9A 5LN1A 1QQBA 4YRBA 2RAPA 5CTAA 1KS9A 1U28A 1J23A 3D2LA 3LLMA 3O1HB 2P1RA 3GAFA 4OLFA 1FJHA 1U9YA 2VXYA 2IEIA 3H86A 3GQVA 1Y1RA 4X84A 3MRVA 2GPWA 4TT8A 3FWKA 3RTAA 4GBGA 2BKXA 5AKJA 1UBCA 4HY3A 5IANA 1N5OX 2C2HA 3UO8B 3MMXA 4RV4A 4U00A 4ALMA 2PS0A 4RVGA 2BI4A 3GLIB 4LF4B 1BA3A 1D2AA 2BVNA 4QRDA 3AFIA 4W5OA 3OD1A 1JMYA 2H57A 4ON9A 4FNOA 4CEHB 1LLQA 2C4VA 4EGAA 4QTUB 5U9CA 1UFOA 3R7WA 3AF5A 3DMNA 5LZ5A 5DP1A 4GKBA 3BXXA 3KV3O 3VBCA 2Q5FA 1U3UA 3WGTA 5MGNA 1DIRA 1P73A 1T2UA 2ZIUB 1NW6A 2XKAA 3A6ZA 3H2IA 3CW9A 1NXTA 3JALA 3OO0A 4FOSA 4WRRA 2RJ3A 3JWEA 4BNNA 2J0QA 2R1VB 1N6IA 1SKYE 4B82A 2UYCA 1XNQB 5FQNA 3VU3A 2AF3C 2V1XA 2PX0A 3HABA 3KWJA 3PWSA 4GPAA 2RKWA 4JV5B 4IIYA 3TGWA 4IIFA 4ZO8A 4N7MA 1OOEA 5HP4A 3ZD7A 4TL6A 2CNNA 3AW9A 1YRHA 1RQXA 3C0KA 3GCZA 1YR3A 3D02A 2OCYC 2ZDGA 4TTRA 3ZYCA 2WC1A 1M6WA 2OEPA 3MS7A 5KHOC 3UY4A 2I8AA 4XPIA 1E2PA 1YZQA 2EG9A 4GE0A 5DTIA 3I9KA 1UANA 3ZJTA 2XA1A 1CNEA 2GUWA 1V4VA 2PSEA 1T8RA 2XXJA 2YYSA 3HLYA 3DJYA 3RPEA 3SVTA 5H9VA 2X77A 4MP8A 4F2WA 5E7MA 5EVCA 2JF0A 4G0QA 1F1JA 1DI0A 5BORA 1LLUA 3TRDA 4ZDIA 1M2OA 2HK7A 4U39A 3OVMA 4CETA 2VJOA 4F7DA 3VX4A 2O6HA 1R37A 4ILKA 2PIDA 1I32A 5F1KA 3CF0A 1E5QA 3JXEA 4YWJA 4E1BA 5KWIA 2I2AA 2NQTA 1H8ED 2J41A 3CZ9A 1TJ4A 3K4HA 2X41A 4NULA 4FFLA 3WZ2A 1PWYE 3ZTYA 4B44A 2PTHA 3R09A 5F9HA 2GZSA 4ND5A 3CVUA 2HWWA 1O03A 1ZPDA 3GPDG 1IB0A 1T0BA 2MDTA 4WX2B 2IW3A 5B58T 3CCFA 1Y4SA 5KAPA 1PS9A 4PO9A 3E1SA 3E5NA 4EENA 4LYYA 1TTQB 4U8GA 2W2OA 3ZHTA 4JQCA 1RACA 2IBSA 2I62A 2VSYA 2HU7A 3JAMA 4MI9A 1Q22A 1T5BA 4MIOA 5FD8A 4K8RB 1UC5B 2GESA 5JECA 4KV7A 1XMOB 2JFBA 3WGLA 2VI5A 4NH4A 4OFXA 1VPVA 1SOMA 2RH9B 2FRVA 1Z5VA 5HOEA 1T3TA 2EQAA 3IR5A 5LA6F 5KC8A 1Z75A 3H2BA 4YRFA 2HD4A 5E6RB 3GLIA 1R9MA 1XC7A 1PFYA 5MGBA 3WRWA 2XMRA 3HDGA 4A6XA 3E7FA 4BVHA 1C80A 1S1CA 1V8FA 3DWGA 2QTMA 4FX2A 2WUFA 3KQWA 2F8TA 4FC7A 1HV8A 2G09A 2CMKA 4JIGA 4KWEA 2P40A 3AFGA 1UJBA 3EG5A 3WLTA 4BO6A 4XPZA 2GEBA 3K8OE 5T6MA 1VLHA 2IK8A 2I3ZA 3H05A 3O8OA 4WCFB 2I5PO 3LVRE 4KQIA 3JAKB 4QGHA 5BYAA 3V3TA 3M1AA 4Z8YA 1PWXA 1SA0B 2FUNB 3B2NA 4M88A 4YJDA 5DBOA 3RARA 2WWXA 2PZBA 4GMXA 3IBFA 3LOUA 2YWDA 4HFRA 1JJAA 5TF0A 4B09A 4AURA 1DT3A 2J0SA 1OLUB 3VNQA 1PGJA 4N48A 1CEXA 1ZCAA 1ZJ5A 3Q7EA 4ALNA 3WLIA 2QI9F 1FS5A 3A32A 1R6BX 3IIJA 3KWMA 1QAOA 4NMMA 2AQ8A 3PXCX 4RX1A 3EXFA 3V5NA 5EJEA 3RVDA 4H15A 1JHAA 1Q57A 4M0UA 3Q5EA 1O9GA 1XZDA 1N0VC 4RVUA 5T7BA 2IS2A 3IAS1 4QEKA 3ZJ4A 4JI2B 4G4JA 4UW9A 3QNMA 4N6NA 3S2UA 3CEMA 2JHCA 5D51S 1Y37A 2VQ3A 1NGSA 3IQGX 3JZAA 4ZEMA 1V5WA 2O8BB 1P2GA 2X7JA 2DHDA 3F4LA 1FRVA 1UT8A 4Q3OA 1ZI8A 2DF8A 4B7CA 3HG7A 10MHA 1GZ3A 1L4GA 4NDZA 4OQFA 2Z08A 4P86A 2MCFA 3CVXA 2FPGB 3AILA 3DBLB 3AOGA 3O4JA 3PRKE 4CNBA 5HUHA 1RXVA 4D8YA 1PNOA 2FWPA 1DOAA 3NW9A 4JS0A 1Y8RB 3UGTA 2WIDA 1MO5A 4N54A 2G9RA 3SE7A 4QBGB 3RU2A 4ZT2A 5J5CA 1X7ZA 4I66A 1CZUA 3HV2A 4IQFA 2B1RA 4ZJYA 1MORA 2OA0A 1WABA 1WMFA 2MOKA 3D8UA 3MIIA 5AJZA 4FHCA 3GFFA 4WWHA 1SCBA 2UXDB 2FEAA 4M0CA 1GJRA 1E3WA 2CJWB 1DQRA 3W9BA 1SQ5A 3ZLUA 4RTPA 4LSGA 1WKVA 1WSDA 4HWTA 1Q16A 3NTOA 1N0IA 2BFOA 2ZI9A 5EJMA 5I7AA 4DUGA 3OCWA 3NC4A 1H93A 1FB5A 3PTZA 4CV0A 5BUQA 4LZWA 4FLEA 3Q8XB 1EXVA 1QH0A 4CMHA 4JYZA 1ISGA 1GUYA 2INGX 4EQ6A 5JR3A 5AXBA 3STHA 6YASA 4CZ2A 4B0PA 4IJUA 2JVKA 2V7BA 1EP3B 2JAOA 4ZKEA 3OTOB 3GVHA 2GN8A 2BP7B 5C5DA 4YCBA 2C2KA 2WYOA 2Z2JA 1MP0A 1CJKC 3KR1A 2J3QA 3RKRA 4M7WA 2QP3A 5DT9A 3A9SA 3FPJA 4EJ0A 5HRAA 4XFJA 1SKQA 4CF5A 1WHTA 5AK5A 1OGJA 4DR6B 2JARA 2POCA 3AI7A 1QP7A 5HOQA 1DDGA 1HBJA 4GOLD 3FPCA 3ACDA 1QLHA 2ZAIA 1V9CA 1CP2A 3L0OA 4RMHA 2JS7A 3DBLA 1GKKA 5BQ5A 3JASB 4Y1EA 2YIMA 1ZWLA 3FJOA 3IDAA 3Q3EA 1GUFA 3ORQA 3WLAA 3FNBA 2ZI3A 5LJIA 1C3VA 3G79A 4FHDA 2B9EA 4B48A 4AZTA 3C3AA 5BR1A 2BJWA 1LPBB 3PT9A 3SBXA 2QVCA 3KXKA 3JRWA 4LHSA 1L1FA 1S2DA 2PM8A 5JAMA 3UMVA 3N76A 2C2GA 1UXGA 2VK2A 1M2FA 1XF9A 3QE9Y 1USGA 1B4DA 1YDWA 3LUAA 3ZHCA 1J00A 4QTTB 4B83A 5A9SA 1I3KA 2FCAA 1UDCA 5E6SB 3H9GA 3ESYA 1XL1A 1A0OA 1Z6ZA 1BX0A 1ZRNA 2PZMA 2YN2A 4JROA 3TPFA 1JGTA 3SYRA 4CVNA 2G88A 1UMDB 5IK2D 1O89A 2BFCA 5IT0A 3MWEB 1GYPA 3P2EA 1U7UA 4Z0NA 2H17A 1CY0A 1HSZA 2JGMA 3IAAA 1T5IA 3RBVA 1PR6A 3Q12A 5A1JA 2RBGA 2A92A 1A9XA 1FFSA 1Y6JA 4Z99A 2ZT7A 3VBEA 4LJ5A 4C4PA 5ALRA 1SHKA 3BWYA 2BFFA 1PT9A 5BN1A 1A96A 1TYZA 4G67A 2Q45A 3G2HA 4JFRA 1I4EB 3VDMA 2Q4BA 3PHLA 1EQ2A 3W6OA 2CSUA 2FMHA 4AFNA 1IN4A 4KR2A 1RD4A 3LRXA 3A9VA 3KQLA 4S24A 1E3WB 2CJWA 4K9MA 4G01B 3OE7D 4LDZA 3TTTA 3OZ7A 1W93A 1QBKC 4G5OA 5JDIA 5AJVB 1LBSA 1T3HA 1THTA 1HRKA 1NI3A 2VHQA 1V9LA 5FUQA 4ZVSA 4BAZA 1Q91A 4ZCRA 4BC0A 3PNVA 2VSFA 1E3DA 1JUDA 5BUCA 1MAUA 1FP4A 3HZOA 2JPDA 2X2PA 2H0RA 2Q3LA 1FMCA 4KSCA 4HEHA 3D6VA 2EZTA 5JSFA 1FQWA 1KPHA 2HWKA 2PV7A 1OKKD 3KT8A 1T2CA 1D2NA 5DDIP 1K2VN 5ITVA 4CKCB 2GJ4A 1DCFA 2CXPA 4FGZA 4ZEWA 4UTRA 4PHCA 3VI4B 1CUIA 3MJEA 1NSYA 2GTIA 1XKLA 1EG7A 2R68A 3GRAA 4H1UA 4F93B 5AJHA 1N3IA 3UH0A 4EB3A 5KTTA 2YWEA 3VR2D 3U7HB 2CWDA 2H51A 2PMCA 3BE5A 3MGAA 4IXNA 4AK9A 2PJRA 1TQ4A 2FSSA 4B2YA 3WK9A 2R11A 4IVRA 1QFMA 1WF6A 5AJYA 4KO8A 2M9MA 1GRCA 2AC4A 2W7TA 4YRQA 3A1CA 1TPYA 3ZY3A 1P6QA 1GYRA 3G8YA 3DBHA 3L4BA 1KYZA 4K6CA 2Y0BA 1P44A 2HCTA 4LDQA 4QQKA 5EE9A 4EGFA 1M2EA 2PSHA 3GRRA 2J09A 1HE2A 1M2KA 3LW8A 1WNTA 4UAVA 5KPDA 3UOAB 4BYMA 2WSIA 4LNHA 3RSLA 2BHNA 2NSLA 2B5OA 4DCSA 4NCJA 4KZKA 2W2TA 5K7SA 2XWBF 4GMHA 2H1CA 4UHCA 3QKWA 2Z58A 5EJ8A 1MT3A 4P38A 2PGDA 3U80A 1TAQA 1JFTA 2CYAA 1P1KA 3IE2A 1HNWB 3I12A 3T4UA 3KPWA 1NJ6A 2X9QA 4C7MA 2DEUA 1L3BA 1WXFA 2AEEA 3OOEA 4WZAB 2Y05A 1UKEA 1H8EA 2JIBA 2CNWD 3PJFA 5DP2A 5DYGA 3X2FA 2RGDA 2B78A 2YQ5A 2FQ1A 2JZNA 3CR7A 4QGSA 4MVJG 4OK5A 2ZCVA 2FPOA 3CZAA 5GV8A 1KRHA 2W0SA 1MZVA 5AICA 1BCRA 5CA1B 3UZUA 5BSFA 5JXJA 5DLDA 3BBLA 5C7OO 1YZFA 1K89A 2QTHA 5CNIA 5ALFA 3D8HA 3K32A 3OUTA 3G68A 2K6GA 3JYPA 3DAOA 4JB0A 4YLEA 4AYXA 1FFGA 1N2ZA 1U3DA 4KX3A 1C30A 3FPAA 1L4BA 4RA9B 2ON6A 3R9IA 2QM3A 3L05A 2NZ2A 4U0JA 1XJQA 2AOXA 1OWPA 3FOAA 1O97D 2YVUA 2YY5A 3W9YA 3CNQS 2C0QA 3EPPA 4NZNA 1NT2A 1LTQA 1KSFX 2R7LA 2IYPA 3AONB 2WBLC 3L7JA 3P45A 4M0FA 5TVKA 4CR6A 4E4YA 2DCMA 4MJ7A 4PU0A 2XVZA 1AKRA 4I46A 3PRJA 4D8TA 5KJCA 1CRPA 4C03A 2Z98A 5JNVA 2G0AA 2GPBA 4ZXPA 2L42A 3WYNA 4ENSA 1EP2B 3DDSA 3UCFA 4PZCA 3TM4A 4KMRA 4R8RA 4BL5A 5EOVA 5JJKA 1SWVA 1UKBA 4GBED 4BQFA 2YZNA 4M0MA 1TA4A 5EIOA 3WGQA 5ALMA 4CFYA 2HH9A 4ZMSA 1NUHA 1UK8A 4J16A 4WT7A 3F3KA 3R24A 5M5BA 5A4JA 3D6MA 4HQNA 1MNAA 1I3MA 3DMTC 1WQ3A 3KV1A 1KVTA 1JJIA 4M9XA 3K92A 2VHYA 3K4QA 2YMMA 4KQJA 5AVZA 3SQXA 5AVOA 1L7BA 3I42A 3AZQA 1VKHA 3A26A 3L4EA 5IM5A 3W6PA 2ZE5A 2VYFA 4ZOCA 3EZYA 2CV1A 2A7XA 4ER6A 2A1UB 1F20A 3RC8A 4OAQA 2M6LA 3W1EA 1BVRA 1OZAA 3BSSA 4ZT3A 2VJMA 3KQPA 3VM6A 5JHHB 5KI6A 1E1CB 2YXPX 3EPLA 5FOUA 2DZDA 1SFRA 5DW0A 3WISA 1COWA 3C5CA 1E2QA 2A2ZA 4M1ZA 1HE8B 3GX1A 2IYOA 1A9RA 5F3WB 5E6UA 2AVDA 2P0AA 2BDUA 2VF7A 4UOQA 5AW9A 5EINA 1Z6AA 1U31A 2P1ZA 2CNBA 4X71A 4M9RA 3T5BA 1HT1E 2VDWA 2F59A 4RSGA 3T9FA 1BKDR 3LPAA 3WHLA 4M1EA 4PAGA 3I05A 1H1LB 4FCVA 3HI4A 4ASUD 2V4MA 4BWGA 3HE3A 4N39A 4QHSA 3PJDA 3UBMA 3BD7A 3OOSA 5J4KA 2PAFA 4CMAA 3MMPA 3HCAA 2GYVA 2OCBA 3GRKA 1P9WA 3AKEA 5HCUA 1G5TA 1I6LA 1VKNA 2Y0PA 3KJQA 3PQFA 2BW0A 4KFUA 4RSHA 4QXRA 3T9CA 2A5YB 4EMUA 1A8PA 4MVJM 1GRNA 2P77A 1B8UA 1ZWKA 4ZANA 4ZZ0A 4MI1A 1WUYA 3W5UA 5IVHA 3SCZA 5TV2A 3G13A 1CQIA 2EX1A 3WHPA 5EHQA 4OI4A 3V9AA 4TTPA 2KX7A 4QGAA 2DWUA 1VB5A 2QJWA 1PNTA 4BBZA 4O5OA 4CM6A 5HVNA 1RWWA 2Q07A 1NKSA 5D01A 4BDSA 3HWWA 3LGAA 2ZPTX 4CIYA 1YH3A 4O3MA 1H23A 1ZZGA 4YQZA 3LC7O 3FYUC 1N8KA 3VOTA 4US2R 3EWAA 1DEKA 1YVUA 2QUJA 3ROQA 4DJTA 1K8ZB 1MJGA 4MA0A 3ZJ5A 1WW3A 4AF8A 2J31A 2WD7A 1X42A 2BTQA 1ADGA 2PANA 2ZULA 2X3FA 3KP1A 1RYBA 1ODIA 3FBGA 4QU8A 3GJ4A 4D4MA 2J0UB 4RH0A 1AHNA 1IY8A 1RIFA 1SAYA 1U6KA 1ZOOA 3QWBA 5CLHA 5JCJA 1MB2A 4DM4A 2VO1A 3W1WA 1YVEI 3DLIA 3WWPA 4IPTA 2G6TA 2P11A 3H4IA 5JADA 2C4KA 1ZJJA 4N5DA 3DDZX 1JG7A 1ZGJA 4MV8A 1GG2A 4G81A 4RK4A 3OLQA 1TM3E 4Q66C 4CQNA 4WCVA 1TUGA 3EZLA 3FR7A 3PSHA 5AHKA 4KR3A 1UXJA 1GA4A 3MS4A 2OK7A 4R9NA 3GLSA 3F9IA 4ND7A 1ZJZA 1J8YF 1HQYE 2DUMA 2R8PA 2XUJA 4CM9A 3G1UA 2EGUA 3LGSA 1YZLA 5D3QA 4YIKA 3VHXA 4KOEC 2QN7A 1ESZA 2CE7A 3TTVA 4MMXB 1HDZA 2A9KA 4ZOEA 3SSNA 4MR8B 4N0MA 1VMDA 2J48A 2YICA 3DAPA 4S1NA 1SEVA 2B8JA 3L7AA 4O25A 5JXHA 3V1UA 2R8BA 3EQ9A 3Q0IA 2OGTA 4N4AA 5DBIA 4ZT7A 3ABZA 1LEHA 4RMNA 1DG9A 2J46A 2VBCA 4Z9BA 5TPZA 4YA6A 4OJMX 2ZU6A 1TJYA 2I3DA 3MOGA 4K40A 3ZW7A 1KTIA 3UWDA 4BV8A 4KU4A 4MX8A 4JXXA 1QDLB 2AOTA 1CUDA 3L79A 4OYHA 2P2ZA 3VGPA 3ZWAA 2O14A 5KYNA 3IVRA 1AF4A 1FRFS 2GSDA 2I1LA 2QVZX 2DY1A 3VJLA 2DERA 4GLJA 3NDRA 4ES6A 5IJ9B 4TWBA 3AG6A 4LYDA 1E18A 1Q3HA 2JJQA 4X1KB 4D0GA 3NJ4A 3R5SA 2WMNB 2ZCUA 5C1BA 2GCOA 1WD5A 3U1TA 1UBSB 4Y2UA 2G8NA 5DBEX 2I1WA 4HQLA 4RD4A 3SQLA 4COOA 4EA7A 4LF7B 1Z7WA 1YQTA 2F64A 1E8DA 2LTAA 2PL9A 5HK8A 3JVEA 3TLZA 1P9NA 5IASA 5CD1A 1F9EA 5AVQA 3FLMA 4Q7LA 2DB3A 4ZN6A 3OZBA 4UPEA 2EP5A 1TMOA 1ACLA 4LOKA 1G7CA 2AC2A 4XYGA 4AWXA 4BMVA 3QY0A 1EGMB 1VE1A 3TW6A 2J9FA 3ST7A 3JYQA 3GRPA 1XT6A 2C5FA 3QPBA 2IOFA 1OH7A 3UMYA 3N8HA 2RCNA 4M9SA 1YGYA 3UW1A 5AVXA 3ICEA 2M6KA 1EX9A 3D6HA 4YJHB 3MBOA 1E0JA 1E2GA 3F97A 4RD1A 1BX3A 2COKA 4MULA 3A9CA 5E0KB 4Y2RA 2HK8A 1OFTA 3IUBA 3U3JA 2XKKA 3FJYA 3U81A 1OXSC 2HMUA 2EHJA 2ZVQX 4PANA 1G4UR 3HO6A 4YY3B 1EJ0A 4NX2A 4NE7A 3AKZA 1ZG3A 5JJLA 4HWRA 1OHHD 3EEOA 2NTYC 3BK7A 1W52X 3L0YA 2GPJA 3W05A 4A16A 3Q6IA 4DLTA 4XOIA 5TS2A 1JBQA 4PN7A 2PBLA 3LDGA 3L7CA 1YFJA 3AJEA 3RF6A 2FUG1 3EA0A 4NU5A 4CIDA 1UP4A 2GTHA 3DBRA 3PUXA 1VFPA 2PX6A 1XBTA 2J8ZA 1XDDA 3BMCA 3GLHB 1WPGA 3JTMA 4X7RA 4A92A 4NAVA 1WW2A 2A4MA 3L7OA 4LWZA 2VKQA 3LRPA 1OAAA 5A06A 1RAAA 4GZMA 4XM1A 5LU9A 3U44B 1PR2A 3OIYA 7YASA 2AN9A 1BCSB 2O05A 3LVBA 1W36B 4RVHA 1F5NA 1OXVA 3AUJB 1V37A 3D4PA 3EBPA 3MBKA 2IHVA 4JVLA 4P3OA 3SBEA 3T52A 2FEPA 1EA7A 4R9RA 3QMWA 1QTRA 2JATA 2X4DA 2UYHA 1AGRA 1PEDA 1U4OA 4MKIA 4ISBA 3Q5DA 2IFTA 2B4QA 3HMQA 4XJXA 4LC9A 2PSSA 1U6IA 3ZK7A 4CKWB 1SBTA 3BFVA 5EP3A 4K26A 4DVJA 1JH9A 2BTEA 2W58A 3SG0A 3UMRA 2KMLA 1TM4E 3ZDDA 2HL6A 4MPJA 3HA5A 1QQTA 3C3YA 4GI2A 1A04A 4LZJA 4UKDA 2VDQB 4U7WA 1NY6A 3EIHA 3OIGA 2A7QA 3CSSA 2HQRA 1XDSA 1QC5B 2W2LA 1PK7A 3OZRA 2X0DA 4DANA 4E46A 2VRNA 1NDQA 3H87A 1PV4A 3ABRB 5IP5A 2R86A 1E9SA 3O0DA 1XN4A 4KQCA 5EJ9A 2EJVA 2AN1A 3CKKA 3ENQA 2AJLI 1IIRA 3I01M 2HWYA 4M6WB 4AB1A 2E7ZA 3IT0A 4R01A 3RF7A 2WFAA 1YDGA 2J6BA 3HACA 2XUOA 3X1MA 1F2DA 1IG3A 2NYUA 3K70B 5EIWA 1PR0A 3KOXA 4WLOA 3EA5A 1X7WA 2CLSA 1TLFA 1T3LA 2YHIB 1UJ2A 1HYHA 3O7MA 5LP6F 1G60A 5JQWA 2NZUG 5ENVA 3DMYA 4EECA 3EASA 1U0RA 2X2FA 2J5BA 4DV6B 1XJWA 3LBFA 4I1YA 3SDSA 4XA8A 1S3FA 1VMKA 3IUYA 3MYRA 2AXPA 3GUUA 4QXQA 5HTKA 1XZFA 2Y1KA 4HATA 2JI6A 2HCFA 3Q2IA 4IH1A 4QDKA 4INAA 1GPYA 3B3QA 1MRSA 3UMGA 2H92A 1CJCA 1I13A 3OPMA 2IZ6A 1UEXC 3L1JA 1UKVY 1RHUA 4LNUA 4H1VA 2H4WA 1EHCA 1SIUA 3V2GA 5D5QA 1KEPA 2E87A 1RAGA 1HC7A 2L0XA 3DZJA 3ET5A 2A86A 4UHHA 5L3QA 1A76A 4RADA 3RS7A 2ZIXA 1FE8A 2PK3A 2RAFA 2PX3A 2ODPA 4QEDA 521PA 1RQGA 4IEIA 4AZSA 3UMCA 4AMGA 1ZOPA 4EUHA 4DBVO 3JZMA 1DEOA 5BV1A 1M76A 3RREA 4B33A 3UA4A 2P67A 4E15A 1RHKA 2XLBA 4BV2A 3ILXA 4R8VA 1DG3A 1TIBA 3L3BA 2HKIA 2VA9A 2GNAA 1TM7E 1UAGA 1USIA 4QEZA 3MJ4A 3PG5A 3T7TA 1F7UA 2OYCA 2KW5A 4J0CA 3GA0A 1E9FA 1KYYA 2R6AA 3HEBA 2DRIA 3KSRA 4PHHA 1K66A 2V3WA 3H2ZA 1DVRA 1Z33A 2HQ1A 1S8FA 2P91A 2XGGA 4K3UA 4PG6A 1ULZA 4FW8A 5AJWA 3RCBA 3ZK8A 4TMVA 2R6HA 1EWRA 5FULA 2ZQZA 4KPUB 1M33A 1WEKA 4Q47A 1NVVR 2GZ3A 3PNPA 4D2IA 2VG8A 1O4VA 2O57A 1GGEA 1SH7A 4YUAA 3T9DA 1J33A 3FHJA 4K1XA 4ZC1A 3IUMA 1EFTA 1SXJC 2XYQA 2RHBA 3S5JA 1JIUA 2JAQA 3KELA 3MF4A 3RRMA 2WFLA 4L28A 3U0BA 4W8HA 1ABFA 4OBBA 3ZWCA 2EC5A 3VVBA 3K2BA 4LDPA 1B6TA 4EY4A 1X1DA 1PGPA 2F8LA 2QSUA 2QM8A 3HBNA 3SP1A 2C58A 3FUUA 1OPXA 3WGNA 2ZBUA 5BVHB 1GR0A 4CFSA 2VDPB 1KQPA 1H2AS 3V32A 3SR0A 5M34A 3DO5A 3FD8A 2C83A 4CM5A 4QOIA 3LFUA 3QFTA 1Q15A 3IP7A 3KZVA 4JX8A 1E3QA 5DULA 4E5MA 3FX2A 1ZI9A 5MDHA 2NUBA 4GL2A 4JP2A 4DZZA 2VDWB 3AY7A 1NVXQ 4GI3A 4AX8A 1BIFA 5IPFA 1ZRHA 3VA7A 4W9MC 2LP4Y 3CY6A 4E08A 3WXBA 2WD8A 3I9FA 4G0ZA 3QYPA 4RHEA 5KTNA 3C8HA 3NBMA 1XEWX 1ZONA 3C5EA 1IQPA 4IGKA 1Z0SA 4QQRA 1H66A 2VHXA 3AKDA 5F23A 2WF7A 5AM1A 4ZODA 1H3NA 4KO3S 3BRWD 4A9AA 1BD3A 5BN4A 1SO8A 2JFGA 1HLGA 1Z4MA 4JBXA 1J0AA 2B92A 4O29A 4P3NA 1RJ9B 1UXHA 3BICA 1P4SA 4N5IX 3D31A 3SM3A 1XFDA 3TLAA 4RH1A 5LMCA 3FF4A 5HF5A 2J9XB 3Q0TA 2G3YA 4HH0A 3H1TA 3IPYA 2CHEA 3AU9A 1QTNA 3WMFA 5G4KA 1UKZA 1MUUA 2HA7A 4LFCB 3GJRA 3A05A 3VR0A 1PO7A 3G2IA 3EVAA 3GLHE 4L75A 2JA1A 5ELXA 4WXRA 1RM4A 1YBVA 5LP6C 2FRDA 2XLCA 4PZEA 1S8OA 3FY4A 3RVMA 1U90A 2OLEA 1G8HA 2E9SA 4PLHA 2J67A 5IUJC 4LDAA 2DPYA 3I9V6 1BKSB 1WF3A 2EOAA 1DRKA 5DM1A 2IV3A 3RRZA 4MQLA 3OQBA 1Q44A 2OHOA 1FW8A 1A8IA 3AF6A 1UXIA 3PX2A 4DV1B 4BAGA 3F6CA 1QVVA 3EFOA 2DVMA 3U9TA 1VQ1A 4Q7JB 1TD9A 2QRNA 3SSMA 3MLBA 2J33A 5T4EA 1H5UA 2V59A 3ICWA 4MW0A 1R00A 4KPEC 4UTNA 3U5ZB 4B3FX 4B7ZA 1L5HB 1YZTA 2FSIA 2OXFA 4RCVA 3C45A 1ENOA 5T64A 3QH4A 4BRWA 2VRBA 1L8LA 1UUFA 2HJVA 4X3CA 4JXJA 3MJDA 4ITUA 4PLZA 3WLQA 1UADA 1UXOA 5JCOC 4D4KA 4DJFC 1Z9BA 4Q9KA 2LW7A 5B4VA 1TOAA 2QQGA 4KQHA 2R2GA 3C1OA 3CG4A 3M3HA 2Z56A 3Q87B 3WL3A 3TL6A 2B36A 3IHTA 1EUZA 2XQGA 3ICPA 2IXDA 2LKCA 3MG9A 3JASA 3C16C 4KB5A 5CCEA 5HUJA 1I3NA 1GCIA 1GFIA 5K09A 3RHZA 4CTOA 3MCWA 3U31A 5ADUS 1PW5A 1HTBA 4MQ5A 4R1MA 2NP6A 1SIOA 1U0GA 4IDFA 5FFMA 5FPSA 4ENVA 1EFHA 1Y6GA 1VGQA 1WD7A 1X86B 3NV9A 2CLMB 1Z3CA 3RUDA 5HZKA 2DBVO 3BXPA 1T9CA 2IY8A 1C1HA 4KCGA 4OGKA 5IYZF 4GRDA 3WGGA 3PD1A 1JNXX 5KUTA 1LJLA 3AQ4A 4JCOA 3QZUA 5AKKA 2NG1A 3N1UA 3NTUA 3PFHA 4HT3B 4QTYA 1BH6A 5KTOA 3NVDA 4RY0A 3L7IA 2XVMA 4QU9A 3WBKA 3WRVA 1ADBA 4DQ0A 4ESEA 4TLBA 4B6SA 3R3SA 4A0SA 5E95A 4Q9HA 2CY0A 1GFZA 1Z2EA 1XP5A 1QE0A 3F3SA 3X1DA 2UZ4A 1BU8A 3DTYA 1I7NA 1TA9A 1P81A 4L2IA 4FR0A 3JATA 3PE3A 5B2FA 1JDZA 3WDMA 1HURA 4WZAE 4BC1A 1VSVA 3VHLB 3GEDA 5G1PA 2NU9A 4EBBA 4JLKA 1RXCA 3TIXB 1XDWA 1QOPB 5BNWA 4IS3A 1U2DC 3C8DA 5JWHA 3L1UA 1N8SA 1PYOA 1Z39A 3FTPA 3M4ZA 4G8JA 5CX4A 4KPFC 2H65A 1SPXA 3NTQA 2JI4A 2AV6A 3GWGA 3RR2A 3VH1A 3NEPX 3UJ8A 1UR5A 1AXGA 3E3OA 4E12A 1OC4A 2QTNA 3U3XA 4QXMA 2OC9A 2FPKA 4GPEA 5DF1A 4QQFA 4AJHA 4EPWA 2WJIA 3FGPA 3TL3A 3TLYA 4RWZA 2FR8C 4ZDKA 2B21A 5MN6A 2R8ZA 1F2TB 3EZFA 1J2RA 1VRCA 5B1EA 4A5OA 3LVQE 5TSDA 2X58A 5DN6A 1SC4A 3IOCA 3KO8A 4NU8X 4W5TA 3ADDA 4I5DA 1CWUA 1GRVA 1QU3A 3PPWA 1YZKA 3RROA 4BQEA 2R1UA 3C6KA 4A6EA 5LVAA 5EERA 4PY2A 1GQYA 2PDAA 4ALIA 3MK31 3BXGA 5FUBA 1ZJYA 2QLLA 3AV3A 2AG5A 3MWJA 2QQFA 4MWZA 5IAOA 3ZU2A 4CF7A 2QY6A 1D2MA 3QLVA 2NXCA 2FSUA 2JBHA 3Q2OA 4G26A 4HLDA 5EA2A 3FLAA 1VIDA 2HPZA 3WYDA 1KO8A 2ZQ5A 4JYCA 4RGQA 3PC8A 1F4VA 3UGQA 2QUHA 1N1EA 2OHHA 1ZC4A 4QA9A 3WQSB 1FXWF 1GPBA 3L6BA 1KYIA 5K6AA 1CR2A 1L9XA 3W5IA 4ACAA 2JD1A 2XZOA 4LFAB 4R6XA 3FNQA 1VZ2A 4D41A 5B4TA 4MDFA 2HJGA 1CG6A 3JWHA 4QVGA 4UXIA 1U94A 1T9HA 3SS7X 2ZJOA 3I2GA 5LOVF 4X7BA 4Z5XA 2AI2A 1TB4A 3ND6A 4DPMA 2YHAA 4LAFA 5CDUA 4DYVA 3W4IA 2Y68A 2QIPA 3TJRA 4DDWA 2JD2A 3EDCA 2F62A 1WUJS 1B3RA 1BGWA 2W4QA 1ZIPA 3PR2B 3F8SA 4M8SA 4KR9A 5EP1A 2B3TA 4ZCMA 3H9QA 4UCQA 4DY6A 2XAUA 5B1YA 1QLWA 4YASA 3AUTA 1ISHA 4K9DA 2D59A 4RD3A 1XEFA 1Z36A 2J4CA 1HETA 2BBSA 3KOWA 4GYJA 3WV4A 4QPNA 4B3SB 3EK2A 3DOFA 2GAOA 5NLLA 4NBVA 2BM1A 2PHZA 3DVLA 4RZSA 1KZ1A 5EWLB 1K4KA 1KAEA 1KZ4A 4ZT6A 3QPVA 1JEAA 4KKVA 3RV4A 4WLEA 3A7EA 3UJNA 4DCUA 5CFLA 1GCGA 4DMRA 1P1BA 5IAAA 3KLBA 2Z6QA 4B7XA 4P0PB 1ZK4A 2I2WA 2QENA 3ESDA 1D4OA 4NRDA 5DBGA 4NOLA 4O2BA 3WOHA 4PXAA 2NU9B 4EX6A 4J0IA 5KWEA 3HJAA 2FEOA 3P0FA 3ZE7A 3KFXA 3T1HB 1U7XA 1LSJA 2JEYA 1EUQA 4KNYA 2GM9A 2CZCA 3I1FA 4WNCA 1VYUA 2GGSA 5ELMA 2KJQA 4YO8A 3R6GA 1J7JA 4WACA 2PKQO 3U3OA 2BP7A 5EXPA 2VUTA 2GA9A 4U3JB 3AETA 4Q18A 3I2HA 2Z9BA 3L0PA 2HF7A 3WV5A 4D4HA 4QVIA 1QUEA 5CCBA 2EL9A 4YRSA 4MARA 5JJCA 1TRKA 2ZITA 4C3UA 3TOSA 1QJCA 4CCYA 2NV2B 2ZRQA 2ZVPX 3ML1A 4QICA 3HUFA 3J7AC 3CWZA 4DNOA 3I73A 3DCNA 3PGKA 4NG4A 2JVIA 4TKVB 3UV6A 4G4GA 2Q41A 3IJRA 1FLVA 5GONB 2BPOA 4B8WA 2JNWA 1XV5A 1NNEA 1YJ8A 1IK4A 3DBIA 4JJGA 1K7FB 1HE3A 1FYEA 1VJRA 3B6KA 3TLCA 5H3CA 4MLDA 4G25A 5C8YA 3H9CA 4TMXA 3VSCA 1OZ0A 1RVV1 4KWCA 1I36A 1LJ8A 2H2WA 3DBHB 8ADHA 1C7FA 3LKVA 1XVAA 4I1OA 2AC7A 3KDAA 4HXFB 4M87A 2XCTB 3E15A 3ONEA 1J42A 3I9OA 3KRTA 2NO7A 3A6GA 3LU1A 4TV9F 3V8RA 1Y8RA 4DYDA 5AVUA 3VTKA 2X8AA 1NLYA 1ORHA 4G4SP 1MQSA 1Z12A 4ZRDA 1OJ7A 2Y76A 4IHQA 1XTZA 4QUDA 4ZIRB 4XJSA 4Q1DA 3FHCB 2JFWA 2CXUA 4JI8B 4CUJA 2UVPB 2Q0SA 3EW7A 5BY2A 1ULAA 3GCXA 1EDZA 4UD2A 5I9LA 1COZA 1CIPA 3ZTWA 4TT3D 1QGAA 1VBNA 4ZU6X 5EHGA 3UH1A 3UV7A 3VTFA 3Q3GE 4O2RA 4Q4JB 2WIFA 2PMWB 2HEGA 2XJ4A 5BW5A 3HWX1 2A30A 4BFTA 1KERA 3DVAB 3MLEA 5LBUA 5CA0B 3GU3A 2QTVB 2X2OA 3RBXA 5FTWA 1NNLA 1RU3A 5GAJA 1WZEA 2QWXA 2WWGA 1KKUA 3AY0A 2Q1SA 4EAAA 5IF9A 4CMIA 1IUKA 4XX1A 3L8FA 1NIJA 2DFLA 1A5SB 3L8ZA 2J7KA 4FDVA 4JI3B 3SC2B 2JFUA 2HA5A 4HLUA 3S1LA 1C0LA 2P9HA 1LZLA 1II8B 1I33A 3BJIC 5DI9A 1G7RA 3UV3A 1GEGA 5TT1A 1EZZA 2W6JD 2GZDA 4E5UA 4ND8B 3U7RA 5B1HA 1IATA 5I4CA 2HBRA 1Z62A 5KC9A 2YYZA 1E4EA 4ZCTA 3ZVLA 3L7BA 3CURA 4OYYA 3U6BA 4MQFB 1VBKA 3VRHA 1CQXA 3DYIA 5CT4A 2FPPA 2XRYA 3CJQA 4A8JA 5IT5A 5IBCA 5JY1A 3LUCA 2Q3BA 1FUYB 1JZTA 1KH3A 1KI3A 2B0CA 3EXAA 2Q1YA 1NVMB 5ULLA 3OKAA 1SBCA 5IKMA 1BS1A 1BMTA 1GL7A 2B9VA 2SKDA 4GDMA 1Y33E 4A2CA 4BLOA 3GDOA 4DC0A 3BKXA 5A9TA 4BXOB 2I91A 4I81A 2YV3A 5BR4A 1N2CA 4J7XA 4KXYA 3AR3A 3NHYA 3HDHA 1XVUA 2PXCA 2QZ4A 5HXAA 3IP8A 5LP1A 2AXNA 4TV8B 1KWKA 5AOCA 4FPXA 2D2XA 3O1LA 5CIQA 1M67A 3AEZA 4W5NA 2RBKA 4WGFA 1BOOA 3KPUA 3T0IA 4QWMA 2Y1DA 3FZYA 2PX4A 1U0TA 1YKFA 5ITSA 1DOHA 1RZUA 4DJAA 2J7PD 4OAPA 3DOHA 4PC1A 1JX6A 4ROTA 5I9BA 3N58A 4UC0A 2G9NA 3ICQB 3IVCA 4Z6KA 5M2QA 2PUFA 4JEIA 1DKOA 3WYEA 5EMMA 1O3YA 2R6CA 2IUYA 4FYYA 1EQUA 4MEAA 4U2GA 5GGYA 1JSZA 1EZ1A 4OFBA 2EZ8A 1IN6A 4J0JA 4I1PA 4K6GA 4L22A 4RK0A 5I7OA 1CULC 4I4CA 5EZ6B 3CIOA 5KOHB 1Y4AE 3HCEA 3MUEA 2AHOA 2IUFA 4N3BA 2JGDA 1FFCA 1K0FA 1TGYA 4Y6RA 3Q11A 3PL1A 2HA3A 3B5JA 4OU5A 5F1OA 4YCNA 5DGCA 1LVGA 1EU1A 1FVOA 1PD0A 2ERCA 2AMVA 3OX2A 4JBNA 3ONFA 4Z3DA 1H8HA 1KP9A 3EC7A 2X1MA 5FBRB 5K6TA 1V1MA 3PEEA 1Z2AA 1I24A 3SEFA 3LYLA 2GHIA 3DL0A 3WHIA 3MJCA 2DETA 1QAQA 3OJOA 3DDCA 4QM6A 2VNSA 1ZD8A 3HY6A 4ETWA 2GKOA 2QKYA 3GLUA 1MA3A 1GDHA 3WICA 2HRZA 3QVOA 3U4QB 3U56A 5CLLA 2AUMA 4XM2A 2X40A 3KIPA 3FMPB 2WG0A 4JEHA 4Q7MB 1P4RA 4OQLA 3UG6A 1Y1TA 1IZYA 5CDYA 1F3LA 3ZU6A 2C8KA 1KVSA 1MC1A 1XZPA 2IT1A 4HVTA 3HV0A 1AOXA 3FRHA 2ZG6A 1V95A 1EK6A 2HCBA 2WF5A 4BMDA 3B3AA 1YNSA 1H2FA 2F7SA 2C5AA 3UKJA 2JGJA 1J25A 5ECDA 1U4SA 3GGCA 5TQ0B 2B61A 3P4UA 4J7AA 4Q16A 4CQLB 1U5AA 3A4TA 4BB9A 4IG9A 1KZ6A 4QLOA 5L9AA 3D1JA 2VQDA 3DC7A 1PQ4A 3PQ7A 2HSDA 2W2KB 1ZITA 4FJ0A 4LWQA 2QROA 1OH6A 3C14C 4LCJA 4QHYA 3ZN2A 3D6UA 2BGWA 3AVTA 3VU9A 2AMFA 1J8DA 4KQXA 5IN4A 2CEAA 2BUCA 1WMEA 2V9PA 4G0UA 1AKUA 3AUAA 5E7JA 4CR7A 5T8KA 5INTA 4QE3A 3D9QX 1L7PA 1ZA1A 3OJWA 4NCHA 2DLCX 3DNMA 2V7QD 3DOIA 1TK3A 3MGGA 4AY3A 1CZRA 1NVBA 4B34A 5SICE 2O8CA 4JBLA 2BFWA 2CN1A 3ZE9A 3STVA 1EFVA 3WIUA 1FJGB 5J59A 3UFXA 2TS1A 5DGXA 1MZPA 1PD1A 1TT5B 3RSGA 1YIDA 3K9LA 3TZLA 3U4MA 2A59A 3DP7A 2GZ2A 2HJWA 4FNGA 1CXZA 1EXMA 4LGYA 4WZBA 3GEIA 1R6UA 2DYKA 1ILEA 2XDQB 4WH0A 3P2JA 4HN2A 2C9MA 1H6CA 1UKCA 1SY7A 1N2XA 4YB8A 4LRQA 5EJGA 2QSJA 3WP1B 5E38A 2VP5A 3O3CA 4AJOA 1BDIA 1YI8A 3MTDA 4N8SA 3W3ZB 2HNBA 4LJ8A 2WSYB 4LV6A 2HY7A 2IP4A 3JQGA 1HNNA 5EUMA 4EQ6B 4ECEA 5KSZA 3H3FA 4YECA 3R0XA 1WZ2A 4WXMA 5JNRA 4XIJA 2CCJA 1UQRA 3GGSA 3Q7IA 1W4RA 3RBAA 1QMGA 4OXKA 1ZVQA 1JLMA 5AUPB 3FOCA 3LBNA 4MDYA 1RKUA 4DUZB 3B1ZA 2YXBA 3DL7A 4C04A 1R3DA 2IXEA 3U6KA 5EMJA 5IU6A 1VMEA 3TNLA 4OU4A 2ZIVB 1K5PA 4CKBA 5ENDA 4ZD6A 4EY5A 4UTVA 4G97A 4Y8VA 5JMOA 1TGVA 4HTAA 2HJRA 5FUWA 3QTBA 1B73A 1GGJA 1QORA 3KBBA 5JH7F 1TO6A 2TSYB 2EX0A 3RYFA 2EWWA 2GZAA 1DEXA 3EZ9A 2JK1A 3IUPA 3N6VA 4XLTA 3U39A 3VYUB 2VLIA 3C15C 1KHHA 4Q3KA 1R9JA 1JKMA 4C0AC 1KSJA 4BEVA 1G6KA 1IJFA 4CM9D 3T9AA 1A4XA 3V7FA 1WCIB 4EIWA 1UWVA 1PTKA 1K98A 1VL5A 1E5VA 1P19A 2QDKA 3DW3X 3N8DA 4DLUA 3Q3IA 4FUTA 1AKQA 4YV7A 4F92B 3W5VA 2O23A 1MAAA 1BXGB 1BSVA 1MW9X 2RI0A 3AJ9A 3OIFA 4LSMA 5FLYA 2NP7A 4PPNA 4S05A 2O7RA 4QUJA 1NN0A 1P2BA 2QVBA 4DA7A 1O77A 1J4AA 1PNVA 3ISVA 4O2BF 7ABPA 3KLMX 3I6QA 3PDUA 4I8XA 3QX3A 3OQIB 4MVWA 3ZG6A 4I9GA 4HGPA 3L84A 3ROXA 2GETA 3UQZA 1KMQA 2QK4A 1G98A 2V7TA 2YWHA 3ES9A 4Q7EA 4KXMA 4RY8A 4TPKA 5FHQA 4OA5A 4JFAA 5J2UF 5HKKD 3MCVA 3NR2A 2BJHA 3BCSA 3D54D 4L95C 1YA8A 4DIOA 4JCCA 3BEDA 1YS9A 3TIVA 4QPJC 3OMLA 3W6ZA 1KQNA 3C74A 1U81A 3IAM1 4D57A 3MB5A 1IONA 1QX4A 4NU0A 2FZCA 1D6JA 3HY3A 3EQ6A 1MJNA 4IIGA 5FF9A 4KQ9A 4I1IA 1I1NA 3E4DA 2MIIA 3GFSA 1CIVA 4GSLA 4DAEA 1J2TA 3AF2A 3T0FA 1GG8A 3HYRA 1IVNA 4IEFB 3DEAA 3PL5A 5BSVA 5CJ2A 1LBIA 1PJ3A 2HSGA 5CDGA 3PR1A 5EUBA 1M73E 4TXMA 1I7SB 5JEEA 5J63A 3CFYA 3H5AA 4YBRA 2I7TA 2JLQA 3OI7A 3UB3A 4KR0A 2A35A 2XEDA 4LJ9A 1QPGA 1ZUIA 2J6HA 2WAMA 5E1OA 3VJRA 1JQ5A 2QRZA 5CEFA 1KC3A 4TSFD 1RJEA 3RS9A 1FQOA 4LYAA 4RHUA 1NC3A 2OQRA 4GWGA 1KOFA 2D0PB 3EA4A 4HGRA 5CYGA 4BNHA 3RYHB 4Q4JA 1OFHA 4E4TA 1NNUA 2FQXA 1M10A 2AZDA 4JEUA 2JCGA 4K0RA 1HDIA 2VP0A 4BFWA 2RD2A 5JIBA 1YFLA 1FLNA 3UOWA 3B70A 1T0HB 3MAJA 3TE7A 1WUTA 2FX3A 2W11A 3O1IC 3O93A 4LGVA 4MV9A 1X1RA 2G77B 3A11A 1NN5A 1V7ZA 3IQHX 4K05A 1E4YA 5EQDA 5IVIA 5G4KB 1ODKA 1XCJA 3HPRA 3TNYA 3PYLA 1ISFA 1K88A 2G17A 3CF2A 2GAAA 1DPGA 4FNAA 4ZO7A 4QYMA 1JQAA 1XRQA 3VOAA 3NUGA 4R1PA 4ZOBA 4Y6PA 5L95A 4D02A 1ACJA 5G02A 1TAHA 4OGGA 2UZ3A 3C39A 4G24A 4CE6A 3PC7A 3LWZA 2OD2A 3NMUF 4LTNA 5B3JA 1DT5A 1GAWA 1SC6A 3AIMA 3Q40A 4HDNB 4HTFA 3PKZA 4RZIA 1IRXA 5EWJB 3LUBA 4DLRA 4P5EA 3T5CA 5FOQA 1R4NB 3E2MA 4GNKA 3ITEA 1Z13A 7REQB 1Y5MA 5I7FA 2C7RA 4MTCA 4ENQA 2ZQYA 1OI3A 3S55A 2ZI6A 4KQMA 1AMOA 4Y2VA 3HJRA 3B9PA 4ARZA 2W00A 5DHFA 5T5QA 5FX2A 2RGNC 2O3SA 2IPAB 1U1GA 4RGYA 1TEVA 1SZCA 2FWMX 3CE9A 3C6BA 3IH5A 4K28A 4RIIA 3FPLA 2VBGA 1BWPA 3IMGA 4PLVA 3MFQA 5D3MB 4GGMX 3VV3A 1B6GA 1LV7A 2C2BA 2Y1LA 3ZI0A 3GLIE 3OQIA 4P53A 1SOWA 1O96A 5CLQA 5A0FA 3GNQA 5FTMA 1PWZA 2QAJA 3I30X 4WV3A 3GNLA 1NOJA 2WIKA 1YA6A 1Z4JA 2R6DA 4XIIA 4MIEA 4N01A 4OHWA 3STTA 5HGJA 3ZDYB 3KSZO 4QATA 1BYIA 1QQAA 1UP6A 4O2AF 3VMFA 3ZGNA 3SNHA 2AQHA 4RORA 3OZEA 3DM9B 2QD4A 1VXOA 5AK4A 4LYHA 2E49A 2E1RA 1DXQA 1IFXA 1LF0A 2JIRA 1CR1A 2C2MA 2F1HA 3NHSA 1MGPA 1O7JA 2FPIA 4NAUA 3CZPA 1PSDA 4L8VA 3G2PA 4FOPA 2JH8A 3B82A 4ITVA 1TMYA 2XB4A 2BGKA 3PCRB 5DSTA 2EBWA 3MGBA 1KO4A 1UMBA 4UEQA 1XLTC 4ZV7A 2XUGA 4OQDA 4QPDA 4HJXA 4CQJA 1LDEA 1MRNA 3C3MA 3MJVA 2I4LA 3KAKA 2VPXA 1HSOA 3M5WA 3GMTA 2VZEA 2WYWA 3IV6A 1L7OA 2CFIA 2UAGA 1NVUQ 3H65A 2AMYA 4TLAA 5LQNA 2VHUA 1DBWA 1GZVA 4G84A 3O2JA 3I5AA 4X3OA 1PJAA 3PWTA 1M5RA 4FIZA 3NAMA 4KWTA 4KIJA 2NU6B 1A9SA 2Q0HA 4L5JA 4FFDA 1Q19A 1K0UA 2GLXA 4LPKA 2H1LA 3OTWA 4CL3A 1FTYA 1LVUA 1Y4ZA 2V58A 4CQMD 2FN3A 3T7RA 1SD2A 3KHKA 1ULBA 5DVZA 5A3QA 1ORRA 1NM5C 4DHEA 4UU8A 2XZLA 2ZT5A 4QSMA 2OHIA 2W71A 1WKBA 3GJXC 4YPFA 3RRYA 5SY4A 1SHJA 3OLYA 1CB7A 3WAGA 4EEZA 4ZU3A 3LPNA 1JSRA 1Q3TA 2GN1A 3TKLA 2VDRB 1YVDA 4BZXA 3WAJA 5FFNA 5AW4A 1G20B 5GIPE 4ZJPA 3DS8A 5PGMA 1ZM3A 5C4GB 4PG8A 1FP7A 1R18A 3TEMA 3A9RA 4X8LA 2YWJA 3OZFA 1H2YA 1PW7A 2OGZA 2FH5B 3LIIA 2H1WA 4XWAA 4C0XA 4BS9A 1SKUA 4EKEA 2Q5LA 1S89A 2FWBA 4II2A 3GLFE 2O8CB 4W7SA 1L7EA 3MWLA 4GL4A 4HGOA 3WHKA 3S8YA 1SQ6A 3DLCA 4V0RA 4QT0A 4Z7NB 1OASA 1NLMA 3ANLA 3I76A 3OLZA 1UK9A 1Z2CA 1NSTA 2QORA 4LCBA 2JJ1A 4C0HA 1XJ0A 1VJTA 3N2GA 3UVEA 2W5UA 5AKXA 5L40A 1ZICA 3DONA 4RVSA 2HQOA 4CM7A 1R3UA 1K6JA 4CEJA 2D3TA 1ONOA 3HGTA 1F17A 2C57A 1UFRA 2GS9A 3R7FA 4D3SA 5ERYA 3QXJA 1M34B 4UUOA 1NMSA 3JATB 5K5EA 5C5CA 2DXIA 3FZEA 3CA8A 4MQ4A 2ODNA 2TMKA 4L0MA 4DLVA 1H94A 4ZK6A 2F3RA 4ZVKA 3ROKA 1Q77A 2CNWA 2D2EA 1JEQB 1SU4A 1FY2A 3EZ6A 3HU5A 4LY6A 1B0AA 5EEGA 2EW2A 2DM6A 5F76A 3QIAA 2PO5A 4Y7DA 1G63A 4HAIA 3AH8A 2AD5A 2NPIA 1F0NA 1TU4A 2FDRA 4EJSC 4CLRA 2HMTA 2MSEB 2Q46A 4Q4HB 3R76A 5KNBA 1JRLA 1ANKA 1Z25A 1IWPB 1L3CA 1K9SA 4ZEXA 3RM3A 3DPUA 3IBTA 3AEYA 3T3HA 3USES 5JUWA 1G20A 1X0VA 2P9JA 4WKBA 3ETNA 2JCSA 2XRFA 4MVJA 2XCOA 3DHEA 4JI6B 2PLNA 2XR1A 2O5CA 1BE6A 3HRIA 4OEHA 2O59A 2CE2X 4BLQA 3R3YA 4KIGA 1EXWA 1V5FA 4K1LA 2PVCA 4Z4CA 3RG8A 5KOHA 2CJPA 3S2IA 3ZHYA 5CB4B 1OKKA 2GCGA 4W82A 2RK6A 2XE4A 1GR1A 4XDGA 3TS1A 2FPRA 1V39A 2Q6IA 2QZJA 3EGWA 4RM3A 1KI9A 2C98A 3R23A 4EYOA 4RKWA 4UJ5A 2IV7A 5FAKA 3G1TA 5IZCA 1MX9A 2WB4A 4HYQA 2NVBA 1U9JA 2LRHA 3G9QA 1MEEA 1KH1A 4LZPA 3VVLA 1C9JA 2F6RA 3Q3JB 2B82A 4FEGA 4GP7A 4RACA 2HO4A 1BKYA 1DAPA 3N87A 3ZBQA 1RPTA 1NZJA 2GEKA 3GZTB 4IM7A 1RRPA 1AKYA 1TJPB 3F96A 5DASA 5DSZA 4CLHA 2Z2XA 3P9RA 4DMKA 1E2MA 1P8AA 4QC2A 5H02A 1VDMA 4L85A 3ERCA 2I9PA 2NQ2C 2CUZA 1U2ZA 3GRZA 3PXGA 1Y9EA 1CZNA 2HA4A 1UMBB 3HJTA 2C4HA 2H16A 4H4CA 5BNIA 1Q11A 5HW0A 4HX9A 1W73A 1CJSA 2V8OA 1GU0A 1Z82A 3O7WA 3V8MA 1VE6A 3EEIA 3PGMA 2MYUA 3ZWXA 1UXKA 1AV7A 2QXUA 4KBYA 3FI0A 3G7UA 4R0VA 5ALDA 3RVKA 4EF5A 1P75A 1YL7A 3EAQA 1XMIA 1MJHA 3E9RA 5GOTA 3TD9A 3ELDA 3H5RA 4ESOA 1C2YA 1M8FA 3K09C 4Q1AA 1UT5A 2B2XA 3A1TA 3G7NA 3NCHA 1X8KA 1XG5A