2ONZA

Structure of k57a hpnmt with inhibitor 7-(n-4-chlorophenylaminosulfonyl)-thiq and adohcy
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWALRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Enzyme Adaptation to Inhibitor Binding: A Cryptic Binding Site in Phenylethanolamine N-Methyltransferase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2onzA00
1B42A 4PONA 1EG2A 1YZ3A 3F4KA 3NWBA 5HOQA 2ZZMA 2DPMA 2ZIGA 1G8AA 4GUAA 3P9KA 4X1OA 3BT7A 1XJ5A 2CKDA 1O9HA 3EGEA 4M36A 4DF3A 5IKMA 4PINA 3LKDA 3LDFA 3M33A 3I53A 2OKCA 2QM3A 5E9JA 3JWGA 4KW7A 1RI4A 3FTEA 1FP1D 3A7DA 2I6GA 5GOZA 3A25A 3DULA 1WG8A 4RVDA 5CVJA 3SSMA 2PX2A 2E5WA 2QYOA 3EVZA 3I64A 3R24A 5GP1A 5EG5A 3B89A 4GBED 3MTIA 3EVFA 2XYQA 5FHQA 2NP7A 3M6XA 4EQZA 5EHIA 4GEKA 1XDUA 5DM2A 3HCCA 3GDHA 2GB4A 3O4FA 4V0RA 2ZIEA 4AZSA 2Y1WA 5LQAA 1XTPA 3B3JA 1NW5A 2F8LA 3C6KA 3REOA 2WA2A 1EIZA 1VQ1A 4CXMA 1YZHA 3SR4A 3EVAA 5DRYA 3EEOA 3FPGA 4P7GA 3P71T 4C06A 4Y30A 5E8JA 4F86A 1P1BA 3G8BA 4PCAA 4RYLA 1N7IA 3BUSA 3R0QA 3IHTA 4P7FA 5EZQA 5DM4A 1OR8A 2AOVA 1JG1A 4BLUA 5LSAA 2H11A 2UZ4A 1ZQ9A 4POOA 4QPNA 1DCTA 5EMJA 3GXOA 2GPYA 5HIKA 5CIYA 1V39A 4RTRA 5EIWA 1I1NA 3FPJA 3K6RA 3VC1A 1AQJA 2JJQA 3GNLA 4FP9A 2AN4A 4JXJA 2NXEA 1U2ZA 4QQNA 1VPTA 2I62A 4IV0A 4QVGA 5K0EA 3R9XB 3MB5A 3UJ6A 3V97A 3CKKA 5DX8A 3LKZA 3P9CA 5FHRA 3TM5A 5DXAA 3T0IA 3TMAA 2Y1XA 3PFHA 2G1PA 5K09A 3KPUA 2XVAA 2ZZKA 2EJTA 3BZBA 3G5LA 2G70A 3GRZA 4GQBA 4QDKA 3DXXA 5DXJA 2UYCA 2ZCJA 4KIFA 3FUWA 1AF7A 1VIDA 4BY9E 4U7TB 3UJAA 3QOXA 3I9FA 3JWHA 4R8RA 3FTFA 4HTFB 3GRUA 10MHA 3PT9A 5GWXA 4EKIA 3ER9A 4C07A 2PV0A 3ID6C 3NW9A 3KR1A 4HC4A 2JH8A 2PBFA 5ICGA 3OE5A 2HV9A 5B1SA 3CJRA 3VYWA 5K05A 2FK8A 1Z3CA 1X1DA 2WA1A 3EVEA 3HCBA 3KQVA 3K0BA 4HGZA 4PYLA 4MQ4A 5FCDA 4ISCA 3UWPA 3O7WA 4HGYA 3KPJA 4KDRA 2NNWB 3EGIA 1M6EX 4PCLA 1JQ3A 3DMFA 4HG2A 3RIEA 1JG4A 4YUWA 3UJ7A 1YUBA 3PLAE 4F84A 3OZSA 3GIWA 4B17A 3PVCA 4YV2A 2C7RA 5DWQA 1QYRA 4GF5A 2O0LA 1R8XA 2R3SA 3M4XA 2O06A 5IH3A 3NMUF 3NDJA 5K0CA 3A26A 2PWYA 4AZWA 3LECA 4R8SA 1RI3A 1L1EA 2P3OA 5BW5A 4X41A 1BKYA 2ZVJA 2N47A 3AJDA 3UA3A 2P40A 2NXNA 5EQJB 1VE3A 4PYKA 5DX0A 5G02A 3AXTA 2WK1A 3KR0A 4YUXA 2PX8A 3THSA 4YV0A 5ERGB 1NBHA 5FADA 5KVAA 3B3GA 2ZWAA 1BHJA 5HILA 5LQCA 4RTOA 5P8WA 2IH5A 2ZSUA 1NBIA 4C05A 5KS2A 2OZVA 2QRVB 5ICEA 1WS6A 3E8SA 3HA3A 3BGDA 3EMBA 3EEYA 2P7IA 3SGLA 2H00A 2AVDA 2NYUA 3R3HA 2O05A 4G56A 1ZKDA 2G71A 4M37A 1T43A 5BXYA 3DTNA 3FPEA 4KDCA 4RVHA 3NVMB 5EGSA 1X19A 5KQSA 1RJDA 4RTMA 2BM8A 1KP9A 3TFWA 3C3YA 9MHTA 3TR6A 1KPGA 3ME5A 3LX6A 3BKWA 1AV6A 5CCBA 4DMGA 2KW5A 3FZGA 1X1BA 3KR2A 4ER5A 4GC9A 3EGVA 3TQSA 1I9GA 3IEIA 3P8ZA 5F2OA 4C04A 2BM9A 3HCAA 4OA5A 5K03A 4PWYA 2PY6A 1JQDA 3EVCA 3CJTA 5E1BA 3EMDA 4CTJA 4PGHA 3P2IA 3CCFA 4XUCA 4YUVA 3EPPA 2G8NA 3LBFA 4QVKA 3UFBA 1FJXA 1WZNA 2OYRA 2V74B 2P35A 4HRAA 3OU2A 5EEGA 1F38A 3NJRA 1XXLA 5EMLA 3DMGA 3FUVA 5FWAA 4C4AA 3PTAA 1O9GA 3B3FA 3FYDA 5LR6A 1RJGA 1HMYA 3LDGA 4BP1A 2IH2A 5E9QA 4LG1A 3G2QA 1KYWA 5K0BA 2UYHA 2YX1A 4U7PB 5CD1A 1YFLA 2AZTA 4QTUB 4OX9Y 3SXJA 4RTJA 3FPHA 2PT9A 3RW9A 3LDUA 1YF3A 3FTDA 5EZSA 4OBWA 3TRKA 1RI5A 3KPYA 4R6WA 4RX1A 5K0JA 3VC2A 1L3CA 5FA8A 4DM3A 1KR5A 1RJFA 2AOTB 3A7EA 4PYOA 2AOXA 3IYLW 2ZBPA 3JWJA 2I7CA 2PX5A 2R6ZA 2ZIFA 3G88A 3SSOA 4ER7A 2OBFA 3DOUA 4KRGA 3SMQA 2FK7A 2IP2A 5DPMA 3P9NA 3BKXA 3P2EA 1YFJA 1JG2A 5MHTA 1D2HA 3CVOA 3PS9A 3GGDA 5E1OA 5K0FA 1INLA 4AZTA 4DA4A 3KQPA 3KQWA 2IPXA 3OU6A 4C08A 1NV9A 1EAMA 3MHTA 5DSTA 2P41A 4HSGA 2PXXA 2PLWA 4M38A 4CWAA 2ERCA 4RTPA 2DULA 2IBSA 4E2YA 2P1DA 2EFJA 4RTLA 4CTKA 2HMYB 2ZBQA 1KYZA 2XVMA 3UJ8A 1KIAA 2BZGA 2K4MA 4QQKA 3LCUA 4A6EA 3HA5A 4YMHA 3UBTA 1DL5A 2IBTA 3JWIA 1UFKA 1HNNA 3C0KA 3PB3A 5EKXA 3CBGA 5HFJA 5GINE 2VDWA 2ZBRA 3EVBA 1I4WA 4UOEA 4RSRA 4YV1A 2JHCA 2ZTHA 2VDVE 2PJDA 1ZGJA 2EX4A 5DT2A 4GC5A 4YMGA 2GLUA 3M6VA 2B78A 2C7OA 2IH4A 3B5IA 4X61A 5GIOE 1FBNA 1JTEA 4E31A 1P91A 2C7PA 5F2KA 1IXKA 5DTMA 4EKGA 3OZTA 1TW3A 4LECA 3T7RA 1R00A 4EMSA 1G55A 2HR1A 1R6AA 1N7JA 1NW6A 1PJZA 2ZLBA 3C3PA 1UIRA 3HVJA 3L8DA 4WVLA 3EVGA 3KQOA 5H02A 2BR4A 5DX1A 3TLJA 4E30A 1D2GA 1NW7A 3DMHA 3E23A 4PNEA 2ONYA 2PSSA 2IIPA 5LQUA 2NP6A 5CVEA 4E33A 4P7KA 4YUYA 1RI1A 4O29A 3RODA 3BWYA 4QPPA 3HVIA 1P1CA 2A14A 2QY6A 1D2CA 4RWZA 3T7SA 1SKMA 4GOND 2NXCA 3LL7A 4LWOA 4GOLD 3TKAA 2YXEA 2XBMA 1AQIA 2B3TA 1TW2A 2ADMA 3P2KA 4HTFA 1SG9A 1X1CA 4P7JA 3KQYA 3NWEA 5E9WA 3SX0A 4QDJA 3UZUA 1QAOA 2AR0A 4ER0A 4CKBA 4FT4A 5BW4A 5CVUA 3SM3A 2PWPA 4DZRA 2ZW9A 3EVDA 4PYQA 2NXJA 5FA5A 5GM1A 5LQJA 2B9EA 4M7RA 2AOWA 2JHAA 3AWIA 3FYCA 4DCMA 2GA9A 1NT2A 3FUXA 3BWCA 2HNKA 2ZFUA 5FQOA 3CC8A 2OY0A 1ZGAA 3KU1A 3MTEA 3DP7A 1YB2A 5T67A 2AN3A 3BWMA 4OBXA 1EQAA 1VBFA 4R05A 1NW8A 3MERA 3KQQA 5HIMA 1Y8CA 3DXYA 3KPVA 4Z2YA 3G2PA 1KHHA 2PT6A 1R18A 4GOOD 1JSXA 2ESRA 3O31A 2C7QA 5HZMA 1TPYA 1L3BA 3BGIA 3FUUA 1JG3A 1N2XA 3G2MA 4PYIA 4FSDA 3LCVB 3GRYA 3OFJA 5JUWA 1L9KA 3PX2A 1X1AA 3A27A 4MTLA 3QV2A 5E2BA 4RTSA 5EOVA 3G89A 3GRRA 2PXAA 5ICCA 5DSXA 3D2LA 3WSTA 5KYGA 5FTWA 1H1DA 3KR9A 1JQEA 2XYVA 4KIGA 4QTTB 4RVFA 4P58A 2QRVA 3HVKA 3HCFA 3CJQA 5D1HA 2BR5A 3ELDA 4KWCA 3UA4A 4EVIA 1G8SA 4IKPA 5CVVA 5EEHA 4MWZA 3HNRA 4PGGA 2AOUB 3KPWA 5E2AA 1JSZA 2Q41A 4OQDA 1WXXA 3TPZA 2OB1A 4PIMA 3KQSA 2AVNA 2P3LA 4ER3A 4KVZA 5DRTA 4A6DA 2ORED 1P39A 3B7PA 1QANA 2IDKA 3PX3A 2OXTA 5F2NA 3FRIA 4DKJA 2FHPA 5ICFA 3HVHA 3G5TA 1NE2A 1KPIA 3M70A 5EC8A 3KKZA 1BC5A 2GAFA 5K8VA 8MHTA 3V8VA 2JH9A 5K0NA 5JR3A 2G72A 3LSTA 4OA8A 2EG5A 5GIPE 1VP3A 1SUIA 3BWBA 3FRHA 3HA7A 4LWPA 2YR0A 3UJCA 3KHKA 2FPOA 2OPBA 4BP3A 2YQZA 5EPEA 1FPQA 1WY7A 3OFKA 3P97A 4FSXA 3LBYA 4BLWA 1ZHFA 3ER8A 3G2OA 3AXSA 4OQEA 2QE6A 4PYNA 2AOUA 5HEKA 3GJYA 2OO3A 3DUWA 3KQMA 3MAGA 3UJ9A 1DUSA 3AY0A 3GWZA 5E1DA 1F3LA 3A4TA 3DR5A 3IV6A 3ERCA 5EKUA 4YUZA 3NVKI 1IY9A 2PX4A 3ELWA 4FT2A 1G60A 2JG3A 5DTRA 3OE4A 2B25A 3R6TA 4AX8A 4X60A 3SVZA 1QAQA 1SQGA 2V7EA 5DLYA 3GRVA 5DTQA 2XYRA 3VSEA 5E1MA 2AS0A 2IGTA 2FCAA 2YTZA 3DLIA 2YVLA 2AOTA 2YXLA 4H0NA 4AZVA 2VS1A 2IFTA 4XUDA 5CVDA 2GS9A 3GCZA 3T7TA 3GO4A 4FGZA 4PIPA 4HH4A 2VDUE 3DLCA 2P3QA 3THRA 1EJ0A 4E2WA 5EVJA 1MHTA 3QOWA 3CGGA 2VP3A 1RJEA 3I5UA 4WXHA 1RI2A 2VZ9A 2GH1A 4E2ZA 1XCLA 3E05A 4R6XA 1JR4A 2P7HA 5LQRA 2BR3A 2AN5A 3HEMA 3DXZA 1XVAA 3LHDA 2P8JA 4GOMD 4RTQA 3M6UA 4FZVA 5DM1A 5E8RA 1M6YA 5C9ZA 3ORHA 1WXWA 1VL5A 2ZULA 3ELUA 5BP7A 4RTKA 2Z6UA 3TM4A 4BLVA 5CM2Z 5LQNA 3BXOA 2O57A 4PYJA 2YXDA 5EIFA 3OPNA 4MIKA 4DQ0A 5U4XA 1BOOA 2LD4A 3E7PA 4CKEA 4IV8A 3H2BA 1EJ6A 1SVUA 4XUEA 5D1NA 4CKCA 5KQRA 4K6MA 4XCXA 3Q87B 1ORHA 1QZZA 1R74A 1VP9A 2CMHA 2PVCA 3NDIA 4FR0A 5K01A 4V0QA 1Q0TA 3ANXA 3HP7A 5DM0A 5GM2A 1NW3A 3HCEA 3LCCA 5CCXA 1IM8A 4E32A 2FYTA 3HM2A 5T64A 1R8YA 2OB2A 2ZWVA 4E2XA 4E70A 2ZZNA 5C1IA 2IDJA 2UYOA 1NKVA 3FTCA 2UYQA 1JTFA 2ONZA 5FULA 7MHTA 3UJBA 5HIJA 4DCGA 2O07A 4Y2HA 1NV8A 2JHPA 3HCDA 3P9IA 4PYMA 5FQNA 4C03A 4X63A 4F85A 5LQKA 2HTEA 1PRYA 5EHGA 1MJFA 2FRXA 3MQ2A 3OZRA 4L7VA 3SSNA 1G38A 1ORIA 3DH0A 1VLMA 5HIIA 2CWWA 3MCZA 1FP2A 4ER6A 2PKWA 4EK9A 1XDZA 3S68A 4RVGA 2YUIA 3KQTA 2CL5A 3ELYA 1G6Q1 1KXZA 5K0GA 1KPHA 3OU7A 2PXCA 3MGGA 2HWKA 1XCJA 4RV9A 4ATNA 1M0EA 1ZG3A 1L3IA 2CMGA 3I58A 3OCJA 3TOSA 3TKYA 5C0OE 2Z6AA 2BH2A 3HTXA 3BGVA 4NECA 4IWNA 4RTNA 4ZTBA 1QAMA 5M5BA 3Q7EA 3M6WA 1SQFA 3FPFA 5FWDA 4MHTA 3U81A 2I9KA 2EJUA 5CUQA 5T6BA 3UJDA 5K0LA 2B2CA 3G8AA 4AUKA 2PGXA 1O54A 3LGAA 3C6MA 3PFGA 1UWVA 5EMKA 1Q0SA 1SUSA 3FUTA 3MCTA 4FS8A 3G7UA 5EMMA 5FUBA 2H1RA 1XDSA 3X0DA 3NTVA 3LPMA 2Z6QA 3GU3A
chains in the Genus database with same CATH superfamily
1WHTB 2ZTSA 2B4AA 1JPNA 1ST3A 2B7BA 3V2HA 4C4RA 1EBBA 2EU8A 3AP2A 5CR9A 1GZHB 3ICWA 1VZ3A 4GZ5A 5CYGA 1M73E 3A9TA 3TIVA 4D9KA 2QAJA 1JU9A 2HRCA 3KETA 5DHRA 3I09A 2OKCA 1B0AA 4BX0A 3A7DA 3CM0A 4L07A 4LZNA 3SJBA 2ZYWX 3SBXA 2JLCA 4XCVA 4LZJA 1QVWA 3PV0A 3O5AA 2DHCA 3MTIA 9ATCA 3EVFA 4LKOA 1TA0A 3BYZA 2XYQA 3DDCA 1YTUA 1DAEA 3IE2A 4QLAA 1LS1A 2HGSA 2L69A 3ESDA 3MIIA 4Y7CA 1O5TA 1U0JA 5FTMA 1G2PA 1K5PA 2X1LA 2XE4A 2WFZA 3MLBA 3P9YA 2ACEA 4WADA 3ZHCA 2LKCA 2YOGA 4QBKA 2ZM6B 2WHYA 4CXMA 1F2DA 1CRWG 1YZHA 3ZHBA 1BD4A 3D59A 4L4UA 2JGEA 1EP3B 1LEHA 3L6CA 4RH0A 3T3EA 1C41A 1P1BA 2QF7A 3BUSA 5EZQA 4JI8B 4MQLA 1U65A 2I6QA 5LUAA 3BILA 2JFWA 4ZVMA 2BKEA 1XDGA 4FUTA 3TRIA 2I91A 3RUDA 3TCNA 2VYVD 2QA5A 4RFSA 3T1HB 2QSUA 5IJ9A 1SCIA 3GMDA 1R8JA 1RWVA 2GFQA 4HAWA 3LT5A 1JHDA 5DYNA 3MMXA 3RS0A 3PIRA 4CCWA 3IAUA 3VZCA 1ZH4A 2AN4A 3DZJA 1XU4A 1E2FA 3R74A 4X97A 2PX6A 1D2NA 5A6SB 5K0EA 4MV6A 2Z3VA 4XFDA 3D3WB 5TC4A 3V97A 2C9MA 3CKKA 4N5HX 4EO9A 1AA6A 1I7DA 1Q7RA 4NZMA 4IKOA 1LLCA 1JHQA 2A1TR 4HK4A 3KXKA 3ZE8A 1R0ZA 2AHRA 3DXXA 3T7JA 3FNFA 1QE0A 2ZE6A 3BRWA 1CUIA 4BY9E 1JLHA 3AO0B 3I9FA 4LNHA 2O8CA 1E4OA 4LJRA 1UBUS 2ID8A 1W1UA 5KX5F 1PYGA 3RYCB 2JGAA 4KYUA 4OMUA 4QUHA 1A4RA 2Q6OA 4IINA 3GT4A 2IYVA 3K8ZA 4IDEA 5KDDA 2R8ZA 1OV4A 1XV5A 2VT2A 3CG0A 4YXWA 2QLNA 4GLJA 3G0HA 4G8BA 1SEVA 2QRMA 4OB6A 3ZDAA 1CIJA 1WW8A 4FFBB 2I22A 3LRTA 1ADYA 3AM5A 3UGJA 4PPQA 1EE9A 1CQJB 3DGFC 1JHAA 3DDOA 1QTQA 2VXOA 4PLTA 3NVAA 1QQTA 1BN6A 3BH7A 4NZPA 4OQZA 1CUGA 3SC4A 3LUBA 4HGYA 3R75A 3ONFA 3H1GA 2HLDA 1QYVA 3G3EA 4DJ5X 3M2TA 4LZZA 4MI9A 4L85A 3NZEA 4S1VA 4TSFA 1JJVA 3COJA 1GQSA 2DFLA 1LKZA 3QHQA 1UKBA 3FBGA 1R8XA 2O5VA 4AJLA 4DDHA 1M5UA 2PRSA 3W77A 5IKEA 1PJ2A 3CNLA 3TJZA 1MCZA 2H06A 3P45A 3RTBA 2JLZA 2JJ2D 4JLDA 5AUQA 5D6NA 4X41A 1QCYA 2UAGA 4TWAA 1Y37A 1A9PA 2AZ4A 4MUYA 1EK5A 2C1ZA 5LBUA 2BGMA 3KLMX 2OUKA 3BJMA 3E4CA 1PZGA 1U4SA 5DMHA 5EVCA 3T5AA 2QXYA 4IHAA 2ZETA 5KYYB 2POQX 1E60A 4RUKA 4FB5A 1TYDE 1RVDA 4FZJA 4P1ZA 3VPAA 5ICEA 4RH3A 1G16A 1WS6A 1U5BB 4KSBA 2XUOA 4JC0A 5AKYA 3WTCA 4WXMA 3JQ6A 2OP0A 3SGLA 1NI4B 4RPJA 5AFSA 1K89A 1I0ZA 3GJ6A 4R1TA 2ATCA 1T43A 2Y8EA 4RNCA 3DTNA 5HNKA 2QX9A 1AZWA 4HEA1 5FYDA 3QENA 2M32A 3JZFA 1XEXB 4JBYA 2GMWA 2RAFA 3RFXA 1PJSA 1EESA 3GH1A 2O20A 4K9OA 3WYCA 1NG1A 2X5NA 2C9DA 4HFJA 1AG9A 3UXMA 1XLVA 1QCCA 2QAGA 4IIJA 5HGJA 3KTDA 1U8CB 3IEIA 1I2ZA 4BE9A 3T94A 1O6CA 2N1MA 4F46A 1ZOLA 4L0MA 3SMVA 1HF3A 1YQWA 3WLMA 1BW9B 1XVVA 3P2IA 4D43A 4B4OA 5A06A 3QUAA 3V55A 5F3WB 3AUYA 2G8NA 3TUZC 3KELA 4JR0A 1LNZA 2FQYA 3M4JA 3J81A 1A4IA 1AQUA 1Z29A 4H7DA 2A94A 2BI4A 3QIAA 1M6HA 3PGA1 4G5SA 4YHHB 5E4FA 4AIIA 1KJQA 3IR6A 1YQ9A 1IULA 1YRAA 2PUWA 2Q3CA 3ZHRA 2IH2A 3VNUA 4TX1A 3N7UA 5SV2A 3HYLA 3WRXC 2R1VA 3M6LA 4KN8A 5ALHA 5EPUA 4B3DA 4BFUA 4OX9Y 1XR3A 5KVSA 3Q3VA 3NNSA 4RTJA 4X62B 1N92A 4OXQA 1PF7E 2B7CA 2VWHA 1V8PA 4KIUA 4XLLA 2JCBA 5DV9A 5L3ZA 3FDIA 4GYKA 2YC4C 1PW5A 2D0OB 2J6HA 3NPAA 1KR5A 4HR7A 3WWCA 4KPGA 4X85A 3T06B 4BFXA 1FXUA 1P0QA 1PQPA 1ND6A 1TM4E 1ZD8A 5ESDA 3VU9A 1L4MA 4KO3S 4NOJA 4R1MA 1ULSA 3WQQA 4ER7A 2CXUA 5FR2A 4KR0A 5FAXA 1T8WA 1AM4D 3NH9A 1CUDA 3BKXA 2O0JA 2JCYA 1KFKB 3PUVA 2IZ6A 3DW1X 3PS9A 5DEIA 2YFHA 2GDZA 1HH4A 4M8NE 1CUEA 4G4SO 3OIDA 4RPKA 1LI4A 3LHIA 3GEEA 5EP4A 5HPYB 2Y2VA 2WZCA 3IT2A 3ROTA 4AM8A 1FDIA 1NVMB 5SZIA 3GJ8A 4C3UA 2QGZA 1Q17A 4D8YA 3KXLA 5C7OO 2Q4BA 1YI0A 1M1NA 3S40A 1KJNA 1UDBA 2AYXA 1MFPA 3GUYA 3DCNA 3UOAB 1SXPA 2IBTA 1QFMA 1HNNA 1U4OA 3PB3A 4PVCA 1EDOA 2JAWA 3AJ8A 4BECA 1OH6A 1SCBA 2B37A 3OJXA 4LMPA 5LIRA 2NU8A 5IABA 1YCFA 1RLMA 3IL2A 1KI1A 2GWRA 1M72A 3G5AA 3F8TA 1KRXA 1DMSA 3D3KA 5DSZA 4LY9A 2WKQA 3HUTA 1PS0A 4PF1A 5TF4A 1JTEA 1D5CA 1O8CA 1OXBB 1JS1X 2ZYIA 1GQYA 1OYOA 3PDWA 4KH1A 4II3A 1KZYC 1R3DA 2XIQA 3W2IA 2OHFA 4KUEA 3EMVA 4NE7A 5IWAB 2CXXA 1Z4LA 3AC0A 3HVJA 3KWLA 3VBEA 4OHRA 5IN5A 2ZI4A 2R97A 4LEIA 3W06A 1E6UA 1R1DA 2B4YA 2JFHA 4Z53A 3AV3A 4RD1A 4G0VA 1RDFA 2XHEA 4MV1A 2BMEA 2VJOA 2HU2A 3OESA 2FSVC 2Q0QA 4Q3NA 2WAYA 3NBAA 3B9RA 2A9QA 3N76A 4HNHA 1N3IA 4ZV7A 1SG9A 2PLNA 4Z86A 2FKAA 3CPJB 2Z8XA 3HBJA 4HNAA 5ITZB 1OJ7A 3F96A 3TBHA 3TZBA 3DMPA 1YQUA 1WXHA 2YVKA 2HU5A 2ZYRA 3CNEA 4LZOA 3WBBA 1BFDA 2ZW9A 2VPXA 5LU9A 5DULA 5HVNA 4JHLA 3NG1A 2R9VA 4F4DA 4NYJR 2GA9A 5EJIA 3ZVMA 1G5IA 4OLAA 5FQOA 2HHHB 1BXGA 1M8FA 2YDXA 1ZH0A 3SICE 1W49A 3PC8A 4P4GA 1BCRB 4CW7A 5CFRA 3EJWA 1GPLA 2H4YA 1RAIA 2XZTA 2MSDB 5KEIA 4HDQB 4IXMA 4AAYA 2A5FA 4HH0A 1KJ8A 1ZESA 3UJHA 4MX8A 3IEMA 5TS3A 1R18A 4BNKA 1R9JA 2HJVA 4A27A 3BMNB 1KEPA 1RC8A 2A1TS 3VOAA 4KSYA 5ES3A 1JPJA 1K0UA 3OPYA 4IQGA 2CVZA 2IWRA 3S2GA 1XTQA 1Z33A 4Q1AA 1GQ2A 3A27A 4ZJUA 2VI5A 3C5CA 1RXYA 1R0WA 2WV7A 3CN7A 5BQXA 5CEFA 5CA0A 2DR2A 4GM1A 3AHHA 2B21A 3INNA 4IOMA 1A5ZA 4MA5A 5BQPA 1WPXA 5NLLA 2YZ7A 2NYRA 3HDYA 4Q9HA 5IYZA 3CJQA 2NO9A 3G68A 4RA9A 5JXJA 3HSKA 1TC2A 2XOKA 4RA6B 2F3TA 2H51A 3MAAC 4AJJA 5CNKA 3I23A 1E3DA 2WU8A 1JXAA 2GDJA 3ZD7A 2AI3A 3SZLA 4ZCMA 1WXXA 2DE0X 1ZA1A 2IGBA 3L0CA 5K8CA 1Z8DA 4ER3A 2XSZA 2MMGA 4K8RB 2JI8A 2X8JB 3B7PA 5C8YF 1NXVA 2OXTA 3VR4H 2XWSA 2R2GA 4A5OA 3S0JA 4WOKA 1NTRA 1NY5A 3BBPA 5LLTA 1BAPA 3HO8A 4H15A 3QLTA 2XXBA 1CY1A 1A9XB 3G5UA 4GKBA 4IOJA 4B6EA 4I3FA 3RUHA 4PBSA 3LSTA 4DA4A 2VYVA 3ZK7A 3STHA 4Q93A 2COKA 2VZ8A 5CDSA 2A8YA 1PSZA 2PZFA 4UFOA 2PKQP 3CX3A 2VNIA 3VX4A 4AMGA 2Q6VA 4UNPA 5TVKA 3U1BA 2UVPA 1E1RA 2I3GA 2OO3A 4DR2B 3PUYA 3D1JA 4DMHA 1ZUIA 3L5KA 1BS2A 3PC2A 4XM2A 2H5LA 4YUZA 4FYHA 2H6EA 1Q5PA 4HWTA 1O94A 1M2NA 4TM8A 3TVTA 4Z7JA 4R8LA 1K3FA 1LBEA 1LJUA 2HRDA 4RNDB 3SQNA 3MN1A 4N3GA 2KB0A 2ZSFA 2WB4A 2HLHA 4HQLA 4A2WA 1T5IA 2IGTA 4B73A 2UUAB 2TMGA 1OWOA 1I51A 4NAVA 4FYYA 4WJLA 1K3UB 2O19A 1C2YA 4IFEA 2IU6A 2ZP1A 4LOJA 5CVDA 3GCZA 1FCJA 1HURA 3WP1B 5CRIA 1YZVA 4CU5A 3QOWA 4NZZA 1TT5B 2H9IA 4FI3C 1F51E 3TQHA 3IBGA 4PG4A 5COAA 4XARA 1QYWA 5JZMA 1PQ4A 1WF6A 4R6XA 4DUGA 5CK4A 2XDQB 3MMSA 4YCMA 1MF7A 1FRQA 2GPTA 1MZPA 4O4HB 1X9IA 1ESMA 1QIFA 2JJ1A 5KI6A 4BC0A 4EUSA 1T9BA 1W52X 5GZ3A 1QJ4A 1Y42X 2TMKA 1E98A 3PUXA 4JJFA 3KOUA 5EMNA 5GMOA 1E1QA 4GMKA 3WLKX 4ENUA 5AI8A 5KO2A 3EK2A 3W8EA 3MWJA 4J9UE 5KHOC 2O2IA 1SY7A 3VR5D 1E3WA 1NBEA 3TXXA 1KEWA 4L2IB 2O8BB 3BEDA 2RH4A 3NALA 2JJ2A 2BEWB 2DPHA 5ALMA 5IAKA 1DKQA 2QU7A 4HOYA 1QQAA 3UEOA 5BSWA 2XNKA 3P0HA 1EXMA 2BGUA 4AZ3B 2IDZA 5D1NA 3ASYA 1SQ0A 1UM9B 3DBLA 3EIEA 1PJCA 2ZRPA 3GPDG 3H5VA 4OJQA 4JZYA 1JX6A 2F9LA 4LDRA 2XQIA 2ZJ5A 5TGDA 5ETJA 1PJTA 2R1TA 1SHKA 1PDWA 1YNSA 4G1BA 4CDNA 4MYSA 4L02A 4RZ2A 2BLLA 2WJWA 4RENA 4B7XA 2VH5R 5JHGB 1L4GA 1OREA 1EVEA 1JR2A 2HIHA 3G6WA 1JTFA 1GT91 1I7PA 4MW6A 1GV0A 1E5TA 2EGGA 1WUIS 2R60A 1MOZA 2XMZA 3BFKA 1KDRA 5GV8A 4ZZIA 1NQUA 1ECBA 2QVXX 4JP1A 2VUIB 4PYMA 4X63A 2WBLC 3RUEA 2F55A 5CB4B 3DLHA 3W3AH 1LS6A 3EODA 1EJBA 2BELA 4XIFA 4C6TA 4BEJA 4C0HA 4P34A 4EABA 3P4YA 1YR9A 2ZJ7A 4FEGA 2E49A 2AC4A 5K0GA 2GTIA 5FD8A 2FMKA 3V6LA 3GNQA 1K06A 4ZYXA 1L3IA 3Q5GA 5ICSA 2WJ6A 1YB1A 4P32A 2CCKA 2LW7A 4YJ3F 2X9GA 5F7XA 3BXZA 2H63A 3WTBA 3H13A 3RROA 2ACWA 2OGSA 2VRCD 1UBTS 4MVXA 1T2FA 4QM6A 3TW8B 1SVSA 5LA6F 1LLDA 3U4DA 3VBCA 4AXXA 3FDZA 3Q7SA 4LFBB 1Q2UA 1E6WA 4HWSA 3DE5X 1GUBA 2E4VA 4XOIA 4F4CA 3KC2A 2FRDA 2H1RA 3NTVA 3GCGA 4PPGA 1D03A 1E2KA 2H2WA 2QLTA 4YROA 4UPEA 3KSBC 2GK3A 1KEVA 2B36A 1JZSA 1YZ3A 4BFWA 1MJHA 2QP3A 4DA7A 1ZK1A 3U19A 4I14A 2B69A 2REXB 5HK8A 4CV3A 1P77A 2CKDA 3PQFA 4CBVA 4N9QA 3JWPA 3UYKA 3QVMA 3ZY5A 5BMVA 5JU6A 4BB5A 1Z2PX 2IS4A 3KSAC 3INGA 2AMJA 1GKUB 4PC1A 2XB4A 4OTZA 1CZNA 3H5LA 4PSAA 2DFKB 4ND8B 2CK3D 1ZUWA 2QYOA 2XBLA 3SQLA 1JEDA 2GBGA 2M6RA 3AG6A 2FU5C 1GCUA 3BVPA 3HN6A 3OY2A 3V7WA 2WYVA 4MI3A 5JCOC 3I52A 4LF7B 1AS3A 1QX4A 1BE6A 3L7JA 1JR3D 1OX4B 2NP7A 3RWMB 4D42A 1IIRA 4WIAA 1FRNA 4JYAB 3FW1A 3T7EA 4K9LA 1NVAA 4O63O 4U7JA 5H4GA 3O4FA 1SU8A 3OUUA 1X7YA 4AZSA 3PEEA 3JQPA 2VWQA 3OZXA 1XRRA 3K9HA 5BSGA 5GZ1A 5J2TB 1PNQA 1OI3A 3C6KA 1QHXA 2PK3A 3L8FA 4MAFA 1ZBQA 3ADCA 2D0DA 2O1EA 4LJ5A 2JAUA 1K8XB 3JW8A 3O0DA 1P31A 5CJPA 3WLJA 1DHRA 1YJBA 1Q3HA 4F8YA 1CTQA 4E14A 4MA0A 3RUCA 1KF0A 2AE1A 1EGMB 3PT5A 2IHJA 1DBVO 1J39A 3LC7O 4X1YA 1K63A 2PZJA 3QXXA 4ZVLA 3A9WA 4KGVA 1QK5A 1XTUA 2OTCA 1Z6XA 2FJ0A 4IXWA 1TU3A 4EI8A 1XEWX 3ICVA 3USES 4FGJA 4ACAA 4FP9A 4ITUA 5AVWA 3UCEA 2EHJA 2H2HA 2QZZA 4TV9A 1NF3A 3M2PA 3MWDA 1KA9H 2NSJA 2ZU0C 4EFMA 2ZJ6A 4ZIRB 2B6NA 2QUBA 3MRVA 3UN1A 2R4QA 2ZIXB 2GD6A 2Y99A 3HLYA 4GI1A 4JL6A 1W6UA 2Q3JA 4L3VA 1UZNA 1XPJA 1DQRA 3TZCA 3DFUA 5JW6A 4S0ZA 4LDAA 3I4LA 1N3LA 2WZDA 3AHGA 3HS3A 3QH4A 1QKJA 4YB8A 3FTFA 3IT1A 1EVLA 5EKDA 3RGGA 1GGVA 1ISMA 1BXRA 3LXRA 4N3CA 1QCZA 3VPXA 5GWXA 4TZ6A 3ER9A 3ID6C 3TZ6A 2P9TA 4MYDA 1M1XB 5FKJA 3NHYA 2HV9A 2MYNA 1KEZA 2RB5A 3A6JA 1ZJ5A 3C41J 3FMIA 3LE8A 4N49A 4N39A 4R4JA 1Z3CA 5JFOA 3IEXA 4URFA 2BTQB 5GONF 3DZIA 3VH2A 3SHQA 4PYLA 1U2DC 3CW2A 1ZLXA 5EUBA 4EO7A 3QKSA 5HQJA 2EW1A 1RQXA 3O7WA 4ZKEA 5JARA 1H3NA 4LYDA 1N9ZA 3AY3A 2VT7A 3IHKA 2ADOA 5AXAA 2Z08A 2NSYA 3RVSA 4EG4A 4OHUA 1P5FA 1PUIA 2H2GA 3A2LA 4I8DA 2ZJFA 5F2EA 3UWDA 3IIMA 2VDJA 4J6FA 4YCAA 4C4TA 1QHEA 1ZK0A 2O0LA 3PICA 1Z7YA 2BTOA 4MUBA 4C1BA 3OA0A 4B2IA 1RI3A 1TIKA 1F4LA 4B81A 5EFZA 3CE6A 2EARA 5LXTF 5BV7A 1CZRA 2H7YA 1KDTA 3Q85A 2BGJA 3USCS 1PI3A 3DAGA 4P86A 4IEIA 5ESWA 3RH0A 1VE3A 2DPGA 1MQSA 4S1NA 3H97A 3AXTA 3RC9A 4BO1A 3GFTA 1GRQA 5AKGA 1E61A 2LWIA 2JK0A 5LD2B 4UTRA 5P8WA 2C2HA 2XT6A 3QMMA 5DMXA 3ZBTA 5JYCA 2O8EA 2C31A 5AI9A 1YZLA 3E8SA 4M53A 4YRTA 5JLAA 1SK8A 1USVA 4UM7A 3SQXA 2C7BA 1WPGA 3ZI0A 621PA 2HF2A 1GZ3A 2WJYA 3WC4A 5BXYA 5EGSA 3T5TA 1X7DA 1JIQA 3TOCA 3G7SA 1FTWA 3UT5A 1K2VN 2IZOA 5IDXA 3KL4A 2XGSA 4J2OA 2JGRA 3TH5A 4DJDC 5I7SA 1WA5A 4BGVA 4PFSA 3SR3A 1H2RS 3PR1A 4O1HA 1II8B 4DDTA 4HN2A 3TSOA 5DNDA 1WCV1 4D4GA 2IIQA 4D4JA 4MYRA 1VLVA 2IW1A 2KW5A 4KX3A 4TS3A 5KX5B 5DM70 1H0HA 2Q0XA 1ZIDA 2EJCA 2I6XA 2PZAA 2QSJA 2VP9A 2X86A 3Q4GA 1TECE 2YOHA 2PUCA 2C4MA 3L3BA 3R3YA 1XQXA 4QGBA 4UOZA 2P5YA 3PX7A 2DHEA 2QRZA 3C3AA 1UT6A 2OK7A 4MV0A 1S7CA 1PR9A 4FBMA 5I8WA 1YK0A 2B5WA 1X7XA 2Y3IA 5CTJA 1T9GR 1UKZA 1TJ3A 3UK0A 1U1GA 4HPJB 4QVKA 4A0FA 4DJEC 1MW9X 4DXDA 4HNVA 3D31A 4MS1A 5A5DA 1SXJA 1XAIA 2W2MA 1O97D 3ZU4A 5DN6A 1BFUA 1YRBA 3ED1A 1XXLA 2H52A 1FLDA 2BFPA 2YJ3A 2VBFA 4QNNA 3B3FA 2Q21A 5LR6A 2GEFA 4YFVA 4NCBA 1L7MA 3D81A 4BP1A 1CG6A 1FX0B 3ADDA 1XG5A 3G2QA 2UYHA 5CAEA 1AVTA 3OM9A 4M7PA 4QDZA 5D51S 4MKFA 2QK4A 2WNSA 5B1HA 1MB0A 3EN0A 5ILOA 2D2FA 2E5FA 1FFXA 4J9VA 1TF5A 5HKOA 2WNIA 4JBXA 2ZRQA 3CEJA 1ORWA 4R6WA 4NEQA 5FR1A 1Q0QA 3JARB 1SBTA 3U3MA 1RJFA 2A9JA 4OEHA 1C0IA 2RJOA 4WFKA 3IP1A 1K4MA 1G8MA 3PHBE 3WMGA 4JLVA 2NQTA 2ZBPA 3A4IA 3NDPA 3PCRB 5IDVA 4B75A 4DJAA 3Q9LA 3HCWA 2Z5LA 1QM5A 2AUMA 1S7GA 1ESEA 3GAMA 3PR2B 1YFJA 4B3SB 4AS2A 5ED4A 1VL2A 4NJMA 5E7IA 1THMA 2Q3DA 3F6EX 1GJRA 1NJ5A 3OU6A 4ZOCA 2BD0A 5E95A 3GLFB 1AHIA 1DAFA 1C4OA 4RTPA 1Y9DA 4EM6A 2QUAA 4ZVVA 4E2YA 2FMTA 4HNGA 2CXNA 3WKDA 4YIKA 2C8JA 1HQYE 4O4LF 1XMVA 4C7KA 2ORWA 2IE8A 4IUBS 5A0FA 4C9BA 4KITB 4LRQA 4XKJA 2K4MA 4PU0A 1UBHS 2WF9A 2C94A 5JRJA 1Z88A 2WJJA 2HJWA 3LBNA 5HRCA 1KJWA 4KBGA 5CVTA 3THWA 4A26A 2I6SA 1T25A 2GPBA 2XGGA 2BCJQ 2O50A 4IUDS 5LQSA 3RSFA 4BMPB 4YMGA 3THYA 1PCXA 3UAOA 2QVYX 4M9SA 3HKBB 3U62A 5C51B 5K3BA 5JYEA 3SHTA 1YWGO 2X4DA 5E7QA 5F64A 1YVDA 4MDFA 3W05A 1ELOA 1NT4A 3O8OB 4ZOLA 4YWJA 1CZUA 4D57A 5LSAA 1N8SA 2CFIA 4ZC8A 5HDBB 3KQOA 3GVHA 2BR4A 1T3HA 3OTGA 4M22A 5DX1A 4XGKA 3DGEC 3VO2A 1H85A 1VKNA 1XL0A 1GO2A 2OZLA 2PSDA 2SCUA 1AXEA 2J6BA 2OLKA 4X45A 4ECEA 3L8GA 2E9SA 4HF7A 4IDPA 1BEZA 1IQUA 1SVNA 4DCTA 5KJFA 3WSWA 2GM3A 1T4CA 2AR9A 2QG4A 1PBTA 3Q12A 4L4ZA 1V7PC 2HC9A 3WL5A 5FWXB 3QJ5A 2WHXA 4KBFA 1EZ4A 3AR8A 2F3RA 2YNMC 1L7BA 3CUWA 3MS2A 3H9EO 1YS2X 4J0QA 4OXKA 3BSWA 4HGPA 3LQRA 4E4YA 1SQSA 2WWRA 3CF4G 4QOIA 1Y63A 1OWPA 1PJQA 1Y1LA 3W5IA 3K94A 3G9QA 3NI2A 3TX6A 2QL5A 3FDJA 1M6NA 2NIPA 5IP5A 4AQYB 2PBRA 1AKTA 3P5BA 3KUKA 3DTYA 2FP3A 3QP9A 4BWVA 2YS6A 3C48A 2JJYA 2H08A 3QK7A 3VR4D 3ER6A 3DAPA 4Y0NA 1GADO 3G9TA 4CVNA 3MERA 4F3KA 3U4HA 3IIIA 3DOOA 2MOKA 3DHWC 3HB1A 1JLLA 3R23A 3I9OA 3BGIA 4A82A 1KOGA 4DSOA 1Z5UA 2Q7XA 2NZVG 2XXJA 4GYWA 1L9KA 1FP6A 1OA0A 3W04A 1Q0RA 4F38A 5TPWB 4AC9A 4MRMB 5EGNA 1JAXA 2IXTA 3G89A 3GRRA 4H27A 4AJHA 1VCHA 1LF5A 2PXAA 1LPBB 1GCAA 3KZKA 3OETA 2CK3A 2J3JA 2YN4A 3EIUA 3N8HA 1ZJWA 3BD6A 3A3KA 4RANA 2XRYA 4BU1A 3U7QB 2VXCA 3NC4A 3PNMA 3OCXA 5FOXA 3FD8A 1I7SB 1JR3A 4NBNA 3F8WA 2QAIA 2J9YB 5AXDA 4B85A 3GHHA 3KRTA 4QXAA 5EEHA 5FTLA 4UM5A 3L4KA 5JD6A 2VNHA 5FPYA 2B1QA 4HRYA 2PCLA 3TPZA 1LV7A 2CHFA 2R11A 3KQSA 4PFKA 4PIMA 4DLSA 3U5ZB 3AM1A 3RC1A 1UBEA 1Z6AA 2BFCA 2CVQA 5ESXA 4JODA 4L4XA 5B7QA 2R7LA 1C9NA 3FXAA 1KI3A 5J4LA 1Z6PA 2R1ZA 5ICFA 4MMXB 3RJ9A 1A1VA 4J7AA 2PUVA 4M1KA 1NMZA 3V4PB 3M70A 1ORTA 4OPMA 6GPBA 2CMFA 3D7SA 4JT4A 5K8VA 2ERXA 1IHOA 4KPEC 4L5AA 3VPBA 1EFRA 3B78A 4BQRA 2GM9A 2V7TA 3T54A 3PGKA 2K2WA 3KHKA 1X74A 3NHFA 4JKIA 4Q00A 1ODFA 3RYTC 4Z7QB 5IK2A 2A1IA 3O2SB 3RAFC 4WDQA 3W3ZB 3BGSA 1GGKA 2KYRA 1EK6A 2QE6A 3GVIA 1KEEB 1GQRA 1PT7A 3DUWA 3FAKA 2KJQA 5KVCA 3RVRA 2VP5A 1OCEA 4JH0A 1Z9BA 3M82A 3GGCA 4KWTA 3WBKA 4F2HA 2P4EA 4OI4A 4XGRA 5EJ8A 1C7IA 1GLGA 3MRXA 1CE8A 1KSHA 2R44A 2NO6A 3IAM1 4ARUA 1U7UA 2PKCA 3HYNA 2WV9A 3IHLA 4HLDA 3AR2A 4MVJF 4TS9A 3ZWBA 4O2LA 3TRDA 5IEJA 1XL1A 1E79D 2VK1A 3EGDB 3PKIA 5JOQA 1E20A 3FIUA 1SCUA 2XYRA 3QZUA 3SYLA 4TL9A 1Q3KA 1UT5A 2AS0A 4AYXA 1XAJA 1R4NA 2VH1A 1P0CA 2AOTA 1I1HA 3G59A 4O1IA 4ZRNA 2FWAA 4CLXA 2VS1A 5BSVA 3K71B 4PRLA 3HFGA 1HETA 3JALB 2GS9A 3OJLA 1VL0A 2HJ9A 3HKEB 4AJEA 2VQEB 4Z0TA 2LCIA 1H1TA 2ZYDA 1WB5A 1Z28A 3AERB 4B09A 1GPMA 2NTYC 5HQTA 1EZZA 3CY6A 1JR4A 1T9GS 4YJGA 3K1AB 4BQFA 1KAOA 3TLGA 3LFHA 2XUAA 4NMHA 2QTGA 3W3AD 2IUEA 1X2EA 3QE9Y 1EDBA 5DM1A 4ERNA 4YAKA 5SICE 3E22A 4NYJQ 1RZUA 2C7GA 2FJPA 1V5GA 3QGMA 3OTOB 1IL0A 1SG0A 3TM4A 5C8YB 1WJGA 4GBJA 1L1QA 2IA5A 1AUOA 2XUGA 3DXFA 3GFFA 4CEHA 4LW8A 4TKUA 5IHPA 1FNMA 1RBQA 4AS1A 3A11A 3OJFA 3R0JA 4G6ZA 3FI0A 4QQ8A 1FSPA 4E11A 2QJWA 4Q24A 1VCMA 4FFRA 2BDEA 1AO0A 3L2OB 4OHMA 3CA8A 3IQGX 1RPTA 3EAGA 5D5PA 1ZM9A 5EIBD 4CFZA 4ZVQA 3TL6A 2J07A 2WJGA 3FSRA 2CHGA 3KJGA 2VYFA 3WLSA 4ARSA 5CW2A 4ALLA 5JQWA 2VJDA 2OB2A 2VJMA 5FLKA 5IN4A 2X2OA 4K40A 4OQYA 3M3PA 1C3OB 1W19A 4YO8A 3U3XA 3N2GB 4QDOA 2HYIC 1BXKA 3FA2A 4RKQA 4W5OA 1G18A 1Z8FA 2V6MA 3EBLA 3S4YA 3SC2A 1UZLA 4DCGA 3BFPA 1SC3A 3F6CA 3I0ZA 4HYTA 4ZKDA 5MF6A 2VDMB 1K8QA 1FE8A 3LMKA 5FX2A 1L5HB 3U31A 3P4UA 3RTEA 4I9NA 4HVLA 1KFJB 6YASA 2MINB 3RM3A 4DR1B 1GN8A 2VJQA 2XUFA 3DHVA 4D4KA 2G5TA 3KAPA 3G1TA 3ZH9B 3ILVA 1VIMA 5LM3A 4PXAA 1L4KA 3BEOA 2HO5A 4OV6B 4YJFA 3T9AA 3ESAA 3C39A 1CR2A 3E1SA 3SZMA 5BSFA 3JQ7B 4KQIA 4S1PA 4YT2A 4BXOB 3A0RB 4AKHA 1KBZA 3PHHA 4UAVA 5C5CA 3SG0A 2WWWA 5JE8A 5JIBA 3VKGA 1MA0A 2HCFA 3OA2A 5FWDA 2I9KA 5I7OA 1RYEA 2OXFA 5AK0A 3T5GA 5JS7A 2XITA 3LGAA 4KNYA 2HYDA 5C46F 3R7DA 3ETCA 1BWQA 1LNQA 4B48A 5J2UF 4JZKA 3G7UA 4KQ2A 5EMMA 3CLSD 4E5PA 2O3RA 5IM4F 1LDBA 2FDCA 5CP8A 2ZI7A 1U3TA 4MPRA 1TUBA 1TL7C 2ZKIA 3ES9A 1EG2A 3A1DA 1RU3A 3NOOA 4PM4A 4PONA 1JEQA 1AC5A 1UJBA 3HDQA 3NRBA 2GO7A 3K1ZA 4GLLA 4XB2A 5K1ZA 5IBCA 3NTXA 1J90A 3RF6A 2FOXA 2RGUA 2ZB2A 4MCAA 3UW1A 4B6RA 4KXLA 4Y1EA 2KLBA 3FNBA 4J6EA 1D6JA 1QV6A 2G40A 2WMOB 2XNJA 4HX2A 5H0IA 1N8NA 2OZKA 4JASB 1MVNA 4DIEA 3TBKA 3KYCB 5C8XA 4DV2B 2E5WA 2JGDB 1U8FO 2G3YA 1D2EA 1KI4A 1W4CA 4Q7QA 2VDLB 4BX2A 5HFNA 3KLBA 2XTMA 4HWRA 4XRRA 1S3FA 2R47A 2EBHX 3O8RA 3LQFA 2FG6C 1H65A 1X7WB 1XDUA 3A9UA 1ZOOA 3K2QA 3TLYA 4A9AA 3QY0A 4C76A 4DMLA 3GDHA 4ENVA 1Y34E 3ZQJA 4D92A 4MV4A 3FETA 2W2KA 5IAGA 3I4CA 3W7VA 3IP6A 3X1DA 4JI2B 2FGJA 4ETNA 3AB8A 1E7YA 2F8LA 4PTYA 4LQDA 2P9EA 3NNDA 4FBLA 4HFMA 3CVXA 1M54A 3L46A 4YAUA 5BN5B 1YS9A 4QDTA 3WFIA 4P7GA 4JVNA 5HS6A 3S6JA 5AVUA 2IUYA 2ZTUA 3GV0A 1KH2A 3L8MA 4PO8A 1UM8A 4R0VA 3RIGA 3BORA 1D3AA 3VR6A 3IPRA 5JCXA 4KQWA 4YJ3B 4WZAA 1NLFA 4POOA 2PAFA 4YRKA 1EXWA 5JNLA 3L0OA 2CE7A 3GHYA 3Q11A 4ASUA 1GPJA 2RARA 5GQSA 2OXIA 3IAFA 4RFVA 2GHRA 5LA6B 1OF1A 1PIWA 1QG4A 2FWNA 1P4JA 1D1SA 4QQNA 3DZFA 4DKXA 1IM5A 4MP8A 1CQIA 2J7KA 3JVIA 4B6SA 3UGTA 2JFVA 1KIMA 2HGZA 1U0OC 3E82A 5ERXA 3A6KA 4ADSG 5EZYA 4MVJH 2WVAA 1NBAA 1XVLA 4RKWA 3TR0A 5TS2A 3RVOA 3WWEA 1X2BA 2Y1LA 2X41A 3PUHA 2IUUA 4YYEA 4XQEA 4JJ8A 3K0CA 4MW2A 3KT0A 3UV7A 3I61A 5DYYA 1J2EA 3F3KA 1XWWA 3BPSA 4ID3A 2ID7A 3PT9A 5FWYB 4EZBA 1JNXX 2VZLA 1SHLA 1TJYA 4CKBB 3FYUB 5DNUA 5FNVA 2YRFA 3H8SA 4Y6SA 1Z0SA 1SHJA 1XEWY 2IF0A 1KP3A 3Q9UA 5LQDA 2CDNA 1SVLA 3R1IA 1R9GA 1P2GA 4HDKA 4KSCA 1XPUA 4EPYA 4F6CA 4IGKA 1B0UA 2GRJA 2AX4A 3K0BA 4HGZA 3SBOA 3WIDA 4LFAB 1T3GA 3B85A 3IQDB 3NM5A 4QOGA 4ZPXA 3TL3A 3VGPA 1QO9A 1FU8A 4BZWA 4R9VA 3LNCA 4UULA 5BVGA 1QO0A 5CA0B 4II7A 2J9RA 2J0VA 3LY7A 5IC5A 4F84A 5JNRA 1HYHA 4ZHQB 3RO7A 5IH3A 3P52A 3NMUF 2PUJA 3ND6A 2HEIA 3GVCA 1RFLA 4YP6A 1XFAA 2P3OA 2GESA 1YRHA 3O95A 1QRDA 1WD5A 1NFQA 2LGJA 3AJDA 4NZYA 2FWIA 4IUYA 3TX2A 1RJ9B 4TWJA 2GF0A 2REQA 3F98A 4J4BA 1K8RA 2PD6A 1OXUA 1NQVA 4FPXA 1T0JB 4PZAA 1NBHA 2HA7A 3AVQA 4EJ0A 4YV0A 4YUXA 1BHJA 3IFSA 4NIMA 3SN6A 1IN1A 1SIUA 2ZJ8A 1OAOA 5I48A 2B1GA 4QTYA 4JUDX 5KS2A 2PJZA 4UU1A 221PA 3KYDB 1AKEA 3F7MA 3ESQA 3R7WB 3MJ4A 4BVJA 2CV0A 5LLDA 3O1HB 4KDCA 1WRBA 4RF4A 5FLYA 3WGUA 4PX2A 2WF8A 3DDNA 3FCCA 4BO9A 4CTMA 4TTIA 2GFIA 4IDDA 1T5BA 1KAMA 1SGWA 1IZYA 3FZYA 3ZW8A 5EHZA 4ZVSA 5JO0A 2J1LA 4HAUA 5CCBA 2AJBA 4AG3A 3GLGE 2E6KA 2JAPA 1I80A 3IPAA 4KBYA 3S1AA 3U7JA 4CMEA 1I0IA 4DDMA 1OB2A 2W8BB 2UXBB 1P1FA 1X70A 2CMKA 4PZZA 4U7GA 5FIUA 5FL7A 5EJEA 2P2ZA 5E6SB 1KEKA 1W7AA 1TQHA 3L5OA 2C4TA 3NUGA 4FD2A 3IOCA 1FFHA 4GAEA 5DBGA 5GONB 2YWJA 4C5BA 2HI0A 1G3IA 1JN0A 2G76A 2ZAYA 4TXJA 1AIPA 3UFBA 3PQ7A 4CM8A 1OKKD 2WJ3A 2X19A 5SYAA 1LC3A 4JLMA 1C1DA 1Z12A 1XTIA 2P75A 2ZWOA 3FVWA 1K8ZB 1MO3A 1P2DA 3NJRA 3OU2A 4PGMA 3STXA 5EJ5A 2ON6A 4ZAXA 4G97A 1NMYA 4Z0PA 4BO0A 5DHTA 5JJCA 3IDQA 2OV6A 5IDYA 3CS3A 1OSNA 1PG5A 3CSUA 3E61A 5CFMA 9ABPA 3ORYA 3WGTA 1MGPA 2PKXA 1MJGM 3OQIB 2VATA 2JDID 3LVFO 3LDUA 2E2WA 4X94A 3A04A 4GI5A 5LXTB 2YNMA 1B3RA 2ZJOA 1MV5A 3PXAA 4MW0A 2VJNA 1DT5A 1JJ7A 3LVBA 1U28C 4AT1A 3VC2A 4MUXA 3F9RA 1UK8A 3D2AA 4L72A 5IAOA 1QOQB 5H4HA 1VKZA 3H2SA 3O4JA 5KBYA 1SXHA 3OPYI 5KYWA 3HB9A 4EG5A 3RYIA 4WCFA 3UB2A 1VLZA 2LV8A 2FK7A 3QG5A 4XEHA 4PLPA 1K3TA 3EUAA 3CVOA 4JMPA 3NB0A 2VP4A 2A0WA 2EGUA 4D2IA 1LA2A 1ZXXA 2X9LA 4JMLA 4RIEA 4XA8A 5IBQA 4JI5B 4LY3A 4RU1A 4Z1MA 4JEMA 3WB1A 3TEMA 2F6RA 3URKA 1MDBA 4BV8A 1GUYA 3TLXA 4ARZB 4F04A 1J9GA 5DP2A 4F1JA 4XVUA 4ZK6A 2XWQA 1O77A 2XOXA 3AUJB 1SBIA 2JA2A 3L7YA 3HA5A 4RZQA 2YVAA 5CHEA 4CU2A 4DVJA 3UBTA 4MARA 5HFJA 2BN4A 3JQAD 4MRRA 5GINE 2ZBRA 3IB3A 2RGDA 2R8XA 4LDZA 2GJ4A 4Y98A 3KVNA 5G1OA 4DDWA 2BISA 1M2GA 2RJ3A 4QXPA 2QVCA 3MGBA 4D96A 2FN9A 4JBIA 4UFPA 1HSZA 2C7OA 4E31A 1XFDA 2FE1A 3OJ0A 1VE9A 2CZCA 4P8RA 4TL6A 5AHKA 1RKUA 2QI9F 2NPFA 4AK9A 3E0XA 4D7AA 5A1TA 2GCEA 1BQ4A 5BV8A 3K70B 2E4XA 1NUHA 1YACA 2QGNA 4O4IF 1V8DA 4NAHA 3T7AA 1P8JA 1W6RA 2OL4A 3BQMB 3K9WA 2CLFB 3WV5A 4PNEA 3E23A 5TQ2B 1RP7A 2R8PA 3TSAA 1TUEA 4NMWA 2R5FA 4E46A 4I1OA 1V9SA 2GN1A 3K6SA 2BKAA 3BXEA 2NXCA 3D3QA 1X7ZA 4CLDA 1OYYA 2WJ4A 2WR8A 3E5RA 1DOZA 1KAHA 2N1BA 5LDGA 5C31A 4DUYB 4I6JA 2AZMA 5CT5A 1ZXBA 4NS4A 4REQB 5FOSA 2JPDA 3VQTA 2XCRB 4MWOA 5FTNA 1Z2DA 2AXPA 5H3HA 4E09A 3A6GA 1MG5A 2Y0PA 1Z45A 5IBRA 1AGYA 1WUKS 1WTAA 2WW8A 3AZOA 2QUJA 4WNAB 5GM1A 1RLUA 3N86A 3FPLA 2WTEA 2WP0A 3FHLA 4YRDA 2XB8A 3CTMA 3MD9A 3PXBA 3C2QA 4I1RA 1Z4QA 1HYEA 4DJFC 4CG0A 1HGXA 2JKZA 3GPCA 5A3SA 4CQMD 4H1WA 4R01A 2P11A 2ZATA 2GZRA 1KDYA 4H60A 4AG5A 4URVR 2ZUUA 4Y2SA 1UXJA 3PDUA 4N6GA 2OUIA 4O4LB 5G3YA 4EB0A 5AUOB 1ML4A 3QU4A 4WCVA 4HVTA 3JTEA 3LPLA 2PT6A 3LUHA 4CE6A 4TN5A 2AN9A 4XE5A 3FUUA 1JG3A 1QIDA 4P98A 4F91B 1OA1A 4PYIA 4IMRA 3MTGA 1YB4A 1XCPA 2WWXA 4O4JA 5ICMA 1FFCA 1H0RA 3WY9A 2AFRA 4HFNA 4JGIA 5L9AA 1D2AA 3LC1O 1GDTA 2ZTLA 5COQA 3K70D 3X1MA 4QYIA 2ZXEA 1XCMA 3KR9A 4NCHA 2Y1FA 3PHCA 1YJXA 1NU6A 4QLBA 1XQYA 2JGLA 1Z83A 1COWA 1EE2A 3OTWA 4HEJA 4RS3A 4GO1A 3I83A 4KWCA 2W4MA 4YGYA 3UMYA 3LZCA 2PL9A 2PBLA 1PX2A 4KR6A 4EG1A 3SJAA 3V2GA 2CVFA 4URUR 4YJ2F 1LGYA 4KI0A 2R6GA 3QEJA 3ICQB 3N2LA 2G8LA 4UE3S 3COWA 3FHJA 3BTUA 3QEAZ 3F73A 1EDZA 4PV7A 1Y80A 2J41A 2C98A 3KD2A 5KOYA 3GG9A 4GYJA 2F8TA 2AFIA 3PWTA 3M9XA 1B1CA 2XPCA 3U13A 1M33A 5DLEA 4CR8A 2A5YB 3ISJA 4QPCA 1JAIA 5EC8A 3VVLA 1ZHHA 1YZUA 1G3MA 1FMLA 5G40A 3EIFA 5K0NA 3S29A 4BB9A 1A8PA 6PFKA 1Z6QA 2GEBA 4H1HA 1NN5A 1U2EA 2XMQA 1I2AA 1SZCA 1TZ2A 4EHAA 3GY0A 2ZM5A 4EUEA 1J2UA 1GNRA 1QGUB 2GBLC 4BLWA 3FHCB 5B12A 1RMYA 4JROA 5FFMA 3BQNB 1WP9A 2J3KA 1AE1A 3GDFA 3JASB 4PS0A 3DR5A 1N0UA 2JI6A 2B5VA 4BU0A 1CY0A 3MYYA 5H68A 1HQKA 3ZWQA 2QOEA 1DZIA 3A6EA 2WQ7A 1RD4A 1GNQA 4QOJA 1OI2A 2P78A 3H84A 1ZVJA 4IWXA 3SC3A 2FPLA 4X60A 1G41A 3DBIA 2R86A 2VDKB 3L0SA 4XSVA 1WCIA 3RABA 4NH0A 2YVLA 3I28A 4FYXA 1TM1E 1X1EA 1YT5A 3IKMB 5M29A 3RU7A 1FSGA 1FSZA 3UXYA 3AR7A 3JQBC 3E5NA 2C5GA 4GR5A 2QUHA 4DT1A 4YECA 1FVOA 2QP4A 3LIPA 3I6BA 4LZAA 1CJBA 2G7MC 1J8VA 4W5RA 4RZ3A 2D13A 2GN4A 4WZBB 3L8CA 1UH5A 2XRMA 4ALIA 1YDGA 2YCBA 2IJGX 1VFNA 5A02A 2QTFA 3ZV6A 4Y2QA 3D2CA 4TL7A 5JDIA 1LV8A 1P9NA 2OAEA 1YMVA 3B3QA 3KOYA 1DOAA 2Z5VA 4DUZB 2WG0A 1NYRA 2RHOA 5KWEA 1Q16A 3BSYA 1J8MF 2Q8QA 1AZLA 3H3JA 1V11B 2PM8A 1BVYF 4UW9A 1U99A 2CLEB 3OOHA 1ISGA 2WKSA 1ZM7A 4JYBA 4AICA 5BWNA 1VKRA 1SVUA 4D79A 2BH9A 2Z1NA 3SOPA 2CMHA 2H2FA 2JIOA 2A0KA 2NNLD 2CGEA 2Y66A 2CLIB 3AF0A 3BCSA 3L6UA 3NDIA 4FEEA 2D2EA 5EXXA 5A0VA 3WYAA 4IGIA 2PS0A 4XLZA 4E32A 4G84A 3MF4A 3AGQA 2GK4A 5JSFA 3HM2A 4X7MA 3GFGA 2ZWMA 1SVOA 3ZE7A 5I4KA 1KY4A 4YO7A 3ZYZA 2QL6A 2XUQA 1X8KA 4E70A 2YV1A 3DQPA 1J33A 1MORA 2Q8PA 1NJ8A 1WY5A 2IUTA 2FWPA 1VHLA 1GXSB 2BV3A 1BKSB 1X9HA 3D8NA 1QF6A 2ONCA 4KR9A 2IU4A 1EX1A 3PFCA 4DR3B 1MJFA 3SSNA 3FIJA 3GFQA 2P77A 2PQ0A 3CRZA 2ZQZA 2E0IA 4NOKA 4BKRA 4ER6A 1NRIA 1YK1A 2BBTA 1R6UA 1K92A 2YWBA 4O1MA 4EF5A 2NYAA 5C80A 2CL5A 3B5EA 3AEUA 3WLLA 1ZOSA 4UU8A 3SFTA 1JXOA 1KVRA 3DNMA 5EP2A 1NVUQ 2ONJA 3UIEA 2W6PA 5KNCA 3QLEA 1XLTA 5CX1A 4JLNA 3PI7A 4MKIA 3DV2A 2V7PA 2TMDA 3F4LA 4MVJG 1O9BA 1K0FA 1ZPDA 2YCLA 1DCFA 1CJVC 1POWA 1FK8A 2JW5A 1YZTA 2QN2A 2BGWA 1QIKA 2EJUA 1ESNA 2YMMA 2WOOA 3GEHA 2A9RA 2HTFA 3QMVA 2XA9A 2PYIA 1AH2A 4RD0A 4U9HS 2DJIA 1N2IA 4ZVPA 2QQ0A 3OE7A 3W2FA 2XJ4A 4X65B 4X8MA 1CT9A 2X7JA 3R7AA 3IIJA 1GU0A 1XTRA 2GKSA 1JWAB 2ENWA 4RKYA 3WJ2A 1DXYA 1PTJC 2BGRA 3ZH2A 5TRTA 4CTNA 1SC9A 1UJ5A 1G21A 2Z4TA 3FCUB 4MB6A 4UCXA 3H04A 4KLZA 3C6BA 3REQA 3U1VA 3OIFA 2PZ8A 3V46A 4JI4B 3GROA 3HDVA 3N2EA 2QIOA 3R3JA 1O9HA 5AVZA 1XDBA 4G9BA 1E6EA 1MKYA 1TVMA 5C53B 1LB1B 1F9AA 3DAOA 3H8VA 4UHFA 1YR1A 1T6ZA 1SOWA 1Z5GA 4NU5A 2BFNA 1C0PA 2OP1A 3FNHA 4U8GA 3FMOB 1PFQA 1ZNZA 3A2MA 4UXHA 1U11A 4GBED 3K05A 4OBEA 2XNSA 3U4QA 4KQHA 2OORA 2QQEA 4QBHA 1ZH2A 3LYLA 4MVJD 4EB6B 2TSYB 3WYBA 1FUIA 5BY2A 4S35A 1OYWA 3F3SA 1Y1PA 1ZK2A 3QEMB 4MB2A 5DM2A 5AW2A 1GTRA 2WDZA 4M46A 4OB8A 1ECJA 4Y9RA 3OO0A 1WXGA 1A5SB 4KOAA 4BLQA 2H65A 1ZM4A 3R41A 3KKEA 2GHIA 4EW6A 4EY4A 1GGEA 1HE2A 1VQ1A 2ZVQX 3ENZA 4Z9BA 4B43A 3F71A 4F6LA 3EEOA 3UAGA 1FS4A 4HHEA 1GP2A 3I01A 4KQJA 1D04A 3CMMA 1GFWA 1A04A 3FVQA 3F78A 1NC3A 4I4LA 2Z9CA 2Z2IA 4PQRA 1CEXA 1XD2A 1N7IA 1PFKA 5FI3A 5LPNA 2V5AA 1OR8A 1VE6A 3AR5A 4J0EA 4X9XA 3UKDA 4M1MA 3LDAA 3GXOA 3DBHA 1Y48E 4UBMA 1TF7A 1PR4A 2CEAA 2O1SA 1TM5E 4DANA 1XMIA 3LCRA 2W2QA 3UK1A 1AUXA 4G5FA 2J0UA 4XLTA 3OZWA 1YOVB 3O21A 3Q7TA 1L4BA 1L5KA 5J2UB 4EVSA 5JNVA 4D5GA 2E21A 3UANA 1PHRA 3EDMA 4F7WA 1O95C 3TM5A 4BQSA 3W4IA 1OVMA 3PFHA 4LCJA 1M34B 4H7FA 3W5SA 4DAOA 2HV8A 4I6EA 2WPDA 4NHEA 3O4IA 4BMYA 3CZ4A 4P93A 2QE7A 1GL6A 4UDXX 3RKRA 2JFZA 4M4SA 5IJZA 3PF9A 4PAGA 2OPHA 3WJ1A 1CDEA 4EYEA 3FZNA 4HTFB 1CC1S 5KREA 1IC6A 1QPBA 2YXPX 3FPSA 1SZJG 2PX0A 1EUCB 2O9JA 4UBIA 3N2NA 3MJCA 4FW9A 3KYIB 4HZGA 4REOA 4E21A 2YV2A 2I80A 4IO1A 4YASA 5SZJA 1ZVMA 2GPAA 3L06A 3OM1A 2WA1A 1X1DA 3K0AA 1C3LA 1FY2A 1ZITA 2EFEB 1R7RA 2XUDA 3DVLA 1QLJA 3LLVA 3RSCA 3ZVRA 3KOWA 1YJ5A 2ZREA 3Q10A 2LTAA 4DSAA 2Y9PB 2VN8A 1OHHD 4I1YA 4Z4CA 5JC8A 3W6PA 5HUQA 5B3AA 1RQPA 1YBVA 1KARA 2OO7A 4FFMA 2W43A 1RLJA 4TT3A 5F33A 4YUWA 3LOUA 3PLAE 1RKBA 3GIWA 5FF9A 1PUXA 1Y89A 3CPSA 3GDGA 1DEAA 3UV6A 1QZUA 2R3SA 1J23A 3DD1A 4ZAFA 3S2SA 2BEJA 4Q3DA 1Z0FA 1IMJA 2BI8A 1SRQA 4TMKA 5AK4A 5B58T 4GMXA 2ZVJA 3UA3A 2N47A 1VBKA 3VPHA 4OFWA 1BN7A 1L4FA 3EG9B 3HLKA 4E3WA 4ZHSA 5EQTA 3RRNA 1WZUA 1FZTA 1XZEA 1YS1X 3K9CA 5DYIA 5ERGB 5FADA 5C8DA 4LDNA 2ZJ2A 5E7MA 1W76A 2FMUA 5A4DA 2WD8A 3GAFA 1IDOA 2CBXA 1NBIA 3A3YA 3ZHOA 5JAOA 3Q5EA 4TM7A 2H4JA 2ISSD 2Y4NA 3IBYA 3IBTA 1PGNA 2V3WA 3QVWA 1S8AA 3U2QA 4IIBA 3VU3A 1EG7A 1FYFA 2O2JA 3LLCA 5IAJA 5T57A 5BQ5A 4YRZA 4YALA 1T1GA 2PJRA 4NLLA 1DU4A 1T6XA 1V7ZA 3F5DA 1F0YA 1XRNA 4YJHB 5IVHA 1GKKA 4M0DA 1KP9A 1NNI1 2EJWA 4KK4A 1TFRA 3QOFA 5HF5A 1KAEA 4AN1A 1UPCA 1IATA 1PU2A 4HQ6A 1ULHA 4LSZA 2PYDA 3H0KA 1TB4A 4JITA 3TQSA 3T0FA 3KLOA 2IP1A 4BLSA 3IEVA 3T3GA 3HKCA 1YV9A 4FEAA 3JQ9C 1DXHA 2BM9A 2WKRA 3KDAA 4OMCA 4OHZA 2O2SA 5I6DA 3DKVA 5DU2A 4LV5B 3RARA 5KYXB 1HY3A 4IEEA 3VDNB 3VPSA 4PGHA 3NP7A 1OXVA 4GKKB 4WFJA 5CCDA 1OWMA 4L76A 2ZG6A 4OAQA 3X2EA 5M04A 4IBOA 3CUVA 2C4HA 2VF2A 2XUZA 2REOA 1GRRA 4OP1A 3LG2A 5GPBA 1V8FA 1VGRA 3HFJA 4BQOA 1DPFA 1JR6A 4RYDA 2GZ1A 5FWAA 1ENOA 5B37A 3RAPR 3P9QA 1A7JA 1J4AA 4OU4A 3E81A 3FVTA 3EXIB 4UKDA 1I4DD 1EK1A 4HBZA 7ABPA 5K0BA 2QNRA 3UPTA 3HJAA 1WHTA 2QN1A 5ALXA 1UT8A 1BO6A 1C9KA 4RMGA 3RW9A 2ZPTX 1N0IA 3SYRA 1XO1A 5A5VA 1NNEA 1DDGA 2VK2A 4I4NA 3ZCVA 3KPYA 1RM5A 4DHWA 4ZVRA 2BHSA 2IXEA 5K0JA 3T3NA 3F1LA 1VHDA 1G8GA 3S5UA 2YASA 1AB6A 2EZUA 4CDGA 4MK4A 5AW0A 4V38A 2NGRA 3ZDBA 1GITA 1S4QA 1XRQA 3G88A 3KVRA 1LVHA 3SSOA 2QNBA 3KFVA 4H7IA 4NYMR 2ID4A 4UDOA 2PZBA 4YK7A 4DTIA 4D74A 2VNAA 2ZUWA 1V25A 1X9GA 2BZSA 2JK1A 3FFXA 3KAQA 3UNXA 1X14A 1LJLA 3PPWA 5K0FA 3WNZA 3KQWA 4C08A 3IXQA 1PJ4A 3NEYA 4HSGA 5JHHB 3IQHX 1AXRA 3L1HA 4JBGA 1MC4A 1NPDA 4OL9A 2MMCA 1XN1A 5FJJA 2NU9B 2C07A 4F3CA 1S3SA 4OSPA 3PGJA 2I6FA 2ZBQA 3A9SA 4MP6A 5IJXA 4I5IA 2XGOA 1BZYA 1UK6A 4Y2RA 2I2BA 2EZ4A 4IUCS 2OAQ1 3Q9NA 2HPAA 3ZW9A 3VJKA 1W34A 3EGXB 4MTCA 4L74A 3BULA 3OMLA 1W0CA 1UKVY 1LTHR 2WJHA 3K31A 4GRIA 4O8ZA 4LOLA 1BQEA 1GG8A 4XJVA 3MJRA 1UBGA 3GT3A 4ZGGA 5EJMA 1KFBB 4NBUA 1TMYA 3K2BA 2RJNA 1OD6A 2XB9A 2CXSA 3UBMA 5DIZA 4D9CA 4EH1A 1Q0ZA 3BF8A 4EMBA 3NORA 4E08A 2CVPA 3AU8A 3KYBA 4H59A 1R00A 3CUKA 1I3CA 1UKYA 3LUJA 1N7JA 2XBUA 4OOEA 4QODA 3O94A 5L45A 2XMSA 4L4RA 4BNJA 5A6SA 5H02A 5KOJA 3LM8A 1MR3F 2Q45A 3NATA 1VJDA 2J9FB 3PQ5A 1DC5A 3QXSA 4UATA 4C0SA 2C9OA 3VMMA 3GJQA 4P0TA 1LD3A 5REQB 1QRTA 1KJZA 3BRSA 4LKRA 3M6MD 1ADGA 4BP8A 3C3XA 3LL7A 1EI9A 2C20A 4JJKA 4O2RA 5DNCA 5MN4A 5DLDA 4BMNA 1UDXA 1WKBA 1F06A 1W59A 4URWR 3TKAA 3OTHA 3V34A 5LOVB 1TW2A 5BNIA 2BPOA 1H9AA 2HIMA 3RYCA 3ZBQA 3W5AA 3AF5A 1E18A 4JVLA 5TARA 1WE2A 3SC6A 1GNSA 3M0EA 4YRLA 3G02A 4M1EA 1QK4A 4G0UA 1HV8A 3BIFA 3LTNC 2Z4RA 1WO8A 1K5GA 5FA5A 2Y0CA 3HDHA 3R5FA 2GBLA 1RWOA 3TOXA 3UATA 4AF7A 3AWIA 1CQJA 1FYDA 2E18A 4MAMA 4WK4B 1NT2A 5TT1A 4UBKA 4HJXA 4MKRA 3GFRA 3HXPA 4GPEA 1FTYA 4O2AA 1JKMA 1L4HA 2O5RA 4HAVA 3ZIAA 2AN3A 1Q15A 3BWMA 2IEBA 1W2GA 1RIFA 1VBFA 4ENPA 5KJ6A 1NRJB 2C8VA 1UEJA 2FEOA 3QBDA 1FFWA 5IMBA 5JEDA 2UDPA 3L18A 3INRA 2JL1A 1YBAA 3EMKA 4H3VA 5AQEA 3TZHA 5I7FA 4NATA 4GOOD 4JV5B 1FMFA 3OEHA 2GCOB 2C29D 4CMJA 4YR7A 2C8LA 3BMCB 3MYRA 4G5RA 4IF4A 2H4ZA 3TJMA 1G1MA 4BNMA 1UR5A 3AYZB 1ODJA 1NOJA 1AZSC 4ZXPA 3EHEA 3SIRA 4JP5A 2YRWA 5DSXA 4CIBA 1C9DB 2W2LD 2LBPA 4MS4B 5DOVA 2F3SA 1SKUA 4KIGA 2QUZA 2K7ZA 4DNQA 1F1BA 2FEAA 1MHPA 1RPAA 4BE4A 1SBHA 1U5BA 2DFDA 1B16A 4O4IB 1CNMA 4AO8A 3OMXA 4OGGA 3WAKA 4DM7A 3LRPA 1NI4A 1QPGA 1WM1A 2G5PA 1WW2A 2FPMA 4N41A 1E1LA 1G6OA 4PGGA 1F8XA 4R51A 3QTLA 2J0QA 4QTXA 1TK2A 3QPBA 1DKUA 4XFJA 1J2TA 3O1JC 4N1AA 1XEXA 3IKJA 2O54A 1V6AA 2KX7A 2NO0A 3EW9A 2C82A 1PR0A 2HRRA 2CHEA 2I0FA 4L08A 4Z9YA 4A6DA 2PO7A 2YHBA 3T3OA 3E8MA 2IDKA 3PQ2A 5TPZD 4Q18A 2A59A 1CF2O 2FN7A 1SOUA 5IU6A 5IT0A 3AL2A 2XWBF 3MWEB 4YP1A 1NAIA 5JR3A 1A9TA 3TTTA 4WZ6A 5IF9A 4AY6A 1BW9A 3FRHA 3KKOA 2GPWA 4JSYA 1Z56C 4MDYA 4H4DA 4RQAA 4NBVA 2WFLB 5TNXA 1WDKA 2C4NA 5LP6F 4XW2A 4U3JB 3E18A 1WL8A 3QF4B 4IJ6A 3VDQA 3CRW1 3W9BA 4AZ0B 3R5XA 4PAQA 1AMNA 2WT8A 2Z2JA 3LUFA 5A7FA 4BNIA 1UOQA 6Q21A 4TSKA 3PUKA 3SR0A 1QYCA 1M7BA 2XLCA 1TKBA 1NXQA 5EKUA 5AM2A 4P3KA 5I7HA 4K1LA 5M7EA 1IY9A 1O97C 2AE2A 3RQSA 2WSIA 2GBCA 3QF7A 4B1FA 3PENA 3L93A 2ZQ5A 3QXGA 1W35A 1L7NA 1V1RB 1E4YA 4PHGA 4GICA 2RI0A 1KTVA 3OAAD 2BFEB 2JIQA 3GPBA 1EFUA 4JBHA 3H2GA 2XRFA 4PAWA 1E77A 4JI1B 4BVAA 1VE1A 4EAQA 5BR7A 3K6KA 3SVTA 5E1MA 3OH8A 5ECWA 2C88A 3UK7A 3ZJVA 1DEHA 2YXLA 1Z2OX 3NTRA 4QSHA 5AKEA 5FTJA 2H7XA 4EARA 1YVUA 2HWUA 4INZA 3T9FA 1U0HC 2XDYA 4GOKA 1IY0A 4FFPA 4DADA 3DLCA 1HKUA 3IQZA 3DCIA 5DNEA 3CGGA 2H1SA 1PT5A 3KHSA 2GZAA 1O6FA 2P2DA 3E9ZA 1MA3A 5LD2C 4KXXA 2C2MA 4MQEB 1W88B 3EA0A 1KVTA 2QRUA 2BR3A 2RDMA 4YJ2B 2N3ZA 3RIXA 3A58B 1WZ2A 3CH5A 2F2TA 1Q7GA 4GOMD 3UMBA 3W2TA 2WIBA 1K27A 1LH0A 4UU7A 2QRPA 1OOEA 3BGOS 4OMFG 1GA4A 3QBTA 1A1SA 4OSOA 4ND2A 2E4WA 5T8KC 4B35A 4S2UA 3IUSA 1YQTA 4P3OA 2ZYSA 1UWLA 2YXDA 4MGIR 3QKIA 2PMFA 1W1WA 3E35A 3JAWB 3GRCA 4GMFA 4FXPA 3K8QA 3K32A 4R0MA 2GBFA 4PRZA 1YU6A 5J3JA 2HT6A 2CJYA 1EXNA 1NXOA 2H18A 2AQ8A 4IIVA 1M7HA 1W46A 3KKQA 5DM0A 1HNWB 2FPUA 4YT8A 5K6AC 4CGZA 1ZGBA 3V32A 3DFZA 2N42A 3D3JA 4DLUA 3AEQB 1V7QA 4L9RA 3IKLA 4UD2A 2PQ6A 4NNOA 3SZGA 3H1EA 2QTVA 1JHRA 3JR3A 3ICEA 2OXEA 5ALVA 4OLBA 1NKVA 5TMPA 4JD5A 2VYNA 1RHKA 2R48A 2WJZB 3FPKA 3MINB 3N58A 3AIMA 3NGXA 1CRQA 1FUYB 2VHXA 3V2UA 3CEMA 2M98A 1U1EA 3KIPA 2PV7A 2G6TA 4OG2A 4UAGA 5FQNA 2DUJA 4HTAA 5HKAA 2VIIA 3UKJA 3HN7A 4DLBA 3OZRA 3CVWA 4YH1A 4CEJB 3AHEA 3KX2A 1V9CA 4I4TF 2FEKA 3EQ8A 2PKWA 4OSEA 1TM7E 4B9EA 1XZ8A 4X1KB 4BCBA 4EB8A 3EUFA 5EAIA 1PGJA 2GWHA 3HO1A 3BB3A 1X7HA 1ODCA 4I9UA 4OREX 2Y68A 1Q1BA 2Y67A 5DHQA 4QAJA 2A5GA 1HI9A 1NSFA 1ZX1A 3CV3A 4G85A 3TKYA 2BH2A 1DO8A 3HTXA 1FXSA 4K6KA 3EIXA 2GSWA 3LBIA 3M81A 3IQFA 2G82A 3QVUA 4R2WA 1SQFA 4ZZ3A 4XDYA 4RIIA 1BCRA 4DQ0A 2NM0A 2C7PA 1AKRA 1H4SA 5C8VA 2G83A 3JSAA 2G88A 2J87A 4ZWNA 2XGMA 1QC5B 3U60B 3L6EA 3AZQA 3L0IB 5BR1A 4LCBA 4FS8A 4IIDA 4I4IA 4RCZA 3V4LA 2G80A 1SQ6A 1I10A 1EFVA 3BMNA 4FB4A 1DUVG 1G8JA 1JVBA 5CTAA 3F4KA 4D0GA 1L1FA 5ALKA 5FOVA 4QARA 4X1OA 3PHGA 4ZCLA 3LX4A 5PNTA 1SOMA 3WNDA 4D9GA 3BE4A 2AUTA 3V8RA 1QH0A 2QTMA 2OBXA 1T0UA 1A4UA 5CJ2A 1XZFA 2JGNA 3C3MA 5IXJA 5JC1A 5A4IS 1EFHA 2PMDA 4ARAA 5BSRA 5I7AA 1JFTA 1QIEA 5KTTA 2JLAA 1RP1A 1C7RA 4AWXA 3OM0A 1G2OA 1ATIA 2DPLA 3AM3A 3TVDA 4RA6A 4CG3A 4KH0A 1VSUA 2C77A 3AEYA 1LCIA 4BDTA 4FYVA 3QE4A 2CWDA 4IZOA 2AQIA 1CEQA 4YWHA 3WZMA 1UFOA 2Z8ZA 5MFPA 3A1CA 4CT5A 2ZB8A 1BWSA 2VHJA 3O2JA 2Z9DA 5TMBA 4CKWA 3BDVA 2MT9A 4L15A 4OK5A 2EW8A 4AIRA 4H9GA 5HZGA 1HRDA 1I4OA 4CL0A 1UMDB 3M5DA 2UUBB 1KWGA 3R5TA 2I8AA 2ZRJA 3ND7A 1T2AA 5FBQB 1ZNXA 4JEHA 3CINA 4TTRA 5TMDA 5KTOA 1YVEI 4BO6A 4GI3A 4CNBA 1NUSA 1FFSA 3B20A 4N6OA 1DRUA 2ZEJA 2LVBA 3SI7A 1OIVA 2AOVA 2ISQA 3UG7A 4EYGA 4KO4S 1P5RA 3QX9A 5JWHA 1P9WA 5H5JA 3UWOA 2R8BA 3D3EA 3VH4A 5I9MA 4ZRMA 4CHGA 4E7OA 3HYCA 5EIWA 5ELLA 1B1AA 4ZA2A 5DN9A 3K6RA 2ECQA 3M5WA 1AGXA 4J2TA 1KMHB 2JJQA 4QBIA 2GEKA 3JRXA 1N8TA 1CQPA 4IV0A 2I62A 1C8KA 4MB0A 3OQPA 3MB5A 3QPAA 1NP6A 1OAAA 3IJEB 4BPRA 4J3JA 3PQ4A 3WGGA 1DGQA 3IHWA 3KZOA 2EJTA 3G5LA 5CFQA 4QDXA 4YJDA 3UJ3X 1II9A 2YFKA 1E2BA 1T1IA 4LJ4A 5B6JA 1RQGA 4DRYA 1U6JA 3ETJA 4IDCA 1SULA 4YRIA 3HJCA 2GUGA 1WSAA 1BWPA 2V6BA 2VJKA 2V5UA 4CN9A 2YYSA 2BMDA 4G1FA 3A2NA 2JIPA 4XB6B 3TKLA 5SYMA 2Q3MA 3L82B 2IPAB 1OXXK 2C78A 3NRJA 1TUIA 3SQOA 3K96A 2ODTX 4Q3AA 3TD2A 5FUQA 4MQ6A 2NVOA 4RGBA 4NTZA 2ATVA 2FLVA 1YI1A 2XDQA 3EZYA 3KQVA 4R0NA 4EBBA 1E3LA 1P5JA 4DLRA 4B3GA 1JWBB 3DTTA 1ADCA 2NW6A 3UWPA 1N0VC 3AHCA 2AT1A 3KEFA 3AEXA 4F5YA 1XF9A 2NSDA 1W4BA 2WINI 3A1VA 3GP3A 3MPOA 4P33A 4BBAA 4MW4A 3L7IA 1C7EA 1XQ9A 4JAVC 4UVGA 4CPDA 2PVSA 3BIXA 3MUNA 2C42A 5FBLB 1GFIA 2Q1WA 3QSYA 4L2IA 3M4XA 4XX0B 2O8BA 2BEWA 5K0CA 3CHYA 1EGVB 1LBQA 5JJKA 2P79A 3ACCA 1P2UA 1C1YA 3CTPA 1U9YA 1SKYE 4QUIA 4BO8A 2DFVA 1TU4A 1B8VA 1UM9A 1U7PA 3ESRA 4LV8B 1EFPB 5EINA 5AJUA 5EQJB 1MEEA 1Y0BA 3A1FA 3I2IA 4BEWA 1TLTA 2DTDA 3L1IA 2WK1A 4KQ1A 3R9IA 3F0TA 4HJRA 1CY8A 1O7JA 4M0KA 1JEJA 2NG1A 3ZKAA 3B3GA 1P81A 1QHHB 2DG2A 3ZEAA 2VHUA 3H6KA 4AB1A 2NV6A 1YFKA 2ZSUA 1WR8A 3WLAA 3FNIA 5LLSA 4MO9A 1RXIA 4GI2A 3TEJA 3VRHA 4BJ3A 2ZI5A 3H1FA 4GBGA 2JZOA 4D9MA 1T4DA 4FMDF 2AVDA 4NZ9A 4E3ZA 4C2TA 4UUQA 3OX2A 5IRCD 1JFFB 1KH3A 1YR2A 2FP4B 4M1ZA 4QEDA 5JTTA 4ENTA 4FHCA 5ITWA 5U9CA 2NO7A 2NU7A 2AC2A 3LWBA 1JI3A 1JQLB 2R6R1 3Q7IA 4CIVA 4E0BA 4JENA 4WVFA 2A30A 4K05A 4GKVA 1L7QA 3A31A 3WWPA 4EF6A 4RQTA 3ZV5A 5HQ3A 4BNDB 2RC5A 3WGYA 4JB0A 4JJIA 4N0MA 5DGHA 3KR2A 4G81A 3B8EA 3FSEA 4N0QA 2XCLA 4DPLA 3FNEA 3FY4A 1RNLA 2I2WA 2LPMA 2P27A 3IUMA 1NVFA 4XD7D 3ZTWA 4FM9A 1QQ5A 1JRLA 2HJRA 3OJOA 2QVLA 3ZDRA 2DTXA 3I1JA 2PRKA 1MVOA 1YSCA 5U4QA 1ULBA 1KRWA 4QYSA 1TD9A 3EC7A 2OBMA 3MJHA 5LQMA 3GYBA 4WESB 4QXOA 4YAFA 2OYRA 2QXUA 2HIAA 3ANSA 3C7AA 3TZLA 4HRAA 5F1PA 1I36A 2ODBA 1T8UA 2RGWA 3DKRA 1ONNA 2C96A 3JVDA 1ESZA 3IUYA 2C4UA 4H3HB 1XK7A