2ONZA

Structure of k57a hpnmt with inhibitor 7-(n-4-chlorophenylaminosulfonyl)-thiq and adohcy
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWALRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enzyme Adaptation to Inhibitor Binding: A Cryptic Binding Site in Phenylethanolamine N-Methyltransferase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
total genus 92
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2onzA00
4DKJA 3CJTA 1KPGA 2QYOA 2JH8A 1G55A 4EMSA 4LG1A 3Q87B 4BLWA 2OZVA 2O57A 2AVDA 4PGGA 3GO4A 4RVDA 5E8JA 3SR4A 4EK9A 5EMLA 3P9NA 2R6ZA 4KW7A 3FZGA 4RYLA 2BR3A 4ER5A 3IV6A 5CVVA 3HVIA 4QDJA 5EHIA 2ZFUA 1JQEA 2IGTA 2AOXA 2AN4A 2OPBA 3R24A 4V0RA 1L3IA 5G02A 1QAOA 3HCEA 4LECA 4RV9A 5C1IA 4C4AA 3OZRA 5DT2A 2FPOA 1TW3A 1SUIA 3R0QA 1MJFA 1P39A 2ZZKA 2P41A 1JR4A 4FP9A 5K09A 3MQ2A 4KIGA 1JQ3A 1P1CA 2WK1A 3GNLA 3OU7A 5DPMA 5FULA 1X1AA 4FS8A 3OZTA 3MCZA 5CVJA 3EVGA 3M33A 2P7HA 1G60A 2ERCA 3FRHA 2YQZA 3P2IA 3RW9A 3OFKA 4C08A 3G8AA 4OQDA 4EVIA 5BXYA 4NECA 2WA2A 4FT2A 2AOWA 1BOOA 5CIYA 3ERCA 4RVGA 10MHA 1ORHA 2FYTA 4ER7A 5EHGA 2PXAA 1UFKA 2PJDA 3EGEA 3LHDA 4MWZA 4PYLA 4KRGA 5E1BA 4DCGA 2XVMA 5EIFA 1KYZA 2G72A 4LWOA 4XCXA 3AWIA 4DF3A 5EEGA 2C7PA 1Q0TA 4WXHA 2O05A 2PGXA 2QE6A 3TRKA 3M70A 5K0GA 3NMUF 4RTNA 4Y2HA 1FP1D 1XCLA 2YUIA 3SX0A 3TR6A 5K0BA 3FUUA 1M6YA 2P3LA 3MAGA 3R9XB 4YUXA 1XVAA 2NNWB 4EQZA 2B25A 1XDZA 2P3OA 3KPYA 1UWVA 3HNRA 4OA5A 2QM3A 5P8WA 1NV8A 1HNNA 1XJ5A 2JH9A 1VPTA 3P97A 4AZSA 2ZVJA 2XYQA 3ME5A 3I64A 4RVHA 4HG2A 2QY6A 2H1RA 2PBFA 4YUVA 1L3BA 2AS0A 3OCJA 2VDVE 2ZBQA 3ANXA 1VIDA 5DM0A 3B89A 2C7QA 3NW9A 2G8NA 5K0JA 4F86A 5IKMA 1M0EA 5FWDA 3I5UA 3TMAA 1N7IA 4RTQA 3F4KA 1YF3A 4X60A 5FA8A 3DLIA 1G38A 1RI5A 3FPGA 1VE3A 4R8RA 1VP3A 3V8VA 3G88A 3LPMA 3A7DA 2FK7A 4FSXA 4CWAA 1JG3A 3P2EA 5KQRA 5EKXA 3FUVA 3FUTA 4R05A 2PX5A 5EGSA 2IPXA 4P7FA 3HA5A 5DM1A 1D2CA 1R8YA 5JR3A 3B7PA 3UJ9A 3KR0A 3UWPA 3DH0A 3DXXA 2Q41A 3A7EA 5M5BA 2IDJA 4P7GA 1NBIA 4PONA 3LDGA 2DPMA 4QQNA 3UA3A 3C3YA 3T7RA 3SXJA 3O31A 2B2CA 4RTLA 5DTMA 2PT6A 2JG3A 2NXJA 5FCDA 2VS1A 3BWYA 2PXCA 3H2BA 1XDSA 3KPJA 5DM4A 5EVJA 5F2KA 2NXCA 2ONYA 3FYCA 7MHTA 3P9KA 5HZMA 4DM3A 2HNKA 3DOUA 3NVMB 4CTKA 3DR5A 2AN5A 2ZSUA 3FPFA 3UJDA 2PX8A 3TQSA 1VBFA 3TFWA 3DXZA 2UYCA 4UOEA 3U81A 1G8SA 3UJ8A 4PCLA 2GPYA 3HA7A 2QRVA 3BWMA 1AV6A 3GDHA 1BHJA 2YXEA 1N2XA 1RJDA 2CMHA 2JJQA 3BGVA 3SSOA 3UZUA 3EVFA 2JHAA 2HR1A 2HWKA 3NJRA 2OYRA 3THRA 2NP6A 3JWGA 4YUZA 1MHTA 4PYKA 3FTEA 1BKYA 5E1OA 4CXMA 2P40A 1EAMA 5CD1A 4MIKA 3UJCA 5LQNA 3E8SA 2ZZNA 1JSZA 4A6EA 3ER8A 1KR5A 3R3HA 3P71T 4GOND 2NXNA 4FZVA 3UJ7A 2IBSA 2IH4A 2Z6AA 3KQSA 5DSXA 3UJBA 1FP2A 1XCJA 1RI3A 2BZGA 2HMYB 2PXXA 4E2ZA 3OU6A 4CKBA 3FUWA 5EIWA 2ZIEA 5E2BA 5FQOA 3MCTA 2BM8A 1R18A 2CMGA 3VSEA 4FSDA 3MHTA 3CGGA 3NDIA 3HVJA 1X19A 4F84A 3MTIA 5C0OE 5B1SA 5LQJA 1ZKDA 1VP9A 2A14A 4Y30A 2AOTB 2UYHA 3TOSA 3LCCA 5ICFA 1P91A 4V0QA 1HMYA 1JQDA 5MHTA 5EZQA 3A25A 4KWCA 3DP7A 1SQFA 3K0BA 5BP7A 1YFJA 3LDUA 1R74A 5BW5A 3G2OA 3S68A 4YV1A 4IV0A 2EJUA 2OB1A 5ICGA 2O07A 3JWIA 4E31A 1R6AA 5T67A 4U7PB 3HEMA 1DUSA 3LSTA 1VQ1A 1RI2A 5FA5A 3T7TA 4OQEA 3T7SA 2ZIGA 4E2XA 5ICEA 5K01A 2EFJA 3TKYA 2ZLBA 3P8ZA 3ELYA 1Y8CA 2YR0A 2FK8A 4HC4A 3SM3A 4YV0A 2UYQA 3PT9A 2ADMA 3EVDA 3KHKA 4P7KA 1SQGA 4PYOA 3RODA 3M6VA 4RTMA 3CKKA 3DLCA 3PX3A 1IXKA 2AN3A 4QVKA 1EJ0A 2HV9A 2G71A 5ICCA 5FHRA 4RTRA 4PYJA 3ER9A 2IDKA 4PCAA 3E05A 4ISCA 2BR5A 2ONZA 3GRUA 2N47A 3B3JA 2XYRA 3D2LA 3I58A 3KPWA 3LCUA 3QOWA 1QYRA 3DULA 1NW5A 1EJ6A 4FT4A 4C05A 4RVFA 4C07A 4DMGA 1G8AA 1VLMA 3CJQA 2O06A 4GOLD 2IH5A 4RTJA 1RJGA 1F38A 1EIZA 3ELWA 4DA4A 3UBTA 5GP1A 4MTLA 2PKWA 3G89A 3FPJA 3PX2A 4PWYA 1ZHFA 5U4XA 1ZGJA 3UA4A 2YXLA 3MB5A 4M38A 5EMKA 2DULA 2AOUB 5E9WA 5KVAA 1FJXA 3PFHA 5HIJA 1AF7A 3OE5A 3FYDA 1KPIA 3BWCA 5EZSA 3NWBA 3KQWA 5HILA 4MHTA 5E1DA 3HCDA 4POOA 2IIPA 3B5IA 2CWWA 4U7TB 5F2NA 2AOTA 3LKDA 3O7WA 5CVUA 5EC8A 1X1DA 1G6Q1 1M6EX 1D2HA 3GWZA 4GUAA 3QV2A 4AUKA 4E33A 4RTKA 2ZZMA 3BT7A 1JSXA 3EVZA 4PNEA 5EMJA 2VDWA 1RJEA 3BXOA 3UFBA 4R8SA 2PV0A 4RTSA 4A6DA 1B42A 4YV2A 2E5WA 3QOXA 4ER3A 3LDFA 3L8DA 4M7RA 1IY9A 1NV9A 1X1CA 5GM1A 2PLWA 2VP3A 4RTPA 2FRXA 2H00A 3SVZA 3C6KA 3HCFA 5FQNA 2Z6QA 4HGYA 3KR9A 3KQOA 5CVDA 1R8XA 5EOVA 4EKGA 3FTCA 5JUWA 5IH3A 2P7IA 1P1BA 3DTNA 4RTOA 2C7OA 2UYOA 2FHPA 2P3QA 3BUSA 1NW8A 3FPEA 1JG4A 2FCAA 5E1MA 5LQRA 4X1OA 1QZZA 1NKVA 3VC2A 2K4MA 3HTXA 1WG8A 3ELUA 4G56A 3LKZA 1EQAA 2ZTHA 4QVGA 3R6TA 1WZNA 1H1DA 2O0LA 3EVCA 3KR1A 3G2PA 5DTQA 3HP7A 3OU2A 2PVCA 1ZGAA 1NW7A 5HFJA 3C0KA 2ZULA 4EKIA 5KQSA 2BH2A 5D1NA 5DX8A 3KPUA 3LBYA 2EX4A 5E2AA 3FRIA 4M36A 2PWYA 5DXJA 4PGHA 2ZBRA 4RSRA 3PS9A 3I9FA 2ZWAA 1YZHA 3EVEA 1JTFA 2PSSA 2VZ9A 1RI1A 1O9GA 5EPEA 3RIEA 4DQ0A 4ER0A 3SSNA 5K0EA 1D2GA 5DXAA 4ATNA 3G8BA 2ZBPA 1JTEA 3HM2A 3ORHA 4OBXA 5BW4A 1ORIA 5FWAA 1OR8A 2GLUA 3EEYA 1Z3CA 3CVOA 3G7UA 3FPHA 3GRRA 3M6UA 5GOZA 5FTWA 1NW3A 3CBGA 3EGVA 5K0FA 3X0DA 2AVNA 4PYMA 2AOVA 4QTUB 3G5TA 4E2YA 2B9EA 2CL5A 3BKWA 3GRZA 4DCMA 5E8RA 4MQ4A 3C3PA 3KQVA 1TPYA 4L7VA 5GIOE 4RWZA 1EG2A 2EJTA 3KKZA 2AZTA 1O54A 3NTVA 3BZBA 3MGGA 3BWBA 1UIRA 3EPPA 4FR0A 5FHQA 3K6RA 4Z2YA 3VC1A 4YMGA 1R00A 3JWHA 2IFTA 2GS9A 4QPNA 5FADA 5CUQA 4KDCA 2CKDA 5EMMA 3REOA 2C7RA 3JWJA 3E23A 3IYLW 5DLYA 4BP1A 2H11A 4P7JA 5GM2A 5GIPE 1KIAA 3WSTA 3O4FA 5EEHA 2OXTA 1VL5A 2NYUA 3HCCA 3AXTA 5HIKA 1DCTA 3M4XA 3GXOA 2BR4A 2ORED 3M6XA 3EEOA 3GIWA 4HSGA 2IBTA 5DRTA 3B3GA 1SG9A 4E70A 2P35A 3LCVB 4O29A 4F85A 3A27A 3KQQA 1YB2A 1SUSA 5K03A 4XUDA 3SMQA 1I1NA 3LBFA 3PFGA 5T6BA 1QAQA 3EVBA 3KU1A 2ZWVA 1NW6A 5E9JA 4GOMD 5LR6A 2YTZA 2OKCA 1PJZA 4GQBA 4E2WA 2G70A 1N7JA 5D1HA 5HOQA 2Y1XA 3IEIA 2OY0A 2PX2A 2KW5A 5HIIA 3A4TA 4FGZA 2XBMA 1YFLA 1KPHA 1FBNA 4X61A 2IH2A 2I9KA 2PWPA 4IWNA 5CM2Z 1YZ3A 3BGDA 3T0IA 5K8VA 2PY6A 1O9HA 3HCBA 3UJAA 2I62A 3LL7A 4IV8A 4BP3A 2YVLA 2ZIFA 1NE2A 3OPNA 1AQJA 3P2KA 3A26A 2QRVB 4JXJA 3EMDA 4QQKA 3HCAA 5T64A 2BM9A 1BC5A 2PT9A 3THSA 8MHTA 3DMFA 3SSMA 1XDUA 1L9KA 4OA8A 3ELDA 1NBHA 3GCZA 5DTRA 5HEKA 3HA3A 3DMHA 3HVHA 3ID6C 3OE4A 4OBWA 5E9QA 3NWEA 3GGDA 1XTPA 4QTTB 2Z6UA 2OBFA 1NT2A 3P9IA 2XVAA 2OO3A 3FTDA 3FUXA 3SGLA 5KYGA 2B3TA 4BLUA 1X1BA 5DX1A 1QAMA 4P58A 5LQUA 2V74B 2PX4A 3BGIA 2EG5A 3EMBA 3EVAA 3I53A 2AOUA 3DMGA 1IM8A 4WVLA 2V7EA 4YMHA 5C9ZA 2ZCJA 1RI4A 1F3LA 3TM4A 2LD4A 2Y1WA 3LECA 3P9CA 4HTFB 3E7PA 2R3SA 5LQAA 5K05A 3KPVA 4OX9Y 1SVUA 1RJFA 2OB2A 4IKPA 2YXDA 4PIMA 1JG2A 5DRYA 2GH1A 2HTEA 3IHTA 2AR0A 3KQTA 4YUYA 5H02A 5EQJB 3DXYA 4C03A 4ZTBA 2GB4A 3GRYA 4AZTA 4HRAA 1FPQA 3HVKA 4R6XA 3B3FA 3C6MA 4KVZA 2ZW9A 5DWQA 4GC5A 4X41A 1JG1A 5EG5A 3GU3A 3V97A 3VYWA 1KYWA 1U2ZA 1XXLA 4QDKA 2GA9A 4C06A 1ZG3A 2P1DA 3DUWA 4M37A 5K0CA 3AY0A 1PRYA 1INLA 3PB3A 3TKAA 9MHTA 2F8LA 3G2QA 1ZQ9A 1WXWA 3CC8A 1I9GA 2JHCA 3KQPA 4HH4A 4PYIA 5HIMA 1I4WA 5CCXA 3NVKI 2UZ4A 1L3CA 5K0NA 1TW2A 3TM5A 3NDJA 3BKXA 5K0LA 3OFJA 4K6MA 1Q0SA 1T43A 3KR2A 3CJRA 3G5LA 4HGZA 3KQMA 2WA1A 3MTEA 1WS6A 1WXXA 3UJ6A 5GINE 2JHPA 5DX0A 5F2OA 5DSTA 4XUCA 3OZSA 4BY9E 3G2MA 5CCBA 2NP7A 4PYNA 4AX8A 4CTJA 4QPPA 4PYQA 2NXEA 3EGIA 1AQIA 4GOOD 4H0NA 4PINA 1SKMA 2VDUE 4DZRA 5GWXA 1DL5A 4RX1A 2YX1A 3GJYA 1QANA 2ESRA 4GBED 4HTFA 5EKUA 4E30A 4ER6A 3LGAA 4CKEA 3AXSA 4GF5A 4X63A 2B78A 4LWPA 3TLJA 2I7CA 3TPZA 4AZVA 4YUWA 1L1EA 5ERGB 2XYVA 1YUBA 2P8JA 4GEKA 3CCFA 4KDRA 3FTFA 4C04A 3AJDA 3LX6A 4E32A 1KP9A 1KHHA 4PIPA 5FUBA 5DM2A 3PLAE 1V39A 1WY7A 3GRVA 4B17A 3M6WA 4BLVA 3PVCA 5LQKA 3PTAA 5CVEA 4XUEA 1KXZA 5KS2A 2GAFA 5LQCA 3KQYA 2G1PA 4GC9A 3Q7EA 4KIFA 4AZWA 4R6WA 5LSAA 4CKCA 2I6GA 3MERA 2IP2A
chains in the Genus database with same CATH superfamily
4BDTA 1GZHB 2ON6A 3FYHA 3G9TA 1SVOA 1GL6A 3GIDA 3Q7TA 2GNPA 4NAHA 4P4SA 3PHLA 4GX2A 4A2WA 4F9TA 4UCFA 1EUQA 4QUGA 4GM0A 4AJEA 3DE3X 4QOIA 2YHBA 1V4VA 4B83A 1RHQA 2VPQA 1NFRA 4CODB 3HVIA 1UKCA 3G2IA 2VRWA 3C7DB 1WBJB 1P2UA 1DC8A 3ZVRA 4IIUA 5LOVB 1SB8A 2OE2A 2BKEA 1QHEA 1XWFA 1OHHD 1Z0KA 1JE0A 1OC2A 4RHCA 1TJ5A 4E5MA 1RKQA 3OHMA 2I3AA 2WNHA 3WYEA 5AHKA 3W8FA 4OPMA 5CFRA 3NCTA 2ZM5A 4KOEC 4BQFA 1UBHS 4PC2A 2FZGA 1OV6A 2CLSA 4S2UA 1F9EA 3DFMA 4PHFA 1ZUNA 2NT4A 3A3PA 3G8AA 3DOOA 3DZBA 5CGZA 1BTOA 1M33A 2AEMA 2ZRIA 4TTIA 4YACA 3SIPA 2IYXA 4NLLA 5CIYA 2C2WA 10MHA 5HCUA 2WFZA 3EGEA 4KAAA 1MKYA 1LW6E 2O2EA 1SHJA 4HDRA 4L2IB 3UH1A 1K4MA 3WLAA 1GY8A 4JHLA 1C80A 1AN0A 3I8SA 4F1WA 1D04A 3TQCA 4P86A 5K0SA 4H18A 4MRMB 1FS6A 1JT2A 2J48A 1LB1B 2PCJA 4EB3A 1UBFA 1UZNA 2YW9A 3LY8A 4R9NA 4HGRA 4LF7B 3GY0A 1W5BA 1SCQA 3DHVA 2OGZA 1GARA 2CSXA 3TRJA 2CJXA 1QR6A 1Z4MA 1MC4A 4YTEA 3WMGA 2QN1A 1N2CE 1EVLA 3H11B 4UCWA 1HNNA 1U7ZA 2YMPA 3ANLA 4N0MA 1DSSG 4ZOAA 3G0HA 5BN1A 1WB5A 4RCVA 5JJ5A 4ACAA 2XODA 1ISPA 2W6JD 3CT6A 4MR9A 2BGNA 2ZIVB 3AVOA 3MN1A 5DF1A 2WUVA 4UZSA 5A6SA 3QWAA 1GA1A 2DF8A 3BD7A 3VOBA 1E9DA 3INRA 3TMAA 4QUBA 3QU7A 1C1YA 2AA3A 2EXXA 4FQ8A 4HB3A 3E2PA 5EHZA 4PPGA 4KR7A 1UOQA 1JDVA 1P1RA 1ZGCA 1BA3A 4CV0A 3GLHB 3QVMA 3NM4A 2P2NA 1PYDA 4CVNA 1USUA 3RS4A 3T7DA 4LFBB 3P2EA 5EKXA 4RACA 1IZZA 1V9SA 1O2DA 2VUHB 2HHLA 1SOMA 3A1TA 4Q15A 4QICA 3QW2A 2V6MA 1PL0A 5DM1A 3W3AD 3HUDA 3R6GA 3HL0A 3NORA 4WKNA 1SC9A 2GPWA 1MIOB 1NDQA 3GJ5A 4JMPA 1QO7A 3M89A 5TSDA 3SE0A 2VNAA 1KU0A 2VYCA 4GT1A 5YASA 1O7JA 2ZRQA 4RPCA 2BTQA 2RDMA 4J1TC 3ORRA 3PU6A 3ZE2B 2JZNA 1JTVA 4PX2A 4GMDA 2QX6A 4N40A 2WWWA 3USES 1UP6A 3WLNA 2B5OA 3U4QA 2EKDA 4M8NE 5LYJB 4JHXA 1R64A 2QQGA 4UUOA 2ZT5A 7MHTA 3P9KA 2A6PA 2Z30A 1L2TA 1G98A 5LQDA 3UJDA 4TTAA 1MD9A 4DRXA 2CCKA 4XVUA 2OHHA 4HATA 4KQWA 4RJLA 5HQJA 3U3XA 1GSOA 2F17A 2MSNA 3NHWA 2RHOA 3OZ7A 4I9FA 2RHDA 2J7PA 4KQ2A 4JIMA 4B40A 2HK9A 2P0EA 3BJZA 1QYDA 4DMKA 4Q24A 1DUIA 1O94D 1ODJA 4FMDF 5G0VA 4NBTA 4KXXA 3IVMA 1GFWA 4LBWA 3M7IA 4OFBA 4R2XA 1SBHA 2OCPA 4NY1A 5D8DA 2J0QA 3VPBA 5K8LA 3LX8A 1AMOA 1E63A 3QTBA 3QEKA 3UJCA 4DREA 1JWLA 2LXNA 2Q28A 3F96A 3KETA 3RIHA 3UUEA 1FFBA 4A6EA 3H84A 2QBYA 1KR5A 2IBSA 3BREA 3UJ7A 4N48A 2BAGA 3B51X 2AX4A 2FG7C 4RK6A 2X0EA 3UJBA 1FP2A 2HMYB 4K9QA 1G4AE 4F46A 3IP7A 3I5AA 3L6RA 4KK3A 4U00A 5JNWA 5JY6A 1KVSA 2Q9UA 3CWCA 5PGMA 3OQIB 4YRKA 3P94A 3IEKA 5BSHA 3G0OA 3F5MA 4OMFG 4RFVA 1SVNA 3DD1A 2VUSA 1TEVA 5T3UA 3TQRA 4QTZA 3L93A 2ETXA 3H18A 5IMSA 4Q6WA 3UWKA 3FNQA 4E7OA 5F7JA 3MRXA 3GLVA 2O7RA 1FRFS 4BLTA 4C3OB 2QKYA 1VG9B 2JFGA 3RV3A 3FJYA 3O1JC 3NWPA 2IHNA 2ZRAA 1AZSC 1Y8AA 1PJ4A 2QZ9A 3DJFA 5TE9A 4KWHA 3UB2A 3OPVA 2HNBA 4PPQA 1DCKA 1KEUA 4B81A 4ZTZB 4V24A 3MRTA 3COYA 1VQ1A 2ZJ8A 4J0DA 2XDYA 1RE1A 2ZK7A 2BKLA 4DXHA 3VH4A 2HLPA 3PZRA 2C2XA 1CJTC 2VXCA 3CEHA 5HZHA 1KDTA 4R2KA 1XTQA 5E7IA 1P7ZA 2JVJA 4RKWA 4NULA 4NYJQ 2WWYA 4YCCA 4E08A 3NWJA 1R4NA 2D0PB 3DLCA 2EX1A 2PYZA 3RUDA 5HG0A 2IDKA 1ZAYA 5ALOA 2IQIA 1TYEB 1PGOA 2BR5A 2A8YA 4FT2A 4QUAA 1SQSA 5JNLA 1X3LA 9ATCA 3QU5A 4HYQA 4KPEC 1QKKA 1TECE 1Z34A 4IQ0A 4LQLA 1H5UA 4PV7A 3PD0A 3OD1A 4PAOA 4IMRA 4Q12A 4RZQA 3D3QA 4WLVA 2GAIA 3ETCA 2WWVD 2GILA 3F90A 3ZDRA 1E2GA 1TVKA 5GP1A 2VWQA 1HE5A 2GTHA 4BDSA 3C3WA 1A9QA 5JT1A 1P4SA 1ZEMA 2RHMA 1VHLA 2Y8EA 4JEIA 5B4VA 2Z5FA 3VO2A 4JLVA 5PNTA 3OCCA 1L7MA 2IF2A 3BEOA 4FEGA 4GWKA 2VZ0A 2YIJA 2FA9A 2VHZA 4R8KA 1VLJA 4W8GA 1E3EA 1WUTA 2FEAA 3KYDA 5C1OA 1YT5A 3JRWA 1DCFA 4TQ9A 2ZRGA 4PZ0A 5LB2A 1DRKA 2CWWA 1XZMA 1W8IA 3FCYA 1HQDA 1OBHA 4B7ZA 3GB9A 4D57A 4OBBA 3VMMA 3SC3A 1BXGB 2JFUA 4LA4A 3W6NA 4X7PA 3OMWA 4KXMA 3D4NA 3FKJA 2QHXA 1AQNA 4AWBA 2H2WA 4TOIA 3U4MA 3P1JA 4HX5A 4PLCA 4R8LA 4R5MA 1NV9A 4G09A 4E5KA 1KQNA 4CFYA 1LTHR 1BCSA 2BISA 5ED0A 4H1WA 1HDXA 2IYLD 3A0RB 3KR9A 2ZYDA 1R15A 5C8YA 1GN9A 3GPLA 2WFAA 3DPUA 5L3SB 3RQIA 1YGYA 2NU9A 1M6VB 4DPKA 3D8TA 3UWMA 2WIGA 1NW8A 3EXHB 3W78A 3BQMB 3P9ZA 4HLCA 4DJTA 2AHRA 3N86A 4F60A 1XYYA 1WKVA 2JFBA 5M29A 2FN3A 4CUZA 3V6LA 3KKNA 3VHRA 1Q83A 3M3DA 3QVVA 5K0TA 2ZS7A 2PYDA 2PVCA 4JLBA 1LGYA 5LZ7A 1MX9A 4PE5B 1HSOA 1P2FA 2NN3C 2ZBVA 4UM5A 3K1AA 3LT5A 4MQMA 3JR7A 3HHEA 5L95A 2IS2A 3AFOA 2YS6A 2ZE8A 5AVKA 2HFKA 2YJ3A 4OOFA 1IQ0A 2QRJA 4PGHA 2W2MA 1SUFA 3AESB 3FI0A 3JYQA 2FN7A 1JTFA 3H5OA 4M9ZA 5KOHA 1HRDA 4NCKA 1TLLA 2JNWA 2OM6A 5EL0A 1RQXA 3EGXA 3QPVA 1R27A 3UAOA 3UAXA 1M34B 4XWYA 1YZTA 3FX2A 1S7CA 3OMLA 1QS0A 1C1DB 1JTEA 4U7WA 4WACA 1Y80A 1R6DA 2NU7B 4WI1A 4YRQA 5DYIA 3UHJA 5FWAA 1ICIA 3DC7A 3PPXA 4FWTA 2Q4DA 4N6GA 4QHYA 3BG5A 1VHQA 1VE5A 2BKAA 3JD2A 3WWDA 5IEBA 4LE0A 3PRKE 5ESRA 2PS1A 4LXTA 3WWZA 2IEYA 4FC7A 4EVSA 3VGPA 4B3FX 1RMYA 3KZNA 4D9JA 1FLNA 3O38A 4OUDA 4UM7A 3OVMA 4F7WA 3HN7A 1E89A 1K1EA 4CM9D 1N7HA 4B2LA 8LDHA 3BKWA 1J1ZA 3NHZA 3V1LA 4B87A 4BEBA 5CIQA 3IMEA 2EKQA 3MJEA 1R16A 4AL4A 1V71A 4TXNA 1QIHA 4N5MA 5D3ZA 5AO9A 1MO5A 3WL8A 1XTIA 3B53X 2CHQA 2PH1A 3S1AB 3SVLA 2VPPA 3JWHA 4LQ4A 5CUQA 4JKIA 2HX1A 3D7LA 4MR8A 1U5CA 1F17A 3JWJA 2C7RA 1P73A 3WWYA 4JITA 1XROA 2XKKA 2FOXA 2NYRA 3L4EA 2WZBA 3LLVA 3N0WA 3IBFA 3RFTA 5B7GA 3BIXA 2QR5A 4Y1EA 3EQ6A 3K5HA 3GBSA 3B3GA 5EUMA 1MC1A 1QOQB 4KVGA 2X14A 2I2CA 2PJRA 1CUSA 1J90A 5KJFA 4K6CA 1QPBA 1ZOOA 3QXHA 1ISSA 1KI9A 2J6IA 1RKBA 2J4DA 4HDCA 2W2NA 5T6BA 4ZJPA 1BE8A 1OTXA 1TYCA 3CF2A 2C5FA 4GOMD 1A9TA 1Z9BA 3AETB 4U2KA 2JD0A 4GQBA 1SU8A 1UPCA 5HS6A 2KQUA 2Y1XA 2VZEA 3K4PA 3L92A 4QYIB 2ZKIA 3GHHA 2N1BA 3TOCA 3ZLTA 5M34A 2PQ6A 2ZXEA 1Z7BA 4K7JA 4MW1A 1HA3A 4RHEA 4G0MA 1NLZA 2ZBGA 4HNRA 2P9BA 2PZEA 3FOEC 3T0IA 5CT6A 4FHDA 4RD0A 2PGJA 3FOWA 3U4CA 3UJAA 4BN0A 3I1FA 3C3AA 3U4HA 1UUFA 2ZIFA 4NYIQ 4MUBA 2CNNA 5GY7A 3AL2A 1Z25A 1XTKA 2GXQA 4WOJA 4JXJA 3A6FA 3AJRA 4M46A 4XX0B 1NKSA 3UICA 2B4RO 2IY9A 3A9TA 3QVLA 3DMFA 3IIEA 4JI8B 3HYRA 3DV0B 8MHTA 4HDNB 3BMOA 5KB3A 1X8JA 2CBXA 2EGHA 1UDWA 5TNXA 3MIIA 2P2ZA 2ZYWX 2DKOA 4NZMA 4ZHQF 2AQIA 2J45A 3HZRA 2IZ5A 4BAZA 4ND1A 3GGDA 4QM7A 3DQPA 3VSAA 3RGWS 1B6TA 1NBEA 1NT2A 1WULS 2FWPA 2B4YA 5LM3A 3TLGB 4CYMA 3VC3A 2XKAA 3B6JA 1EFRA 3FNGA 4QDUA 4B7AA 5FYQA 3UAYA 3ICQB 1YZGA 3FR8A 5FOTA 3IKLA 1AKVA 2GCEA 1WF6A 3AIKA 4FOOA 4IXMA 4M22A 4XAQA 3QLEA 3E3LA 2AHOA 1FSSA 1DXOA 2HEIA 2PU7A 1AD2A 3MXOA 4N03A 4URHA 4YMHA 1G64A 2V7EA 4PG4A 1B1AA 2HQBA 3P0RA 5CEEA 1ZMRA 3N8NA 3D3NA 3DZDA 4BRUA 1RLTA 2JLBA 2FMUA 1B2LA 2HPAA 4EUFA 4B31A 1K6MA 2X3FA 4H7HA 2XOXA 3MWDB 1QQ5A 5HTKA 4N39A 2PSJA 4IKPA 2B34A 1Z28A 2B0JA 2F43A 2RK4A 2VSQA 4UTVA 4YUYA 5BQFA 1GPYA 3ZU5A 1U9IA 1WV0A 3TB4A 4AO7A 1PZMA 1GZ3A 2P2GA 4R83A 4LKRA 5CJPA 4RA6B 4YRRA 1CIPA 1FPQA 2GO1A 2QMYA 3D6NB 4J6EA 5FP0A 1I6MA 3AEXA 3IT0A 5HR5A 1JFSA 1GZSA 1JS1X 3RQSA 1PFUA 3ZWBA 2I1QA 2A0KA 4DUYB 1QP0A 2SECE 3H19A 2JI8A 4U8GA 4C06A 4D4HA 1IL0A 1BCSB 2HDHA 1YB6A 5BR1A 3MJDA 3EXEA 4GICA 5ALWA 4BQIA 2YFYA 2FZLA 1RYMA 4DLWA 3CS3A 3F98A 3RH0A 2ISSD 3LPNA 4G0ZA 4WCDA 3CZAA 2ZIAA 1DQPA 3OF2A 2V7VA 4HFNA 3KEMA 5HKLA 5LUBA 5C8VA 3L7CA 3L40A 4IVQA 1BVHA 2OV8A 4RELA 3CG0A 1Q12A 2C5BA 4IS3A 2WA1A 1ILWA 1FTYA 2BOVA 2CMKA 4N3GA 2A4KA 5AHRA 1SELA 5H9VA 3SS9X 4PPYA 4HUQB 2FPMA 3KVVA 2FTKE 1U80A 2XB9A 5F3DA 4BY9E 1RM5A 1G1MA 2FQ1A 4EJ6A 3HXQA 1CP3A 1RRMA 3INTA 3O47A 1RHKA 1KA9H 4NS1A 3DYBA 3P52A 3UH0A 1AQIA 1DAGA 2FPPA 4L7QA 4FEEA 1NUAA 3AUJB 5D3QA 3KM0A 2W2VA 2D13A 2H5LA 3AR3A 3PUVA 4TQAA 3LGAA 4WXEA 5DHAA 2CEKA 3T4UA 2QQEA 4IIHA 3D6UA 2FR1A 5KYUA 3AJDA 3VI4B 4QTYA 5D2CA 1SCAA 4X8OA 5C31A 1X94A 3LTNC 1K9SA 2J9FB 1J9EA 4B3JA 4EVRA 4B5KA 3HABA 3GJ0A 4IIJB 4NFLA 4P5EA 1T8UA 2GYYA 1YWGO 5LP6A 5KS2A 1YJ5A 3FJOA 5TARA 5JS2A 2TYSB 1AMNA 4MQ6A 1Z5NA 3PR2B 2GM4A 1WXDA 5EHQA 1ID8A 2OXEA 1E2KA 2MSEB 3L8YA 4N7MA 1ECPA 2Z1NA 5DMHA 4Z1MD 2EX0A 5IJXA 1YBVA 5J3JA 4L74A 2HLDA 2ZKLA 4OYRA 4CR6A 2Q5EA 3GO4A 2P78A 3SR4A 4N49A 4DNPA 4LIPD 2PLNA 4ZYZA 1X38A 3ESDA 1RPNA 3M6FA 1T9GR 4RYLA 2YWHA 1SD1A 1XAGA 2C1EA 2VHEA 5CVVA 3REQA 5FEUA 2ZFUA 5G02A 3CHYA 1KARA 1LRLA 1OW3B 5ILQA 3WNBA 4RKFA 3VR3D 4CFZA 1A50B 3ZWAA 1DBWA 4Q9LA 3MTGA 4XQGA 4OHRA 1H2ZA 1IUOA 1ISMA 1NQUA 5BSUA 4A8JA 3FLAA 1RQLA 1V2GA 4HN4B 4XD7D 4KLAA 3VJRA 4B71A 4H59A 2KBFA 4X54A 5DLDA 3L4KA 1WP4A 2FF5A 2O3SA 2RH9B 1BGXT 5DBGA 3FRHA 3P2IA 4MYSA 1RXWA 1O9BA 1O5TA 1MZVA 1WHSA 3QXXA 4HAZA 4KP7A 4UHBA 4MDFA 5IJAA 1GVHA 1R6UA 3ERCA 2Q7DA 2QRPA 3GBPA 1J0XO 4RVGA 4CJXA 2QZJA 1XCBA 1R6VA 3OE7D 3W5UA 3CCCA 2D7DA 4MYCA 3DE1X 2BFEB 2AXEA 5B55A 3ZZNA 3KXDA 3ESRA 4HRXA 3Q10A 1W0CA 1QDLB 1ZU5A 2O05A 2PGXA 2ZRJA 1H1LB 2GHIA 1ZFNA 4DG5A 4TSFD 4LSWA 4RHTA 3NIBA 4UBKA 4C6SA 2BDUA 4EKEA 3FUUA 3HDQA 3V8QA 1ZRMA 3MT0A 1AUXA 1F8GA 3EZXA 4GPEA 4HWGA 2OFWA 1Z5VA 5D87A 1EIWA 1WCXA 2QVCA 3UF0A 1S02A 1A7AA 1K98A 3ETGA 2WKWA 3EBLA 3FJ1A 4HNVA 5TQ0B 3T7CA 4HGOA 4JL8A 1P8AA 1GG2A 4I99A 4LCBA 1YTLA 4C20A 1JHPA 2HEGA 1J09A 3ONVA 5KDLA 3PQCA 3L9XA 1LEHA 1WTAA 3DLPX 3O74A 4GPBA 5DM0A 3DBHB 3HBMA 4WT7A 1FMJA 4NL4H 1XA4A 4P3YA 3HS3A 3DOHA 3T5CA 3Q8XB 5IKMA 2FLVA 3DNMA 3KOMA 1HT0A 3UKDA 3ZTWA 3IESA 1TI7A 5AK5A 4C4ZA 4F97A 5HVNA 1JZTA 4L3VA 2VRBA 4KB5A 2IODA 4YALA 4ZVVA 3LL4A 3UMVA 4I7EA 2E37A 2C5HA 1C0EA 3LJKA 5ALNA 4AJHA 2GK3A 3M83A 4Q9NA 2WT9A 3VAYA 4J6FA 3QHPA 4FSXA 1P5RA 3WIOA 5F7OA 2XJ4A 4KACA 2QJFA 4FK8A 4LNUA 1V5EA 4F1JA 3ANMA 1KHTA 5KDDA 2WTBA 1GKYA 1D2CA 4B6QA 1DARA 3KYCB 3UJ9A 2XVYA 1YJAA 2JKVA 3JTMA 3W1EA 5LBTA 1WUHS 3H5LA 5AESA 2JARA 1IH8A 3HJBA 3K05A 4UXIA 2NAPA 3K3PA 4ZOQI 5AUOB 1DAHA 1CEEA 3SJAA 3K0CA 1YR2A 1WCIA 5ILGA 1T2VA 2VDJA 1C1HA 2NSJA 3EGXB 3C3YA 3PEEA 4J3JA 4CL8A 4OGKA 1UM9B 2B2CA 1TC1A 3RG8A 2JG3A 1M0SA 2LIVA 3F6BX 3HB0A 1LFDB 5I8PA 3MJHA 4B3SB 3CR3C 5IKOA 2ZYUX 3EQZA 2QTLA 1P33A 1CJSA 3HGTA 2FMIA 1FY2A 1ZHHA 1JEYA 3TQSA 1NVTA 4K9PA 2YMMA 4LYFA 1QTIA 5EQDA 3ZBQA 1UC8A 2OCDA 3QJ5A 5HRAA 1G3IA 2HKIA 1VZ2A 1X15A 3TEFA 2DTDA 4BS9A 2JKZA 1X92A 1I51A 3KLOA 3V4OA 4ARZA 2BHNA 4O4LF 2FZCA 4LUCA 4RZIA 1CZHA 2A67A 1VXOA 3TTUA 3O8BA 4NZPA 2OYRA 4BX8A 4BFXA 1D6MA 4DQVA 2R9VA 3ROEA 3T1NA 621PA 2ZG6A 5JO9A 5JJIA 2LCFA 2VI5A 3OLXA 1T1IA 5CD1A 1H8HA 2ZTUA 1RDFA 5IVIA 4Z5XA 1YHZA 3EX7C 5HK9A 3HL4A 5LNK6 1JSZA 3ZXIA 4H1HA 1CQIB 2C58A 2XUOA 4QE3A 1U8EA 1VLLA 2CFTA 1E2IA 1L8QA 1MB4A 1K0UA 1BA2A 3F5SA 3OFVA 2A9KA 4OHPA 5J63A 5L6LB 4H60A 4ND2A 4GAEA 3KV1A 1DJPA 2OFXA 4ZPXA 3WIVA 2AEEA 1QGYA 4E2FA 1LDNA 1T5TA 2QEQA 1UADA 4Q4AB 5KBYA 2I8CA 4LISA 4O5OA 5EYPA 1V25A 3WSVA 1JQDA 4GQIA 4C0XA 4M6WB 5H70A 3R0XA 2H18A 4DLLA 2CB0A 1RJWA 1D4ZA 2H07A 3IR5A 4E5UA 2VDKB 3FFWA 2W4IA 1ZJJA 2HCJB 4C1BA 1HQKA 3KD3A 3A6LA 1CJMA 2EL9A 4MPDA 5CGQB 2ZI5A 2R65A 3HN2A 1HO3A 3LAWA 5J2TF 1Z8NA 4BFVA 3DG9A 2PNJA 2QMEA 2I33A 5K01A 4HN9A 5JXJA 1F6WA 4GGMX 2NZXA 4EB6A 3LP5A 4Z4GA 4LRXA 1DO8A 3TVTA 4LYYA 3CZPA 1WU7A 1L5KA 1UBGA 3RODA 1XFDA 1THTA 3I45A 1L7XA 3UKJA 3AYZB 1FP7A 4OP2A 3GP3A 3O6VA 5FHRA 3WZLA 3VU9A 4DUPA 5FBVB 1D6NA 3E05A 2IXFA 1ZZGA 3LCUA 5IJ0B 2I99A 4D25A 2XSZA 3K1YA 2RK3A 3IJEB 4FINA 1EJ6A 2H3HA 2JCBA 3IVGA 4FE3A 4FT4A 4GOLD 1VLMA 1TCVA 2WJIA 2JHFA 4KYIB 4RAQA 3W9YA 1ZNZA 4OJKA 2DR0A 2XRFA 3NYIA 4MTLA 1QIKA 1KJQA 5F1KA 4C0SA 1A8QA 1QLWA 1T3HA 5CTAA 1AH2A 1COWD 2FEWB 3B13B 1LPSA 4TMYA 3OPQA 4G2NA 4MVWA 4MMXB 3HCWA 4C4TA 1H2WA 2DWPA 4B6EA 4QNMA 1HG1A 4P53A 4DYVA 2I80A 1ZIOA 3PD1A 5EJ9A 3WLEA 4CMJA 1Y6FA 2Q9AA 4D9FA 5E1DA 4XQ9A 1KIMA 1EFAA 2IIPA 1S7GA 4ZOLA 3QIAA 3CLSC 3KZKA 5CVUA 2FAXA 2W2QA 2JRCA 3P0FA 5ES4B 4RTKA 1YI1A 2FEKA 3QU9A 5ALGA 2WSIA 4R8SA 2XQJA 4D1YA 3L8DA 5A1TA 2WVJA 3QE3A 4URWR 1KY5A 3BL6A 3DF7A 1X1CA 2IYQA 3CRQA 3PF8A 2OL4A 2PK3A 3I9MA 1JQ5A 4ALNA 1E6LA 3U61B 1BCRA 2QBYB 1B4DA 3RT1A 3HB9A 3ZDQA 3G49A 1R0YA 1R8XA 2OZKA 5H3LA 1RLJA 4JLJA 2PUCA 3EA0A 4O2BF 3OOEA 1GU0A 5IJWA 1M1YA 3DCYA 5LOVA 5I6DA 1MJGA 2R751 2DQYA 5EZ6B 3WTCA 1NRIA 3R0VA 2NQTA 1E4VA 1HKUA 5F12A 4QGSA 2GWHA 3A10A 1YRLA 1T3SA 3DLHA 3MF4A 5FNVF 4WY5A 3I6YA 2AG0A 4U39A 1X74A 4OOEA 1CEYA 5IDQA 1JIXA 4DC1A 4KBYA 1E2UA 1D7AA 2BH2A 5HX7A 2RIRA 4YAUA 3HC7A 5E2AA 1Q91A 1E9FA 1TZCA 1EFPA 5TMEA 3PNOA 3VJKA 4DVGA 3L8GA 4KFRA 4OJTA 2OSVA 4EEKA 2W8ZA 5IYZB 3G0DA 5JRJA 1NC1A 1ZUHA 2X0RA 4P3NA 4DMUB 4R1UA 4R84A 5FTMA 4GW3A 2ZBPA 2HU2A 3Q0IA 4D56A 4ZFNA 2YZGA 3W2IA 3VKHA 2JDID 3BMQA 1O0CA 2CD9A 1CK4A 2H08A 1PP4A 2Q5QA 4G0YA 4PVCA 4YBZA 4EO4A 2NMVA 3PQEA 4H4CA 2F3QA 3OZUA 4F56A 2JGDB 3ED1A 1ZSVA 1PI3A 1M2WA 3OBIA 2IYAA 4L2IA 2EYUA 1Y1PA 3L0IB 1JB1A 5DDIP 2N3ZA 2XHZA 5ALUA 3TLBA 1BFUA 4QTUB 1D4FA 3HCRA 4ZCTA 2AFIB 1B16A 1O6FA 5JCOA 2QN7A 2RGGA 3A4YA 1UJCA 2QTFA 2C2BA 2B4AA 3AHCA 2G1AA 3OPYB 3MZ0A 4Q3AA 1FYDA 3WSWA 5HUHA 2NO9A 4R7GA 2BGTA 1U1DA 1YK1A 3IP6A 3KTAB 4UHKA 1FCJA 3DC2A 1SHLA 3OX2A 4EF5A 5IXSA 1EXDA 1U4OA 4YBRA 5IM5A 1FSFA 1PNTA 4LGYA 1XA3A 4CMGA 2VXYA 2W6IA 4I1IA 3X1MA 2H7CA 4CIBA 1N8NA 2EJBA 2X5JO 4OM7A 4XPIB 5BSFA 2OKGA 4QUKA 5LNK1 4IJVA 4YRPA 2QRHA 1BROA 3WSTA 3EIHA 1CFZA 1J8FA 3E84A 3HCCA 2G63A 2FWAA 1GLVA 3FAZA 1E1NA 4OTZA 1I4EB 2XXJA 1NJ5A 4LZLA 4KHZA 4OHKA 1ATZA 2WJVA 1RRGA 1SG9A 1T8YA 3WL5A 1V43A 3LCVB 1MNAA 3QE4A 2Q1UA 4V3BA 1N8KA 4EEXA 3SEQA 1PD1A 3WRYC 3RAFC 1ZZEA 2BKXA 5F1OA 5A4DA 3VU8A 5G3ZA 1ZVQA 4OB8A 2XMPA 3WO1A 5FEMA 2E2WA 2GK7A 1CSEE 3ZGNA 1MAAA 2DUWA 3CN9A 3IC5A 2A59A 5KC8A 2LGJA 1ORWA 3PENA 4TMXA 5LU9A 4MB0A 4TMZA 4Y9DA 2BUCA 1Y89A 4U7GA 3F8TA 4LCEA 3B1WA 3OX1A 3W7AA 2GQ0A 4KQFA 3EPRA 1QFXA 5JNRA 1W2GA 1PS8A 2BTQB 4UAJA 3RFCA 3N75A 4R9UC 2Q49A 3KKQA 3QEMB 3C7AA 5HE8A 5IUKC 5TPZA 3I04A 3S70A 3BWDD 3OPNA 4DKXA 1CIJA 4B0OA 1XVLA 3GJRA 4JJ7A 2BPOA 1M2JA 2W2LD 4PYRA 4OFZA 2PT9A 3ECSA 1E2LA 3KAKA 3NM5A 5E3JA 4MNTA 5HCNA 1TQ8A 3T1HB 1EFCA 2PWZA 3GCZA 3WDMA 2OGWA 5L7WA 5F1YA 1Z4IA 3BE6A 3LQ4A 4Q7EA 1MTZA 1FYXA 3OE4A 1T3LA 2HSWA 5AQ1A 2HHHB 4QYTA 4NOJA 2XGSA 2XVAA 3PUXA 1IQRA 1BQ4A 1T2DA 4IDEA 4EHJA 2Y1CA 2F62A 5IX8A 1RLMA 3MA0A 3WMXA 2AI1A 5LCXA 1SC6A 1H94A 1II9A 5IAAA 2VF2A 3TNJA 5BYJA 3U3JA 1EM8A 1JQKA 1T5LA 5BMVB 2WIAA 3G9UA 3HBJA 3M4JA 4LFCB 1E79D 4HTFB 4I3GA 3ZDXB 5AFSA 5ALHA 1MOSA 1OT3A 1Z06A 5H59A 3QLTA 4I5EA 4MV3A 4XYLA 1S3SA 2WZQA 1KOGA 3GEMA 4QU5A 4BNKA 2A94A 2E6UX 3PUHA 4L5CA 2JFHA 5BR8B 1QQTA 1U2QA 3URMA 1Z3IX 3MFQA 2W6JA 3KJFA 3EWNA 3J81k 1F12A 4W63A 4B43A 1O8BA 1EDOA 1USVA 1NN3A 2RKBA 2SKCA 3F9RA 4KVZA 4R1QA 3CX4A 2E85A 3ZE8A 4X41A 2XGJA 4BKPA 3L79A 4MYDA 1N2HA 3CH5A 4O1HA 4Q3LA 5AIAA 1M83A 1XXHE 2HJ9A 4PLVA 4DLVA 2XSZD 2DJ5A 1NNUA 4L08A 4BTEA 1DWOA 5ALFA 2QAGC 4IRXA 3G2QA 1IZ7A 4TMVA 1VIVA 2FEXA 5C1DA 4W99A 3OC6A 4PWZA 4IVRA 5HJ7A 1KDPA 2UZ4A 1WSDA 2HWWA 1I5RA 5K0NA 3IBSA 4A3SA 3NLLA 2JFFA 4HNAB 2Z2IA 1AHIA 1II8A 1L0BA 1O5IA 1UMDA 3FGPA 3RPEA 4FYYA 1ENYA 3G6WA 1JT9A 2G09A 1CQIA 1MENA 1O4VA 1GPBA 3RASA 5GONF 1CC1S 3OICA 4LHSA 4R9VA 1F60A 1JYEA 4AZ3B 5JAMA 2KMLA 5BO5A 6NULA 3K5WA 4LC1A 3ZU6A 5CCBA 1XLWA 3NJ8A 3E9YA 3OPMA 4J7CA 2QJOA 1JHMA 3MJVA 4YRIA 1UCFA 2XVZA 2G83A 3PIIA 2NXEA 4H0NA 1FVXA 1B0UA 3AG5A 1X7YA 4IDDA 4J2HA 4PINA 3LIIA 2QUKA 3SIWA 2Y1GA 4LXHA 3TPFA 3TS1A 5B57C 2W43A 4XB1A 5C1PA 3L6OO 1U2DA 4CFSA 2GF0A 4CKEA 4AZVA 2R0QC 4HGPA 4A27A 1P0QA 3RSOA 4O8ZA 1CR1A 1JVBA 4ZICA 1ISIA 1QTQA 4ZPJA 2ZJ2A 3ZDEA 2G08A 4DNFA 2NO7A 3J7TA 1K6XA 3A9CA 2G28A 2J7KA 2VAWA 1E7SA 3RYHA 2EEZA 1KHHA 1YU9A 4G4GA 1WY7A 5FWNA 2FDCA 4XH9B 5ALDA 2YWJA 5BR7A 2AD1A 3D6FA 1FRVA 4IUBS 5LQKA 2OPHA 4RHUA 3S2IA 2Q8NA 2A9VA 2QJWA 4CG3A 4DRYA 3K70D 1K2WA 3UOWA 4S35A 2AE1A 3TSWA 4B8YA 1H8HD 3E3AA 3ZHVA 5LQCA 3L0ZA 4M1MA 4GC9A 3WP1B 5BUSA 5LSAA 3HEAA 3UENA 1AB5A 4YQEA 2L2QA 1R8SA 4ES6A 4FHCA 4LK2A 4CL3A 2E49A 2JH8A 3R5TA 2CLIB 4XZ3A 3Q87B 2Q1SA 4NJMA 4PFJA 2V97A 4Z4IA 4GYKA 4HGNA 4BLPA 3E9CA 3ITEA 2C9BA 2IL1A 3Q3EA 1TYZA 4AP5A 1SCKA 2ZS9A 4D6YA 4KR9A 2CHFA 2ERXA 2RB4A 4IIVA 3V6MA 4QDJA 5I4KA 1E5DA 3P4XA 2EARA 3HCEA 2FXVA 4UUNA 1C9KA 4R1NA 3KKEA 2F1RA 3NG1A 2FPOA 2F43B 4WE3A 3R0QA 1DKMA 1Q20A 4ND6A 3LRTA 1C7RA 2XQKA 3F3SA 2P41A 3KOWA 3Q0TA 2IIBA 4Q1CA 4O4JB 5GIOE 4EQ6A 2PSFA 4UMEA 4BNDA 3DEHA 1U7OA 4CG2A 2O0KA 3KZ1E 4X62B 1P2GA 5G4KB 4DLSA 2VUIB 4B4VA 3QLUC 4UPVA 2XIQA 1OH8A 1T2UA 1R5OA 1ZPDA 3LHKA 4M3NA 1LBIA 2OHOA 4JI2B 1KVTA 4U6NA 1I33A 3EAQA 4NAUA 2XUJA 3RS3A 2L42A 1KEZA 1G18A 1QFJA 3DCIA 5C8YF 1UOEA 3N8HA 4FJ0A 5C5EA 2C5LA 4KRGA 1DHTA 3KEQA 2O3RA 1QGZA 1GAWA 1Z5GA 1C41A 3RIXA 2WP8J 4LV6A 4C0WA 2YN4A 4EJMA 2OUKA 4WXHA 5JCXA 4OHZA 4HUQA 3TRKA 1W36C 2UXCB 5DISB 1V96A 2VVTA 3A2MA 1JHXA 3ABIA 3I42A 2D0IA 3TN7A 4TTSA 5JATA 1AA6A 1SWWA 1E96A 4XVQA 3IODA 1XSEA 2NNWB 1A8SA 1YASA 4R54A 1J2TA 1CUGA 1M67A 3RYCB 3RKRA 4QODA 5IT4A 1XJ5A 3C45A 3OSZA 1OROA 2ASEA 4X9XA 1FX1A 5TEVA 2ZRHA 2GR9A 3TSOA 2AS0A 4OK3A 2B6HA 4EKYA 3EXFB 4L15A 3GT3A 3GEGA 4XM2A 4IMJB 4G1BA 4CCSA 3OLWA 4A10A 3VKFA 3T99A 2WYUA 3EZ6A 3K53A 2VSFA 1LBEA 5AI0A 4B8WA 1P2SA 4V0MA 3R1IA 3IURA 1N7IA 1MLDA 1TIBA 2DQSA 3BPSA 1MF7A 4JIGA 2Z04A 3DLIA 4B3GA 4OXNA 3IVXA 5HW0A 4WESB 2QY9A 2ZI7A 4W7IA 4R68A 4C7KA 4F04A 3UOAB 2H65A 2FK7A 3EDQA 1JL3A 5FL7D 4RPLA 1GZ7A 5KQRA 3C5VA 4FD3A 3ZHXA 4BNMA 1UFVA 3AINA 2EL7A 2I87A 1H2EA 1EJBA 5DM60 4KC0A 1W87A 1I3CA 3FCXA 4YA6A 5LKRA 1XQ6A 3VAZA 3ZK8A 5MF6A 3IAFA 1E1KA 2VDWB 3GUCA 2C5AA 2O0MA 1UFQA 3HV0A 2KJQA 1Z7WA 1BMDA 1LH0A 3RTGA 2A9FA 1Z6QA 4IHJA 2PBZA 4FHFA 2GJ9A 3TL3A 2IS1A 3IQXA 4IFEA 1WMFA 4FNAA 3HU1A 3GK3A 1S4MA 3HUFA 4HNUA 2D1QA 3II6X 1JJFA 3OJEA 2A9PA 1U2DC 3RB8A 2YXNA 1LBHA 2VQ6A 2XTZA 4OUDB 3RJ5A 3GPCA 5ITZA 2BCJQ 5JDCA 4F4HA 1JP7A 4FYKA 3RT7A 3GJZA 3TINA 3CIOA 1W1WA 3CEPB 4P98A 1Y33E 3UG6A 1WBBA 1EUYA 1Q22A 3HXTA 4MA4A 1ENOA 4QULA 3WGHA 1C8BA 1OSNA 3H2JA 3R5KA 1GJRA 3CPSA 1LSJA 2BGKA 3K20A 1N77A 3FTEA 3FHTA 1P45A 5E1OA 4DR5B 2WUFA 3GN2A 1MT0A 4MI3A 3KJGA 5CX4A 5JHGB 3X2EA 2XAAA 2IPLA 3E4DA 4TGLA 4H7JA 3R6WA 1SBYA 2IKSA 4OHVA 2WKSA 4PS0A 3GZTB 4XIFA 4DV1B 4I36A 2SKEA 4FZVA 1JIVA 3GI1A 2C3OA 2HA4A 2W2TA 2ZIEA 5BN5A 2OCBA 4BQEA 3OM0A 4ZJYA 4M1EA 4EELA 5IJZA 2IPOA 4GU5A 3NOQA 4W6ZA 5I9TA 3UXEA 1TZJA 2I1VB 3MTIA 5C0OE 1ZKDA 4WAUA 3OA0A 4HDAA 2EQ5A 1QK4A 2SICE 1YH3A 3O4JA 4YPVA 1LPPA 4ZYUA 3TCXB 4EYOA 2G5PA 1SQFA 5HIAA 5BV7A 4YV1A 3SN6A 4EJ2A 4D43A 4ZAVA 2R7LA 3A9SA 4FYIA 3LQ2A 3RVMA 3S5UA 4IRMA 4QXQA 2PA0A 1CS0B 5FA5A 3GDOA 1JDUA 4CNQA 3MCWA 2EFEB 2PA3A 1Q50A 4BNLA 4X1IB 4H3VA 4J0EA 2GDJA 4IX9A 2X9LA 5JXGA 3Q5DA 3A6GA 3PT9A 2UVQA 2W83A 2ANCA 3TOXA 1TRHA 2VCHA 3M6VA 1WLSA 3IP5A 1RABA 4REOA 3AW8A 4V0OA 4L78A 3ER9A 5DNEA 1ZC4A 1ZIDA 2ONZA 3JQRA 3KFVA 3MS7A 4I50B 2J6CA 1VMKA 4P84A 1MEEA 2QLNA 3DE6X 3KUDA 3RG2A 2HSGA 1G8AA 1AG9A 3H6KA 4KLRA 2B30A 1WMSA 4F4IA 1WM1A 3N53A 4G9BA 1NZJA 2VDQB 5DIFA 4IM7A 3NI2A 4U6SA 4RF4A 2JJ1D 5EQTA 3G7SA 3B6IA 1KOJA 1WDMA 4M38A 5CFNA 2LUOA 3KQUA 1PNOA 1WKCA 4Z0TA 3IV9A 1VKZA 1EFPB 3PFHA 3SXUA 1VXRA 1H1TA 3HDTA 5BMVA 2O6HA 3PYLA 4FU0A 4ZT3A 2QYSA 3A4VA 3G0BA 2O4UX 3BHIA 4D8YA 4F5EA 4C5AA 1N5DA 2WJ3A 3GJ7A 4AUMA 5FO0A 3HDGA 1NJ8A 1U0HC 2YJ6A 4EBBA 1W30A 4KK4A 1CZUA 1C1DA 1T34A 1UJ5A 4UJ3A 1IAVA 2QG4A 3HO1A 1SOVA 4CT5A 1D2HA 7AT1A 1K5DA 2MINB 3H0CA 3QI7A 3W2GA 1P74A 5CPFA 3KOOA 3QPDA 1A5TA 1QM5A 4NOLA 3IB3A 3PRJA 4HQKA 5EI5A 5AXCA 3UFBA 1VL1A 3ZKAA 2LRHA 1PLKA 3SYLA 4UTPA 3LDFA 3W90A 2OECA 4O1MA 3AR5A 2W11A 3I6MA 1TD9A 2NW6A 3ZY5A 5JBQA 1TCUA 1ODKA 1UT6A 1ZD1A 4WCFA 3TX6A 1KJZA 4QQ8A 3STHA 3HCFA 4P0PB 1RT9A 2C2ZA 4DANA 3NT5A 9ABPA 3LHSA 1TJ4A 4KV9A 3CX7A 1SA0B 3QRWA 1TYBE 4LHYA 3OF5A 4P4NA 2FCAA 4G5OA 3G0IA 2R5WA 3OQOA 4WZBB 5EE1A 4G56A 1VJDA 1EZ4A 2HUNA 2V54A 3QG1A 5BQ5A 4XWAA 2O0LA 2IOYA 3DFUA 1THMA 5JH7B 3G2PA 3KTFA 5AOCA 5LMNB 1ST2A 2WHRA 4QATA 1ZWLA 3CEAA 1U2RA 2XX3A 1UP7A 3GAFA 4M49A 2ZULA 3I9OA 4QFDA 2ZYIA 5FOVA 1Y4SA 3IR7A 1HKHA 4KV7A 3BJIC 4BFUA 2RB5A 3QOFA 5DXJA 4YJKA 3WA7A 2XA1A 3QLUA 2K7ZA 2VRCD 3V7FA 2NUAA 1YZHA 2EV9A 3MAJA 1RWXA 3RSSA 1FXUA 1NMZA 2QDXA 4LHZA 1UJBA 3TVYA 5JY1A 5FXMA 2OO7A 2QVZX 4CUKA 1A7JA 2WJ6A 1KP2A 1QP8A 1VA5A 2W2PA 1QGUB 1Y3IA 3FVWA 5T57A 3DAYA 2OVBA 3RK1A 4DN6A 1VCIA 4KAJA 3PUWA 3E22A 4BRSA 1NXPA 2HYIC 4FOSA 3NALA 1PT9A 3IOBA 1NG9A 4JUBA 4Q7KA 2YVKA 5E6UB 3VU9B 3D0OA 4PSUA 1GKLA 1NWHA 1SVMA 1DEHA 1N6HA 3K16A 1QIMA 1RFGE 1MRSA 2OK8A 2Q4TA 4G1CA 1M34A 1MU0A 5IK2A 2H1WA 1EVQA 3LCMA 2Q5FA 1TPYA 3VX4A 1EINA 5K4GA 2JLXA 2ODNA 1OLXA 4OFXA 2AZTA 2WLSA 4D3FA 2CNOA 3QVJA 3SSAA 4MQBA 1HTBA 5FX2A 5I48A 4NKRA 1VFPA 5CA1F 3EPPA 4MZXA 1D4AA 3K6RA 1XMOB 1OBFO 2OORA 4GXRA 1T6YA 1NMYA 2FZ5A 3FWHA 5FADA 2RHRA 3BJRA 3TIIA 2II6A 1HDOA 4JKYA 4YHHB 4YCMA 5KEIA 3EJWA 4ZKDA 1YBMA 3H0EA 2OG2A 3EZLA 3N0TA 5EEHA 4WMLA 4ZGGA 3DA8A 2QVBA 2ZDHA 3A1SA 2J31A 2J46A 1R9JA 3S2GA 3GLIB 3D8RA 2UDPA 3S8EA 4JOCA 1FP4A 1SVSA 4R9SA 3FW1A 5C5DA 3Q3IA 2IYSA 1OWOA 1GKUB 1SGWA 4PLHA 3U31A 2JA2A 3OFND 3V2UA 2JLYA 5CHEA 1QGDA 3CQ9A 3NYRA 5G1NA 2A0XA 4KGDA 3VZPA 2GPTA 1K8RA 2CHVA 4ARSA 2R7KA 3VVCA 2X15A 1IHPA 5AKZA 2H7XA 4A5SA 1NASA 2IYUA 2FR8C 5FLXA 2WAYA 1PJZA 3H8SA 3PPVA 3LC0A 5HJEA 1FNSA 2QW8A 3KZXA 3KZVA 1N4AA 4BX0A 5LKAA 1CUBA 2B5WA 5A4JA 5M04A 4D9IA 3WICA 3IEIA 2J0SA 3O4RA 1W4RA 3MEQA 4WTOA 5E6RA 2EOAA 4LZWA 3WOVA 3A4TA 1WCV1 2JZCA 3JQ8B 2GJAA 4BNHA 2EIHA 3AT1A 1YR6A 4YJHB 2KYRA 1UWLA 1VCOA 3A3OA 3MB8A 2X1LA 2NPIA 4PSCA 1F2VA 1P3DA 1ZL0A 1KKUA 2ID8A 4DNQA 4CQMA 3VR5H 3CLRD 5FOXA 2FUG1 4CM8B 3EMDA 4YIHA 3HXLA 2FRDC 1L7BA 1OBVA 4XWOA 1NU6A 3WIUA 1H6CA 1L4UA 2C94A 2FZWA 3UMGA 1Q7EA 1C9EA 1VMEA 2C8KA 4EHDA 3EDCA 1KVRA 4YT8A 1W0KD 4Z0PA 5EJFA 2OV6A 2WAOA 5IVHA 2O8EA 4PGFA 1H9CA 4ZA2A 1BE1A 3BMCA 3BRWA 3ZU2A 4CMIB 2X76A 3QE2A 2DFDA 1X7GA 1ZCJA 4HQOA 4Z4FA 3FVRA 1MC8A 2YBEA 1JB9A 4X00A 4WZBA 2J4CA 5IHXA 1U8CB 1Y4UA 4NP6A 5E3HA 3BGIA 2EG5A 2A86A 4P31A 1QV9A 2PGDA 3FGNA 4WK6A 3D1JA 4FIDA 4PPFA 3WV5A 1M34E 4R69A 1ZMXA 2FE4A 5SICE 1KKLA 2AC7A 5HMLA 4U9UA 2BGGA 1I4DD 5LYJA 3MJCA 3HACA 2P68A 1DKPA 5FCDA 4JN6B 1OU0A 2DU8A 1WNTA 4YPOA 1W88A 4FGLA 1GZUA 2G04A 2YMLA 4MP8A 2REOA 4MZDA 1PO7A 3HFJA 5HF5A 3WV4A 3B8HA 3GN1A 1UMBB 4HRAA 2OCKA 1JKFA 1LRKA 5LP6B 4MDYA 1TM7E 2I03A 2C9MA 1E4EB 3G02A 5LD2B 4ZHSA 1E0JA 1SHKA 1DV2A 1T26A 4NU6A 1PD0A 3KT0A 1U2ZA 1VE1A 3Q5GA 1K2VN 3RS7A 5ALMA 3QF4A 4YCDA 4PRZA 1WZUA 4JSTA 2DFPA 3DUWA 3K9NA 3FLEA 4DIDA 1QHXA 4HQNA 4BQPA 1GPDG 4E3ZA 1XA0A 5I3CA 4FX2A 3FOZA 1TC2A 1A97A 2WV7A 3O1IC 1PKXA 5AVXA 1CY2A 1I9GA 2H5JA 2R68A 3WGJA 5CCXA 4AQYB 3RYIA 3BKXA 3MMSA 1DEAA 3JS5A 3BDIA 3EARA 2JI4A 1GPMA 4MV7A 4D97A 2BEKA 3EQ8A 4AI6A 2QTWB 4C29A 5C2JB 1IN1A 4FR2A 1P4AA 2RI6A 3DVAB 4AX8A 3OOJA 3VHQA 5IKXA 3F3KA 4B3IA 5EYPB 4DBLC 2XXAB 3RHZA 1D8TA 3AR7A 1WOMA 3PFCA 5CYPA 3CF4G 3IOCA 2TMYA 2W2OA 4MGKR 2EFYA 1Z6PA 1NQTA 4LV8B 1BU5A 2NUAB 1J22A 3AXSA 4TL8A 1WXIA 4J3NA 4V1CI 2D2EA 4RM3A 2HF8A 4TYYA 3AQ4A 1PZHA 1FP4B 1W34A 2M98A 4CR7A 2VHTA 1S2GA 1N0VC 3FTFA 1NTRA 1JDSA 5CD9A 3TXXA 2ZJ3A 1F48A 2CVQA 3QNMA 2A5LA 3HJNA 4EGQA 2A3NA 1ZXLA 4PIPA 3JATB 3PLAE 4GKJB 1LVGA 1H2HA 1N5LA 3U4QB 3L7NA 2JJ1A 1QRAA 1P75A 1IOWA 4YK7A 2QN3A 4M0LA 2R6CA 2PL9A 4JS0A 2GVZC 3KT8A 4UAGA 4XIYA 5FO1A 4GI3A 3BFVA 4KKXB 4X1KA 3UB3A 3ZHOA 1KSFX 4OXQA 4KDEA 4LV5B 4F71A 4ANFA 3K0HA 1DQNA 2QD1A 3LLUA 1XFAA 5BW8A 4R6WA 2ONCA 1XLVA 1GXSA 2XB6A 3OQ6A 2IP2A 5A5DA 1N6OA 2OGTA 1KZ7B 2UZ1A 4Z8YA 2P2LA 1MGPA 2JFNA 3RS9A 2KI5A 3EDRA 4NMXB 4B6GA 3VOSA 3OQ1A 1M6NA 4BO1A 3AC0A 3P9NA 5B4UA 1YMQA 3QUSA 5AVUA 3SYMA 1OBOA 5BYBA 1DQZA 5EJIA 1X7HA 1KMIY 3EDMA 4RVNA 1QU2A 1IY8A 1S1CA 1ZD3A 3A3NA 4FQ7A 5HBRA 5C1IA 1BKSB 1E5XA 1EEXB 1UM9A 1Z45A 5KX5B 3GLFE 4EKDA 5DT2A 4O2LA 4O4IA 1TW3A 3GZNA 1P39A 5CLQA 1BMFD 2ZZKA 2IP1A 3D0QA 3T94A 1ZBQA 1F6BA 1XWIA 1QF6A 3W05A 1IDOA 1KBQA 3WBJA 7ADHA 4LQCA 1P1CA 1MJNA 1AHNA 1LS1A 2V6BA 2XBLA 1BS9A 5KQPA 5LMCA 3OE1A 3ZD8A 5DN6D 4CCYB 4LZOA 1ZGZA 1Y8ZA 1XQWA 1ZR2A 3ABSB 5HRCA 4LOKA 3DWEX 2HA6A 4MI6A 3USZA 3U7GA 3H1TA 2DHDA 2WA2A 4RJKA 1EBBA 4I3HA 1BOOA 1P31A 1FP6A 1RRCA 2W93A 4P38A 1XTRA 2R79A 2GZ3A 4PTLA 2NTEA 3NTQA 3I5YA 3TAHA 4MQEA 2G1UA 2XNDA 2V7XA 4MWZA 1DTWA 5IFKA 3FIUA 1IN7A 1RAIA 4LWOA 4YY3B 3QKSB 1NPDA 1QVZA 4Q4HA 3NBXX 3IB6A 4GXQA 3HG7A 1A71A 3C3XA 3NM6B 2A5GA 5FUWA 1UXKA 3DDSA 1E1YA 1O6GA 2BBWA 4J1QA 2PH3A 2RH5A 2Y1KA 1ISFA 1NJGA 1W52X 2JAPA 3EA4A 4WN9A 1SG0A 1M6YA 1XIVA 2CLHB 3UAGA 4D9BA 4DAEA 4HQ6A 1XJ0A 2X7HA 1T0PA 3E5NA 4OREX 1KDOA 1XZEA 2HA5A 1GITA 2QTCA 4HNTA 4Y6RA 2X9QA 2BHRA 2CUZA 2IU0A 5BNTA 5AVSA 1BJKA 3DMNA 3W5HA 2XUPA 1GCUA 4IYRA 4MW7A 4FLMA 4YUVA 5JXIA 1D3AA 2BZ1A 1QE5A 1M72A 1EWYA 1WX1A 3OCJA 3I3OA 1KI4A 3EXHC 5FOUA 3FWPA 3BAFA 3ZGVA 4BU1A 1O95A 3B89A 3O93A 3CUWA 1NI4B 4ZV7A 5I7OA 4ZP1A 2PLFA 5KHOC 4DXDA 1RPTA 3GG2A 4ZI2A 1KAQA 4KYUA 3QFTA 4X60A 3SHTA 2GJ8A 1SCNE 2GBLA 4I5GA 2O2JA 4QIHA 3WJ1A 1TT5B 1PT5A 2V4ZA 1J0EA 2JLZA 1JQJC 4N5IX 1IUKA 5KNLA 1E8DA 3I2GA 1LK5A 4OO3A 5EGSA 1CQZA 3C6QA 4WK4B 2Q2VA 5HTOA 2QLJA 3F9CA 3NBMA 3NPAA 4NFSA 3NP7A 4AN4A 4Y7DA 5CFLA 2YJGA 5GVRA 3DH0A 5COAA 3TIXB 3NC4A 2N75A 4GD3Q 1V16A 4IXWA 3U3RA 1CJUC 3VRHA 1HFWA 1ODFA 2UZ3A 5IZCC 4EPTA 4NXMB 1TE2A 1K7CA 2BJWA 4FQ5A 1V8ZA 4JQSA 3T7EA 1KI7A 1EK2A 1V8OA 4Y9RA 4M1ZA 4DMLA 4UVDA 2FPIB 3FAKA 1QS0B 1AIPA 4QGAA 4ZDKA 1F8YA 2FPWA 4LF9B 1A5SB 5B1IA 4AVYA 4B3XA 1V7ZA 2ZUTA 2JGFA 1J97A 3BMOB 4MVJF 2Y71A 3ZHUA 1YKFA 4BPBA 3KDSE 3LYHA 4YRJA 2Z2XA 5JALA 3EBPA 2UYCA 2VP0A 3FYTA 4WADA 1U7PA 5IDYA 1O0SA 1R2QA 4TZ6A 4YV7A 4PCLA 2IPNA 4P08A 4JJZA 2Y1DA 2YYYA 4FX5A 5JAOA 1F51E 4K88A 2VOEA 3VDNB 4C87A 1PDVA 1Z6AA 2YWDA 1C3OA 4FZ5A 4JJEA 4DIEA 5DK6A 1HR0B 1NU8A 1U1EA 2UYGA 1Q7BA 2DR3A 3E2MA 1ZIYA 4ND8B 2FCRA 4ZDIA 3AKEA 2B6NA 4E12A 1E2QA 1E5TA 1QJ4A 1L4KA 3ER8A 2Y05A 1FLAA 3KZOA 2WFMA 4GP7A 3ZHZA 1MW9X 4J1TA 6LDHA 4IFTA 3GUUA 5CLFA 3T3NA 3MJTA 2GK4A 3MOIA 4L76A 4CKBA 1HQCA 3AERB 4XTRA 2XCLA 2IYZA 2NU8A 1ZM3A 4FYPA 1AF4A 1T9ZA 5JS1A 3AFHA 4JLKA 2PZMA 1AKNA 2BFOA 5B3JC 5FUQA 1P80A 1PL6A 3R7AA 5LLSA 3E61A 1PK7A 3NNNA 4FMCB 3E9NA 4UZEA 4G65A 4JBNA 3ZOKA 3CX8A 3BXFA 4BB0A 2F7SA 3L41A 3JZFA 3MINB 4W7HA 1DU4A 4J07A 4OMUA 4QD3A 4KUEA 3AFMA 2XE6A 4AN0A 3TRIA 3G2OA 2PO7A 1K5GA 4I55F 1L5FA 2HC9A 4RL4A 1YJQA 2AMYA 3AF1A 4D9GA 1FSZA 4N3NA 3U17A 3AF5A 1E92A 4JEMA 3T7TA 1LK0A 1TYDE 1XCPA 1FFDA 2FW6A 1DX9A 1AGYA 1YUMA 3G3EA 3TKYA 1Y6QA 2FW1A 2Q3CA 3KRTA 3SICE 2UYQA 4PBRA 2ZROA 1OXSC 4ZODA 2QL5A 1T2FA 1VLQA 1B93A 3P5SA 4MRVA 5ESDA 3D6TB 1WHTA 5CVCA 3RU3A 4BWVA 2DWOA 4B4DA 1ZGGA 1KZ1A 4Z7QB 3UNXA 5CT9A 4FLEA 2A0FA 2VDNB 3B3JA 1QFSA 3CUVA 2FSVC 4KIUA 1VLHA 2BHLA 5I4IA 1P6XA 2ZQZA 2O06A 2IH5A 4AZ0A 3MC1A 1E94E 1UC5B 1P0IA 3CRZA 2JGRA 4K03A 1AXEA 4X44A 5F5NA 3VR6D 4DUZB 3TTTA 1C29B 2FSSA 3N8DA 3ZGOA 4ZT6A 1OLUB 5I7HA 1T9CA 4YRZA 4A15A 1FJXA 3IX7A 1PVVA 5A4MS 2JIBA 3N5CA 3V8PA 3MYYA 4DWVA 4J0QA 4Y2TA 1PT8A 4MHTA 4OVKA 1Z33A 2VJKA 1CJKC 5B3JA 3V1UA 4ZDWA 2CVOA 2J9YB 3ZUGA 1E60A 2AOTA 3OOYA 1Z4OA 4TLEA 5EXEA 2FSIA 1RBYA 2HGSA 3CEJA 4PG6A 3IAAA 2RGNC 2ECOA 1J49A 1MG5A 5KNBH 2WWIA 1B6RA 4Y6SA 5JCJA 1B74A 4J16C 2LW7A 4QXOA 2DSNA 4RJJA 2CVZA 2O2CA 1G5FA 4D7AA 5C35A 1IY9A 1HE8B 2GBLC 1UK8A 3OTWA 1HTTA 1OI3A 1U0RA 3L6EA 4PZLA 5CG1A 1SQ5A 2XYPA 1NAHA 3DV0A 3O0TA 1MV5A 5SY6A 4FN5A 4EKGA 1J2UA 1SU4A 2FUKA 5IC4A 1P1BA 3T4PA 4FPXA 1JAZA 3VPDA 3FTNA 3F9IA 2BMWA 1JYFA 4X1OA 5BV1A 5JCZA 5JNSA 3B1YA 4MLDA 3MT8A 1H2RS 4LF4B 1ADBA 2IJGX 4J43A 1OPXA 1WZNA 4YJFB 4V02A 3CRVA 1JR3A 3KR1A 4XJVA 5FBKA 3UQYS 4N3BA 2EIXA 4RQAA 5KX5A 2YZKA 3H5WA 5DOVA 2F59A 4B7XA 3FR7A 5LU8A 1JZSA 5HFJA 1XP5A 1UANA 2B8WA 3R75A 1U0SY 2I2AA 3PJDA 4OH7A 2ID4A 1XXHA 3ZIAA 3EIQA 4YJ2F 1VZ3A 3W7BA 3WO0A 3LVBA 1PEDA 4E14A 4P1ZA 4AM8A 4G4IA 2JIZD 4WNCA 3KWJA 3B8EA 1RKUA 2VLBA 4ILEA 4UNNA 4Q9KA 4HZIA 5DW0A 2XWSA 4ATNA 5D84A 2BFMA 3DEAA 3F47A 5LDHA 4XOIA 2XWPA 1XJQA 4OL0A 4CKZA 1M2NA 3RUEA 1FFEA 4D5EA 1G7CA 4OH1A 3ED5A 4L4XA 4C7MA 4QECA 2B1GA 1F0PA 1ZRSA 5FTWA 4FGUA 4N65A 4JI1B 1H2FA 2GPAA 2QR2A 1L5HA 3WLKX 3G5TA 1MA3A 4GQAA 2B9EA 4JELA 5G1OA 2A0WA 1NT4A 4ZVOA 4CGZA 1SCUB 1VKOA 1P19A 1C3LA 1W85A 1FW8A 1F5SA 2EJTA 2GNOA 1XVTA 2Q6LA 3SYRA 1BOFA 1H2AS 3W6OA 4E51A 2ZJ7A 2IOQA 3BWEA 1O6BA 1PJSA 2Q3EA 1G21E 1XLTA 3DFKA 4IZOA 3ZGLA 5BYAA 2P9QA 3N3BC 3QFSA 1W0KA 4ZYXA 1TVCA 4KHPB 3PFKA 2G0TA 4DIOA 3I30X 4IDBA 2QE7D 3TOVA 2R7NA 4NATA 2O14A 4F9EA 5KCMA 4BAGA 1PR0A 1TUGA 2PZGA 4TS4A 2JC3A 1VL5A 4EYEA 5KWSA 4RCYA 3PNYA 5I5GA 4IHKA 5KQLA 3E18A 2NTVA 2NZ2A 3JVIA 1MQSA 5EZ5A 4Q03A 2I7DA 1ZU4A 3IIKA 1V11B 3CUKA 1GL7A 2GBIA 4KFUA 4DSZA 4LTMA 3UV6A 2DPYA 4EY8A 3BXZA 1REQA 1BS2A 1FNNA 5TC4A 1I1NA 1CE8B 3O8OB 3GLKA 4LZNA 4PG5A 1NVEA 2DYKA 2JIOA 3QSGA 5B30A 4CIVA 1IIRA 2OV2A 1E6WA 2HZ7A 5G0TA 5KYXB 1XLTC 2ZWOA 1G5HA 3LZDA 1ULBA 4MR7A 5CBKA 2Q8QA 1N7JA 1IBMB 2ILVA 1FLVA 4EPYA 4Y9SA 1MX3A 1O87A 4O4LB 3UMRA 2RFLA 1OY1A 4LHEA 4ZVNA 4DGSA 4E5YA 1M1YB 1MO6A 2ODWA 4OCZA 3V48A 5DNAA 2V5AA 4POAA 1U1FA 2QROA 4OQXA 3IH5A 3JVVA 4DSAA 2QI9F 3I83A 1BYUA 2PZ8A 3AL0C 4YI5A 1EGVB 2OORC 1FDRA 3H8WA 4N3CA 4QSHA 2O52A 3HJHA 1SK8A 3EPLA 1UC9A 5F64A 1SURA 2Z2YA 4QDZA 1U65A 3HCAA 4Z9BA 5T64A 4BNIA 1XZBA 1G9TA 1SBCA 2FPSA 2QN8A 2WTNA 4KFSA 5F77A 2OO5A 3EC1A 5AUQA 4ENWA 4OA8A 2C7VA 3ELDA 1Z0IA 2FSGA 1PR4A 2YWBA 4B80A 2CUNA 3T5GA 5ALYA 2Q2NA 5L3QB 4G4JA 1I2DA 2XDWA 2PX3A 4TTQA 5DGDA 4D80A 1BIFA 3HU5A 2Q3BA 2XV1A 3QMMA 2P9FA 4U8HA 3I0NA 4GPIB 3E8XA 4V0LA 4ZJZA 2ZJ1A 3AJ9A 4U6QA 4TUYA 4HUJA 2B1QA 2FPGB 2DH6A 1U8TA 4F21A 2IY8A 5LZ9A 3K8ZA 2FKNA 2WP0A 4QTXA 4YP0A 3FMIA 3C5HA 4GWLA 4IPTA 2X19A 4Q3BA 4BKUA 3U3ZA 2H2HA 1PTJC 1IBKB 5DEOA 1VI2A 3AM3A 4TN1A 5DBOA 3R2JA 1GTJ1 1FDWA 1XZJA 1AUOA 4G36A 3ZQ6A 3DYIA 1E1RA 4OXXA 1I13A 3QI2A 1QG0A 1USWA 4Q19A 5GJCA 5CFMA 4NPCA 2GB4A 3D5QA 1FPMA 1YJXA 3PTZA 1QDEA 4ML3A 1U63A 4F91B 2LDXA 4WRRA 4IF6A 1V45E 2PAFA 1JR6A 1UT8A 4L0DA 4W82A 2XGMA 3OQJA 4B33A 1HYBA 2ZRKA 2GA9A 3LQQA 2MJLA 2R8OA 2XCIA 5WRFA 4PXYA 3NHSA 3H11A 3AY0A 4WV3A 5DP2A 5AP9A 3JZMA 4HVLA 5IDWA 2F8LA 4MVJI 4OHXA 4BBZA 1S9DA 5DB4A 1JKXA 4WCFC 2OCXA 2YY5A 2XNCA 4J76A 1UAGA 2HFJA 3VR1A 1JXAA 4DDUA 4HCJA 3QHAA 3NS7A 4ZRMA 3WGYA 1RC1A 1PQYA 1Q0LA 3VDXA 3A8TA 1EP3B 5F2OA 2BI7A 2A9QA 5C5IA 1E3LA 4GI7A 5ECWA 1ABFA 4BE4A 1DBRA 1XEXB 1T3TA 3JXEA 4KWIA 3TEJA 3PXEA 2MTBA 4KN5A 5REQB 4PYQA 1CR6A 3AFNA 4Q6BA 3STYA 3GJYA 1QANA 2J67A 3RTEA 1DC5A 4L8WB 3KL4A 1WDKA 3PG5A 4MKFA 2QNIA 3D54D 4QXPA 3FCUB 3AEKA 4KFTA 4MUJA 2FWJA 2OV3A 2QRLA 4QQRA 3ZV6A 1TKBA 3HWWA 3H9EO 5AVJA 3QBVA 4F5YA 2BFFB 3KT3A 5JWOA 4IMPA 2TMKA 5FFFA 3EH2A 1CLEA 1ZSYA 3FNEA 3O4IA 3WADA 2R8XA 3KYJB 3DFZA 4R71A 1CQJA 1Y1SA 2YICA 5IT9A 1MB0A 3J80A 1P9OA 1B3RA 4ZQCB 2AK3A 3K32A 3SOPA 4C5CA 2C3YA 1G0NA 1I80A 3KALA 4TV9F 4RY0A 3K72B 1Q1BA 3DE7X 5JSYA 1Q0TA 1YVDA 1K6EA 3B7GA 2IEDA 2QT0A 3CJTA 5DHPA 3VYVA 1AUQA 1T9BA 4EMSA 3BCHA 2W22A 3VU1A 1BW9A 4WKCA 3CGWA 3L7KA 4LQDA 2IZ6A 1NLUA 2RGNA 1KETA 1LC3A 2JGDA 4JH0A 3IV6A 3AG6A 3O26A 1WF3A 5J5CA 1WVIA 1RRKA 3LXXA 3CKMA 1CB0A 3D7KA 4G01B 1U4SA 1V11A 3LX4A 3PCRB 3T8YA 4J1NA 4ZOLF 2WUEA 4RULA 3WBKA 1JF8A 3CISA 3RRJA 4KSCA 3QQ5A 5L3QA 4XFDA 4C6TA 4LGMA 4TLMB 3RFVA 1G2OA 4ZOLB 3RSZA 1WVGA 1ST3A 4NU8X 4Q37A 4JOBA 3I0ZA 5JVDF 1TAUA 1QO0A 1V3QE 3O3CA 3DFFA 4BPRA 1XVIA 1U0TA 2DH5A 2QNBA 5CVJA 3T06B 1S3GA 4F2WA 1QQ7A 5LQMA 3PPYA 1Z2PX 1ZONA 3G2LA 1GOTA 5JC8A 1A9XB 3HP4A 4C08A 4DGQA 5KQMA 4M21A 2RGXA 2V7BA 3BCSA 3GUVA 3KAPA 5DXFA 3UT5A 5IJ9B 1GTRA 5ADUS 4L5YA 2H0AA 1QYVA 1SXJB 1E1RD 1MX5A 1E3SA 5I5EA 4KJZA 3FI9A 2ECFA 1E6KA 4HEA6 1P2TA 1K66A 2C29D 2IX9A 2G72A 4JP5A 4DWOA 1KK3A 1G20A 2D5CA 3LUBA 4IKOA 2ZIWB 2O8DB 4WL0A 5CM9C 2AF3C 2QRUA 3MBIA 4Q00A 1CY7A 4TWRA 1IY2A 1QFZA 2QTTA 2XRMA 1Z7YA 3K9HA 4UQPA 4DADA 3QKRA 4AYTA 5B4TA 1XI2A 2JFOA 4GMFA 2FFAA 4C4YA 4EHNA 1GGHA 3TR6A 3M8KA 3HCNA 3NH6A 2P3LA 3EXG2 4KX5A 4DWWA 1JA9A 1FMCA 3K0KA 3WGLA 4B3MB 5IVDA 1JDBB 3W06A 5DGHA 4MWGA 4RK5A 3DP9A 4CHTA 2R8ZA 4UASA 1DINA 2ZVJA 3K96A 5BMOA 3I64A 5CDGA 3R5HA 2EW1A 3KHTA 1N3LA 3G2JA 3LWBA 2HL6A 3UMYA 5GMOA 2DTEA 1J56A 2WYVA 2V7QA 5BPHA 1P5HA 3V2HA 3DTVA 1RVDA 3LRXA 1JJBA 4DA7A 3LUGA 4OBEA 4P2GA 3AF4A 3WS7A 4MUXA 5K7SA 1ZOPA 5K9ZA 1F5NA 1F8UA 2VZLA 1A82A 1LDGA 4GZ5A 4DM4A 3QWIA 2EEPA 5BQPA 2GVDC 2Y2UA 1TM4E 2IUFA 4UUPA 1VE3A 4NAVA 2RGEA 5DBHX 1I01A 4BLSA 4DB4A 4TLAA 1RAEA 3OPXA 4FYMA 5A4FS 1M2VB 3ZCSA 2VNKA 4OQ4A 4UU1A 5HM8A 3FUVA 4EJSB 1YR8A 1XNHA 2C84A 2WHPA 3BXHA 3DAHA 3JQCA 4IUYA 3E7FA 4LGCA 1JAHA 5CU7A 3ON5A 5TQ2B 1RKVA 1S8FA 2C4VA 3VNSA 1QPZA 3DXXA 2I3BA 3OMXA 5BN4B 3TFOA 4FFLA 1EVIA 2PD6A 3E1KA 4OSPA 4EM6A 1U28C 2I2BA 1NVXQ 4IDGA 1W1IA 1G6OA 4HDKA 3UTCA 3Q12A 4IO0A 2QRQA 3GLGA 4EW1A 4D4IA 5L6MB 3G68A 1AGNA 1JXQA 1QBGA 1LUAA 3NOOA 4KO8A 5FR2A 3U3KA 2PT6A 3ZVMA 4A0QA 3M4ZA 4KR3A 3C85A 3D7MA 4IMIB 2ONYA 4FIZA 2WIBA 3VV3A 4W1SA 4H27A 4IVNA 4NWIA 3QW4B 4E0BA 3L84A 5KNBD 4GP6A 4W8HA 5EZYF 1VPDA 3TJZA 4EI9A 2PKXA 1IPFA 1W59A 3C5EA 3DOCA 1DWPA 3KVYA 4G8JA 3RHTA 5IUJC 1ZA1A 3TGPA 5BOSA 4I2NA 3HA7A 4DAOA 3UANA 4EJSC 2EHDA 4Q9IA 1OZFA 4NBNA 4Z3KA 2MINA 2CDCA 1RYZA 1D1QA 1VI5A 2WSMA 4D0NA 2P6OA 4GH5A 5INTA 1IFXA 3A1FA 5HRUA 1KAMA 4NBUA 1NF3A 2Y66A 2G25A 2V58A 3F8WA 1EFHA 2Q7OE 2ZIXB 4ZD6A 4DWJA 1PR5A 5FUMA 3E5MA 4WKGA 1Z4QA 2X9NA 3QVGB 4MIKA 4IJMA 2QD4A 3WRYA 5CFPA 3AZPA 3LOQA 1AXGA 1P18A 7MDHA 3DL2A 3AF3A 4G23A 5HXAA 4E2ZA 3PD7A 4HXGA 1P1KA 3E82A 4LXUA 4MV6A 4CKYA 1BG6A 1FU7A 1WE2A 2GXSA 1SIWA 4LDNA 3O8QA 4TKZA 2PS9A 3GF4A 4ZCIA 1L7EA 4YI3A 1MDBA 4M88A 4UHDA 4AXXA 3KJHA 1ZO8A 3F73A 3TOSA 1WR8A 1TPZA 3P2MA 1IPHA 2CVHA 2LPMA 3ITNA