2ONZA

Structure of k57a hpnmt with inhibitor 7-(n-4-chlorophenylaminosulfonyl)-thiq and adohcy
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
257
structure length
257
Chain Sequence
b'ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWALRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
molecule tags Transferase
source organism Homo sapiens
publication title Enzyme Adaptation to Inhibitor Binding: A Cryptic Binding Site in Phenylethanolamine N-Methyltransferase
pubmed doi rcsb
total genus 92
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2onzA00
2JH8A 5ICGA 3E8SA 4LG1A 3NMUF 2ZCJA 2GS9A 3GRYA 2I7CA 4XUDA 2FK8A 3UZUA 1SVUA 3KQSA 4RTLA 3ER9A 4K6MA 1F38A 2HR1A 4R05A 3U81A 2ZZMA 5EG5A 2BM8A 3KQPA 3SMQA 1JQDA 2VDWA 1O9GA 3LBYA 1G38A 2UYQA 1P39A 4YMGA 5CVDA 3G5TA 3M33A 1YB2A 1I1NA 4GOND 1P91A 2Y1XA 5EZQA 3P97A 9MHTA 3WSTA 4P7KA 1TPYA 5E9QA 3P2KA 5K01A 1M6EX 2H00A 5DXAA 7MHTA 4OQEA 5F2KA 3CBGA 5K09A 1NKVA 3FRHA 3GO4A 2OPBA 2G70A 2GPYA 3EGVA 1H1DA 2PXAA 3BGIA 3GRUA 3NDJA 2ZBPA 1SUSA 3ME5A 4ATNA 4FT4A 3GNLA 1Q0TA 1BOOA 3LDUA 3DULA 4WVLA 5K0JA 2AOWA 4DA4A 5T67A 1DUSA 3THRA 3M6VA 5E1BA 3TFWA 3HCBA 3GXOA 3E05A 3KPVA 3LX6A 3ID6C 3MTEA 4C06A 5CD1A 3HM2A 3TMAA 1M0EA 4O29A 2EX4A 2XBMA 3FUXA 5FHQA 5GM1A 2PX5A 3I5UA 3LKDA 4AZTA 3HVIA 3M70A 3RIEA 4YV2A 4ER3A 4BY9E 2HNKA 5DPMA 2BR5A 4A6DA 3H2BA 1IY9A 2IFTA 3FPHA 4E32A 4YUZA 1F3LA 3PT9A 4HTFB 1NW6A 1NW8A 3UA3A 1RI4A 1RJGA 2YXDA 2WK1A 1ZHFA 4RTQA 2JHCA 4RTOA 3HTXA 2LD4A 4X1OA 4EVIA 5EIWA 2CL5A 3OU6A 5EMMA 3O7WA 3DLCA 4GUAA 2QRVB 3TKYA 3CJTA 2F8LA 3BZBA 2XVAA 2DULA 3B3FA 2A14A 4XCXA 4QQKA 2AOTA 4F85A 1EIZA 3BGVA 3ANXA 4OA8A 3JWGA 5GWXA 5HIKA 3MHTA 3M6XA 3HA7A 1YUBA 3P71T 1I9GA 2H11A 3CC8A 3MQ2A 2FYTA 1RJFA 3HVJA 3LGAA 2AVNA 3TRKA 2P41A 4DZRA 3LDFA 3QV2A 1G8SA 1N2XA 3EVCA 4FGZA 5EQJB 2XYRA 5FCDA 5F2NA 4RTRA 2Z6UA 1WG8A 2VZ9A 1BHJA 3LCUA 3MERA 4HGZA 5G02A 2OKCA 3I53A 4HSGA 2XVMA 5ICEA 5LQAA 3K0BA 4HTFA 3S68A 1VPTA 3A26A 3P2IA 3RODA 1EQAA 4QDKA 5EEHA 4AUKA 2YVLA 4RVFA 5BW4A 1ZGAA 3I58A 3LCCA 5DWQA 1L3CA 1FPQA 5LQNA 2P3OA 2ZSUA 2AN3A 2UYHA 1HNNA 2Q41A 2P1DA 2XYVA 2KW5A 3B7PA 4PIPA 1B42A 3IEIA 1MHTA 3B5IA 5C0OE 1X19A 3X0DA 4MIKA 3FPJA 4YUWA 2IBSA 3HP7A 5LR6A 1HMYA 1KP9A 3P2EA 2IH2A 1RI2A 3DMFA 5K8VA 3LKZA 2EJTA 3DP7A 4DCGA 3EGIA 3G2MA 5DRYA 5C9ZA 5DTMA 3EMBA 3FUWA 4M36A 3VC1A 5FA8A 4V0QA 5HEKA 4C07A 2ESRA 5EKXA 4DMGA 1FP1D 2OBFA 5C1IA 3BWMA 1XCLA 2O0LA 4PYKA 3SR4A 4LECA 4E2YA 5K03A 5LSAA 4P7FA 3HCAA 3KPYA 2FPOA 2VDVE 3EVBA 3Q87B 4EKIA 5BW5A 1X1AA 5T6BA 3BT7A 4E30A 5LQCA 5KQRA 5DXJA 4IV8A 3KQOA 3KPWA 1OR8A 3LSTA 3P9CA 1JTFA 3UJAA 2ERCA 2NNWB 3BKXA 3EPPA 4P7JA 4GBED 3SSOA 1O9HA 5E8JA 3FTEA 3ELWA 4KIFA 2VP3A 4PNEA 4RTNA 1YF3A 3ELDA 1FBNA 1KXZA 1VBFA 3PLAE 1AQJA 2V7EA 1TW3A 4C05A 4QVGA 4OQDA 1KYZA 3UFBA 4EQZA 5E9WA 2P7HA 4QDJA 5HIIA 2AZTA 3HCCA 3QOWA 2P8JA 4R8SA 3UJBA 1JG4A 4AZWA 4M38A 2NXCA 2C7QA 3ERCA 3EVAA 3T7RA 3UA4A 5GINE 2I6GA 2N47A 1P1CA 2P7IA 3SGLA 1L3BA 2PY6A 1VP9A 2ZWVA 2IPXA 3DXYA 2PGXA 2IP2A 3C6MA 4HC4A 5FWAA 3KU1A 4FZVA 2B2CA 5CVEA 2PWYA 3LPMA 2XYQA 1AQIA 5H02A 5K0BA 3NWEA 3OE5A 5HILA 4IV0A 1D2GA 2VS1A 3FYCA 5K05A 3PB3A 4MTLA 4ER6A 3I64A 4P58A 2IGTA 3F4KA 3ELYA 4FP9A 2B78A 4MHTA 3KQQA 5DSXA 5DX1A 2ORED 4YUXA 2Y1WA 3TPZA 4EKGA 4IKPA 4DKJA 1ORIA 3O4FA 4GQBA 3A4TA 4R8RA 4EK9A 5FTWA 2IH5A 3KR1A 2JHAA 1KPGA 4CKCA 1AF7A 3EMDA 3FPGA 3PVCA 2FHPA 4YMHA 3V8VA 2HMYB 4FS8A 2BZGA 3MAGA 4NECA 5DX8A 1ZKDA 2PX4A 2ZLBA 1KPIA 3P9NA 1VLMA 3PFGA 4GOLD 1QAMA 3TR6A 2OYRA 2WA2A 1N7IA 1JR4A 3TQSA 1YZHA 3OFKA 5ERGB 4DCMA 3GCZA 2PLWA 4PIMA 3EVZA 3SXJA 1YFJA 2P3LA 2C7RA 5FUBA 4AX8A 3O31A 1KR5A 5FQNA 1RI5A 10MHA 1L1EA 4M37A 4QTTB 3FUVA 3NDIA 3OE4A 1JQ3A 2PBFA 3LECA 4Z2YA 3RW9A 5HIJA 4CKEA 2I9KA 4FSDA 2GLUA 2AOVA 5E8RA 3IV6A 4PYQA 3UJDA 2IDKA 1TW2A 5EIFA 3SM3A 1L3IA 4PWYA 5HZMA 3BUSA 4DQ0A 3NVMB 2AOXA 2IH4A 1WXXA 5EMKA 3FTFA 5GIOE 1RI1A 1SQGA 1NW5A 3FUTA 4KDRA 3VSEA 5GIPE 3DH0A 2G72A 1VQ1A 5DSTA 3EVFA 1U2ZA 2PVCA 2ZBRA 2AR0A 3R0QA 4PYIA 4RVDA 1Y8CA 3LBFA 5FULA 2PSSA 3KHKA 3TLJA 1R74A 3TM4A 4CTJA 4JXJA 3EVEA 5D1NA 2IDJA 3OU2A 2FCAA 5KYGA 4DF3A 2YXEA 3NVKI 4YUYA 1QYRA 3FZGA 5GOZA 3AXTA 3C0KA 1PJZA 3PX3A 4M7RA 1M6YA 3AWIA 5EHIA 2AOUA 3AJDA 5LQRA 3DUWA 2PX8A 2B25A 3KQMA 4E33A 2H1RA 3FYDA 3E7PA 3MGGA 4IWNA 3MTIA 1XDSA 4YUVA 3C3YA 3KPUA 2OZVA 5DX0A 2HTEA 1RI3A 3C6KA 4C08A 3G2OA 4GC9A 2YXLA 3G2PA 4KW7A 4MWZA 4CXMA 4G56A 4HH4A 3PFHA 1G55A 3HCDA 3DLIA 3G88A 2EG5A 2ZVJA 3KR2A 3OZSA 3CKKA 4FR0A 3JWIA 4QTUB 4RSRA 2ZW9A 4Y30A 2PX2A 5CVUA 5ICCA 3G89A 4E2XA 1IXKA 2QM3A 4KVZA 2ONYA 4RVGA 1BC5A 4RTMA 4OX9Y 2QRVA 1AV6A 2B9EA 2B3TA 3LHDA 5EOVA 3UBTA 3UJ8A 1YFLA 5MHTA 4AZSA 3HA5A 4X63A 1NBIA 4R6WA 3UJ6A 2FRXA 4PONA 5CCXA 2PT6A 3SX0A 4OA5A 2V74B 2Z6QA 5DLYA 4PINA 1D2CA 3AXSA 1P1BA 3GRVA 4R6XA 4ZTBA 4RTSA 4XUCA 2CMHA 1N7JA 3EEOA 3B89A 4GC5A 2PXCA 2ONZA 1QZZA 5EMLA 4GF5A 1R8XA 3EVGA 3DTNA 3FTCA 4HG2A 3IYLW 2YUIA 3P8ZA 5K0NA 1KPHA 3BXOA 1RJDA 2ZZKA 3NW9A 3P9IA 4KIGA 1SUIA 3R3HA 4RYLA 5LQKA 2PKWA 5DM2A 4AZVA 3LDGA 4POOA 1ORHA 4WXHA 5K0CA 1EAMA 3GDHA 4QPPA 5EHGA 2P35A 3A7EA 2GB4A 1L9KA 3A25A 3GIWA 1G60A 3CJQA 3GRZA 1JG2A 2NYUA 3KR9A 5ICFA 4F86A 2YTZA 1R8YA 5DM0A 4B17A 2EFJA 1JG3A 4A6EA 4DM3A 5EZSA 4CKBA 1JTEA 2WA1A 5U4XA 3VYWA 4YV0A 4X41A 5CVJA 3BWYA 3JWJA 4PYMA 5CUQA 3HNRA 1G8AA 2GAFA 4OBXA 4FSXA 1XVAA 2AN5A 5HIMA 2QYOA 4QQNA 1ZQ9A 4PCLA 5GM2A 1Q0SA 2OB1A 2G71A 1R6AA 2E5WA 1NW7A 3E23A 3JWHA 2ZWAA 1WZNA 3OFJA 2BM9A 4KRGA 5K0FA 3TOSA 3G7UA 3BGDA 1XCJA 3HCEA 3M6WA 4PCAA 4V0RA 5GP1A 4H0NA 4FT2A 4HRAA 4E2ZA 3M6UA 5LQJA 2JHPA 1MJFA 3MCZA 3QOXA 5FHRA 2UYCA 1X1DA 4E70A 1EJ0A 2PWPA 3FPEA 1SG9A 4CWAA 5T64A 3BWBA 5HOQA 2ZIEA 4F84A 5EPEA 3G8AA 3G5LA 2BR3A 3EEYA 3IHTA 2P3QA 3OCJA 3PX2A 3OZTA 3SVZA 4BP1A 2R3SA 3KQTA 4GOOD 5EEGA 1VE3A 3PTAA 3DXZA 4CTKA 3V97A 3MB5A 1VL5A 2P40A 4LWOA 2BH2A 3D2LA 4E2WA 5KQSA 3DMGA 1DCTA 3B3JA 5IKMA 2G1PA 1SQFA 2O05A 4C03A 2OB2A 2PV0A 1O54A 3DR5A 5B1SA 2PJDA 3T0IA 3M4XA 3CVOA 2O06A 3NJRA 2CWWA 1NT2A 2NXNA 3A27A 3EVDA 4U7PB 3THSA 5E1OA 2NP6A 2ZIGA 2HV9A 4Y2HA 1JG1A 1Z3CA 5E1MA 4BLUA 4X60A 5FWDA 5F2OA 3SSNA 4ER5A 4PYOA 5FA5A 2ZIFA 2QE6A 5KS2A 3BWCA 2AVDA 3HA3A 3C3PA 3FTDA 4PYNA 4MQ4A 2K4MA 3VC2A 2JJQA 4RTJA 1DL5A 2I62A 3AY0A 3ORHA 1X1CA 3CJRA 4UOEA 3OU7A 3LL7A 5K0GA 3HVHA 3UJ7A 1WY7A 2O07A 3TKAA 3DOUA 2BR4A 1FP2A 3G2QA 3EGEA 5E2BA 2C7OA 2UZ4A 3A7DA 4U7TB 5DRTA 3UWPA 4EMSA 5CCBA 2ZULA 2PXXA 4XUEA 1V39A 4LWPA 4RVHA 3GJYA 2O57A 1ZG3A 1X1BA 5D1HA 3R6TA 1KIAA 1QAQA 5EVJA 5KVAA 5EKUA 4QVKA 1SKMA 1NV8A 4RTPA 4ISCA 2AS0A 2HWKA 5IH3A 1QANA 3UJCA 2JH9A 3KKZA 2NXJA 3Q7EA 5FQOA 3PS9A 1VIDA 1NBHA 3GGDA 2Z6AA 1JQEA 2CKDA 3FUUA 3NTVA 4PYJA 1NV9A 1XDUA 3GRRA 4X61A 3REOA 1UIRA 3KPJA 2YQZA 2ADMA 3LCVB 4KWCA 3KQYA 5E1DA 5JR3A 4HGYA 1NE2A 2YR0A 1EG2A 1KYWA 2AOTB 1R00A 4C04A 5DTQA 3CGGA 1EJ6A 3HCFA 5DM1A 5EGSA 1UFKA 5E9JA 2CMGA 4P7GA 1PRYA 4ER7A 5LQUA 1WS6A 3FPFA 1D2HA 2IBTA 3GU3A 5CIYA 1XJ5A 3UJ9A 4RWZA 5K0LA 3CCFA 1I4WA 3HEMA 3KQWA 5EMJA 3B3GA 1JSZA 2FK7A 1IM8A 5BXYA 3T7TA 1BKYA 2G8NA 3L8DA 4OBWA 4L7VA 5EC8A 2QY6A 4RV9A 5P8WA 3T7SA 1XXLA 2OY0A 2ZZNA 3HVKA 3R9XB 1INLA 2GA9A 2UYOA 3DXXA 5HFJA 2NP7A 8MHTA 2ZBQA 5CVVA 1UWVA 5FADA 2OXTA 2IIPA 1ZGJA 3ELUA 3OZRA 5DM4A 5DT2A 2AOUB 3K6RA 4BLVA 1XDZA 2DPMA 1T43A 3NWBA 5M5BA 1G6Q1 5K0EA 1VP3A 3G8BA 4PGGA 4PGHA 3P9KA 1R18A 4BLWA 1FJXA 3I9FA 4ER0A 1QAOA 2R6ZA 2YX1A 3KR0A 2C7PA 4RTKA 2EJUA 4PYLA 4BP3A 1XTPA 3DMHA 5BP7A 2ZFUA 4KDCA 5JUWA 1NW3A 2ZTHA 4RX1A 2AN4A 2NXEA 3OPNA 3MCTA 4E31A 1WXWA 2VDUE 1KHHA 1RJEA 2GH1A 1YZ3A 2OO3A 2PT9A 3BKWA 3FRIA 3R24A 4GEKA 5CM2Z 3ER8A 3GWZA 3TM5A 5DTRA 3SSMA 4YV1A 4QPNA 4GOMD 5E2AA 4C4AA 2JG3A 1JSXA 3KQVA
chains in the Genus database with same CATH superfamily
4O4LA 1MCZA 1R0RE 4PHCA 2UUBB 4E4TA 2WSSD 5FBWB 4BAUA 1S2OA 1K7SN 4H1TA 5ES3A 5CA0A 4RTLA 3DXFA 2DTXA 2Y9MB 1KAGA 4C0AC 4Q24A 4FEYA 3CW2A 2X7JA 1UMBB 1DAIA 5EAIA 4G5OA 5EHXA 2DFPA 4I99A 3QXSA 5IS2A 3CZPA 2CDBA 2DKNA 1EDDA 2PSDA 1WPXA 4V0LA 2NUAB 1U9IC 3D7NA 4J0GA 2FUG1 1K8ZB 1Q0LA 2NZXA 3F0TA 1NBEA 4XM2A 4MKFA 1JLMA 3F7OA 4N7JA 4MW5A 1DXHA 5JNWA 4AMBA 1Z82A 3K6JA 1U99A 5F2KA 3DWFA 2ZG6A 5CT9A 3ROZA 4Y6OA 5JSQA 3T5PA 2R6GA 4IFEA 1HORA 4PLWA 1QE0A 1OT3A 4U2CA 4CI0B 5EMNA 3GFTA 5GJWC 2YV4A 2AKYA 3T3IA 4MGZR 4A10A 3AUTA 2GD6A 4IHJA 4AY5A 3MTJA 4PFKA 4PSCA 3SZRA 3IDOA 4O29A 4YALA 3RBXA 4A0HA 1YS9A 3MMXA 4IVRA 3D3WB 1OX4A 1XRLA 1CR2A 2I67A 2QTRA 2NUBA 1G6KA 3A4MA 3DZIA 3GUCA 3I5UA 1Z74A 3L0PA 2IEZA 5ERYA 3URKA 3VBCA 4D2IA 2ZK7A 4YV2A 7AT1A 5JADA 1USIA 1MO5A 4U00A 4YUZA 1FX1A 4NBSA 5FUYA 3KKEA 5LXTF 3PD0A 5JC1A 3QLTA 1L7XA 1RM4A 3C3AA 1NJFA 2VP2A 2YY5A 3RYCA 1SA0B 4DNQA 1AURA 5CGQB 4L72A 1SWWA 4LJ8A 1V9SA 3A1SA 5L53A 3B1JA 3FUCA 5ALZA 3S3TA 4LWQA 3QVOA 5L3QB 5KYXA 1KH2A 1Y33E 2OHVA 5LB4A 5BVGB 3PHCA 1QZXA 2ZSBA 1N3LA 3HUDA 1AN9A 4Z49A 3CLSC 2IYSA 4AF8A 4DILA 3NC4A 4JLSA 4QNRA 1E0KA 2J41A 3HG7A 3KAPA 4FGZA 5FCDA 3WR5A 4E14A 5J1SB 1UBOS 3AWDA 1GPJA 2PMWB 4EUNA 1Y8QB 1DXYA 4PG4A 3ETGA 4EYOA 2JA2A 1NVTA 2QZ4A 2AZDA 1Y5RA 1RQNA 1FMJA 3DHNA 5DB4A 1X6VA 4PGAA 4CLOA 4Z3DA 1OBCA 1YIDA 1SXJA 4MGHA 5FPPA 1DKUA 4RADA 1KO1A 3CWQA 1WCV1 3FDZA 4HGOA 4JL8A 2QTTA 3TNYA 4RLFA 4QZVA 5HTKA 5I7OA 2FSVA 2NV0A 5AI6A 1VKZA 1HTWA 1GLGA 3TLAA 1D1TA 1EFUA 1M2GA 3K20A 2J3JA 3UW1A 5LR6A 2G1AA 4K6FA 4AKEA 2N1BA 4NBRA 3FVQA 4JLUA 1ZONA 1GNPA 3LYUA 5L7TA 3SVLA 1MIOB 2YJTD 1D8TA 1WCXA 2HJ9A 3T99A 2VJQA 3UK0A 5BSTA 4D57A 5FH9A 1QNLA 5HEKA 3GK3A 3MB8A 4K46A 2ICAA 2VBIA 2Y77A 4CEJA 2G9RA 3ZXXA 3CZ5A 3IAS6 3LWBA 3OJEA 5CHEA 1A3CA 2O2DA 3TKLA 3K16A 2QUBA 4NMLA 3ECAA 1TAHA 2VDVE 3EVBA 3ESAA 1E1KA 2Y1GA 2X14A 4MV8A 2WM3A 1TJNA 5M3BA 1KWKA 4FNGA 3G8DA 4R54A 1R66A 2FEXA 2ZT7A 4KO1S 2NYRA 3OLXA 1CZUA 4FYVA 5A3SA 1NNI1 5DULA 3LRTA 4QSHA 3UJAA 5GOTA 5FR2A 1IIRA 1YI8A 2OG2A 3PC7A 1N4AA 3SSOA 2VXBA 4ZYUA 2XZDA 4GXNA 3HDQA 3NATA 4UEWA 4XYGA 2NYAA 4CKEB 4UNPA 4UXHA 5A3RA 4MS3A 2Q3HA 4Q9DA 1T0JB 5BOSA 1VFPA 3X1KA 4EG4A 3HCCA 2NV6A 2IXBA 4ZRMA 3OJWA 2NXCA 7GPBA 1MTZA 4JEHA 4PPFA 4P2GA 4HRYA 1VHJA 4HY3A 2AQKA 1AV7A 4PHFA 1G1MA 1L3BA 5TGDA 4MZXA 1VP9A 3WGKA 3BTVA 3EF3A 4HH1A 2FWRA 5H4HA 1KSGA 2BZSA 2FZLA 1FDTA 3D2CA 3RQSA 3QU2A 2IE0A 1MA3A 2VS1A 1E6EA 3FYCA 4J3JA 1ORVA 4XFDA 1Y7HA 1E5QA 1D6JA 3CF2A 4KNWA 4WKCA 4YCJA 4D6XA 5JT1A 2QENA 2Y4NA 1NOIA 4MHTA 3C3DA 1FRZA 2HWWA 1WTCA 3RVSA 1W1WA 3CFYA 2WKQA 1GGEA 2GCIA 3JALA 3K73O 4F1JA 2VYFA 3SHTA 1DKNA 3WWYA 2KSQA 2AFRA 1I6MA 3ESZA 4HQ6A 4IIVA 3EFHA 1CS0B 1U3TA 3G0OA 1ZD9A 5DGDA 3W6OA 2J3LA 1EE1A 4NBWA 3IQEA 1C9EA 4MV4A 4TMKA 1KZ1A 2HRRA 4AN0A 2R65A 2VTEA 1SEVA 4GUDA 4LYDA 1MRZA 3T54A 5IEJA 2OYRA 1N5IA 2Z8YA 1YZHA 3AZOA 3RRXA 3RHFA 2H4JA 3GCZA 4Y9UA 4DZTA 3DKVA 4ZODA 3TL6A 2C7RA 2H3EA 3O31A 5LLSA 5ALIA 4JYCA 3F7TA 2QRLA 4M37A 4ND3A 1GCIA 4J7UA 4KK4A 4UBMA 5EKDA 3DEKA 1XK7A 1LDMA 1Q92A 1R37A 1DE0A 1EVQA 1ORRA 1VJDA 3LKVA 2V6IA 3BULA 4HZGA 5DHUA 4RULA 1C1DB 1OJLA 3NHMA 2JGDB 3FUTA 3C5HA 4GICA 2FSFA 2NVUA 5BQPA 1JECA 4ZI5A 4Z4IA 3RVRA 3ROPA 1SEPA 4CGZA 4IJQA 5HS4A 4A0RA 4A73A 2VK4A 5ALLA 2C5BA 3D59A 3OH8A 5ALYA 4ETIA 5HZHA 4LNUB 1Q1GA 2H2DA 1ZR4A 1GNTA 4ZJZA 1JFFA 3ZHZA 1O2DA 1L4MA 3PFWO 4R2WA 1ZCJA 4G81A 4UEKA 5BSUA 2CJFA 3LY8A 1RD4A 2O3SA 3LX5A 4WA8A 1EBFA 3C0KA 3CVXA 1ISIA 3VHXB 3ZWYA 5JISA 4UULA 5I5GA 1IFXA 1P7WA 5BSEA 2VOJA 1IN8A 2NSJA 2QIOA 1ZD8A 3E7PA 4IDNA 3BQ9A 1LBEA 3VR4H 3DVLA 1BQ3A 4QFDA 5FOSA 1SQSA 2UZ1A 3C6KA 4C08A 5KOIA 4MWZA 4BNIA 1N3BA 1VHLA 2PAAA 2PMCA 4OFXA 1Z7WA 1OREA 4XA8A 4EA6A 3S4YA 4IRMA 4JP2A 2FZ5A 4UHFA 4ZT4A 4C2BA 3H11A 4EHFA 4YJHB 3IMCA 1IXKA 1HT0A 3S1AA 2CSXA 5ECYA 1TTPB 2QRVA 2ZSDA 4ZO4A 3FE2A 4HKTA 2HQSA 4B74A 4ZARA 1BN7A 2XH8A 2D3WA 5TQ2A 3F2VA 2RHHA 1LBQA 5DLYA 3GEHA 4Z0PA 4G9GA 4L8VA 3FMIA 5HIAA 3D3QA 5B1YA 1KQNA 1F7VA 2FEPA 1BTOA 4BFZA 5JQGB 1CJKC 2W6JD 1AH2A 3VKWA 3WYEA 2C1EA 4MS1B 5EMLA 3PQFA 2WY2D 3ULKA 2J3QA 2P1RA 1FXWA 3G7NA 1JYSA 3COZA 1Z68A 1Q11A 3KV3O 1O6FA 3EIFA 2QI9F 4OK6A 1EFVA 3R7SA 2AG0A 5HW0A 1KYTA 4XB6B 4MYCA 5CW2A 4BB9A 4EITA 4PTLA 1G60A 1D09A 1R50A 5HE8A 1F8XA 2HMTA 3BMCB 2X0EA 1TLTA 2PKXA 1R8YA 3FBWA 5DM0A 4LDQA 5IDXA 1JG3A 1NUUA 2AEEA 2WU3A 4CKBA 5B3KA 3B2EA 4YCAA 4BO4A 3L7NA 1TUIA 2FPMA 1AIPA 2I4MA 4IXDA 1OBVA 2B5WA 3HNRA 4TLAA 2Q27A 1AXRA 1XYGA 3LC7O 1VL0A 1X1SA 2CMKA 1G1AA 2Q3CA 1MABB 2QROA 2PYDA 3B9QA 3FZEA 2E5WA 5D3KA 3UAXA 2CLIB 4Q15A 5A6VA 1PWXA 3OFJA 1JBQA 3WKBA 3Q7IA 2KB0A 3ZIUA 3SX2A 3E1GA 1Z4JA 5EUMA 3HCEA 1T8RA 4F1KA 1OFHA 1DO2A 2G9NA 4BNJA 3O8QB 4ZD6A 3ZG6A 4BZWA 1FFAA 4Y2XA 1Y7PA 3KLPX 4YRQA 1Q1QA 2R1VB 4YRJA 2I8LA 1E63A 3NOQA 3PPVA 2YWEA 3GJ7A 3OHPA 1T8WA 3TTVA 4P3XA 1U3UA 4U02A 4MDEA 2G88A 1CUAA 2B98A 5C4GB 5TV2A 4L0QA 1UBHS 2COEA 3AP3A 4CF7A 1YDEA 1FDSA 3U4HA 4EG8A 2HA7A 1XRRA 1JAIA 3LBHA 3S55A 4YAGA 5FDFA 1R4NB 4ZALA 2GESA 2JLYA 2PH1A 3O2NA 4LGVA 3VMFA 5MFPA 2WKSA 1H42A 2D2XA 4F04A 1YZFA 2V0NA 3R6WA 2VXCA 1X1RA 5J2UF 1XVLA 1D7AA 2O06A 3SJZA 4URHA 1MC4A 3A27A 5H16A 4J6FA 3AH8A 1TZBA 1TF2A 1N34B 4WACA 5C31A 2BY4A 4MYHA 1M6VB 2ZROA 5EP1A 1X38A 2GPAA 2IV7A 1HPLA 3IELA 4RM3A 5IP5A 3WL3A 3LXRA 3ZYCA 3CRW1 3C70A 4FDUA 3AF6A 2PMEA 3HSSA 3ZEIA 2ZIFA 1RQRA 1OAAA 1DJLA 3BWCA 1K6MA 3SOZA 3ZZUA 1JZQA 3U16A 4UREA 1MZPA 3BICA 4MWOA 1X8XA 1UM9B 2FW9A 4CT0A 3KL2A 4EI2A 2O3JA 2V55B 3VR6D 1T8TA 1V7CA 4DV4B 1NFRA 3JARA 3LBAA 4MI9A 3S6JA 2O0MA 3D43A 4YAFA 2LPMA 5EIBD 1RJ9B 3VXKA 4F3NA 2X9VA 3F3SA 3M2TA 5A4IS 4N03A 1D7OA 2JVJA 2BGKA 3AQIA 4FC6A 2FRVA 1GAEO 2I4OA 1WSWA 3DDCA 1X1BA 4D74A 2Q6LA 4NU5A 2OOSA 3Q8LA 2ZPAA 1RFLA 3C1AA 1T5LA 2VCHA 4ZTUB 5L6MB 1IONA 5HP4A 1P3JA 1DKRA 4JA2A 3UJCA 3OG9A 4BFVA 5DTJA 1CZLA 1U0SY 3Q5GA 5IBQA 4EB8A 1C4OA 5B3JC 4YC7A 2VJDA 1I7LA 3QG5A 4G6ZA 4UPEA 4GKBA 3IOEA 1KJ8A 3VR6H 5AKIA 1KI7A 4BKMA 4LRXA 1TE2A 4UHBA 1V5GA 4N41A 3H8VA 5LZ7A 5E1DA 2XCQA 3E84A 2P2ZA 2AD5A 2PNFA 1AXGA 4LKOA 2GPBA 4B7ZA 2PZGA 3DMNA 4PN3A 3HYCA 2D7CA 4AG6A 3LP8A 4DMKA 1XX6A 4XDZA 3WYFA 3QFCA 3LY7A 3RC2A 3WO0A 3FPFA 4DIUA 5JOQA 1LA2A 5CB4B 4MS1A 1XJ5A 2YCLA 3BEDA 3BMNA 2D2IA 3CCFA 1H66A 5GGYA 1EHIA 1QBKC 3BTOA 3TRHA 1XQYA 2ES4A 3KVRA 1L4NA 5THKA 3ZE0B 4FINA 5JV5A 4NCXA 3FZYA 2JAWA 1F1BA 2FOLA 1IQRA 1UZMA 2CVQA 3P5SA 3PU6A 2H7YA 1FMLA 3DHEA 3EW9A 4QUBA 4D79A 2OXTA 2F67A 4CV1A 1L5WA 1HV8A 2BBSA 1DWUA 1ZGJA 3NHAA 3WBKA 5FBVB 1CDOA 2RGRA 1JG6A 2HT1A 3DAGA 1LD3A 3KTDA 2X42A 4RF5A 4YJFB 1VDMA 2CDCA 1M5TA 5H7XA 2XCSB 1SBNE 3SG0A 1E2BA 2VF4X 4YEDA 2G1JA 2CD7A 2FFBA 2OESA 1I3KA 1OFIA 2RK4A 4EYKA 4RTKA 5BP7A 3M82A 1YJ5A 3EIHA 2LGJA 1HK7A 2BMVA 3U17A 1NDHA 1ZC3A 2W4MA 2AMVA 4BAGA 3H75A 1F8YA 4PLFA 4IYJA 2VUIB 4ECAA 2P3SA 1SKQA 3DBRA 4PG6A 2V5UA 3CWZA 3FRIA 1CX9B 4M4SA 5CM2Z 5JZOA 1JH8A 3I52A 5IYZF 3AF1A 2JG3A 4W9NC 1JEEA 3OM8A 4Z9AA 3ER9A 1PUXA 3T0FA 3C7DB 4HVLA 4AJHA 3BEOA 2Q3EA 3F49S 5ICGA 3NMUF 4X95A 4EFNA 2A0KA 3UB2A 3EXHC 2P9EA 3DNPA 3WIUA 3TRFA 5C5CA 4ZAWA 1JEDA 1SB8A 2HSWA 4M9SA 5EL0A 5AW3A 4TTRA 4FTWA 1VCOA 3IB6A 2VBFA 2I2FA 2GGSA 5LOVB 3OF5A 5IC5A 3NBYC 3O82A 1LVHA 2GM9A 2IYOA 2Q4BA 1XPJA 3B7WA 1Q0RA 3L7YA 4J29A 4NH4A 3G5TA 4GFDA 4A3SA 4MKRA 1GUDA 4GOND 4MWTA 3AVOA 4EAQA 5HBRA 2D6FA 5IJ9B 4FFSA 1TCUA 1R1DA 3ZWMA 4QU0A 1RVDA 3H84A 2PUGA 4B2YA 4AURA 5JH7A 3CE9A 1FPMA 1DCFA 2C2HA 2XMZA 2ZTMA 3P9XA 5H3HA 1YB7A 1NI5A 2E4VA 2EARA 3D8HA 3KTFA 2GAOA 4QT4A 4G85A 1JWLA 1KJIA 1ZM9A 2P5UA 4JOSA 4C1BA 3J81A 1AO0A 2JI9A 2VJPA 4WVLA 4Y0AA 3Q3HA 2C9BA 1QH1A 1WVMA 2A59A 7MDHA 2ORYA 2FPKA 5TMDA 4D81A 1TU4A 2GRJA 4M8SA 5JSYA 3AR8A 5J3JA 1Y6RA 3GXOA 1YZQA 3L06A 3PQ5A 4D8WA 3FHLA 2HA3A 2GHQA 4I4LA 1A2QA 3LK6A 3WO1A 3P7MA 5GM1A 1WUIS 2PX5A 4RPGA 1FXUA 2AJCA 3LKDA 4KOAA 1ADYA 5KAPA 3SYRA 3MLEA 1M1YA 1G0NA 1WZIA 4HUQB 3DBHA 4RIEA 3R5HA 4A6DA 4DNFA 4F2DA 4AJJA 5CURA 1F3LA 4GX5A 2QL5A 3HJHA 4RTQA 2XCRB 1FMTA 2I4RA 4LZLA 4DLZA 1EDBA 3G0CA 4Q7MB 4TMYA 5G0WA 2EQAA 1O57A 1NJ1A 2VWPA 3QWIA 1G20E 1VFNA 1UPUA 3O0DA 4J0EA 3KVYA 2XXAA 1YRYE 1AKRA 4PTYA 3MPUA 1P9LA 4DCJA 2XUOA 2A86A 4Q3KA 2ZBGA 4KH0A 4RESA 1ORWA 3U7FB 2HHJA 3C3KA 1Z7EA 2C84A 3ZK7A 1DJPA 4J90A 1XNRB 3NV7A 5TPZD 4G25A 3VOBA 3SC4A 3ADBA 3U61B 4CG1A 5EE9A 2B6HA 5F1YA 2W4QA 4JU8A 2P41A 2DERA 4HYQA 4TTJA 5NULA 2WYOA 5FNVA 1TJYA 2EYQA 3AJ9A 4RD6A 4HQOA 1DS6A 3QKSA 5J2TF 3FB1A 1D8AA 4DC1A 3OF3A 3FCYA 3M4JA 1U28A 5KX5F 3K0BA 1B6TA 2WWRA 4B3GA 1P2UA 1VPTA 1SG0A 2CNOA 2GZDA 4JBNA 1D0SA 4X24A 3VZQA 2XQGA 3SD7A 3PZBA 1EEHA 1C4KA 5JRZA 4GT1A 4IXWA 5C8DA 1ZAYA 1CUCA 1YR8A 2A3RA 3KJNA 3AL2A 4YT5A 4EA8A 4JI7B 1AM4D 4DV1B 1XR3A 2FP4B 1JU3A 1PNTA 2O8CB 2BH9A 2O7RA 2VQDA 1W48A 4IEEA 4R4JA 3V1LA 4EJMA 2KLBA 4NU0A 2WZCA 2QLMA 3QRWA 3H1AA 4R8MA 1NVXQ 3EXIB 2EJTA 3LKZA 4IIHA 3HB9A 2EAUA 2V0GA 2H2GA 3NT5A 4R7ZA 4YJFA 1EK6A 1JYEA 3DTVB 3ND5A 3OTWA 4U6QA 4LIPD 4CRWB 2PS0A 1O03A 5I6DA 1ZVKA 3B51X 3N87A 2VZLA 4CM1A 4KHPB 1Y7IA 4U7GA 1TA4A 4ND7A 5C8XA 1CTQA 5AQEA 3AETB 4CBVA 3OZUA 4HT3B 5B36A 1PZXA 3ROEA 1IPFA 2FPOA 1CJMA 2CE2X 1E99A 1ZOOA 4H1VA 5ILGA 3VPHA 1XZIA 3K7EA 1EM8A 3AYXB 3E35A 5LQCA 3W90A 3O8DA 3KQOA 3E9MA 3P9CA 4G4SP 1WP4A 2ZUUA 1KWGA 1W35A 3BKXA 3GEEA 4IBOA 4IHKA 1O9HA 4KEAA 4IFTA 1Z3IX 1TA9A 2EJCA 2J5BA 5CTJA 2GPJA 4EFMA 5ALHA 4GDMA 2JLWA 3GROA 4TLLB 3SJCA 4YV7A 4MICA 3QENA 1AQJA 2M6SA 3OQJA 5ARCA 1PJRA 4GD3Q 4OQDA 3DLBA 1ILEA 2LWIA 3WLHA 4EI8A 4HQRA 3RS3A 4K9DA 4EUSA 3TG8A 4GZ6A 4KV9A 5JYBA 1NM5C 3LVFO 2CCGA 4Q1VA 2B8EA 1M1NB 2YNMD 4U8GA 1JAXA 4HLNA 4WCFC 3V6LA 2XDAA 2DH6A 3T7RA 2I6GA 1U1FA 1NBWB 2N47A 2R1TB 2LW7A 3HA2A 3U56A 3G9XA 3QKRB 3T95A 3ZS9A 3VKVA 3K6SA 5I4KA 2BTQB 2ZAOA 3DZBA 1YNOA 1F8FA 1PNQA 3NNDA 2ZT6A 3IILA 3N7AA 1P1JA 1ONSA 4M54A 4CMHA 2Z09A 4YDRA 2ILVA 2RK3A 2IGTA 5JFGA 1JLSA 1YU6A 3ELYA 2DQYA 4FDTA 1P45A 4HDMB 3AL3A 4XPIA 4DG8A 1U2QA 3JQBC 3GJ6A 4RV4A 1GPMA 1YOVB 4YUXA 1J1ZA 3RC1A 1K9SA 1FP7A 1YDHA 3OHSX 4NFSA 5F7ZA 3GLSA 5JXIA 4DKJA 4GQBA 4EK9A 3FXAA 3PXGA 5K0ZA 1BX1A 4R1LA 1SO8A 3ZY4A 5JBIA 2VPPA 3F9CA 5TQJA 2R8OA 3DYIA 1SCDA 1V8ZA 3C5WP 5BR7A 1I6KA 3EXIA 2IITA 1TO2E 5A5FA 3N2IA 2JW5A 4Z8YA 1DADA 1FSSA 1GKUB 1L5FA 3W05A 3X1MA 4WDQA 2YOGA 1DAFA 1AGNA 1N7IA 4Z2AA 1ZOIA 1OB5A 3TK1A 2FH5B 4RPCA 1WRBA 4R9RA 3MPOA 4J4TA 5FYQA 4TL6A 3L8EA 3UTCA 3LBIA 2O19A 4JLDA 5TRTA 1GZ5A 3ZD8A 1STOA 3FSGD 4DDTA 1JQ3A 3ISJA 2JCVA 4QWMA 1V11B 5HIJA 5K3FB 4B43A 5BSFA 3UW3A 2GLUA 1L7AA 1S2IA 3HWX1 4RVCA 4X85A 1Q1BA 4UDXX 5E8RA 5ELLA 2AR9A 4QPCA 3FTFA 4YACA 5KIAA 2Z3ZA 1HTBA 4IF4A 2NACA 1V5WA 4RD0A 3C7TA 1UMBA 3H1EA 1V16A 2BM0A 4JJAA 1JLLB 4JK3A 4QYXA 2PVCA 5FWXA 4DR5B 1JWAB 3PHLA 4KR9A 1W30A 4ZPJA 3KWJA 4Z7QB 4DLSA 2GCOB 5ER9A 1QKIA 2GNOA 2F7SA 2B0CA 2F17A 3I9V1 1AY0A 2HSGA 4OSEA 2JIZD 4OYRA 1LPBB 2XQIA 5K8CA 1QYRA 2EZ8A 1CDEA 4G5FA 4J43A 3HCNA 2W6OA 3EXEB 3AWIA 4D99A 2Z9BA 1GNSA 3CRNA 3SZGA 1P0MA 5IUJC 1XT6A 4O2BF 2ATEA 2X4DA 3NG1A 4YASA 1HDIA 3FYDA 4UKDA 4DT1B 1MNQA 1TCVA 5KNDA 4X7RA 4QULA 3HBLA 3FSJX 1KI3A 4KVGA 1H9BA 3E7XA 3TZCA 4NCNA 3ZLTA 5FUVA 4OQQA 1ZN7A 3NALA 1EZZA 3I32A 4CKCB 1XROA 2GLXA 3A3KA 1YQXA 1BEEA 3KR2A 1E7SA 3NWJA 5EMHA 3UAVA 4ZVUA 2OHFA 4E2XA 2QM3A 1D2MA 1VYVA 1L4EA 1TZMA 1VSUA 3IV7A 4H18A 3UOGA 2MWMA 2WQ6A 1DFGA 1YR6A 5ALJA 3BRWD 4D9BA 5CVTA 2PUCA 3WHPA 1DLIA 3IXLA 3D5TA 4R1PA 2GNAA 1T0UA 1EJ2A 5JTTA 1DQYA 1D2CA 1O77A 3A2LA 3F78A 2QE7A 5JEDA 4GYYA 2Q2OA 3C8HA 3EEBA 3BTSA 3HDYA 5E0KB 4IQFA 3FGZA 1NPYA 1VE6A 3OLVA 3S8EA 4M1MA 1WP9A 4ZGBA 1XWFA 3R0XA 3KDSE 1FNMA 3LZCA 2ID9A 2ZZKA 1WXHA 1HG0A 3VYUB 2PTHA 4HYEA 3L6CA 4BQFA 1T6XA 4KNVA 5CAEB 3RVQA 4POOA 5CLJA 4Q01A 3H2KA 4GBMA 4HWRA 1ZU4A 2RJ3A 3GYBA 3MJCA 1YQQA 1ZIOA 2RAVA 3NTRA 4RQTA 3TJZA 3D4BA 1U2EA 4RSHA 3EPJA 1I10A 2ZJ8A 1XQ1A 4M1SA 5J5AA 2YINC 4NR0A 2QP9X 4DG9A 5AW8A 1MABA 2QBYB 2M9MA 4PF1A 4OXKA 4WFQA 3M7IA 4ZEXA 1NYTA 4C9BA 1ABBA 1WQ4A 5LKRA 3OMWA 2AFHE 4C6HA 5HKKA 1N6NA 5I8PA 3Q8KA 1NSFA 4QXMA 4DQVA 2OB1A 3QEJA 1MUUA 5LMCA 4XTCS 2VL7A 3HS3A 2RAFA 2BM9A 1FZTA 3KTAA 4N8EA 1JR6A 4UDYX 5KI6A 4REQB 3ZQ6A 3P0HA 3F1LA 4C7MA 4WOCA 1FYXA 2DUUA 4GOKA 4A0SA 4HAZA 1KAHA 5CA0B 1FNSA 8ATCA 2Z2KA 2ZRQA 1MJFA 2HH9A 3K9GA 2MHCA 5KKAA 3SDZA 4CCYA 4DSNA 2GZ1A 3AVYA 1U90A 3G2JA 4WUTA 3V8NA 5AVZA 2H4YA 2ZTUA 4C7OB 5EP4A 4B80A 2Y0EA 2VH1A 4XASA 1D9XA 2LCQA 4AMGA 2BKXA 5MF6A 4K3UA 4AW9A 1BQEA 3EEYA 5BQ5A 2A33A 3HRHA 4E3WA 1NJ2A 1OAKA 4OU4A 4BP1A 5FUMA 4R98A 5IM4A 3Q3GE 4A4DA 5I8WA 3L4EA 4CIBA 2C07A 3VR0A 4LJ9A 1CIJA 2W8BA 2QT1A 3EGDA 1W4LA 1IZZA 1J24A 3I01A 3L9XA 4QVIA 2PRZA 3C8UA 3B3JA 4C0BA 2YJ4A 1Q5PA 4EZEA 1O54A 2W5UA 5CYPA 2PJDA 5B1SA 3IBSA 1JEYB 5FAXA 1E66A 2CWWA 3BJRA 2R47A 1QFYA 3C7AA 1C9KA 3PBKA 4UAJA 2DBRA 1BEZA 1QE3A 1XU7A 2WB4A 3PHBE 4UQPA 3PXBA 1XTQA 4RS4A 5ALDA 2GVZC 3O9VA 1T5IA 4ER5A 1MO4A 4G0PA 4HUJA 3UK7A 2E55A 3X44A 6GPBA 2ZS8A 2WJVA 3ZCSA 1SU4A 5C80A 2EFDB 3OKPA 4EYGA 1NY5A 2VRBA 4LYAA 5ENZA 4KWEA 1OZHA 1EDZA 4MARA 4FCCA 3WLNA 5K0GA 1JFTA 3KEFA 4E5KA 2YH2A 3D31A 3OCCA 4NYIR 4LXQA 5A5GA 5BYAA 2REOA 2R7KA 2YIDA 1EU1A 2PMFA 4IXMA 1QHXA 2QVXX 2R44A 1I51A 3CVUA 4ERNA 3UENA 2XCIA 2C97A 3P4UA 3DBLA 3PQ7A 3BBLA 1WW2A 4UNSA 3TDKA 4JLAA 5ESWA 2RGBA 2AUNA 4FHEA 1K5PA 4QVKA 1UP7A 2QSJA 2PGJA 1A04A 3JVDA 1K4MA 4QJBA 5DHPA 1OASA 2H2IA 1QLWA 3R40A 4TL7A 4ARZA 5BPHA 5TIIA 1YRWA 2O2EA 3CV3A 3QMWA 5AHXA 1VLZA 4JLOA 3M5DA 3MILA 4BWGA 1L7QA 2C4TA 1XMXA 2WMOB 3ZKWA 5B2EA 5AJTA 4UVIA 3TEFA 3WLIA 3USES 1G20B 1H94A 4YJ2F 5C3UA 1P0FA 3N5CA 2HBZA 5IBPA 1NE2A 4K1LA 1GZ4A 3FIUA 2JGNA 1XJ0A 2RGYA 3ABRB 2QGNA 3CGGA 3LNTA 4IVQA 4M88A 4X1IA 3IVMA 4XWKA 4UE3S 3N59A 2CMGA 4P7BA 1VJRA 3X1JA 3EOAI 5J43A 5KNBD 1L8LA 2QQ5A 4LE2A 4OXIA 4KK3A 4B3IA 5DEIA 4JI6B 3P4YA 3UWDA 1CVRA 4YO8A 3IVCA 3KQWA 1RZRD 4EB0A 4ENWA 4R0MA 3D3JA 1M6WA 4ZKDA 5ICSA 2EW8A 1QQ5A 3RYHB 1BWQA 1ZJWA 2X8JA 4JP3A 5P8WA 4G0YA 1PFYA 1Y1TA 3D8NA 4MB0A 1JFRA 3R3UA 3R9XB 2AIRA 2BCGY 3PXUA 4B71A 1E0DA 1CJTC 5EZ5A 1GARA 4J16A 4KC0A 1DTEA 2O2CA 4RU1A 4WLNA 4K8RB 5TS3A 2FKNA 2CJWB 1XDZA 4C5AA 3U49A 1DPGA 1HDRA 4INPA 5GVSA 4IGAA 2E3JA 4FNOA 5K0EA 4I9HA 4DAEA 4YPVA 3DSRA 1XXHA 2PYIA 3V4RA 2ZETA 1WKVA 2QTNA 4R8KA 4IO0A 1WU8A 5AXCA 2YX1A 1XSEA 3K5HA 3KAKA 2WG0A 1WQ3A 3DMHA 5DBEX 5JUWA 3QVLA 2R25B 4BVLA 1GPKA 4BX9A 3ZGNA 5KYKA 2Q2NA 3I9JA 2EW1A 4LRYA 1AD2A 1NSYA 2XCUA 2QSUA 5TS2A 2IOQA 2D1RA 1BW9B 4PY2A 1GILA 4JT9A 3I09A 3QKIA 4S2UA 3W04A 4P1ZA 2DBZA 1RHKA 2J7PA 4CLRB 1Q7CA 2G5GX 3B70A 5G40A 3SK0A 3JV7A 3KG2A 3SXPA 3S27A 3AY6A 1AMUA 5ALUA 2VA8A 4R41A 4BX8A 4D3FA 5L3VA 4X65B 3OWXA 2GS9A 4DQUA 1V1MA 1RKXA 4W1SA 2HA4A 2O8EA 5F77A 4ZOLF 1H9CA 4BU1A 1OGJA 3FAKA 4Q1DA 4WFKA 4BLSA 2O0HA 3TIGA 3NTLA 1N6KA 2BMWA 3CW9A 4KMSA 3I2GA 1D1SA 4OHWA 3V8MA 1GADO 1PYOA 1POXA 4EABA 3AFMA 1OXSC 2QZPA 2K7FA 4DG5A 5K3OA 3DZGA 5HQJA 4HLUA 4HWOA 4BO0A 2GTHA 5DGCA 4KR0A 4MXDA 3S2SA 3TMKA 4ZK6A 3KJEA 3ASUA 5IVHA 3BZWA 3FBGA 3W4JA 4PAGA 1NUAA 4X20A 1GUAA 2LUOA 4QARA 2C03A 3U3RA 2JJ2A 3HL4A 4AY4A 5EWJB 4MSUA 1BOOA 4MV1A 4RKYA 3SVTA 3ZK9A 3ZE8A 2I3ZA 1DUSA 3BS4A 3W34A 5KTYA 5FFFA 4PANA 1A4UA 3HM9A 1XJQA 4G1VA 3RYHA 4LJKA 1LQTA 4UM9B 2XD4A 4N7BA 1Z45A 2XMGA 3M4YA 3GQVA 5SZJA 4AUNA 5IYZA 5JD5A 5KNLA 1PU2A 2POCA 1MGOA 4F9TA 3NAZA 4B6JA 3M70A 4RDHA 1NMEA 2D13A 3OE7A 3AVPA 4EPTA 4ZK2A 5EJEA 2OILA 1C4WA 2XUQA 3KEGA 4BNDA 4KO3S 1GAJA 1S8FA 3IERA 2H51A 2Q3DA 4X1OA 3EQ2A 5KTMA 2OCGA 1Q1ZA 5EIWA 5LDDC 1OC2A 3U4QA 1XZHA 3BSYA 2FY8A 4OHBA 3T4UA 3J7TA 4CLOB 4G37A 2N3ZA 5J1TB 4EHAA 2R8PA 1VPWA 1MKYA 1M8JA 1B43A 1GRCA 1RLOA 4GG1A 2RHJA 4I6GA 1PR5A 3C1UA 1O0CA 1Z8FA 3ANXA 3KFVA 4EMTA 2Q5QA 3O3NB 2VSYA 1IOLA 1E3WB 4ITRC 1PDOA 2XV1A 2O2JA 4Q0MA 3VPFA 5LMZA 3K9BA 5B6IA 2DECA 3SXUA 1B74A 4HNGA 1XL0A 1B41A 1G8KA 4OD0A 1BVUA 4U39A 5CT5A 4EY6A 3WKDA 3LDHA 1N3IA 5GJBA 2EHJA 1QPBA 1WSBA 3LWZA 4G1BA 1TM5E 3HHPA 4KO4S 3UKDA 1BS1A 3KJHA 5DI3B 1A77A 3TTTA 2SCUB 2VFAA 1CQJA 1RAIA 3V1NA 5JSKA 2X0JA 3IODA 1Z4PX 1UXOA 1BMFA 5BV8A 4PX2A 1QHGA 4DR3B 1ZZGA 1QRSA 2UVDA 1YU9A 4Y1RB 4JXXA 4PCUA 5DHTA 4YUWA 2XDYA 2ZDHA 3R9XA 1KP9A 1RI2A 1UFOA 5BMOA 2GR9A 2IYXA 4HDOB 1RBZA 3UFXB 1GSAA 1GKKA 3TB4A 3PEUA 1NNEA 3E2IA 1AA6A 4FWTA 2WYUA 3HYTA 3IAM1 1UBFA 1S7CA 3WGOA 3A4VA 2SBTA 4MPTA 4FYMA 4CZ2A 3B6EA 4C07A 2Q6VA 2VNHA 2JASA 2WAAA 2WJHA 4QUDA 2QRQA 2VPXA 1KMQA 4MAMA 3U5TA 4ZEMA 4JQYA 2I87A 3D4NA 2OBFA 4MPJA 3O0TA 4Q9LA 1RS0A 2EXXA 5JNVA 1ODKA 2C98A 4HGQA 3WYAA 1XMIA 2IEYA 4IUCS 3U31A 1CR4A 4P22A 1G2OA 2O1EA 5IFKA 4IIJF 3U4AA 4RL6A 1CQPA 1ISJA 3HYNA 1IXYA 2MSKA 1P4AA 4MUYA 3IBCA 1V41E 4D0RA 3H9EO 2G9VA 3TI9A 1II0A 1ZJZA 2RBEA 3QPBA 1ZICA 1O97D 1Y81A 1ODSA 3KDAA 4HQNA 4KRFA 4V1CB 4HAIA 3HZHA 3NQ41 5M04A 4RA9B 5A5VA 3P45A 4BE4A 3DMTC 3PEYA 4ZDJA 5ALEA 3NTUA 2P9CA 5B4VA 1YC2A 3DM9B 4QVGA 3GUYA 2R8ZA 1U2SA 1XVTA 2A2ZA 3GN1A 1Q7GA 1FP4B 1WDTA 4Y9RA 1Q6ZA 2EWWA 4AZWA 4EDFA 4OL9A 2ZOSA 5BYBA 1TKRA 1ECPA 1Z0AA 1V95A 2ATCA 5HMMA 4HXGA 3QIAA 2C5SA 4MR8B 1YS2X 2RI1A 4AK9A 3KOUA 1XB2A 4J16C 1A98A 1SXPA 3N2GA 3C6MA 2II6A 4GGPA 2Y0BA 4KQGA 4RH1A 3U9LA 2QLNA 4Q93A 2PR7A 2XYQA 4K9QA 4O3FA 1XLUA 3OE5A 1DELA 2JGJA 2QXYA 3BF7A 3D0QA 3IAHA 3PB3A 5JI3E 4OHXA 1J0XO 1E2IA 1R5BA 3PGXA 1DZ3A 1ICIA 4HH3C 3A9CA 1KQPA 4Y2UA 3UF0A 4HI0E 3HH8A 2R6JA 5TQVA 3GPIA 5IBRA 1DWQA 3A3OA 3K6KA 2YS6A 3KJGA 3VPSA 1SIWA 3FCUB 2GZRA 3GA0A 3JWPA 1ORIA 2FW8A 3A4IA 1RABA 4KRXA 4KSYA 3Q2OA 2QL7A 3I4LA 4H6VA 3RROA 4OHYA 1Z2NX 1FS6A 2NADA 3RG8A 3ZGOA 3K1TA 2CV2A 1MIOA 2K7ZA 4FYHA 3VSCA 4EHDA 1LDYA 1ID1A 1RZ3A 3WRYC 5H0IA 1GQYA 4XYEA 3N0RA 1ZKDA 1LH0A 3LLCA 5L3SA 3MRSA 2XRYA 2EX0A 1SUWA 4OXNA 4UFPA 5D6NA 5D2CA 1NURA 1NF2A 1WL8A 5DXFA 1GAWA 4OFBA 3JR7A 4AQDA 1IHOA 3DFUA 3FBTA 4WK4B 1GU0A 1QGOA 3ZY2A 4TS3A 3OMXA 1L5HB 4ILKA 4AX8A 1NMQA 2PJZA 5FFNA 2ZXFA 3IIMA 3ZGYA 5EYPA 4EP1A 1NNLA 2R85A 3AC0A 4JVMA 1QVVA 2AQHA 3O3MB 1ONNA 2ZE5A 3ZU5A 421PA 5KHLB 4MUIA 4FSDA 1I7NA 2XUHA 4PYQA 3QQPA 4D8UA 3SM3A 3HDTA 4IQ8A 3ETHA 2BEKA 5J4HA 1CUZA 2IH4A 4XR9A 3NT2A 3CZRA 3VHQA 1CR1A 2N1MA 3C8ZA 4HDRB 2C92A 2ODEA 3ACCA 3OBBA 3W2HA 1KH1A 2EBHX 2H1IA 1YCDA 4GYJA 3WGGA 1NVFA 3EVEA 1TGYA 3CR8A 3BD7A 3GH3A 4EY3A 5IJAA 1K6EA 3TVYA 4OI0A 1P74A 4ZVMA 3NVKI 4QECA 1DJOA 1WNFA 4FYXA 5LU8A 2GI4A 4A92A 4DM7A 4KAXA 1PFUA 2QAGC 1UFVA 3V80A 3N0VA 3MGGA 3MTIA 1YONA 5AI0A 1M2HA 5DTIA 2F8SA 1G21B 2CV1A 3KLNA 3MFQA 3EQ6A 4BV2A 1Q1NA 2BMFA 1F1JA 1P4HA 1XQ6A 2P11A 3JRXA 1RYEA 5HF9A 2ZT5A 5C7IO 2E4YA 1DG1G 2YZMA 3VO8A 4QTUB 1UKBA 3Q9SA 3J7AC 3EXG1 3IQHX 1X0VA 2ZW9A 3B6KA 1TQHA 3UV3A 1FLDA 1J8VA 4KVZA 1BC5A 2WQ7A 3CF4G 2B4TO 1YFLA 1JZSA 3FKSD 1PAUA 3TD6A 4AZSA 4ES6A 1M6VA 3AIIA 4D97A 1WUJS 4KQCA 4YXWA 4YMVA 1F6DA 1M2OA 3BRCA 1QU2A 2Z6QA 1ZHHA 1OHHD 1CEXA 1L5QA 1WJGA 2XA9A 4PINA 3E81A 3HVUA 4O25A 3BD9A 3QUTA 4QUAA 3UT6A 5JYCA 5LPNA 3W5IA 4NC9A 5FLYA 2NU8B 5EE3A 2BKVA 2NO5A 3ANSA 3ZY6A 1DRWA 2FGJA 3FCCA 3CR3C 3IYLW 3PICA 5K0NA 3H5VA 2O8FA 3P9IA 1M76A 1G5HA 5MN6A 4Q1CA 3QVMA 4CMIB 5K0CA 4Q4HA 1XTIA 4X90A 4MJXA 1W581 4KN9S 1ZVJA 3R3ZA 4I8DA 4FKBA 1QMPA 4E7PA 3GMDA 3QVSA 5CDYA 2W22A 2WU4A 2FEWB 1V1JA 2XGSA 3FCSB 3RIXA 1CUEA 5LZ9A 4ESVA 1Z56C 3OFND 3Q1LA 3U3XA 4IICA 2BMAA 2YFKA 3JATB 4BL5A 1U04A 2AN1A 3JTEA 2ZTVA 4E51A 3RWMB 1VRVA 5AHOA 3QW2A 3CNNA 2RSLA 2DWCA 1OBOA 3R1IA 1JQBA 1XN1A 2XOEA 4RQUA 3FWHA 2G0NA 5HIMA 4DPKA 2IZ7A 1ZMRA 1MMFB 2ZZNA 4RE6A 4CM9A 4JC8A 4P0QB 1UDAA 4GXQA 4M0KA 1SH7A 3SBOA 4DPLA 3PJEA 5FRDA 1RM3A 4NEGA 2RKOA 2A5LA 2V7QD 5BYJA 3DZ8A 2XNDD 3T3EA 1GXSA 1IXRC 1M34A 1TF5A 4C89A 1YB1A 3A1FA 1C1HA 4DCNA 4MLCA 4NXNB 5H8WA 2AV6A 1DNPA 1NU8A 3TR0A 3ZTTA 1VCHA 3FHOA 1V9LA 1LQUA 3L1IA 5EUCA 2ZS7A 4RPIA 1XAGA 3H7AA 4R9VA 2ZQYA 3U9SA 4MMYB 1KGDA 4DIBA 2IIQA 4DW8A 3AKEA 2RONA 5K8TA 1CIPA 5AQ1A 3UJNA 1YJ8A 3EA5A 4A1FA 5AM3A 4Z53A 3V3KA 4J8PA 3JZFA 4B6SA 3DMGA 2AXQA 2HWYA 4IJ6A 3GV0A 3ICCA 3NBUA 3I28A 1JEQB 2C9OA 2OB2A 2FW6A 3OQNA 3DE1X 1OU0A 4G1MB 5KYUA 3RVPA 4B4DA 2REQB 4XUGB 2Q6IA 1CEQA 3WLRA 3HP4A 4U7PB 5ITWA 1KVRA 2DB3A 3WB0A 5AHWA 1O8CA 3CKMA 2WFZA 2NU6A 4XEHA 3WGNA 3DZFA 4KUEA 4WXEA 3VOSA 3COSA 3LUFA 4IZIA 2RMKA 3N8IA 1KY5A 1SIBE 4D44A 1O6ZA 4NFHA 1OFGA 3TOZA 2BHRA 4PYNA 2C5AA 4BFTA 3IMFA 4JA0A 5FIUA 1D2EA 1OPRA 3K8OE 1HT2E 2ZS9A 4EVRA 5KYXB 5TR9A 1PGNA 2IQ5A 4DYDA 3MJVA 2CFOA 1I9CA 1O08A 1M72A 4ZQFA 3INTA 1RMQA 1SVIA 5F98A 5TSDA 3ZJYA 2BCJQ 2GJKA 2CZQA 2B1IA 2HREA 3A6HA 3I73A 5DRTA 1S3SA 4YNBA 4OGKA 521PA 4DIKA 2I6SA 4ML3A 1Q0QA 3NIBA 4BECA 1Q20A 3G5MA 3RT9A 2PFSA 4ZZ3A 1EUCA 1YTUA 2H4HA 3ICQB 2GM3A 2PV7A 1ELOA 5I8ZA 1AUXA 4TV9F 4BCDA 2HWKA 1BWRA 1AS3A 1SULA 4TN1A 1IEQA 2VYND 2WFMA 4DVJA 2BGIA 3GRAA 4AJ4A 3QEBZ 4I3FA 3GEPA 3IT1A 4YO7A 1UFRA 5J2TB 2JGRA 2D7DA 1CQIA 1UIRA 1ITZA 1VL2A 3QM1A 3GJ0A 4N40A 4HPWA 1PL7A 4QYSA 4XGIA 2ANBA 2P68A 4TVKA 1Z4OA 2YXPX 3ZEAA 5KVVA 1K7EB 1TECE 1J56A 2H7VA 3NGXA 3NC1C 4JIGA 3RUCA 4G84A 5BW8A 5JY1A 2V03A 3A2MA 1COZA 3PPXA 5C81A 3AIKA 4C04A 2E4ZA 2Y2UA 2MMCA 3OLZA 1X39A 2J45A 3V7FA 3AJAA 3QPVA 1JALA 5DLPA 5I9TA 1QIDA 4LDPA 4P7GA 4YMWA 3K72B 2PS3A 2PFKA 2AE2A 3GU3A 3ZPXA 4YI5A 4CG3A 3PWKA 3W5UA 1G6HA 5AH0A 3PFIA 3EHDA 1I1QB 4D45A 3SF0A 5EMJA 2PMDA 2IYZA 3AEZA 2VRNA 4JEUA 4AZ3A 3EZYA 3GD7A 4WLEA 4C7JA 3A9TA 3ZV3A 4E0BA 2A5GA 3C15C 3GQBA 4QD3A 4KQHA 1NNSA 4XQ0A 1JFVA 2GOYA 1L0BA 1PLLA 2AF3C 1A9TA 3VGPA 3V1TC 4R0NA 4MQLA 1ZNZA 3N75A 3NWBA 2ISSD 2JFUA 3WWEA 4L07A 4M8IA 1UMKA 3FF1A 3DE6X 4QE3A 3P9KA 1E7QA 1TD9A 1ZOLA 2EDCA 2WUWE 3DG9A 4Q4AA 3R4CA 4BVBA 2PRJA 4BVHA 4FJ2A 4WJLA 2DPLA 1C7FA 4AKHA 3PUKA 3RRFA 1KKLA 1UK9A 1Z0FA 2DOKA 2X6TA 1I2MA 1OVGA 3E7FA 2SKCA 1ADBA 4TV9B 4L6AA 4E07A 1GGHA 1NJGA 3AEKA 1SVNA 4WINA 1QH8B 4NDNE 1XALA 4YMSA 3T5MA 5KOJB 2OO3A 3P9RA 1GQRA 1Z5OA 3QVVA 3LFHA 4X64B 2O8EB 1QP7A 4L0MA 2O8DB 4R2KA 4IGKA 1N5LA 1Q2XA 4I4IA 5J4LA 1WBDA 1YVDA 4N82A 4LS3A 3SHVA 1CNFA 3VJKA 1QG0A 2W6ID 3E03A 4GKVA 3KVVA 1E9AA 1VGRA 2NG1A 2R1ZA 4ZHQB 1P73A 5KX5B 1JHVA 1CVIA 4G1UC 1Q0HA 4FCVA 4HLCA 4U3JA 4CM3A 1JQDA 5TE9A 5JAUA 3FOBA 3LBYA 3TSZA 4B4WA 5JATA 1WKCA 4NZNA 1TT5A 5CGZA 1X8LA 2QX4A 1CHNA 1YB2A 4AYXA 3OO0A 1TXGA 3SZ3A 3FMOB 4HMOA 1YVUA 2DKFA 3H6HA 2H6EA 4HWPA 3SHQA 4AWAA 1WMEA 2I22A 4P93A 5JSZA 3WSTA 3QPUA 2Q4TA 1W59A 4JC4A 4KGXA 2YZ7A 1U81A 1VE1A 1H2BA 2H00A 1KVUA 1E5VA 3QFSA 2Z8XA 3H17A 4HB3A 3Q8MA 2WTNA 1B6GA 5COAA 2EEPA 4JCCA 1SUSA 2GETA 1T2UA 1E1QA 4BO7A 3AK4A 2FFHA 3O8LA 3BB1A 1OU4A 1K3TA 3PPYA 3AVQA 4XJXA 3ORYA 3ZDXB 1I3LA 2HLDA 4UM9D 4B09A 2XEDA 4II7A 3FOEC 4QUKA 3H1FA 2D8MA 1UOEA 2X1MA 3R8CA 1VBNA 2PZFA 3CNBA 2O3TA 3O1HB 1Y1KE 1QHNA 2P6PA 3EEQA 4K9NA 3AHJA 4ZCRA 4LQLA 4D9MA 4XWWA 3GPLA 2PIAA 5FI1B 2PRYA 4LRTB 3ZHRA 2E1RA 4U9HS 3K9LA 1GN9A 3AZPA 2FCRA 4Z7NB 1Y9DA 2PN1A 1GGNA 3EC1A 4GVXA 1P80A 1DC4A 3LIIA 4H4EA 3E9CA 3EPRA 3O94A 3D8TA 3K09C 3KE8A 3W2TA 5F9FA 4ALLA 3GLFB 2H65A 1RBQA 2BJHA 4TUYA 3OJCA 4JR0A 1LTQA 4D9NA 5FNVB 5FT9A 3DDNA 3O7WA 3OVMA 4OQZA 5AXBA 2DZDA 2ZDGA 3M1YA 4LQCA 4LV5B 1FXSA 1KEVA 3C3BA 4H7IA 4CEIB 3FZQA 2W6PA 1NU6A 3EIEA 3LPDA 1BD3A 3OEED 2VDNB 4F85A 1UC9A 4YCNA 2A4KA 1HFEL 1AS0A 2GXUA 3JWGA 1PBNA 1NR5A 2KJQA 4GS5A 4RORA 1U8YA 2TECE 4WZAE 3SICE 4X91A 5CITA 3LDFA 3WKEA 3NONA 1M2JA 1UT6A 4ROSA 2O7QA 4QAQA 1UP6A 3MELA 4ZHQA 1BHJA 3OX3A 4YRTA 5C37A 3S2EA 3KZ1E 5BN3B 4UVEA 3ZQ4A 2AI2A 2QX9A 2D0DA 2ZU0C 4ZGGA 4P3NA 2M6KA 4Q3EA 2I3GA 2BONA 1YKSA 5TJHA 1FPQA 3BL6A 1SXHA 1WZEA 2HA5A 1R4MA 3AT1A 2OKGA 1GTVA 2IUEA 5KJCA 2UYHA 4MWGA 1Y0BA 4DLUA 3CNLA 3KOZA 2RHTA 1J39A 2C8LA 4BWYA 1WAMA 4UZSA 2HSZA 3C45A 3UOWA 4B2LA 4RD4A 4YQZA 2X41A 1HL3A 3GQBB 3T1HB 1MF7A 1OFTA 3DMFA 4L4RA 1CE8A 3IT3A 5D51S 2ZSIA 1X0XA 3G02A 1SBYA 1C7ZA 2NVOA 3M1LA 5KNDD 4NZ9A 3EGOA 1XNJA 2C29D 2V65A 5FA8A 3HEAA 1CNEA 2PL3A 4CV3A 2CCKA 2UAGA 5DV9A 2VRCD 4WW0A 4AS2A 3BFVA 1ZI9A 3WLEA 4O5AA 4XFJA 4RIIA 1YGYA 3E48A 4JQZA 4R81A 3GLGA 4O3MA 4HWSA 4KFRA 4MVCA 1K3UB 2PL5A 4D4HA 2VJMA 4JEMA 3VPCA 1OH6A 4ARSA 1X86B 5DN9A 5TC4A 4CMJA 4R69A 2G0AA 1J1UA 4KBFA 4EM6A 3L5OA 1MB9A 2W6IA 2I2WA 1U9CA 4MGYR 2RGAA 3K70B 1VHQA 5IKOA 1BKDR 3TW0A 1SXJB 3WDLA 4KIFA 3CEMA 4BFYA 3EGCA 5FB3A 1M0TA 4GLBA 4MR7A 1PZNA 1XUOA 2FN9A 4IJMA 4IVPA 4MRSA 5B2ZA 8ABPA 2IOFA 4B45A 4CEIA 1W85B 2VDKB 3PFKA 4TMVA 4DRYA 1BNCA 5LM3A 4DYHA 1G20A 3EHEA 4Q4CA 1PJLA 5DM60 4FLMA 3KUCA 2C4NA 2FFJA 1C0IA 4CM5A 3ZD9A 2PNJA 3KT6A 1R9JA 3KTOA 5K4HA 1DINA 1HSOA 3PJGA 3H83A 2O1WA 4XRRA 5AYVA 4CFSA 3HR7A 1SVLA 5FLKA 4INJA 3T5DA 4J94A 3HJGA 1VG0B 4YRLA 3LPMA 5JSHA 2FEAA 3K15A 1URPA 1OIWA 2RGNA 4EUHA 1P77A 3I64A 4QJ3A 4ALNA 1AMNA 2RD2A 4JYBA 3F4KA 4MQUA 1ULZA 5KCMA 4M0UA 1GV0A 4NIMA 2HHCA 3S2ZA 3DEAA 4L95C 3CLKA 3DGFC 5DH9A 4GQAA 2H1WA 1G64A 5ISMA 2IHNA 1WA5A 1Z12A 4LHEA 1HDGO 1GQ2A 1YA6A 5DBGA 5FTWA 3GC6A 2WRZA 4X3OA 1J49A 4C4ZA 1I1OA 3UT0A 1EEXB 1ZH4A 2PZJA 3L4JA 3TZLA 3AF3A 4KTVE 4QLBA 2G4VA 2JFFA 3VDQA 4JJ8A 1TZ2A 1P1HA 2C77A 2ZLBA 3E18A 1FE8A 4G0MA 2M6RA 1T2EA 2V96A 5IWCA 1Y98A 2I8CA 1VI5A 1WEKA 2XVZA 4RPHA 1M2EA 1UBUS 2VYQA 2WMYA 3RYIA 5A06A 3GLGB 4DADA 3IUJA 4BVKA 5JALA 3VR4D 5B2FA 3TOXA 2QXUA 2G83A 3GNTA 1HM5A 3IPXA 1CZHA 2ZB8A 1RI5A 3TLYA 2JL1A 3MF4A 3NRCA 4QTTB 4ASUD 4BJ1A 3FF4A 3ASYA 3OT1B 1CRLA 4M6WB 1KJNA 4RGVA 4UUAA 4ICIA 1SNYA 1NVMB 3IE1A 2HSEA 1WMFA 1T4BA 1UWCA 3MRXA 3K5WA 3QMPA 4G0QA 4KJZA 1OH5A 4D26A 1XD2A 3AESB 1RYMA 4GVPA 1KY2A 5IZCC 1Z26A 2HQ1A 2BL4A 5GIPE 3LGXA 1R6VA 3C3JA 4ARCA 4AJIA 4YJ2A 1EVIA 1NKTA 3S81A 1U2ZA 1PFWA 4HPJB 5DWVA 1YOBA 1EXVA 4MW4A 1AKMA 1AKEA 3EULA 3ICVA 2HLNA 1T4DA 2Q2QA 5D7BA 5JG7A 4Q39A 1D2RA 2OXIA 3VC3A 2NT3A 1GZVA 1U7XA 1TKCA 1B7GO 1SKBA 2QUHA 2FJUA 4D41A 1UL1X 1XHFA 4EKEA 3SEFA 2AOUA 2I91A 3DUWA 4BQNA 2BTQA 4P86A 1VSBA 1AUVA 3C3YA 4Z8XA 2GAJA 3KPUA 4KPUB 2YC4C 4J0KA 1EKXA 1S2DA 3EA0A 3M3HA 3O4RA 3JRNA 4OYHA 3CS3A 2IIBA 2FLKA 3Q6IA 3Q0IA 1S1CA 4MW9A 4JL5A 4O33A 3PFHA 1G55A 1UEJA 2ZJAA 3DLIA 3G88A 3L0BA 1TT5B 3Q3CA 1LU9A 1NBME 1NUTA 3QYAA 4M9UA 4JD5A 2F4VB 1X7YA 4OHPA 4YLGA 1BWSA 1R7RA 4NCIA 2B3TA 5JY6A 1IXSB 1U5AA 5HCUA 4UUQA 3DDZX 4EB6A 2QZZA 3U7RA 4ADSG 4B3DA 1IN5A 1YJBA 1KF0A 5JDIA 5CFNA 1GSIA 3FPLA 2XB6A 4QYMA 2QTGA 3OZVA 3NBQA 1LLCA 1X70A 1K7YA 4HN9A 2IY9A 1ULAA 4BB5A 4RK6A 1NVKA 1N9GB 1J9EA 1V71A 2DWOA 1QZZA 4OAOA 3ZHQA 2XYGA 3DTNA 5CD1A 2E2WA 5HQTA 3P8ZA 5LUBA 5A5EA 1RJDA 4J1QA 4KIGA 4JZKA 2PUFA 2Q3FA 1N4DA 1KA9H 4QL3A 4KAFA 4RYLA 4DV3B 1H3FA 2R1UA 1X7WA 4KO8A 1JGTA 2XZTA 4EA9A 4XSGA 4D4KA 3E27A 3A7EA 2VYVA 3ZWXA 1A0OA 2HBYA 3LU1A 1RWNA 4EQ6B 2QYTA 2FFRA 3Q9LA 4K9LA 5JCXA 3R3XA 4RD1A 3EQ7A 5JCJA 2R7LA 4PR3A 1NBAA 4KPYA 1GPYA 2P77A 1VGQA 4BOYA 4DM3A 4H0FA 1JTEA 2PVSA 3LLUA 1QP4A 4NMWA 5ICMA 1Q14A 3SC6A 1PK7A 1PJ8A 1C3VA 1PQPA 3UWMA 4HAXA 3RSOA 2Z43A 3G68A 5ER6A 1QHHA 2H0AA 2ZWAA 5B64A 2I8AA 4KCGA 5DNWA 2JBHA 1XRJA 3OLYA 4ZDIA 2HO4A 4GPD1 1QHEA 3DV2A 1XTVA 1DHRA 3BC1A 2ORVA 3HFGA 3PLNA 5FHRA 3SZMA 3P19A 4E70A 3B52X 3RS5A 2VT2A 1WIWA 3ZQJA 4H17A 1R4AA 1IZ7A 4JI2B 1JEYA 2JEZA 3DZKA 2OMKA 2ODAA 4Y9DA 2AR7A 2PO7A 2ZJZA 3O90A 4L0DA 1JDUA 3G8AA 1VKHA 4RJKA 3UCEA 2XITA 1XZJA 3ONWA 4DA9A 3OZDA 1G3QA 4FFLA 4LYEA 2E4WA 5GONA 4XGRA 2ZI3A 2HGZA 2WHPB 5IAGA 1P60A 4HB4A 1OE0A 3NAQA 3KKLA 1XYYA 2AT1A 4LWOA 3FNBA 3JYLA 7ABPA 1DAEA 4NYJQ 1K4KA 2OCYC 4OIMA 1QHYA 4ZQHA 1D9ZA 1A2OA 1DT5A 4H7KA 4UMDA 1FJGB 1PYGA 1V7PC 3D6TB 3S8MA 3N2LA 3DZCA 4WERA 2EJBA 4RZIA 1DV2A 4Q37A 3X1YA 3FCXA 3E15A 4RHEA 5CTAA 4DABA 2OHJA 1GTG1 1RPNA 5JMTA 1ESDA 2I2AA 3CZAA 3SCZA 1ZO8A 1ETUA 4JB8A 1E4OA 1RJ9A 4DQKA 2HV9A 3TMYA 1KYXA 1RACA 3DFFA 1JG1A 4CMKA 1C1YA 4CR8A 4BLUA 4KMOA 4NENB 1XCBA 1ZUNB 4KQKA 4UJ5A 4LVOA 4IIUA 3FKSA 2PRKA 3I34X 4DMFA 2P75A 1S9DA 1EG7A 4YONB 5BMVB 3CF6R 1SPBS 4R1OA 2V9ZA 1FFCA 4MQ4A 5ALTA 4BIIA 3AY0A 2PLFA 2DUJA 3WTBA 4FCWA 1DG3A 4UJ3A 2R5WA 2A9VA 1PWYE 3G6KA 4LTMA 5FAKA 3ZBTA 1QG4A 3I45A 4X84A 4BGUA 4Y1EA 4DA8A 4OQYA 3ILYA 4R2JA 5K1ZA 3VBEA 1Y6JA 4IMRA 1H3NA 1E1RA 1RRVA 2ZSJA 1T4CB 3B6IA 3JVEA 3LSYA 1FVXA 4JP5A 5E7JA 2E7ZA 4R2MA 1WB9A 5DBHX 1P6UA 1P81A 1RXEA 2OORC 2CC2A 2WTEA 4EMSA 5HGXA 5CCBA 4GMHA 3ZGVA 3RVNA 1N57A 4IXNA 3X1XA 3U40A 4N0MA 2UV8A 4CI9A 1KIAA 1YQEA 2IYFA 3DFKA 4Z99A 2E89A 2JH3A 2B82A 3QOYA 4PBTA 2I71A 1SAYA 2YN2A 3HN2A 4PX3A 1NHWA 4ZZ2A 5JD6A 1EUQA 3FG9A 1DQNA 2BHTA 2N75A 1L7PA 3WGLA 1ODFA 2ZANA 5A7FA 2PLAA 1X14A 4CTOA 3CVJA 3H18A 4DMMA 2C2MA 3KYCB 1R5JA 1Z5UA 1O95D 3PUIA 3IUYA 3ZUPA 2G9ZA 3PDIA 1S2NA 1SC3A 2W0SA 4YREA 1SFRA 3NHPA 1XLTA 4LZJA 3U44B 3RPEA 4DQDA 3KQYA 1YI0A 3WWZA 4E1AA 2WF9A 4H3SA 5H3LA 5BNWA 2XBUA 1SQ0A 2GKOA 3GT0A 1SWVA 3ZVMA 4N3BA 4FZ5A 4I55B 5ALXA 3GFFA 1TZKA 5DTQA 3QLUC 3P2OA 3OX2A 5EGSA 4IH9A 4RKWA 1UJ4A 2VF7A 4PAMA 3UMYA 1RPAA 3PUXA 3GARA 1PWZA 4A8PA 3M6LA 8OHMA 1O0BA 1NVWQ 3R76A 4E2FA 3OIGA 3D3WA 4RWZA 5FPYA 1W2HA 3UM9A 4NYMR 4YGXB 4BNYA 1IDN1 3QX9A 2FK7A 1LDBA 2G8NA 1QO7A 4P4LA 1NQOA 3UOAB 3S40A 4IM7A 4BZPA 4RKEA 1Q19A 1LVGA 2B83A 1HEYA 3E22A 4B73A 3HVKA 3LDAA 2I80A 4F71A 3GPDG 4UHCA 4GH5A 3KWLA 5EJFA 1USVA 4HATA 1TIPA 1JE1A 2VDMB 5A6SB 2HK8A 5ENDA 1R64A 4RMJA 3UK1A 1KIFA 4J2OA 4N1AA 2F8MA 5EE5B 4ARVA 5JCOA 3MTBA 5BSKA 3LW7A 1GNQA 1G5TA 4QFCA 3A6EA 4ZKEA 3PE4A 5E4FA 4ESHA 3BX1A 4H7FA 2Q46A 2NVBA 4FFNA 4FFVA 3RYIB 4ER0A 1SZDA 4F7WA 3NM5A 2R6ZA 4LXYA 4UU7A 4TVSA 3KZOA 1YQWA 2PKQP 3W5JA 4X62B 2YKGA 3CZ4A 3DVSX 3T8YA 3AILA 1SCAA 4TRMA 4DLBA 1QHHB 2WJGA 4XYMA 4DR6B 5JDCA 5K20A 2Q5CA 3ANNA 3DVQX 3HKBA 3COVA 4DNOA 2UU9B 2WVAA 4WK2B 3VYVA 1QYXA 2ZYWX 4QXAA 3RSQA 4BVAA 3VAZA 4M0PA 1PIWA 3NEPX 4G8JA 4FD2A 4RENA 2IYYA 1IG3A 1CHDA 1D04A 2VOEA 2Y8EA 3CB2A 3HCRA 3IAFA 3NHWA 5DTRA 5AO9A 5I9MA 5IANA 3HXOA 1UC8A 1XJWA 2VP4A 5TVGA 3E8SA 3QLJA 5CCEA 1QOPB 2QVZX 3GRYA 1JLRA 1W47A 2IUUA 5JPIA 3NDPA 4NZPA 3W8EA 3DEJA 2CV0A 1A4RA 1YBVA 2FPXA 3ZDYB 2A30A 5C2JB 5JASA 4BV8A 4FK8A 1H3EA 2NPOA 1DPFA 2FMIA 3FSEA 4KAJA 2NU7A 4RO0A 2R7NA 2CE7A 2DUWA 4FFMA 4A8JB 3W7BA 2FP3A 4LRWA 1OXBB 5CPBA 5K8LA 2Q5EA 3OSZA 2V6GA 4HDAA 1W94A 3LLMA 3E0XA 4N7MA 2BHSA 4UASA 3LP6A 3WK5A 2PZKA 3R7NA 1O94C 2IYNA 2A5FA 3JVIA 3MWLA 4P4NA 1PN3A 1PL0A 4ZOEA 3RIYA 4CG2A 1BE8A 2XY4A 4ZU1X 4Z51A 4KVAA 5K09A 1FFBA 1YS1X 3D6HA 1ICEA 3FRHA 3LQKA 4FFBB 4HFRA 1YVRA 2K87A 3H0CA 4JXKA 5KINB 3NDJA 4TL8A 4G0UA 2I1WA 1N25A 2X8AA 3O8NA 4XVQA 5CK4A 3DW1X 1WB5A 3TH5A 3ZDAA 1QV6A 1SVWA 1UBNA 4TMTA 1RWPA 1PGQA 4TKUA 3INNA 5DYNA 4RKQA 2FJPA 4ZT5A 4DHWA 3MW8A 5T67A 3OETA 4DA4A 3TUZC 3SDBA 4GR9A 4K9SA 3M6VA 2RJOA 2ZI6A 1TQ4A 2Q8NA 3HCBA 2FJ0A 3DHWC 1SUBA 2J08A 3PKIA 1U7UA 3R77A 4MQEA 4G8DA 3RM3A 3EIXA 3T52A 3KBBA 2QZ9A 4Q3AA 1X7HA 3E7WA 3SJAA 3VPGA 1P9WA 2CXQA 4BTEA 3SC2A 3FROA 1DX4A 1BFKA 4YRBA 3G2LA 1MJGA 1PSDA 4YLYA 2GN6A 4YAUA 3MCWA 4ETWA 3BXHA 5AJYA 1G41A 4Z0NA 2WF7A 2ZRPA 1OXTA 2YXDA 3HJAA 1E9FA 4BJ6A 1DX6A 1PJCA 1G8JA 2AYXA 2JHCA 2NO6A 2XAUA 4W1RA 3TVTA 3LUDA 4A0QA 4EVIA 5LOVA 1J2YA 2H85A 4JLVA 1O5TA 5CX1A 2BGLA 1G3RA 2W6NA 2YVKA 4R84A 4AO7A 2VCEA 1LUAA 5AVRA 2F8LA 4P8RA 5KWVA 1Y6GA 1JTVA 4XCXA 4CMBA 2WC1A 1LY1A 4L8LA 4QQKA 4EKYA 1Q91A 3HCPA 4NZOA 1L4FA 3RADC 3OEHA 3MHTA 2C7GA 4KE8A 1JVBA 3O38A 1DQZA 1WDMA 2Q4DA 1NUHA 3M5PA 4HB2A 3PGA1 4UTVA 4N9WA 4WL0A 1AQNA 3D3EA 1XF1A 2VUTA 3DC7A 2Z58A 1C3XA 2G82A 3GPCA 1N2XA 3KZKA 3PTZA 821PA 1E1MA 3VR4A 3C97A 1EVKA 2VZ9A 4OQMA 4QHYA 2X2OA 3I0MA 3JALB 3D8BA 4FGSA 4XH9B 4NWIA 3O84A 1HNWB 1RZRA 1BYIA 2X8BA 3PNQA 5HUHA 4RMHA 3MMZA 4O2AA 4RVFA 1WETA 2QGFA 1ZGAA 2QLFA 3CLSD 2FMHA 3I58A 4L08A 3OOYA 3K9CA 4Q12A 5FPQA 4HNVA 1NR7A 1JSCA 1UK8A 3DKKA 5IAAA 1LK5A 1HNNA 2YHBA 4P54A 1U0NA 5JRDS 4A27A 2R6FA 2IP1A 4MGEA 3TRDA 3VKHA 3B78A 1LDNA 2EZUA 3UCFA 1F4VA 1UMCA 3B5IA 3O4IA 3A9UA 3QWHA 4MIKA 3OOHA 4NLLA 4PLHA 4WY8A 2LDXA 1YO6A 1EP1B 2KQUA 2JLZA 2IBSA 3W6NA 4CLEA 2NN3C 1K3FA 3K5PA 1GCAA 1ECJA 3GLIB 3O3OB 3WGHA 1KARA 3B3AA 3YASA 1QVWA 2REXB 5DTMA 2IXAA 3U5ZB 5E38A 1XFDA 3VU9B 3P5BA 5J2TA 1WZ2A 4N5HX 1U7HA 3MWDA 5K3EA 4Q19A 2ONCA 2ENUA 4PQEA 1ECBA 2C54A 5IT4A 2IXTA 5K03A 3HFRA 4ZRNA 1QGUB 1FTYA 2V4MA 2WILA 4HOYA 4MAFA 3ZXUB 3N8GA 1HYEA 1WY5A 1S8NA 2DP4E 2V8OA 3OPYA 5JJKA 1TKAA 1YXMA 2YFHA 4IV8A 1Z5VA 2I3AA 1ZUD1 3LSTA 4QOGA 2YICA 3DEFA 3KXDA 3A9WA 3C1TA 1J2JA 3SIWA 3OIWA 1W46A 5IDYA 1AZLA 3FKJA 2I7DA 3PNMA 4XSVA 4HCJA 5IAKA 2ZSEA 1DEHA 2SHKA 1P7PA 2XTJA 3ETJA 5JPCA 4X00A 1KK0A 1ZH6A 1KYZA 4FW9A 3L4BC 1HEUA 3FPCA 4UBKA 1Y3AA 3SYKA 4C0SA 3JYQA 4EFDA 4NV1A 1E3WA 3ZCTA 1BX0A 2HTFA 3MNFA 1LZKA 2QX8A 1RAGA 1HRKA 4UBJA 3GLRA 5AWFC 3RAGA 1V7QA 1KS2A 1PDVA 1TEVA 2VNSA 3EG9A 2W37A 4FOTA 4ZQBA 1IQUA 5DZSA 2CLDX 4LRQA 3BGOS 4KI7A 4LVUA 3AVTA 1T34A 1B3RA 3PGKA 1WPRA 2ZAYA 1U4OA 1U8TA 3B3QA 4OJTA 1S0UA 2IXEA 1GYPA 3NWEA 5JFTA 3REGA 1LC0A 2D5LA 3VV3A 1AHIA 4Q34A 3AU9A 2GA8A 2HRQA 2XDWA 4DLTA 1XXHE 2NPIA 1K7XB 1PL8A 3AJ8A 2NNLD 1VIAA 3V9AA 5J2UB 2Y1WA 4KDFA 3FSGA 1N2IA 2I78A 1UJ2A 1N6RA 3A3PA 3C3CA 3CUVA 3D8RA 5CFMA 1ULSA 2FFQA 2Q28A 1L5GB 5AW7A 1XHLA 3QBEA 3GLIA 5I9SA 1Z4MA 2QKYA 1AHNA 3UJ3X 1BD4A 2GZSA 5BMVF 1MHTA 2J4FA 1KPIA 4EA7A 1VLMA 4L4YA 2FN7A 2W2OA 2PU5A 1A7UA 3UAGA 3JQ9A 2EX1A 4I19A 1KEEA 1M0WA 3MJHA 5T8KA 2FQWA 1FUUA 3EYAA 4J7XA 1XQVA 1XTUA 3MWDB 3SXJA 2BFEB 1V37A 3FDXA 2N9UA 4EJ2A 1HLDA 2BLLA 3KD2A 1FFDA 4HADA 4ZCQA 1YMVA 1AUOA 2EL7A 2W2PA 4RETA 4A2WA