2OO4A

Structure of lnr-hd (negative regulatory region) from human notch 2
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
CLSQYCADKARDGVCDEACNSHACQWDGGDCSLTMENPWANCSSPLPCWDYINNQCDELCNTVECLFDNFECQGNSKTCKYDKYCADHFKDNHCNQGCNSEECGWDGLDCAADQPENLAEGTLVIVVLMPPEQLLQDARSFLRALGTLLHTNLRIKRDSQGELMVYPYYGEVAGSKVFLEIDNRQCVQDSDHCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for autoinhibition of Notch
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle,signaling protein
molecule keywords Neurogenic locus notch homolog protein 2
total genus 65
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00066 Notch LNR domain
A PF06816 NOD NOTCH protein
A PF07684 NODP NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3310 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oo4A02
3.30.300.320 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2oo4A01
3ETOA 4ZLPA 2OO4A 3L95X 5CZVA 5CZXA
chains in the Genus database with same CATH superfamily
3T5KA 2CXEA 5AJ3J 3TAQA 1H2UX 1FA0A 3D54A 1XNQC 5JRHA 2H65B 2GVZB 1U09A 4LR9A 1N6QA 5D78A 4ED2A 4X62C 3QJLA 3WDOA 2QN6B 1SC1B 1MSWD 3HVRA 1ZTWA 2B56A 5LMUF 1FRIA 2GV1A 4M8LA 4EI2A 3C46A 4RW7B 3N01A 5KFOA 3MM8B 1T7PA 1OQ6A 2PMWA 2HZAA 2V4QA 2KB2A 4TKTA 2R8KA 1N33J 1MWYA 3LAKA 4U5YD 1RT1A 5DG9A 3LUSA 1K47A 1RYRA 2WZ1A 3POTA 2DKOB 3NNAA 3TVYA 3OR1A 3JXOA 3HM9A 3PV8A 1FHTA 1RCXB 3Q24A 2C2ZB 4Q2MA 3OUYB 2CQHA 3IR5B 2CWXA 3FCEA 4X64C 5L38A 2UVRA 1TL4A 3EGNA 5D4NA 5EUHA 3QZ8A 2DNRA 1IKXA 4C0OC 3GJRB 5HVGA 4H4MA 1I94J 1S99A 1WC0A 4MYUA 5FD1A 2LXUA 3M2UA 3NBPA 3G71S 2YNIB 3OTDA 1N54B 1RCOB 4HR2A 4M5NA 1XMBA 2OGUA 4WFXA 3K58A 1GMWD 3KG1A 2HLUA 1VQOS 3MMCA 5J1EB 4FYDA 2XNRA 2XNQA 3RR8A 4CO4A 4FTFA 3G82B 4DSEA 3T1YJ 2FVSA 2IA0A 3LALA 1F2GA 3UX2A 5BSTA 2VQEF 2ZWOA 3OSNA 3LGHA 3M32B 3RR7A 2YWEA 3OLBA 2DHGA 2AYAA 1NU4A 3MEKA 3QYYA 5E5NA 1HIYA 4ZLPA 3NPDA 1D3WA 3P8BB 3H25A 1RHJB 4F4KA 3LA0A 1V3SA 1MW7A 2FDNA 1VK3A 3BZQA 1XWLA 2KVQE 3P3DA 3TVKA 5D4PA 2XCPA 1BQNA 4CO3A 3W9JA 3C5EA 4P2XA 3G6XA 2HWTA 2M88A 4G65A 2R8GA 1AUDA 1URNA 4O3PA 1S0VA 3IO1A 1RKIA 3EDQB 3RV2A 1Y7PA 3Q23A 1UWAA 3NMAA 2CA9A 4ITSA 4OHZA 4C8NA 1L3TA 3F41A 2PFDA 1YJRA 1Y0HA 2E9TA 4WZMA 3D5MA 4B3RF 3FCCA 4RZRA 1TFYA 2M8HA 4LJMA 5KFIA 1RE1B 3D6MB 1O5JA 1SQGA 1T03B 3MUVP 3LNVA 2XLIA 4DN9A 4DPOA 1KQSR 2XI2A 2W2PP 5KFRA 3DLLQ 4FF2A 2NXEA 2DXDA 3PRVA 4RW9A 1VI7A 2JZ5A 1KD1T 1ICEB 1H7XA 1UEKA 4ZA1A 4E2FB 3H20A 1JLAB 2KRBA 2A2DA 3KLVA 4ZN3A 2XS5A 4GO5X 2BV3A 4KV8A 2JLGA 2HHPA 1RWUA 3G7SA 2MM9A 5D4LA 2R9LA 2JL9A 1PGZA 4D56A 1GX5A 1RAOA 1VRTB 3O5TB 4IRKA 3A4TA 4C0BA 2ZVSA 1WELA 1CJTA 3SCJE 1IN0A 2FGCA 3A3OB 1CPZA 5HVFA 2OP5A 5CZVA 2W9BA 1Q5YA 5KG7A 2ZJRQ 1E6VB 3MPUB 3AXKA 5KFPA 4O4RA 3JSRA 4LF8J 4LF6C 1KC8T 1T05B 1XIQA 4TLRA 3RZAA 3MPWA 4GMKA 4LF5J 3H5SA 4ZLLA 4F67A 4CT9A 1NLKL 3ENQA 2X3DA 3MM5A 1L3UA 4ZPBA 3LPEA 1Z2ZA 2BACA 2DNMA 2E7WA 4FN5A 3AXMA 3MPVA 4ZIVA 4DV6J 1N36C 2WONA 1YI2S 4X62F 1NO8A 4ID5B 4EGLA 4DL5A 3V6DB 2UUBF 4JI1F 1OPIA 2IJFA 2HVEA 3M8QA 4WIIA 4LVOP 5LMUC 2FJDB 3R9XA 1KFSA 3BN7A 2QL5B 2E66A 1MXAA 2WVFA 3GB0A 2A6OA 3OQ2A 5BXIA 1EZZB 1FRJA 2LDIA 2WCXA 2HWIA 4QW9A 3G6ES 2C2RA 2ROEA 3GJSB 4N7TA 3UCZP 2FD2A 5HROA 1VQPS 4LBHA 2OHDA 1BQMB 5A76A 3MTKA 5HVHA 5IT9D 2P6SA 1RISA 2QZ8A 1CULA 2V4JB 4G1QA 5D3GA 5F8JA 3KK2B 3IR6B 3AB2B 3QIDA 4DV3C 3RB3A 2ZH4A 4ZK7M 2OPSA 2V2ZA 3NLCA 2LEBA 1BA3A 3QFWA 2BKOA 2V63A 3VCDA 3OHBA 2HNDB 2Z56B 1FI4A 4CDIA 1HL6A 1TMJA 1Q4RA 1F1BB 4M5HA 3VGTA 3E2EA 4KHPC 2CQIA 1CQMA 5E3CA 4DR4F 2K3IA 2KM8B 2OMOA 2CKWA 3PNIA 4OLOA 2XZWA 4ALZA 4DR6F 4FUTA 3MOJB 3W2VB 1JLEA 3QZ7A 1U24A 1RGVA 4UQTA 3VR1A 2UUAF 1SB6A 1X5PA 1NY8A 1I94F 4LF4C 1EHWA 3T3FA 2AGOA 2XR1A 4FZVA 2MGZB 1S4FA 3KFWX 1S9EA 2Z58B 5DS7A 1HMVA 3VF0B 1H0HB 1UFLA 2W4CA 4U7UD 3HKWA 4NXNJ 4WP3A 1U1RA 3I4PA 1YBUA 2QMWA 4WZQA 3RUBL 5HSPA 1GT8A 1MROB 3TP2A 2FZKB 2DISA 4NXMJ 2DIVA 4I9FA 4X65C 4DV4C 4HT5A 3LNOA 4GXRA 1RWKB 1HI8A 1XR6A 4PWWA 4XAKA 4PKDB 4JI2J 3C15B 1UJ5A 2EKYA 3CDWA 2XLKA 4J9PA 1FEEA 1Y5IB 2GHPA 4GVBB 1F60B 1UVMA 3LP1B 1U2CA 2IAJA 1QUVA 1V9OA 2LQJA 5EDWA 2GJFA 4ZPDA 5A8KB 2N7YA 2GA7A 1RBOB 2HRUA 1VQ8S 2IM3A 2V9WA 4YOEA 4LFBJ 2Q1LA 2BQ3A 2EFVA 1WOPA 4EBCA 1HW8A 3CO9A 1NM2A 2X51A 2MSSA 4WCEQ 2AYEA 4OJ3A 2G0JA 2RUGA 1MU2A 3Q8VA 4O23A 4OI3A 4OYOA 3DCAA 4WXWA 2G4BA 1EQ0A 1O93A 2YNHB 3JYTB 2CZVC 3ETMA 4USVA 1QM4A 2KXFA 2RAQA 4KO0A 3IA0A 1N32F 2XSJB 3KXDA 3CMQA 4F8RA 2GJIA 2BJ8A 2ZKTA 3CW2C 2VFSA 2FHKA 1WKJA 3GIRA 3IG1B 3KDOA 1S1TA 4OZJA 5IV4A 2HBRB 5GVQA 1OY6A 2V5HG 3V81A 1DFDA 4NLTA 1IKYB 3CB4A 2MKHA 2JX2A 1SKUB 1U2RA 2C42A 2WK4A 4DDFA 1WCJA 1S1WA 2HNZA 1GTHA 1UJ4A 3JTNA 4FKXA 4F04B 2C2DA 2J9EA 2UXDJ 1IBLC 4DG8A 2VDIA 2P2JA 4P7TA 2DJWA 4AD6A 2Z2LA 2FIUA 1CSJA 5K14B 4QR2A 1T95A 2VBZA 1DAXA 4LMZA 4RVNA 4JP8A 3AHPA 4L73A 4NCAA 2LEPA 3W60A 4J5OA 1A9NB 1SV5B 4IRDA 2B3TB 3NXZA 4OMFG 4WYWA 2OTJS 4OJ1A 5CYQA 4KGXB 2X1BA 4LF7J 1TQLA 1H38A 3TDEA 4DU8A 1QVGR 4NYPA 3HHKA 5LCIA 2B8PA 4AL5A 3KOAA 3GYNA 5HO4A 2QSFA 1W25A 1AXQA 2E1AA 4HDHA 4DCOB 4ZVQB 4PZVA 4PXCA 4Y2CA 1HQUA 5FIIA 5EWFA 1B4SA 3JS9A 4FF3A 4DR1J 3RBEA 1HLWA 4TN2A 3SI8A 2CPHA 4QPXA 2JDJA 1HI0P 2MZSA 4YB6A 3DHWC 5A6WA 5CCMA 2DYJA 4FNIA 1TELA 5F0UA 4I6YA 1K1QA 2MZJA 1XC9A 1EJ7L 1QSYA 2Y27A 4LT6A 2ATWA 2U1AA 1M5HA 2E29A 2QE5A 2OPQB 4M5IA 4Q8FA 1YX2A 2J76E 5KG6A 3HP6A 2I5JB 3TAMA 1RT4A 2CJQA 4KYZA 4DR2J 2GGPB 4B3SC 1YVFA 2B4UA 1TH5A 3RBXA 4KIAA 1S6PA 1O9TA 3MPYA 1UWBB 2B5JB 2L3MA 2G13A 4W98A 3SIPB 1DBDA 1FEHA 1NSKL 3UX3A 3HD2A 2NSCA 4AYBD 4DG1A 1XR5A 3GFHA 2GVDB 4USTA 4RMNA 1WF0A 2WOMB 2CG8A 3UD4P 2QX0A 5L9NA 1EETB 2X1FA 1LK5A 3BO4A 1WI8A 2J7KA 4IR9A 4ZVPB 4X4NA 1IKVB 3GG0A 2POKA 1J5EF 2AJ2A 3J7A1 5GMDA 2E8FA 2AEMA 4JUZA 5A2QU 1R89A 1FT8A 3CC4S 4LR7A 2XC9A 1RU2A 2MZTA 4XPEA 2QA1A 3US5A 2OEJA 1NK4A 4JV2A 5C2GA 4ICLB 2W2OP 1HBUA 2PT0A 3BGUA 2F4VF 2DR5A 4J7CA 1QVFR 4I67A 1TMMA 2N3OA 3CD7A 5DQIA 4PWDB 4IR1A 2KDNA 2C3MA 3V2UC 3RTVA 1S9FA 4KC5A 5D0HA 4CLKA 4LSLA 1IBCB 5J2QA 4LSNA 3TR3A 2C2NA 2LQ8A 4DV0C 4URGA 3J81D 1R43A 1YJ7A 1Z2LA 4CI0B 3FEZA 4OZNA 2FYXA 5K85A 2D74B 2MDAA 2YKPA 3R5BA 2VFUA 4UOHA 2NYHA 2U2FA 3GCXP 4I69A 1YZ7A 2Y1RI 4XTTA 5FLXY 1XMOJ 2WRMA 1ZZNA 4JI5J 4HHJA 4OYMA 2LECA 2E5LC 3VGSA 1RTDA 4X62J 3SO4A 1OPZA 2ZOGA 2B7BB 1JLGB 3HFVA 4I68A 3T9ZA 4DV2J 3AH6A 4K59A 1MDFA 2YWBA 1SJQA 1GEHA 1XNRJ 2HPUA 1SL0A 1KVJA 1IM6A 3DMJA 4E98A 1PBUA 4OX8A 2CVEA 3S01A 4O3OA 1QAYA 2FVRA 3TO8A 1LFPA 1FJGF 4B3OA 4EK2A 3N0VA 4AUKA 1REVB 4OYCA 3HHLB 4OZLA 1RT1B 1O0PA 2LDYA 2BOAA 3BYPA 2KG1A 5HK4A 3TQEA 1W2BR 4GS5A 1LQ9A 1HNXJ 2XULA 3FC9A 4I2QA 2HHHF 4ECQA 1Y3JA 1V26A 2CY1A 3VZIA 3ZTSA 3CMES 1UWDA 3PCOB 3OUYA 3VAKA 4JI8J 2J6UA 4LIWA 5EX3A 5FDLA 5E3PA 4DF8A 2AX0A 2O01C 1QDUB 4KFBB 5T14A 3CD0A 2ZH6A 5L1JA 4X2BA 3G86A 2Z51A 5U47A 4H4MB 3OVSA 2VONA 5DM6Q 2D3O1 3A3PB 3NBPB 4MIAA 3D2WA 1HHTP 1IR2A 2CAJA 2ZH5A 2V8HA 2KU7A 2BMBA 4X66J 3DN9A 4O44B 4KGZB 2LYVA 1DLOB 2L9WA 2A10A 3FKBA 7FDRA 1LCIA 2DB1A 4OHXA 2DHMA 2XY6A 2FLPA 4DSJA 2UXDF 3T1YC 2CQGA 2N4DA 3SQGB 4Y2MA 3OV7A 3BKUA 3PHTA 5DM7Q 1HNWJ 5K8MA 1S5ZA 4KQZA 2YNFB 3VQTA 2KXHA 3BQ1A 4B3RJ 2WVEA 1RHQB 3M9MB 2KKHA 1XMOF 2VFRA 2Y8YA 2XMTA 4YR3A 3OJUA 4AQYC 4CLPA 1X4HA 3WIUA 1YJ9S 2ROGA 3K59A 3O3LA 4NLXA 1FTRA 3MEGA 4QR1A 4DQQA 2Q6CA 2XCAA 1N8RT 3UDLA 2LLZA 4QWEA 3LWLA 4DPUA 4I2PB 3HO1A 3NNHA 2CU6A 3GCWP 2Q79A 2DNNA 3AODA 3DM2A 4FDFA 3UN3A 2KT5A 3CJ4A 3OFEA 4DQIA 3PEHA 1VCTA 4NI2A 2BANB 3G87A 4UUWA 5KT5A 5D8HB 4RUAA 4WWSA 2M8DB 1UVJA 4CP5A 2V0NA 2GMLA 4PG7A 4LE5A 2XZTB 2PMZD 4USIA 1HR0J 2RDDA 1SXLA 5DLGA 4IH6A 4ZJQA 2RNEA 5BSRA 2HFUA 4RW9B 3KJVB 1XJWB 3R44A 4WIQA 2OLWA 3PEJA 4YB5A 4ZVRB 4DR2F 2BKNA 4NYOA 3IP0A 3K0JA 3FRZA 4M5DB 4QWDA 4MK9A 1DARA 3KLFA 1D9FA 3GSIA 4P75A 4RX6A 4P2MA 2LFVA 2MLYA 1RWWB 2RDIA 1HWLA 3MFIA 2PN6A 4FBTA 2WD9A 2C2KB 2KDOA 4HACB 2DCUB 4MFBA 4B9SA 5E7QA 1Q95G 1I6JA 1RT5B 3GIIA 1EARA 5KG0A 4KR0B 5KFJA 4B9UA 4RBVA 5B0FA 3H5YA 4ETXA 2DNZA 3AY0A 1C1CB 4U96A 3MR5A 1KKGA 1VJQA 3EDRB 2ZHOA 3OFFA 4G37A 5KT4A 5IFMA 1B3TA 4RPFA 3CCTA 4IR7A 4IQXA 4LFBF 3P45B 4LF8C 1TKTA 4W4MA 5CQGA 1GXUA 4J91A 1N5QA 1RLDA 1Q0NA 4PG4A 4CNZA 5EWEA 2AMCB 2NYIA 3L3CA 1PO6A 4RKUC 3JQJA 3FZ2A 4YEAA 2R2TA 2CQCA 3FRYA 2QVXX 1UAWA 1UFKA 2IBOA 5HAOA 1TUGB 4QBUA 1S9GB 2Z8QA 2ACYA 4K5SA 4M63A 5KFZA 3BJYA 4DUZJ 4LFAF 2IIHA 2XMUA 3TWZA 3P49B 2HBZB 3CJEA 3L4BC 3DRPA 4Q2LA 3RRGA 3DRSB 4ZJZA 4I0WA 4K8RA 1N32C 1BY9A 2K06A 3N28A 4O4GB 3BDPA 4CO0A 2M7SA 2RB7A 2CPXA 3FUYA 4OJGA 1NK7A 3MF5A 2Z30B 3N6NA 7FD1A 4V19X 4DPYA 3PACA 2VPXB 1XNRF 1WI6A 4JI0F 3PXGa 2CJXB 3MHYA 3TUJC 3DOKA 3ET6B 3T41A 4CLFA 1BQMA 5T41A 5HROB 2J8AA 5J1PA 1C1BB 3SDEA 3V4IA 3R1LA 1ZS6A 1XMQF 2XS7A 4QW8A 2O67A 4DCPB 1VBYA 1U6ZA 3R3TA 2WW4A 2F3JA 4FXVA 2V4RA 1VGYA 1HR0F 1XNQF 1ZYQA 3DLGA 2SXLA 5F3ZA 1EX8A 3U7JA 1IQTA 1EGAA 2HHHJ 2DNYA 5DQHA 3J81U 1LNQA 1RWOB 1X4BA 5L1LA 2IDLA 3VALA 5LSRA 3PW7A 1NK5A 2FY1A 2UUCJ 4F4YA 3MPDA 1OQ3A 2CZ4A 3GONA 2VKZG 2CPEA 3ZTOA 2J8SA 4DL4A 1N34F 3RYLA 3QGHA 4WFYA 3OXLA 3W5XA 1QM9A 4DBQA 3Q0AA 1VC0A 2RRNA 1WSRA 2UUCF 3H59A 1JQGA 3VAJA 3T1HJ 2RUSA 4QQBA 1JLBB 2FLLA 4E0DA 4NLGA 1HMVB 4NCBA 2R2SA 4FYWB 1IBMJ 2Y4OA 3VNSA 2ZBCA 1WOOA 1NAQA 2OUGA 1JLQB 3I0SB 3VAFA 5K20B 1U1LA 2DRAA 1RTJA 2G2ZA 3MCMA 1YG0A 1PG4A 2ZH3A 2ZVIA 4OZ0A 2DGUA 3W1YC 3BM7A 3G9CA 1F3VA 3CCSS 1ULTA 3CCQS 1FRXA 2QLBB 3M8WA 1CJKA 2GQQA 2VBYA 4RJVA 4Y6IA 5A6PA 4URSA 2QC3A 1JLFA 1RAHB 2IPOB 2RQ4A 3C8YA 3FQLA 4WFZA 4XDCA 3UNYA 1S57A 4E8UA 2EFOA 4UOCA 2ONFA 4PPZA 5BSUA 2ASYA 2KHDA 2OAUA 2V8VA 5B0BA 4LF8F 2MHNA 4DG9A 1T5HX 3O1LA 2HS4A 2OEKA 3MM6B 4NX9A 2ZJQQ 4PUOA 4C8YA 5ETSA 3I5AA 4RWWA 3VAIA 1TK5A 3R2DJ 3ELHA 2XG8A 4Y2KA 5KT3A 2GO9A 1GXLA 1J5OB 5THWA 4ERDA 3MCOA 4CZCA 1YSJA 1HWKA 2FJXA 3R2CJ 1NJIT 1EAYC 2VPZB 3ONQA 2HQ3A 2XBPA 5G0RB 3D66A 4BHQA 5KFQA 1J5EJ 4B3TJ 3R5AA 2K3KA 3SXLA 2ZM6C 4R0EA 1FFSB 5L46A 1S1XA 2A6MA 3KDNA 4F4AA 4RNMA 1SL1A 1D9DA 4C3LA 4CLUA 3EM1A 2W1BA 2VKRA 2HQIA 2F8MA 3HPOA 2PSZA 4D4IA 1IKYA 1ZAVA 2NR0A 3UE2A 1U8SA 3TW0A 3KJNB 3JSMB 2D3OR 1MD9A 1R0CB 4TU8A 1YGYA 3I87A 4LFAJ 4QU6A 3I07A 4WKYA 1DY3A 3GG1A 3IBFB 3BSCA 3CMAS 5GAHI 4A8WA 1U47A 1EIYB 1HNWF 3OTBA 1YZ6A 1TUWA 1KSPA 2YWHA 4UUXA 3WQPA 3LF0A 2E1RA 3Q8PB 1NEEA 4CLTA 1SPBP 4I7FB 2JVOA 3N6LA 3AQOA 4PWUA 3CCUS 1RADB 4KB7A 1U6FA 1F0XA 3SQOP 5C42A 3HK2A 3GWCA 4L75A 4OJHA 4OZ2A 3K2YA 5CYQB 3R9LA 4ZITA 2MMYA 4DN0A 3SZ2A 4QIEA 3EXCX 1BHNA 5AXLA 5KFDA 2B4OA 2CYYA 4ES1A 5M2RA 3EE3A 1XRAA 2UXCC 2DTJA 2DVIA 2LA4A 3A9VA 3IEVA 3IN5A 1A0OB 2F4VC 2PROA 2DBBA 4JI6J 1AZSB 3AA9A 3H7HB 2Z4PA 5AE3A 2CJ9A 1Q8LA 1P1LA 1PCAA 5J2PA 1RWPB 2HVHA 3JQMA 3D6HB 4LUBA 5IV3A 4KBIA 1S1VB 2DRDA 3MMAB 1CS4A 3PRBA 4KHRA 3CJRA 1FE0A 1Y10A 3MUTP 1QAIA 4ZPCA 3HULA 3FCWA 4I1TA 4OLPA 2WP0C 2J9DE 4DL7A 3DLEA 1UWBA 4CM2A 2MQLA 4A8OA 3SFUA 5CYJA 1FF2A 4DX6A 5GADU 1H74A 4X4VA 2N4CA 1T3OA 1UW4A 4ILLA 1IM4A 3TUIC 4LBPA 2DHAA 2I38A 3ILJA 2P9EA 3TYTA 2XQCA 2HZCA 2XY5A 4RL1A 3LGXA 2D3ZA 2P9GA 1DTQB 3WHIA 2MZ1A 2ALZA 1FKPA 3HVTB 3EVMA 4DFKA 1M5KC 4GC6A 4ECWA 4A48A 4Q0BB 4FUQA 1N34C 2EEYA 2FZGB 2V9KA 1RHRB 4N8OA 2JWNA 4YY3F 5MAOA 3GIJA 4L7IA 4X4QA 2FZCB 1PAEX 1SC6A 2DGWA 4Q44A 2XO6A 2DRBA 2EXUA 1JLCB 2MSTA 2B6AA 3G6VA 2VC0A 4M5GA 1S77D 2RVJA 5C24A 4DV0J 1RT2B 2PGCA 5D15A 3ZZOA 3RG6A 3TJ9A 4WK3A 2M4MA 2ROPA 4ZJLA 4RU2A 5CD4H 2WSFC 3DRXA 3Q83A 4ZKAA 1NB2A 1HNIB 2HHVA 4WS9A 1PA4A 4TU7A 2MYFA 1KTQA 1JLGA 3MECA 1R31A 3L7PA 3R5DA 5A8RB 4DV2C 1VLAA 1P8GA 3CF5Q 1XS3A 5AXMA 1JMTA 4LF6F 2UV8G 3BQ0A 4J90A 1S1UA 4KGVB 3S6EA 4B9VA 3BR8A 4GKKF 2NQPA 4X4UA 3FFIA 1JX4A 2O5DA 4B3OB 5DQGA 4NOHA 2XHWA 3ITHA 1X9MA 1ULRA 2HSEB 2BA9A 4V1Ak 4CWBA 2I2YA 4K0BA 4EBEA 4DV5C 1HNXC 2UUAC 4K4WA 1WC6A 3IGNA 4IQMA 2VBXA 1HHSA 1I51B 1YRTA 3CJSA 5AXNA 3QNWB 3UWTA 2MKIA 2D1SA 4JI8C 1U7LA 3BKFA 5HBMB 5E3AA 3K5NA 4OL8A 1NJWA 1GMUA 2MY7A 2HVZA 1U0HB 2MKCA 4TU9A 4DHVA 2HHXA 3C16A 3RU0A 4LF1A 6AT1B 5HMZA 2WTFA 3MCNA 4D4GA 2ZD1A 3BR9A 1RXOB 1FE4A 2VASA 4Y28C 3NCRA 4CTAA 4Z7CA 4YP3A 4PYAA 2MY8A 4BC7A 4RW8A 3AOBA 4V19J 2CWKA 2OPRB 3MDFA 1R0BG 1WEZA 1LK7A 3KHRA 2CQ0A 2XO7A 2IFXA 4OYIA 3SQGA 3V6JA 4OHWA 4OZ5A 1PYTA 3Q86A 1UKUA 3RAQA 1FKOB 2YNFA 2XLJA 1NJXA 2HMIA 2RF2B 1UKKA 1X4GA 1V6HA 5KT7A 2BQRA 4HT7A 1S6QA 2RH3A 3DI6A 3FQKA 4AQYJ 2GHVC 4WPAA 1FJCA 1V3ZA 5KEIA 1KKHA 1AYEA 4PQUB 3RGIA 1Q7YT 3CJKA 4JI4F 3MEGB 1L5UA 3AB4B 4B9NA 3DYAB 1RUSA 2LMIA 4C11B 3OTOJ 2H5IB 4I2PA 1N88A 4Z37A 2D7VA 3DM2B 1LW2A 2AIRB 2KL8A 3Q8YA 3QPIA 3M2VB 3O6QA 5BYSA 1K73T 2C2OB 4OX9J 5HQMA 1B7FA 1RLCL 5DJBA 3KK3B 2RT3A 4IO1A 1RHUB 2Z2YB 3FMWA 1TL7A 4F3QA 1TAUA 2VQEC 3EICA 3N79A 2CPDA 5E7OB 4BCAA 1M5PC 3OTEA 1O90A 1F5CA 1N6QB 2P2BA 1FDDA 2WAQD 1G1XA 2ZH2A 2IRYA 5CA5A 3NS7B 1ZPVA 3DOLA 3W8PA 2OBVA 3EERA 1Q53A 3PRDA 2Q3PA 2OFHX 1D0EA 1R7IA 3TX0A 3MXHP 2QA2A 4RW7A 4ZP6A 5CHCB 1PSDA 3MM8A 1LWEA 5LJ3Y 1WG4A 5F8LA 1I3OB 4MKVA 3UD3P 2BJOA 1R8AA 4DV1C 2H5JB 2BKPA 3BH7B 1HWIA 3OR1B 1VDHA 4DV1J 1FJ7A 2CPFA 1YKWA 3JTPA 5AXKA 4OI1A 4ZS6A 2RMLA 1HBMB 1WDDA 2ZC3A 3W8GA 2I0XA 2DR6A 3ENWA 1B0VA 4CLZA 5GAHU 3IM9A 1PILA 5A2QY 1EKRA 1N36F 4ZLNA 5A19A 3Q89A 5KFFA 1IKXB 1Q8KA 2AZ3A 2HEKA 3PDNA 1ZA1B 4WBFA 5E3RA 4A8XA 4U67Q 3MEEA 3SSQA 4CT8A 1H72C 1QD1A 2NS1B 2FVQA 3HMJG 3RAXA 2GQ2A 2Z0GA 1VISA 1ZA2B 1FNOA 2B0GA 2XS2A 4USKA 3OXGA 3OTOC 1FD2A 1MWQA 5IWAJ 3MMCB 4GKJF 3IGVA 1S9GA 3ZZ0A 3KK1A 4ED6A 4DUZC 3GE9A 4CH7A 2WVDA 4A8QA 3JB9k 5M2UA 1Q82T 4IG3A 2R2RA 3HZGA 3TANA 3KLIA 1AW0A 3HHEA 3CCES 2ZNZA 4DUZF 3THPA 3L09A 2JFDA 2R7SA 4C8LA 3K89A 2ZFHA 2CDQA 2AGPA 2OPPA 2QVZX 3AD8C 4GO7X 1TZ0A 2GAGC 1EP4A 2IYGA 2L48A 2V6AA 2ZBPA 3FGVA 4QWBA 2ILYA 1N0VC 1WHYA 2GW8A 1PKUA 3MAAA 5A0YA 3KYLA 1DZ5A 3DLHA 1HBNB 1S0OA 4KTVA 2PA3A 2QJ3A 4PROC 2LXIA 3MD3A 4IFYB 4RUBA 4TYAA 2EC0A 4OXIA 4DCUA 3UR3C 3DRRB 3H2TA 2UP1A 4LRBA 5KFVA 4CLYA 2JJ4D 5F9NA 2F8HA 2OSQA 3FSYA 3NYRA 2AKWB 1RBLA 3CDUA 2RKIB 3DC2A 3FZBA 3EZOA 3I5CA 4P2SA 4C8MA 2ZH1A 4JV5J 3EXYA 4C3MA 1JJ2R 2K7JA 2F8EX 1KOOA 3D0GE 3H0PA 4RUHA 4ZHRB 2VIHA 1D8YA 4JI2F 3OL9A 2VG5A 1HNVA 2Z2ZA 4F36A 3L95X 2WSEC 4MT1A 5LMNC 1U1KA 2QG9B 1NPPA 4ELUA 4ZVSB 3PR4A 4FPRA 2Y1IA 1WG5A 1K8AT 2DNPA 3A12A 4DCJB 3MR7A 1NSAA 3KLGB 1SJ4P 1R6VA 1HYSB 3HZEA 3EGZA 2UVWA 4KT0C 4DV1F 2DR7A 2QL8A 2K1RB 1RAFB 2HQGA 1M1HA 2QIFA 4OYXA 1IBMF 2BE9B 1D9AA 2VC1A 4ZP9A 4YR2A 1WC3A 1AROP 3X3UA 4DX8H 5IQ6A 2V94A 3W9HA 1CJKB 3NG8A 1WC1A 4O3SA 2PIIA 5KYTA 2BXJA 3LO3A 1JLFB 3QFHA 1VK8A 3V5RA 2GAHC 4QR0A 4L3KA 2DGSA 2J6TA 3PO5A 1RG9A 2J7UA 5ETQA 3KHLA 3C3LA 2YKAA 1RYSA 3NCQA 1UEVA 2NXNA 4DR1F 2ASBA 3MM6A 2CUYA 3WZ0A 5HMYA 2VG7B 1FFGB 4DPWA 3TR5A 4JI4C 1U49A 3O8WA 2H1YA 2YKNA 3FVYA 3MR6A 1W7WA 1PG3A 2UUAJ 1L3VA 2LVWA 2FPHX 1YBTA 4WK1A 1BMQB 2YH1A 1J5EC 1H3DA 1H98A 2AJ1A 3G82A 1TAQA 4J9NA 4JI3C 4NE9C 5DZ7A 3VV2B 1FWPA 2O1PA 2BJ7A 1GXTA 1NMEB 1CVJA 4C8ZA 4NLOA 1WTFA 4CIOA 1X4CA 3QQCD 3SFGA 2JC1A 3PM9A 1C4AA 1WJ9A 1B7YB 2CQ1A 2H51B 3GYGA 3UCGA 1FLOA 1BC6A 3OT9A 2NCLA 2VZEA 1BQNB 1N33C 2NUHA 2NXUA 5KFGA 2J0QD 1S7HA 4G1QB 1WOSA 5ITHA 2FJBB 2I6WA 2C3PA 4JI5F 1M1KT 3Q8UA 4J9OA 2FTRA 2YX7A 3OFHA 5HMWA 2HNDA 4TXSA 2MQPA 3D3BJ 2KO1A 1VIXA 2W2NP 2P02A 5KG3A 2ZUAA 4WFAQ 3FDSA 4OIXA 2XGQA 2RDJA 4DOZA 4K0KF 1S49A 2UXCJ 2XWYA 2P8IA 4CRJA 1SJFA 3GFZA 1F6TA 2Q6BA 4IG0A 2EFPA 4HTJA 4NA3A 4JI6C 3THVA 2OD6A 2HG4A 4GKKC 2KFYA 1YQHA 2FHMA 3C19A 3I6PA 5AJ3F 2Y1JA 1UA1A 2E8EA 5J2PB 1RKJA 1GTEA 3G96A 4TY9A 3QJPA 2EW9A 1S1VA 3KLHA 2YNGA 1V5IB 4LF2A 2C3YA 1MNEA 2K2PA 3CJQA 3TA2A 1NH7A 1VRTA 3GV8B 3I08A 1T8EA 1M6XA 4ZIWA 3HSDA 5HP1B 2MKKA 2VPWB 1SQFA 6FDRA 4UZBA 2WBRA 4PUHA 5E3QA 3EX7B 1USPB 1LWFB 3QT6A 4M5KA 4YN3B 3GIKA 4ZOSA 1YRUA 3N9UC 1TL3A 4ECZA 5DG7A 2GX8A 1E6VA 1U4BA 1FWLA 2KZ0A 5T7LB 2FJVA 2HFOA 1YTYA 4X66F 2UUTA 2VZ9A 2OD4A 4PG6A 1NZAA 2CPIA 2DNOA 5C7PA 4JI0J 3P6YC 3DGPA 3Q2TC 1YDLA 4WU3A 1TL1A 2G0CA 3SCLE 4DR6J 2V7BA 2WBMA 1UTAA 2PFFB 3A8EA 1VMBA 1WUUA 1X5TA 3KUGA 4Y3CA 3BKTA 4R0JA 3TA1A 3IBCB 4F0HA 2NZ4A 2KJVA 4Q0BA 3CC7S 1F9EB 3AD9C 4AL7A 1JXEA 4FS2A 2CNNB 2J9CA 3IG1A 2EFQA 3M8QB 3Q22A 1YJVA 1V25A 3P5TL 2A3JA 3CJ5A 4R5PB 2J6SA 3NGSA 4RW4B 3ZZPA 1HW9A 2RHQB 4F0MA 2XTJP 1DJ0A 4I4BA 5GAGU 4RLFA 4D57A 1RA7A 4DR3F 1Y9OA 2BQUA 2Y0SD 4NMXA 5L9XA 2PMHA 3NGRA 4H54A 4A46A 3DDKA 2X3GA 5KFEA 4GC7A 1N5YB 1XMQJ 4KJIA 1O8BA 5A1GA 3PKYA 4CO5A 2P6TA 4CLLA 2UU9F 5IWAF 4BWMA 1JK9B 1WKLA 1N4LA 3H5XA 3DLPX 4YHHC 5BSVA 2CPZA 4LBIA 1NK6A 5A8RA 4K0KJ 4RNOA 5F8NA 3AF5A 2KT3A 1RWMB 3LQVA 4WJBA 5BYRA 1JIHA 2FC8A 1KLNA 4IFVB 4NZ6A 2R7WA 2IC3B 1K44A 4WTOB 3HFZB 4X4PA 1I5OB 1YJUA 1MLAA 4PXDA 3FFIB 3UW1A 3W61A 2ZM6F 1X0FA 3M2UB 1HQEB 3P96A 3NP5A 3ITHB 3H2VE 4HEA9 1XK8A 5CYMB 2CADA 2EFNA 4OYBA 4DV5J 2KFZA 3C6UB 2OEMA 2Y4NA 3K57A 2UZAA 1MMDA 1E6YA 1S9EB 4NZ7A 3QSYB 1MXCA 1KDNA 2FVCA 1S6UA 1YITS 1SBRA 4NZ0A 2DH8A 3IRXA 3MCSA 4IDKA 4IYQA 2MKJA 2RU9A 5DETA 2RQMA 1FXRA 4HTIA 5HL7Q 3J7AN 4K4UA 3CWJA 2NPIA 2J7WA 1JJHA 1XRCA 2VG6A 1RTZA 4P74A 3A1YG 2MCQA 3HFKA 3DU5A 2EG2A 2D1RA 3GPAA 3LP0B 4U7UK 2AQ4A 2GVDA 1VS3A 1Z1ZA 3I9V9 1MG7A 1LFWA 1N5VA 2HNYA 4FKYA 1WSVA 2DNKA 3QRPA 4X64F 1GK8A 1CC7A 4EZ6A 2JLFA 3HSJA 3M2RB 4W92B 4NMLA 4DV3J 3ZZZA 2L9DA 1RI7A 4JI7F 2L9NA 2CQPA 2VA2A 3A26A 1S6QB 3I55S 2RS8A 4PXBA 4RM2A 4OZ1A 2IDEA 3MTJA 2W9CB 1IWGA 3J7ZT 2MQQA 4DR3J 1Q8BA 3SCKE 2R7VA 3IMLA 2J9DA 4I64A 1OMSA 4Y2IA 1S1TB 5ETPA 3TZWA 3J81j 3V81B 2J0SD 4K4VA 4J9UE 3O2EA 1SH2A 1X0PA 3CE8A 4PWDA 4LF4J 1VIOA 2DT9A 5L8RC 1S1WB 2EBEA 2HNZB 3DGVA 4LSLB 4MKBA 4LF9C 1O51A 2W24A 1IKWA 2D27A 4A4JA 4I6AA 3IAS9 1WORA 1Z4UA 4MIWA 3M1VB 2YVSA 1RT3A 5ETVA 3OD2A 4OX9F 4WFBQ 1JKHB 1U48A 2EG1A 1Y4ZB 5ETOA 2GJ2A 3CD6S 3EWGA 1P4EA 3UQSA 3CCRS 4X65J 2B4PA 4NXMC 4DV4J 2M0GB 2FLOA 3DOLB 4LRCA 1C0UA 2ZE2B 3CJ3A 3GILA 2DH9A 3GU0A 4OV6A 3D68A 2QT7A 3W64A 2P2MA 3BDEA 3I32A 5KFCA 3ZZRA 4PZPA 2ZHBA 3MMBA 3MWBA 5KFMA 2YWKA 2XMMA 3TARA 3QIPB 4DV3F 3HVAA 3UDVA 3LWMA 4ECYA 2AW0A 4I2QB 1FXDA 1J27A 4QIFA 3HJFA 2DNGA 1NSQA 4O3NA 2QLJB 2F63A 1TK8A 4ED5A 2WONB 2VU5A 4IOAQ 1ITPA 4L2ZA 4KH0B 3NOCA 4DV7C 4UZCA 1FVSA 4IO9Q 2M2BA 1VBKA 3G2XA 3T19A 2I5JA 2W2MP 1RT4B 5B0EA 2ZJPQ 1OJ4A 2ZBIA 4ZVHA 1UVKA 1LOUA 3MMJA 2AX1A 5LMNF 3EQ6A 3CUNA 3S1TA 4FF4A 3RAMA 2P2QA 5KFWA 1ZM4A 2R7QA 3FCVA 1IUJA 2DR8A 1YJTA 1QSLA 5IWAC 3S8SA 4RUCA 1ZAWA 4BS2A 1D8ZA 2QLWA 3A8IA 1ZM3A 1X4FA 2R2UA 1PAUB 1K1SA 2KHCA 4NOZA 4EUVA 3R9WA 3CEDA 4WE1B 2NXJA 1KVIA 2RD5C 5B0DA 2G9OA 3KKFA 3PTWA 4Y34A 5A8WA 4JI3F 2OPPB 5B0CA 4F2RA 3ENVA 4EWTA 1EP4B 3T6BA 5I3QA 5IM0B 2EKNA 3MM7B 1Q81T 1WNEA 2KM8C 3D28A 2F5GA 2ZKUA 5F3TA 2BUNA 4U7CA 1T0TV 3CQ2A 2D28C 3FBBA 5LL6d 1PC4A 4LFCJ 3W2VA 4TPSB 3CJ0A 1F9HA 1LW0A 2JRSA 4KGKA 5EX0A 2CNOB 4BWJA 4CCHA 1Y3KA 2KT2A 3ILLA 4DR1C 4GKJC 1X31C 3SSRA 5J2QB 4OYPA 2RKIA 4EATA 3M8PB 2NREA 5IT9U 2M5HA 3R5CA 4O3RA 3CNQP 3HI9A 4NEYA 2JEGA 1RT7A 2GNKA 1OYDA 3OR2B 4F02A 1JWWA 2MKSA 3H2LA 3JSYA 1FJEB 3PBKA 3TJ8A 3M30A 2LQ9A 2BJEA 4QCLA 3VQSA 3BH6B 2V8DA 3HCXA 4MK8A 5K5MA 1PJ7A 1TTHB 2HBQB 4F3MA 4AXIA 4C3KA 5M2PA 4O0IA 3C15A 1SKWA 1DTTB 3AA8A 4JB8B 4NLUA 3Q8SB 4DR4C 2IM1A 3HHLC 1KN6A 1JXLA 3DMJB 2QFJA 1EKSA 1V5VA 3QO9A 4DLEA 3SEOA 4U8YA 5HQ8A 2YH0A 1BXNA 3DHXA 1UVIA 4F7VA 2VJVA 2Y3YA 2OTLS 4HL9A 2B51A 2VB6A 4XDDA 4ANCA 1NNDA 2CQ3A 4YS2A 5DLFA 3VWSA 1GPMA 2JHEA 1U25A 3DKDA 1YIJS 1B0PA 3W7BA 1UZDA 1C1CA 1I1GA 3B8HA 3JYTA 4FYYB 2DGVA 4DFPA 4CYUB 2QYGA 4DU7A 1XBWA 3CQ1A 4RLQA 3GFXA 5DG8A 1SJ3P 4L3NA 2CDRB 2AT1B 4KFBA 4W90B 4TLQA 5J2NB 5AE1A 1HH2P 4Q45A 2XWXA 3PYDA 3RW7A 5EGYA 4K4ZA 1MDBA 2VG7A 5DV9A 1T9YA 2ZBRA 4WTYA 3CPWR 2PD1A 3AT1B 3DLKA 2OO4A 4DCVA 2ATLA 3ZO7A 1ZETA 4CO2A 1HD0A 2P2FA 3C14A 1HKAA 2E44A 3R7SB 2AZ1A 1NDLA 5B0AA 3UD5A 4LF4F 4K4SA 2V8PA 2DPLA 3VTIA 2C2MB 2E7GA 4JI3J 4P73A 1XMOC 2VFTA 1VRUA 2DXFA 3BN4A 1HBOA 2ZEJA 3LUYA 4ILRA 3K8WA 4OV1A 3RBDA 2VQFC 1RBAA 4NPOA 1X4DA 3PX6A 3ENAA 1Y00A 3WC0A 2N82B 2EWHA 5JVHQ 2Z2MA 3HHNB 2IVMA 2QL9B 5BSMA 3M7VA 2YTCA 5D0RA 3E3XA 4EZ9A 3DXSX 4X4SA 4RW6B 1M5SA 4ZN1A 3JSBA 4NLQA 2WVBA 2QL7B 4LRDA 3KJFB 4X84A 1OSDA 3LGNA 4ZPVR 1RZMA 3GTYX 1LXJA 4ZVOB 2LA6A 4IH5A 3FBFA 2KTQA 1GMVA 3CCJS 1HWJA 2CQ4A 1VQ7S 5C25A 4HLBA 3R7NB 4ED4A 2MB0B 3KMQA 3F0NA 2E7XA 1FRMA 1CBKA 4NA2A 5D6GA 2OPQA 1RWVB 3OBIA 4KPCA 5KG1A 4NRTA 5HQLA 1AUSL 2I1RA 4WP8A 1KR4A 3CGIA 1YRXA 1VQNS 1S6PB 4JOUA 3R5GA 2HHSA 1RSCA 5AE2A 2RS2A 2BBEA 3GJTB 4IG0B 4NLSA 4GKKJ 1ROFA 1G6BA 4Q7AA 4ODJA 3SSSA 4DL6A 3U02A 2WOMA 3TOQA 3H8YA 1UP1A 1WG1A 2W2QP 2YWFA 3QLHB 2XGPA 1NK0A 1KLMA 2PI4A 4RVOA 1EETA 3D1HA 1RQ0A 2V2KA 3I0RB 3AFGA 5GAGI 4HACA 1WD6A 4DV4F 1TKXA 4F4XA 3PX0A 1UVNA 3D1OA 5BJRA 4DFJA 4P6QA 5D3GB 1SUQA 3N5BA 3QRQA 4P9SA 2PA8D 3UVJB 2MQOA 2D1QA 4ELVA 2W8LA 4EMDA 2BVZA 3PY8A 3P5BP 4B3SF 1RTHA 3KMSA 2EBGA 1C0TB 2GC8A 4KKOA 4PCQA 2EPIA 1T3NA 4DWIA 2UXBJ 3UPFA 1YJNS 2PN2A 1TKTB 5CXTA 2BE7D 3CIMA 3ZXWA 3PZPA 4UY8T 4C9DA 4WV3A 4L6V3 3DOMB 4B02A 5HN0A 3DGPB 2XMWA 4IKAA 1RTIA 3LP2B 2XYHB 2FB0A 4LREA 2BE2B 1N52B 1N0UA 1QSSA 1OY9A 2XB2D 3RG2A 4B3MF 4LSZB 3FNNA 4F0KA 1ML8A 1O6XA 3A8JA 3IS9B 1KHWA 4IZ6A 1NXIA 2DEJA 5IQQA 3T1HF 5H9FJ 4AFFA 1ZH5A 4B3MC 1SIWB 3BV8A 3CJ2A 3PHEA 1PYOB 4I6WA 4NYZA 1MN9A 3DRSA 4OYAA 3IRWP 1R8PA 1NKEA 1G3OA 2MJUA 2ZDPA 3KNAA 3IAM9 1FX2A 3JSMA 4CQ1A 2RQKA 3GZ7A 5H1SV 4R0MA 3K6RA 3BGLA 1XMQC 4DCSA 5IOLA 4ES2A 3HSGA 1RAAB 5ETKA 2XHCA 3DLBA 1HD1A 3ZTQA 3HHLA 3DLJA 3SCIE 4NASA 1C1BA 3SDEB 4A8KA 2BJ3A 2BH1X 3KNGA 2F40A 2NCKL 3VGVA 4QWAA 3OSPA 4KGMA 5KFKA 4ILMA 5C42B 4JI1C 3OFGA 4DZDA 1S7IA 3OLAA 2HYIB 1SVDA 2XMVA 1GH8A 3B7WA 5FDLB 4LFCF 3NAIA 2M3DA 5F8GA 1Y5LB 1OSCA 4NLRA 1XNQJ 1AFIA 3CO0P 4EYHB 1X8DA 1DHMA 3J7YU 1MXBA 5KYVA 2F4FA 1ZB8A 1A6LA 2D9PA 2DGTA 9ATCB 3HT3A 1CJVB 1TP7A 1UMJA 3BGFA 1B99A 3ETOA 3G8QA 5CYMA 1U6BA 3OHAA 3CW8X 4WXOA 5KFUA 3EPGA 5I4MA 2MHEA 2A2CA 2F7VA 2M52A 1E6YB 3NNCA 4FVMA 5J2MB 2D1CA 2ASJA 2ADBA 4KV8B 1PIEA 5KFYA 2QV6A 4IDKB 2W9AA 3HKZD 5KFSA 2NLWA 3ZZUA 3W5YA 2JNVA 2ZNYA 4UT4A 1JLQA 2CZ9A 5IFIA 4K4YA 1RTJB 3ISND 4Y0FA 2V68A 1V3RA 2KRRA 3CXCR 3MAQA 1N32J 4U6PA 2AJFE 3I82A 5F41A 1TFWA 2B9XA 3EPIA 1TKZB 2R3VA 2YWWA 2VG6B 4PEOA 2H54B 3BBBA 2A18A 1QAXA 2GMJA 4ENOA 4NLVA 4CLSA 1OIAA 1LWCB 3GP9A 3LGMA 2CQ2A 3KG0A 4H4OB 5CAAA 5KFNA 3OTOF 1SJRA 3VVUA 4X64J 3GMGA 1JJCB 1G4CA 3VGUA 3IEUA 4Q5VA 3CDAA 1I94C 2AJ0A 1WF3A 5IXUA 2JH3A 2YY3A 3MM5B 3NGKA 3M6XA 3GKUA 3W2WB 2UVUA 2DK2A 2LKZA 3PYEA 4TY8B 2N3LA 3HVTA 3OTCA 3PIOQ 2C2EA 1R0AB 1J5OA 3DRYA 2R8HA 4QPTA 5SUHA 4OYWA 3LPYA 3BSNA 5FJ4A 2HHHC 2AYMA 2VV5A 4RBTA 4WU2A 4F50A 4DR7J 5I3UB 2C3OA 4NL5A 1N5TA 1F3FA 4RM3A 3SYZA 2GVZA 4LF9F 5IS2A 5C2CA 2QVYX 3DAYA 4USJC 2HRYA 3QWPA 2JLEA 3MGJA 4NA1A 3W65A 1WEYA 2OELA 2Q43A 4PHTA 2NPFA 4DMZA 4ED8A 2BRKA 2NSBA 1RT2A 3HDSA 2RJZA 5C24B 3H90A 1S4EA 2H5EA 3TQIA 4GVLA 2D41A 2QA4S 2JEIA 3M1VA 1B70B 2QO3A 1NRKA 1SH0A 2BDPA 1FCAA 1CULB 1RU1A 2MKYA 3H42A 4HI1A 4G3IA 5SZTA 3IPLA 2J0WA 3HHLD 1SI9A 3MECB 4YQWA 4DS5A 5J1NA 1U1MA 4KHPF 2IJRA 3B82A 1C0UB 1TV6A 1GFWB 1Q8IA 2HGNA 2ZE2A 4HVZA 5CZXA 3TJAA 1VC6A 4HPVA 4JI0C 2HIQA 5DGAA 4NDNA 3AJ2A 3NGUA 2P20A 1ZM2A 3E8OA 3PJWA 3RB4A 1MKYA 5A1IA 1FK9B 1TVRA 4CM0A 5H9EJ 2BR0A 2UUBC 4NLYA 1JLEB 1NHKL 3PYFA 2IVYA 4ZVUB 1UVLA 4EU0A 3KUEA 5KFBA 3I9ZA 2EGTA 2X7IA 4NXNF 4FS1A 3DHVA 3GR1A 3KUHA 3CDBA 3LANA 1TU0B 3J80U 5LSOA 4BSZA 3MMAA 5E41A 2CJAA 4DXLA 2J0XA 3M32A 1G7CB 3KG4A 4QOTA 5HLFB 2W4DA 3RBZA 2DEIA 2YWGA 1HFEL 4TQRA 5LT5A 4DR5F 3M8YA 3MURP 1NSPA 4UQGA 1ZB9A 1IJEB 1GX6A 4ZCMA 2ZZTA 5B0GA 2IAJB 4IOCQ 1KOHA 1VQLS 4OI0A 4LF6J 2Y8WA 3HHDA 4N77A 3DOKB 1HWUA 2WVCA 3ET6A 3P4UB 3QAEA 4C97A 1VEHA 2OPLB 1RWXB 2AD9A 1FKOA 8AT1B 2CNKB 4QU7A 3MI7X 2AGQA 2H3EB 3DLGB 1N36J 2JVRA 4DV6C 1T5DX 4DV5F 4TYBA 2VD3A 3MM7A 1KONA 3MAHA 3E51A 3L7UA 1XQIA 2BABA 2W01A 3NRBA 2HQDA 4DL3A 2FJWA 4BDPA 1T03A 2VH7A 1VBZA 2J5AA 3R6LB 1VLOA 3CJKB 3S7RA 4OI6A 4Y65A 4LFCC 2VBWA 4IH7A 1JLCA 4OHVA 4X4OA 1LW0B 4GKJJ 3NAHA 3NYQA 1LW2B 2E1PA 3PFOA 3A13A 3ZFVA 3K17A 4KTQA 1FJGJ 4PUIA 2YWCA 1VQSA 1DQ8A 3BGOP 2APOA 3M8PA 3KK3A 5E0OA 2UU9J 1XRBA 3LOUA 4NCGB 1AA1B 1RT7B 3FBCA 4WYLA 1YBAA 1T11A 3NEKA 1UJ6A 1FRKA 2FC9A 3W9IA 1UPMB 2G2YA 4DQRA 3T5JA 2G0IA 1HNIA 3POTB 4LVNP 4OYZA 1U1QA 1U1NA 3C2PA 1W2IA 2AYGA 2GQCA 3FMBA 1HPZB 4USHA 1HHQA 3OL7A 1F5BA 3LAMA 2XYGB 3TZZA 4IRCA 5DGBA 3B4MA 5JMNA 3AD7C 2P5VA 1QUPA 4S0MA 1S1UB 2DY1A 1LWEB 2YXLA 4CO1A 1T05A 4KHPJ 2IMOA 4FVCA 2JEJA 2GZOA 3IWNC 4LQ9A 3BO2A 3A9UA 2JOQA 1EQMA 1HQUB 2OKQA 3KHGA 5GAEI 1VHIA 4USMA 2R8JA 3T9NA 1KEKA 2D69A 5JXSA 4EO8A 4XO0A 4N5SA 3UNGC 1FVQA 1XR7A 4QIGA 3CCVS 4A47A 3TAPA 3GV5B 2CQDA 2HS3A 2UUWA 5G0RA 4DI6A 2O3DA 4CYUA 4WFNQ 1IJFB 4LRAA 4ID5A 4YFUA 3AQPA 3K5LA 2KVIA 2QMXA 3V6DA 1TK0A 1S1XB 2ZH8A 4QYZK 4Z2XA 2XSFA 1K0VA 1JOSA 2W7OA 2R7RA 3C16B 4UW2A 2KYZA 2GGPA 3FJ2A 1TR0A 2YPZA 4YY3J 4J9SA 3PKMA 3K5MA 5BSWA 1U0SA 4CNYA 2HW3A 3WBZA 2OIHA 1SKSA 4RW8B 2DH7A 5GADI 2OPRA 2W25A 1WF2A 4XPCA 4WP9A 3JAMY 1X9SA 4JI7C 4K4XA 1GAOA 2V4JA 2MLZA 1M1GA 3DDIA 3QGIA 5AT1B 5LXRA 1H7WA 2XMJA 5IC6B 3TVZA 3WX8A 1B64A 2HMIB 2CNLB 3M8SA 1RAJA 4PRFA 5H9FK 2MQMA 3EVWA 3ZTRA 2BZ2A 4C6AA 3MR2A 2C1EB 4A8FA 1Q86T 2CJYB 2ZH7A 5DZ6A 4LF5F 4DX7A 4PQUA 1RABB 3BS9A 4IFYA 2A0FB 2IVFB 5DDQC 1RAIB 2HBYB 3HX9A 3QAUA 3TX8A 4AT1B 1JJ4A 2QFIA 1X7VA 2PDAA 2HHWA 5RUBA 1VJWA 1RA6A 2BRLA 4DPXA 1IR0A 1JLAA 2MGZA 8ATCB 3T1YF 1IBLJ 5BURA 2XZDB 2UXDC 2AHOB 1ZOTA 3D7SB 4JI6F 1H2VZ 1UZHA 1XEZA 4Q43A 3RRHA 3UEBA 5IC4B 4RU9A 2B4VA 5G4DA 3FSIA 4Z7YA 1S10A 2E5HA 3IM8A 5F8MA 3KJQB 5FLXD 1MROA 3R5JB 4ATNA 2DHSA 5F9LA 1RTDB 1WEXA 4URQU 3DLEB 1SQEA 2OSRA 4QIWD 4QZVB 5KG5A 5DDOC 3OJSA 1R27B 1RDRA 3H98A 3CC2S 3BBCA 2ZOMA 4GVBA 4ZCKA 3UO0A 3PO4A 3J7Z5 2B9EA 3LP1A 4M5LA 2HKEA 2V8GA 3UFCX 1HYSA 2VOPA 4ZVFA 1ELOA 5A8KA 2BJ1A 2YKOA 1KLMB 3BREA 2HFZA 2OPLA 1X4EA 2C3UA 3N6MA 1REVA 3Q2SC 3CSKA 1RWNB 4DV7F 1MU2B 1PJ6A 1VR6A 5K8FA 4P2FA 1FRLA 2V69A 1D1UA 2B9WA 3UVJA 3BBFA 3PR5B 1VQ5S 1VRQC 2YBVA 2IA6A 2WB1D 4J9RA 1AFJA 4FP9A 4MH4A 2DGOA 2XSJA 3QMQA 1KFDA 4JV5F 3PESA 2D3UA 1SJ1A 5B7WA 4DF4A 3PW5A 2UXBC 3I31A 4G1PA 5L39A 4EO6A 4DR2C 4Y00A 1QTNB 4RNNA 4B3SJ 2D1TA 3DOMA 1LQLA 3S82A 2EVZA 4ED1A 1RTIB 5ETMA 3BSAA 3UN5A 2CQBA 4QYZJ 4C2MA 2YKNB 4DV2F 4CH1A 3TZXA 2QLFB 2KZZA 4MMOA 4USUA 2VL1A 4MAKA 4UOGA 3IS9A 4B08A 5MLCV 1NPRA 2VQEJ 3DDNA 1UA0A 4B3MJ 4IUFA 4PG5A 3IC1A 4IG3B 1VOMA 4NXMF 3Q8RB 1S76D 2VICA 3KK2A 3SV4A 2H48B 3TI0A 2R42A 3BB5A 5EWGA 2AWZA 2OPSB 1U26A 1R6YA 3TA0A 4F25A 5JJBA 3KLEA 3E01A 4D3GA 4J9LA 4DSFA 1HNXF 3X1LB 3QGPA 3B4DA 4NLWA 2BM0A 2BJDA 2BX6A 2QGFB 3MAAB 4DQSA 1WH9A 1VLYA 3NS6A 3FCHA 2H4WB 3R97A 5L1KA 4Q8EA 1ACMB 4C98A 3G8SA 2LP4A 3ADAC 4ES3A 5FLXU 1KWMA 2IY5B 1N2FA 1KQFB 2Y9HA 3B54A 4LRFA 5KT6A 4P52A 4KTTA 1F2HA 2BANA 2IHR1 2HRTA 2P2CB 1RT6B 2M5YA 4L74A 4QWCA 3H4DA 2UXCF 1J2VA 1FNMA 1HQ2A 4JI5C 2VG5B 3UDCA 4B9TA 1P27B 1HNVB 1U02A 2E5LJ 4F3OA 4UY85 4NXNC 1U45A 3MZIA 3GV7B 2ZD1B 1AB8A 4UOFA 3H40A 3C6TA 1SIZA 2MLXA 1CJVA 1NHUA 3KJVA 3BYRA 3VAMA 1X60A 3EZUA 3IXQA 1NKCA 1HNZJ 4FXWA 2E9RX 1XNRC 4DG1B 3MFHA 4ETZA 1WF1A 1X5SA 1CG2A 2IRUA 3AJDA 3CJTA 3QSIA 3KLGA 4ED0A 3T5HA 2PE8A 3JQKA 5J2MA 4KPYA 1HNZF 2MMAB 3AF6A 3HSZA 4K2XA 4C48A 4MFBB 4PUGA 3VAHA 2K1RA 4DV7J 1RT5A 2HGMA 3I4HX 3BQ2A 1FO1A 2QRRA 2E8CA 4DL0C 5HP1A 4HH0A 2DD8S 2YNHA 1TKZA 2IYIA 4P71A 5I42A 2HHQA 1L3SA 2E5JA 2HAIA 3RJMB 1LWCA 1L3KA 1FRHA 2M70A 1H2TZ 1S48A 1CLFA 2KI2A 5T7LA 1HBUB 3L7OA 4DR5J 1TKDA 4EEYA 4ED7A 1RAEB 3H4BA 1NDPA 1RACB 2RHSB 2W8KA 1VBXA 2HURA 1NH8A 3VNQA 3W2WA 1CJUA 1S72S 3C66A 4X66C 3J80D 4KHMA 4C8OA 4PR6A 3EYZA 2AYBA 4RWXA 5BUQA 4DR7C 4UTGA 4KAIA 2GHWA 3UI3A 5K8NA 1T9UA 2AEJA 4K7QA 3NGDA 2DCLA 5I3UA 3WIVA 3HJVA 5HI7A 1S0NA 5DDPC 3FK4A 3LH2S 3GQCA 5ETLA 2VDHA 5LMNJ 1SL2A 4DR7F 1HNWC 1ZZFA 4ANEA 4HDGA 4B3RC 1TL5A 5H9EK 4O4GA 1WKKA 2YKMB 3VNRA 1FWKA 1RK8A 2B9YA 3G6YA 1APSA 3PROC 2MXYA 1VQ9S 5KG2A 4ZMMA 8RUCA 1LKZA 1N5YA 2VFVA 3BF4A 3EMTA 5LM7E 1NK8A 5ETTA 4DZ6A 4FXDA 1Y5NB 1M6XC 4R8UB 2E1MC 4FYVB 3V4IB 1XN9A 3D9BA 1YLXA 3U1NA 2JNJA 2AEFA 5BR8J 3PW4A 4DEZA 1VC5A 1T9TA 2OJ3A 2GFFA 2OFGX 4QJVA 2KH9A 4ELTA 2F1FA 3BPSP 3ILIA 1HARA 1TV6B 1YJWS 1DRZA 5BR8F 4IFVA 1CEZA 4G36A 2IC3A 2IM2A 4TQSA 2AF6A 3TAMB 3F73A 1HR0C 1C4CA 2UUBJ 1DURA 1FK9A 1TVRB 2AJ4A 5DO2A 2DNQA 3T6JA 3TRGA 4K50A 1KQGB 3R6GB 4DPTA 2B5JA 1FDBA 3ISNC 3M05A 9RUBA 2RIJA 3C6UA 4X4RA 2FGOA 3OL8A 1DLOA 4DFMA 3OVAA 2RSQA 5ETRA 5I3PA 3HLUA 3KK1B 1GNKA 3QBCA 4K4TA 1KVKA 2AU0A 2XI3A 1PJ5A 2ABYA 3B78A 3KLHB 3KLIB 1ZPWX 1VQKS 3KTQA 3Q8QB 2ZBQA 1IKVA 4OX6A 1VQ6S 2XMAA 1RJJA 4YR0A 4DSLA 1FUGA 2WHOA 3A3NB 2BJ9A 1M0SA 1OYEA 3CJ8A 3HF5A 5A0YB 2QA4G 1NK9A 2WW8A 1TL3B 3O44A 2W4PA 2XY7A 4ICLA 2ACMA 3HVWA 2BYCA 3SMZA 3OVBA 2G2OA 4R1MA 3CD5A 4PUOB 2EI5A 1MMNA 4OI4A 2DO4A 1P7LA 3M2RA 1WC5A 4FYXB 4B9LA 1TL1B 3AOAA 2NZCA 3RRKA 4LSNB 1K0TA 4NI2B 4ZVGA 1NJZA 4DUYJ 2M5OA 4I56A 2LEAA 3BGRB 3NCPA 2ALYB 3A8KA 2VQFF 3NGTA 1M5OC 4MYTA 1T94A 3CTRA 2HK3A 4ZHRA 4HKQA 1ZTTA 2ERRA 2XMKA 3QJJA 1Q78A 2DY9A 3QWUA 2FUG9 1YK9A 5E33A 3MEDA 3VVTA 2QYCA 1FJGC 2FHJA 1H73A 3TQ1A 5EN1A 3SBMA 2HFVA 2Z57B 5ADZA 5D0EA 2UU9C 3CDEA 4Y2AA 2RQCA 4M94A 4NCGA 2W7AA 3CQ3A 1IBKJ 5A2QD 3H2UB 4CLWA 2AJQA 4C0HA 3L8CA 2O66A 3EJMA 1U8WA 2CFXA 4M95A 2FY8A 5HJXA 5D77A 1HPZA 2PEBA 4EFAC 2X1AA 1QTMA 1P4EC 4MTPA 1OY8A 4JV1A 3N2QA 3BO3A 1UL3A 4F4ZA 3DNCA 1YHQS 1R8HA 2UUCC 1PC5A 5GAEU 1RY2A 3RB6A 1W26A 2YKQA 4MKYA 4N56A 2FVPA 4HHHA 1SC4B 1U1OA 3CCWA 4ECXA 3M9NB 3MM9B 2HHTA 4DR6C 3I56S 4LFBC 4O44A 4YDDB 3ZZTA 4A8MP 1JXVA 3T1HC 2KZMA 4ZJOA 2FJEB 1IBMC 3NS5A 2KJWA 2L41A 1GMWA 2DGXA 1FESA 5JVGQ 2CXCA 2HVIA 4WKRA 4YY3C 1WHWA 4ECVA 2LU1A 2HJGA 4YB7A 4B9MA 3IR7B 2UXBF 1QE1B 1NPKA 3N54B 2IBKA 3E7XA 2OI2A 2V34A 5HMXA 2ZHAA 2RRAA 1FNXH 3E7WA 1CQNA 1PYSB 3B6BA 3LP0A 3NKYA 4ZP7A 3OL6A 2Y0BB 4F26A 3UCUP 2HNYB 1R8CA 4OZ3A 1IBLF 1S59A 5KFHA 2R8IA 4K5RA 1S0MA 4JI7J 4JYAC 1X9WA 3LTOA 2HFSA 2V50A 2GCFA 4WE1A 2NUUG 3PX4A 1LEOA 3NWRA 4RO0A 1UPPA 5KFXA 4YHHJ 2HAFA 2VODA 2E0GA 4K0KC 1WDTA 2LU2A 3ISZA 4NWBA 1NHVA 3QT8A 2ZWPA 2CRLA 2L08A 4OFZA 4P7VA 3GFYA 3KHHA 2ZM6J 1QLNA 2JMPA 1Q79A 3M6WA 2ZOFA 2BW7A 2ASLA 4A8SA 1Q7LB 1G2EA 3D0HE 4ZP8A 5GTDA 2KXNB 2B6AB 2NXCA 3VHQA 5L1IA 1HI1A 2C22A 1VQ4S 1UFWA 4ISBA 2CG4A 2E5GA 3QATA 4M5DA 4ZCIA 1N33F 4LFAC 5DDRC 3KLFB 1IVZA 3CCLS 3KWMA 3CVKA 1BD6A 1IKWB 4M1KA 2FHJD 1BE4A 3ZNUA 1PU1A 4PG8A 2OMLA 2DGQA 1RT3B 4KH1B 4J9VA 5K9FA 3L9ZA 3GPCA 4WF9Q 2E9ZA 1AT1B 1VQMS 1IB8A 2KG0A 1URRA 2JEFA 2DIUA 4PAAA 1QAJA 1USPA 4L4QA 2R7TA 4QYRA 5GMEA 1DTTA 1F9FA 1OO0B 1X4AA 3M6VA 2AV5A 4H4KC 4KSEB 2CIMA 2HHUA 3K7RA 3UDEA 4FBUA 1C2PA 2HWHA 3MMBB 2QSWA 1NBEB 4PXEA 4C4WA 2ZUGA 2VJUA 5K8OA 1L2FA 3TEHB 2YNIA 3W62A 1NDKA 5CH7B 2DITA 4ZVTB 2F4VJ 2MQ8A 4EYIB 1AMUA 3PIPQ 3G4SS 2H4YB 1ZAXA 2R7OA 2HFNA 4FPIA 5J1EA 4A8YA 4DSIA 2ZZMA 3A4IA 1JNRB 4XIUA 1DQAA 4N8NA 5HBMA 4RNFA 2JFKA 4DR3C 3M9OB 4DS4A 3VAGA 3DRPB 1NUEA 2MZQA 1U2FA 2I9SA 4R5PA 5J2NA 1JB0C 4ZVEA 4RW4A 2W7PA 2YQ1A 1FDAA 3TUPA 1XHJA 4MJKA 4I9GA 3PYGA 4HI2A 4LF9J 2VUGA 3DLKB 4KRWA 3GSDA 3QGGA 4NLDA 6FD1A 2N7CA 2VSQA 2F65A 4XX2A 1IWAA 3C14B 3D4JA 3ICLA 1NJYA 1IQZA 1RHKB 3HXMA 5IT9Y 2KFNA 2IM0A 4OQJA 2ZH9A 1K9MT 4X65F 2MTLA 1VRUB 2EC2A 3G8TA 3ZTPA 5HJYA 1HBOB 2V2QA 2E1CA 2BOPA 2GIFA 2HZVA 1FERA 4AQYF 1FXLA 4YUDA 2DNLA 2GS8A 2A1BA 2RF2A 4ECTA 2CVIA 1P9YA 2E5IA 3IMQJ 3E01B 5B08A 3DI6B 3KLEB 2DNHA 4DUTA 3OW2R 1N34J 3MR3A 3CCMS 3PVXA 3W5ZA 1M90T 1WC4A 4JI8F 2HGLA 2V67A 1KQKA 4M5JA 1T9WA 2ASDA 2C28A 1DQ9A 1HQEA 2HLTA 4MIBA 4C11A 3KXWA 3IFEA 4MH8A 4ER8A 2HIYA 3W66A 4L76A 3V6HA 4RNHA 3GLJA 3N5FA 4DSKA 3TUFA 1N5SA 1Y11A 3M4XA 2M9KA 4P10A 5C25B 5CCLA 2MQNA 2BW2A 3CIZA 1JLBA 3BSOA 1S97A 1KRPA 2MJNA 1RT6A 2GMHA 3IRXB 1S12A 1TL7B 4J37A 4NEZA 4NRUA 1VFJA 3J81Y 2HQCA 1SKRA 2I8EA 2R7XA 4YDXA 3I0SA 5IM0A 1RHMB 3RW6A 5H9UA 4DQPA 3M30B 2RU3A 1FD8A 3AJ1A 2DO0A 3W3SA 1CJTB 1GQEA 3C6TB 2QW0X 3QT7A 4ECRA 2EK1A 2UVVA 1Q1KA 1HNZC 5D0GA 1KP6A 2W9BB 3ZNJ1 4N76A 4MKAA 3D1QA 2ZC4A 3U1LA 3MD1A 1ZBTA 3QO9B 2DXEA 3NI2A 1T9XA 2B8QA 3RB0A 3U1MA 5LJ5Y 2ZDOA 4DL2A 4B3TC 4LF5C 3N4WA 1PG5B 1DTQA 5LSLA 3F56A 5GMKa 3J7YI 2VOOA 4M5MA 1UW9A 4D3HA 1NCLA 1SUQB 4LIRA 2H9ZA 3I96A 3THTA 1LV5A 2ATCB 5BYQA 7AT1B 1IBKF 2K8GA 5I42B 1N56A 2LXFA 2E5LF 3BEGB 5EHHA 4PYDA 1HBMA 1KNZA 2W9CA 2MPUA 2Y1LB 2P9CA 1WHXA 4JV0A 3UR0A 4AE5A 5LMUJ 2DPJA 2LQBA 2DPIA 4DR5C 3ZC4A 1V60A 1KS2A 3LAXA 3K8VA 1D09B 3UZ0A 4PPDA 2DR9A 3PW0A 4C7QA 2VF3A 1K0RA 1CJUB 1KTVA 1PBAA 1VHFA 2BE2A 2RRBA 3NWGA 1Q5VA 1RB0A 5E2QA 5F0WA 3TNVA 3TUZC 4ID8A 3CW9A 3OXFA 3M8ZA 2E7VA 1RP5A 2DYAA 3V6KA 2MZRA 1WACA 2X1GA 1JKHA 4F4WA 1M5VC 1EB0A 2G1HA 2YX4A 2V2VA 3NOGA 4I7FA 3UOWA 1NZ8A 3IWLA 5LOQA 3NL0A 4MK7A 1WWHA 2MEWA 2YKMA 5KOWA 4DR4J 1UEUA 4LQ3A 2DHXA 5K8PA 4OHYA 4O0NA 3FSXA 5KG4A 3M6UA 4G6VB 5KTQA 5IT0A 3H5UA 4GRSA 1SH3A 2CJKA 4N47A 1YWXA 3QIPA 4TVAB 1WHVA 3DRRA 4R8UA 4ZLJA 3U27A 2QLXA 4YHHF 2YPYA 4IOBA 4OX7A 3ZZYA 2ILZA 3EGWB 3FEXB 3R7BB 3WX4A 1NKBA 5BR8C 1AZSA 3I5BA 2B7CB 3TZYA 1QJHA 2KYXA 4OX9C 3JTOA 4KE5A 2D7SA 4DX5A 5KAKA 4XK8C 3IWXA 2HS0A 1JNZB 3D6FB 4AL6A 2FJAB 2LQ5A 3PW2A 2BEFA 2CJBA 2GO8A 2HVDA 2PO4A 1LWXA 3EVOA 1CS4B 3GYXB 1U0HA 3HT0A 3D3CJ 3LW5C 1XTZA 3BPDA 4ED3A 2AP6A 2YQ3A 2QTWA 4HH1A 2K7KA 3IBWA 4USWA 5HATA 3EUNA 3PJXA 4JI2C 3VZHA 3QLHA 4LF7F 4EBDA 3EGVA 4PABA 4ZCLA 4DV6F 4G1IA 1T02A 1MN7A 3I0RA 1IR1A 4N41A 1TKXB 1XERA 2VQFJ 2PT7G 1FKPB 3SV3A 2YCBA 1IXKA 3T5LA 3ULHA 5A8WB 4QIVA 2FHOB 2QEXS 2GIRA 3R8YA 3V4MA 2F9JA 4JM1A 4DLGA 1NYEA 4KO0B 2QMUB 4J9KA 2ADCA 1FFWB 2JSXA 1FDNA 1OS5A 1RTHB 2EFGA 2YX1A 2IJNA 1C0TA 3PG9A 3QT5A 4KKOB 4KY3A 3D67A 4ECSA 1N48A 5KOXA 1KBRA 4FF1A 3DYAA 1BWVA 2LCWA 2ZITA 1O92A 1R3NA 1SC3B 2IRXA 2PC6A 2KN4A 4RLEA 5KFLA 2F9DA 4HHUA 1P9QC 3LP2A 5F8HA 4L72B 4TY8A 3WC2A 4RBUA 4BC9A 4DUYC 3OPKA 2B43A 3O2IA 5CD4A 2HQFA 3BGRA 1BQXA 1ZM9A 2XEXA 2COLA 4P72A 3J80Y 3OR2A 4ZPTR 3AAWB 1QWIA 3DU6A 4NLPA 1WTBA 3GJQB 5K14A 5B09A 4DUYF 3EZ5A 3MUMP 1KHVA 4BBYA 1Q16B 4OI2A 1MMLA 1MWZA 1P6TA 3DXBA 1SV5A 3PFEA 4J9MA 4BLGA 4B3TF 1NDCA 1QY7A 1T9VA 1P1TA 3MEDB 4U8VA 5KFTA 1FX4A 3K5OA 4YB1P 4AXJA 4LF7C 4TNOA 2XM3A 1CC8A 3ETCA 5IZHA 2RILA 4UF4A 3W63A 4J9QA 4X4TA 1IBKC 2FQQB 2HK2A 2R7UA 5HANA 2CPYA 1RAGB 4JBCA 2IMWP 1A7GE 1F5AA 4FNHA 4JYAF 5JUMA 2GIQA 3NY0A 3A25A 3MOZA 5DRKA 5BUSA 3T1AA 5ETNA 2WSCC 5T8TA 4JV5C 3CT9A 4K2JA 2KZFA 1FTCA 1R8BA 1S79A 4ZDNA 3D0IE 3GR0A 2XYPB 2VHGA 4LR8A 2Q66A 2EK6A 3CULA 4H4KA 2R4FA 3JAMD 1UCNA 1VQYA 2DHHA 3FEYB 3DFEA 3MEEB 4RR5A 4ANDA 1BGXT 5KT2A 3MM9A 4CTAB 2OH2A 1TUVA 2PI5A 5KFAA 2UV8A 3JAMU 3GIMA 5C5JA 4ECUA 4F2SA 3CCZA 5T8SA 5LXYA 4O3QA 4PQAA 1NB7A 3QRRA 2CPJA 4ZPWR 1BUXA 4DV0F 1LXNA 1UETA 3ILOA 2JC0A 2VA3A 3TEGA 1U1PA 2YQ0A 1HA1A 2YNGB 3R27A 3M8RA 1FKAF 5F8IA 5HLFA 1X5OA 4CH0S 4GXQA 5CABA 4R1LA 1REGX 2WB4A 3F44A 2D9OA 1QE1A 3PJ9A 1LWFA 3D6TB 4C8KA 5D4OA 4DJBA 4YMEA 2ZZNA 3UN2A 2FLNA 4H4OA 1HBNA 4U95A 4HYKA 4RW6A 3R1HA 1H6KX 1S6OA 2RE1A 3HD1A 4R25A 4JYAJ 2PEHA 1BWEA 4MTNA 1VYAA 1OWXA 5IT4A 4DCTA 1B0TA 1SCJB 3K5PA 3M2VA 1R0AA 4JI4J 1BLUA 2BM1A 2G1DA 4ZPAA 4B17A 4JI1J 2VPYB 3FBEA 4U9RA 3AOCA 3NMRA
chains in the Genus database with same CATH topology
3TAQA 1H2UX 1FA0A 3D54A 1XNQC 5JRHA 1U09A 1N6QA 5D78A 4ED2A 4X62C 3QJLA 3WDOA 1MSWD 3HVRA 1ZTWA 2B56A 5LMUF 1FRIA 2GV1A 4M8LA 3C46A 4RW7B 3N01A 5KFOA 3MM8B 1T7PA 1OQ6A 2V4QA 2KB2A 4TKTA 2R8KA 1MWYA 3LAKA 4U5YD 1RT1A 5DG9A 3LUSA 1RYRA 3POTA 3NNAA 3TVYA 3OR1A 1FHTA 3HM9A 3PV8A 3Q24A 4Q2MA 3OUYB 2CQHA 3IR5B 3FCEA 4X64C 5L38A 2UVRA 1TL4A 3EGNA 5D4NA 5EUHA 3QZ8A 2DNRA 1IKXA 4C0OC 4H4MA 1S99A 4MYUA 5FD1A 2LXUA 3M2UA 3NBPA 3G71S 2YNIB 3OTDA 1N54B 3K58A 1XMBA 4WFXA 1VQOS 3KG1A 2HLUA 3MMCA 5J1EB 4FYDA 2XNRA 2XNQA 3RR8A 4CO4A 4FTFA 4DSEA 2FVSA 2IA0A 3LALA 1F2GA 5BSTA 2VQEF 3OSNA 3M32B 2YWEA 3OLBA 2DHGA 2AYAA 1NU4A 3MEKA 3QYYA 5E5NA 3NPDA 4ZLPA 1D3WA 3H25A 4F4KA 1V3SA 1MW7A 2FDNA 1VK3A 3BZQA 1XWLA 3P3DA 3TVKA 5D4PA 2XCPA 1BQNA 4CO3A 3C5EA 3G6XA 2HWTA 2M88A 2R8GA 1AUDA 1URNA 4O3PA 1S0VA 3IO1A 1RKIA 3RV2A 1Y7PA 3NMAA 4ITSA 4C8NA 4OHZA 1L3TA 3F41A 1YJRA 1Y0HA 2E9TA 4WZMA 3D5MA 4B3RF 3FCCA 4RZRA 1TFYA 2M8HA 4LJMA 5KFIA 1O5JA 1T03B 3MUVP 3LNVA 2XLIA 4DN9A 4DPOA 1KQSR 2XI2A 5KFRA 3DLLQ 4FF2A 1KD1T 4RW9A 1VI7A 2JZ5A 1H7XA 4ZA1A 3H20A 1JLAB 2KRBA 2A2DA 3KLVA 4GO5X 2BV3A 4KV8A 2JLGA 2HHPA 1RWUA 3G7SA 5D4LA 2R9LA 2JL9A 1PGZA 4D56A 1GX5A 1VRTB 3O5TB 4IRKA 4C0BA 2ZVSA 1WELA 3SCJE 1IN0A 2FGCA 2W9BA 2OP5A 5CZVA 5KG7A 2ZJRQ 1E6VB 5KFPA 4O4RA 3JSRA 4LF6C 1KC8T 1T05B 4TLRA 3RZAA 3MPWA 4GMKA 3H5SA 4F67A 4CT9A 3MM5A 3ENQA 1L3UA 4ZPBA 1Z2ZA 2BACA 2DNMA 2E7WA 4FN5A 3MPVA 1N36C 2WONA 1YI2S 4X62F 1NO8A 4ID5B 4EGLA 4DL5A 3V6DB 2UUBF 4JI1F 1OPIA 2IJFA 3M8QA 4WIIA 5LMUC 4LVOP 2FJDB 3R9XA 1KFSA 3BN7A 2E66A 1MXAA 3GB0A 3OQ2A 2LDIA 1FRJA 2WCXA 4QW9A 2HWIA 3G6ES 2C2RA 2ROEA 3UCZP 2FD2A 5HROA 1VQPS 1BQMB 3MTKA 5IT9D 2P6SA 1RISA 2QZ8A 2V4JB 4G1QA 5D3GA 5F8JA 3KK2B 3IR6B 3AB2B 3QIDA 4DV3C 3RB3A 2ZH4A 4ZK7M 2OPSA 3NLCA 2LEBA 1BA3A 3OHBA 3VCDA 2HNDB 1HL6A 1Q4RA 3E2EA 4KHPC 2CQIA 1CQMA 5E3CA 4DR4F 2K3IA 2KM8B 2OMOA 2CKWA 3PNIA 4OLOA 2XZWA 4ALZA 4DR6F 4FUTA 3MOJB 3W2VB 1JLEA 3QZ7A 1U24A 1RGVA 4UQTA 3VR1A 2UUAF 1SB6A 1X5PA 4LF4C 1I94F 3T3FA 2AGOA 2XR1A 4FZVA 2MGZB 1S4FA 3KFWX 1S9EA 5DS7A 1HMVA 3VF0B 1H0HB 1UFLA 2W4CA 3HKWA 1U1RA 3I4PA 2QMWA 4WZQA 1GT8A 1MROB 3TP2A 2DISA 4I9FA 2DIVA 4X65C 4DV4C 4HT5A 4GXRA 1HI8A 1XR6A 4XAKA 4PKDB 5BSUA 3CDWA 1UJ5A 2EKYA 2XLKA 4J9PA 1FEEA 1Y5IB 2GHPA 1UVMA 1F60B 3KMQA 3LP1B 2IAJA 5EDWA 1QUVA 1V9OA 2LQJA 4ZPDA 5A8KB 2N7YA 2GA7A 1VQ8S 2HRUA 2V9WA 2IM3A 4YOEA 3CW8X 2Q1LA 2BQ3A 2EFVA 4EBCA 1HW8A 3CO9A 2X51A 2MSSA 4WCEQ 2AYEA 4OJ3A 4WXWA 2RUGA 1MU2A 4O23A 4OI3A 2G4BA 1O93A 3DCAA 2YNHB 3JYTB 2CZVC 1QM4A 2KXFA 4KO0A 3IA0A 1N32F 2XSJB 4F8RA 2GJIA 2ZKTA 3IG1B 1UA0A 2VFSA 2FHKA 1CPZA 1S1TA 4OZJA 3V81A 5GVQA 2V5HG 1DFDA 4NLTA 1IKYB 3CB4A 2MKHA 1U2RA 2C42A 2JX2A 4DDFA 2WK4A 1S1WA 2HNZA 1GTHA 1UJ4A 3JTNA 2C2DA 1IBLC 2J9EA 4DG8A 2P2JA 4P7TA 2DJWA 2Z2LA 2FIUA 1CSJA 5K14B 4QR2A 1T95A 2VBZA 1DAXA 4LMZA 4RVNA 3AHPA 1A9NB 4NCAA 2LEPA 4J5OA 1SV5B 4IRDA 2B3TB 4OMFG 4WYWA 2OTJS 4OJ1A 5CYQA 2X1BA 1TQLA 1H38A 3TDEA 1QVGR 4NYPA 3HHKA 4AL5A 3KOAA 3GYNA 5HO4A 2QSFA 1W25A 1AXQA 2E1AA 4HDHA 4PXCA 4Y2CA 1HQUA 5FIIA 5EWFA 4FF3A 3RBEA 4TN2A 3SI8A 2CPHA 4QPXA 2JDJA 1HI0P 2MZSA 4YB6A 3DHWC 5A6WA 5CCMA 2DYJA 4FNIA 5F0UA 4I6YA 1K1QA 2MZJA 1XC9A 1QSYA 2Y27A 2ATWA 4LT6A 2U1AA 1M5HA 2E29A 2QE5A 2OPQB 4Q8FA 2J76E 5KG6A 3HP6A 1LQLA 2I5JB 3TAMA 1RT4A 2CJQA 2GGPB 4B3SC 1YVFA 2B4UA 4KIAA 1S6PA 1O9TA 3MPYA 1UWBB 2B5JB 2L3MA 2G13A 1DBDA 1FEHA 2NSCA 4AYBD 4DG1A 1XR5A 3GFHA 4RMNA 1WF0A 2WOMB 3UD4P 5L9NA 1EETB 2X1FA 1LK5A 3BO4A 1WI8A 2J7KA 4IR9A 4X4NA 1IKVB 3GG0A 2POKA 1J5EF 3J7A1 2E8FA 4JUZA 1R89A 1FT8A 3CC4S 2XC9A 2MZTA 4XPEA 2QA1A 3US5A 1NK4A 4JV2A 4ICLB 3BGUA 1HBUA 2PT0A 2F4VF 2DR5A 4I67A 1QVFR 2N3OA 3CD7A 5DQIA 4PWDB 4IR1A 2C3MA 3V2UC 3RTVA 1S9FA 4KC5A 4LSLA 5J2QA 4LSNA 4DV0C 4URGA 3J81D 1R43A 1Z2LA 1YJ7A 4CI0B 3FEZA 4OZNA 5K85A 2D74B 2MDAA 2YKPA 3R5BA 2VFUA 5FLXY 2U2FA 4I69A 2Y1RI 5BSWA 2WRMA 1ZZNA 4HHJA 2E5LC 2LECA 1RTDA 3SO4A 1OPZA 2ZOGA 2B7BB 1JLGB 4I68A 3T9ZA 1MDFA 3AH6A 4K59A 2YWBA 1SJQA 2HPUA 1SL0A 1KVJA 3DMJA 4E98A 4OX8A 2CVEA 3S01A 4O3OA 1QAYA 2FVRA 3TO8A 1LFPA 1FJGF 4B3OA 3N0VA 4AUKA 1REVB 4OYCA 3HHLB 4OZLA 1RT1B 1O0PA 2LDYA 2KG1A 4GS5A 1W2BR 1LQ9A 2XULA 4I2QA 2HHHF 2CY1A 4ECQA 1Y3JA 1V26A 3VZIA 3CMES 3OUYA 3VAKA 2J6UA 4LIWA 5EX3A 5FDLA 5E3PA 4DF8A 2AX0A 2O01C 4KFBB 2ZH6A 5T14A 3CD0A 5L1JA 4X2BA 3G86A 5U47A 4H4MB 3OVSA 2VONA 5DM6Q 3NBPB 4MIAA 3D2WA 1HHTP 2V8HA 2KU7A 3DN9A 4O44B 2LYVA 1DLOB 2L9WA 2A10A 7FDRA 1LCIA 2DB1A 4OHXA 2XY6A 2FLPA 4DSJA 2UXDF 3T1YC 2CQGA 2N4DA 3SQGB 4Y2MA 3OV7A 5DM7Q 5K8MA 3BQ1A 4KQZA 2YNFB 3VQTA 2KXHA 3M9MB 1XMOF 2KKHA 2VFRA 2XMTA 4YR3A 3OJUA 4AQYC 1X4HA 1YJ9S 2ROGA 3K59A 3O3LA 4NLXA 1FTRA 3MEGA 4QR1A 4DQQA 2Q6CA 2XCAA 1N8RT 3UDLA 2LLZA 4QWEA 3HO1A 3NNHA 4I2PB 3OTOC 2Q79A 2DNNA 3DM2A 2KT5A 3CJ4A 3OFEA 4DQIA 3PEHA 2BANB 5KT5A 4UUWA 5D8HB 4RUAA 2M8DB 1UVJA 2V0NA 2GMLA 4PG7A 4LE5A 2PMZD 4USIA 1SXLA 5DLGA 4IH6A 2RNEA 5BSRA 4RW9B 3KJVB 3R44A 3K0JA 2OLWA 3PEJA 4YB5A 4DR2F 4NYOA 3FRZA 4M5DB 4QWDA 4MK9A 1DARA 3KLFA 1D9FA 4RX6A 2RDIA 4FBTA 1HWLA 3MFIA 2PN6A 2WD9A 2KDOA 4B9SA 2DCUB 4MFBA 5E7QA 1I6JA 1RT5B 3GIIA 5KG0A 4KR0B 5KFJA 4B9UA 4RBVA 5B0FA 3H5YA 4ETXA 2DNZA 3AY0A 1C1CB 3MR5A 1KKGA 2ZHOA 3OFFA 4G37A 5KT4A 5IFMA 3CCTA 4IR7A 4IQXA 4LF8C 1TKTA 5CQGA 1GXUA 1N5QA 4PG4A 4CNZA 5EWEA 2NYIA 3L3CA 1PO6A 4RKUC 4YEAA 3FZ2A 2R2TA 2CQCA 3FRYA 2QVXX 1UAWA 2IBOA 4QBUA 1S9GB 2Z8QA 2ACYA 4K5SA 4M63A 5KFZA 3BJYA 4LFAF 2XMUA 3CJEA 3DRPA 4Q2LA 3RRGA 3DRSB 4ZJZA 4I0WA 1N32C 1BY9A 3N28A 4O4GB 3BDPA 4CO0A 2M7SA 2RB7A 2CPXA 4OJGA 1NK7A 3MF5A 3N6NA 7FD1A 4V19X 3PACA 2VPXB 1XNRF 1WI6A 4JI0F 3PXGa 3TUJC 3MHYA 5HROB 3DOKA 2ZH5A 2XS5A 3V4IA 1BQMA 5T41A 3R1LA 2J8AA 5J1PA 1C1BB 3SDEA 1XMQF 2XS7A 4QW8A 2O67A 1VBYA 1U6ZA 3R3TA 2F3JA 4FXVA 2V4RA 1VGYA 1HR0F 1XNQF 1ZYQA 3DLGA 2SXLA 5F3ZA 1IQTA 3U7JA 1EGAA 2DNYA 5DQHA 1X4BA 5L1LA 3VALA 3PW7A 5LSRA 1NK5A 2FY1A 4F4YA 1OQ3A 2CZ4A 2VKZG 4DL4A 2CPEA 1N34F 3RYLA 3QGHA 4WFYA 3OXLA 1QM9A 4DBQA 3Q0AA 1VC0A 2RRNA 3H59A 3VAJA 4E0DA 4NCBA 4QQBA 2FLLA 1JLBB 2Y4OA 4NLGA 1HMVB 2R2SA 3VNSA 2ZBCA 1NAQA 1JLQB 3I0SB 3VAFA 1U1LA 2DRAA 1RTJA 1YG0A 2ZH3A 4OZ0A 2DGUA 3G9CA 3BM7A 3CCSS 1ULTA 3CCQS 1FRXA 4Y6IA