2OO4A

Structure of lnr-hd (negative regulatory region) from human notch 2
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
CLSQYCADKARDGVCDEACNSHACQWDGGDCSLTMENPWANCSSPLPCWDYINNQCDELCNTVECLFDNFECQGNSKTCKYDKYCADHFKDNHCNQGCNSEECGWDGLDCAADQPENLAEGTLVIVVLMPPEQLLQDARSFLRALGTLLHTNLRIKRDSQGELMVYPYYGEVAGSKVFLEIDNRQCVQDSDHCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neurogenic locus notch homolog protein 2
publication title Structural basis for autoinhibition of Notch
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle,signaling protein
total genus 65
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00066 Notch LNR domain
A PF06816 NOD NOTCH protein
A PF07684 NODP NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3310 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oo4A02
3.30.300.320 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2oo4A01
3L95X 2OO4A 3ETOA 5CZVA 5CZXA 4ZLPA
chains in the Genus database with same CATH superfamily
4DN9A 5ADZA 4CH1A 2P9GA 1SI9A 1SV5A 4BC7A 4M94A 2XY6A 2UUCC 2JEJA 3BKFA 1XRCA 3CCES 1D0EA 3MGJA 2XSJA 2V2VA 1USPB 4FZVA 1N36J 3DDKA 1XS3A 1RA7A 1Q79A 5DJBA 4LF6J 5A0YA 2VBYA 2XNQA 4CO5A 2ROGA 1RAOA 2V2QA 2ZH9A 4PZVA 2XWXA 4WKYA 2E1PA 1LWXA 2B43A 1E6YA 3BDPA 4MTNA 3IR7B 4MKYA 1S6OA 4FYYB 2ZM6F 1FDAA 1NKEA 5I4MA 4PXEA 4F4WA 4MKBA 1NJIT 5BYQA 2CG4A 3UQSA 2QA4S 3MPWA 2WVDA 2CA9A 3OJSA 3KNAA 1S77D 5MLCV 1U1PA 2V8DA 3QAUA 1T03B 2CVIA 2NSCA 1MMDA 2HGLA 1FD2A 4JI2J 4I69A 2J8SA 1VQMS 1EP4A 4OYXA 2E66A 1DARA 1UZDA 2MLZA 1XMOC 2YKMB 1QSLA 5BSWA 2VC1A 4YB6A 4IZ6A 3MD3A 4RU9A 1NK0A 1AA1B 3CNQP 2J8AA 4PG7A 5EX3A 1X5SA 2Q3PA 3CCLS 2L3MA 4KGMA 3MM7A 4FBUA 2Z56B 4DV0F 2VPXB 1WTBA 3JTOA 4KPYA 3IGVA 1MLAA 4OYAA 1WF2A 5KFTA 4URSA 3N79A 4QJVA 4DX7A 1RWKB 4CLYA 3MCMA 4EZ9A 2QLWA 2HFSA 2MJNA 4KKOB 2RF2A 1S1WA 2GZOA 3BQ0A 3J81U 3N0VA 1IJFB 4Q43A 1B70B 3P96A 2IMWP 2AP6A 3BO2A 3KFWX 3DLLQ 3AQPA 3DM2A 2XZDB 4OZ1A 4DV4F 2CYYA 3A26A 3AJ1A 2M88A 5KG6A 2AU0A 4C11B 2M2BA 2OPSA 4DX8H 5CCLA 3NXZA 1T05A 3D9BA 2LEAA 1DTQA 3GIKA 3TX0A 3L7OA 1VLOA 1J5EC 3RU0A 5LMUC 1FRXA 5CHCB 1IBMJ 1UPMB 2YNGA 2UUAC 2Y0BB 2YXLA 3R8YA 1KQSR 3BEGB 4O3QA 4DQRA 1FWLA 2W4CA 1EKRA 2R8IA 2PC6A 5IC4B 2HQGA 3CPWR 2H65B 4EYIB 2KDOA 3TVKA 1HYSB 5L1IA 3R7SB 1JMTA 3KLGB 3O2EA 2VQEC 4NLWA 5HMXA 1KR4A 2P02A 3D6MB 2CDQA 1FWKA 1WOOA 3ZZZA 2X1FA 3RRKA 4DFMA 4W90B 4I67A 5LSRA 5KFLA 1YJUA 2AJ0A 2HFVA 2R4FA 4QYZK 4TN2A 1VRUB 3LP2B 3GV5B 3ONQA 2ZWOA 1Y7PA 3C3LA 2J7KA 5F8IA 5AE3A 1OY6A 2V67A 1AUDA 4C9DA 3CW9A 1V6HA 1CC7A 2XM3A 4ER8A 3UCGA 4LFCJ 4TU8A 5A8WB 3CCZA 3PY8A 1F60B 2FY1A 2C3YA 3KLFB 4U7UD 3E01A 1IWGA 1EGAA 1TUWA 3EM1A 5CYQA 3JTNA 2UXDF 2KTQA 3CJ0A 1FJGF 3J80D 1GNKA 4LUBA 1LWEA 1RTJA 1S1VB 4IFYA 1RWUA 4JV1A 1HNZF 1VR6A 4F4YA 3O44A 2GO8A 3DOMA 1M0SA 4MKVA 4AQYJ 1TAQA 3CCMS 1LXJA 1HWKA 4OHWA 4CO4A 3M2RB 3ILLA 1UL3A 1DJ0A 2KYZA 2N3OA 2WW4A 2QVXX 1N33F 3H5YA 4C0BA 3I07A 3A8IA 1PG5B 3UZ0A 3GG1A 3TNVA 4HDGA 3KLHA 5K85A 3FCWA 2HFNA 3G2XA 1TVRA 2R7TA 4JV2A 2G13A 3LGHA 1C2PA 2KT2A 1HHTP 2UVVA 2N82B 1N2FA 4FXDA 4NX9A 3W1YC 4U8YA 3BQ1A 2NREA 1X9SA 4QIVA 1DTTA 1FEEA 5CYMA 4AFFA 2H1YA 3FCEA 3HVTB 4KHPC 4KY3A 3FFIB 3KNGA 4DV1F 4NCGA 1T0TV 1GFWB 2W9CB 3U27A 3M6WA 1HBOB 1FFSB 3IAM9 1CULA 2B6AA 3W60A 4DR2F 3TUPA 5JRHA 2A1BA 3HHEA 2JLEA 1VRTB 5GAHI 1ZZNA 4NLUA 1UWBB 2GHVC 2XGQA 5LJ5Y 2B7BB 1S99A 2PO4A 4MH8A 2DJWA 2P2CB 1S5ZA 5K8OA 1S72S 2YQ1A 4IH6A 2HVDA 1MMLA 2DNHA 2J7UA 2J6SA 4DS5A 4ZCMA 1WEYA 1SKSA 5I3UA 3CD6S 1VBXA 1ZETA 3CCUS 2KZMA 2KDNA 5IT9D 3P4UB 4I1TA 4B9TA 1HQ2A 4MYUA 3T1AA 2W8LA 2CZVC 3QO9B 3MOZA 2QL9B 5LMNF 2Y8YA 1RLCL 4TKTA 2PN2A 1X4GA 4GC7A 4DUYF 2GC8A 5B0GA 4LF6C 5HK4A 4OYCA 4K0BA 3UX2A 1BQMB 3O5TB 2WSEC 1CLFA 4OYZA 4H4MB 1D1UA 1DLOA 3BKTA 5GAEI 3OLAA 3QWUA 2ILYA 4P72A 3RBEA 3IS9A 1I5OB 4TXSA 2UP1A 2ZBQA 5DDQC 1U1LA 3H4DA 5KFDA 4K2XA 1HWUA 3MM9A 3M6XA 2DITA 2HHHF 3PR4A 4IFVB 1KKHA 1RT7B 1HNXC 3V4IA 1BMQB 3ZTQA 4DG8A 3HHLB 3Q8YA 3LPYA 2CQDA 2IHR1 2PEHA 4B3RJ 2MKSA 5E5NA 1NK5A 2J0XA 1UKKA 3BH7B 2JVRA 5JVHQ 1PYSB 2WSCC 1VFJA 4GVBA 1Q53A 5MAOA 2QL5B 1NLKL 2DB1A 3MUMP 4JI2C 3TAMA 5DQIA 1REVA 3R1LA 1HPZA 2W2MP 4OV6A 4V19X 4JI0F 4KGKA 1HI8A 1JK9B 5EWFA 1U1QA 3EERA 3OTEA 4B3MF 2YH0A 3CCTA 2Z0GA 2J0SD 3AD7C 1R6YA 4DUZJ 2ZVSA 1MWZA 4NYOA 1SKUB 2Z4PA 5LOQA 4DBQA 3PV8A 2PD1A 2W1BA 1ZA2B 2GV1A 1ICEB 3NS6A 4HL9A 5AJ3J 3PDNA 3FK4A 4USWA 4DN0A 3FBFA 1AB8A 4X84A 4DQPA 3MMCA 2JX2A 1C0UA 5BXIA 1NK8A 1OO0B 2OAUA 2X3GA 4LRCA 1TK0A 4Y2MA 1JJ4A 1L3VA 3N54B 1N32F 2DKOB 2D9OA 2DNGA 2A3JA 2O01C 3M8PB 1TKDA 1UCNA 4ED6A 1JLGA 4CYUB 4NOHA 1PU1A 2E7WA 5CA5A 4ZPCA 1N48A 3PYDA 2BZ2A 1EIYB 3FRYA 5KFBA 4JI6J 3N6MA 2CAJA 2EXUA 3HJVA 4P2XA 4WZQA 2YKQA 2E9TA 2OPRA 2DNMA 5IT4A 2HBYB 4U8VA 3HCXA 2BM0A 2XWYA 3FRZA 4I7FA 2XY7A 4KV8A 2LQJA 2RU3A 1OPIA 3W9JA 3VVTA 4DMZA 3T1YJ 5ITHA 3DGVA 1QAJA 4QPXA 1FESA 3H7HB 1Y3KA 2MHNA 1CQMA 1N54B 1RACB 2AGOA 4CLWA 5G4DA 3AJ2A 5HQLA 4O3PA 2ZBCA 4LSNB 4M63A 3KUGA 4HH1A 1FLOA 2QTWA 4LFCC 4JYAF 4ID5A 4FS2A 1X31C 3QGGA 1VEHA 4ZVQB 5KT4A 3C2PA 3I96A 2RIJA 4RLQA 1IQTA 4ZVRB 4C97A 3QLHA 1RT4A 2MZSA 4K0KJ 1VC0A 4CWBA 1C1BA 4BDPA 3JAMD 4G3IA 3NRBA 4B02A 5LT5A 2MY8A 2GFFA 3Q8RB 4QWAA 4DR4C 3OR2A 3UW1A 3Q2SC 3AFGA 1N33J 3DRXA 1FNXH 2OUGA 2R2TA 3UN2A 4PPDA 2E1CA 4UQTA 2YX4A 1TL3B 3K6RA 2F5GA 4FYWB 1XMQJ 3BBCA 3AODA 2DGSA 5AT1B 4L2ZA 2W24A 2WONA 3K17A 3ZXWA 1R27B 2VBXA 1RP5A 3TZYA 4ED1A 3D7SB 4G1QB 2LP4A 2WBMA 1XRBA 1JLBA 4WP8A 1EQMA 4HH0A 1Q4RA 3JQMA 1WF1A 3T6JA 3GSIA 3DHVA 4WP3A 1QDUB 1U24A 1NCLA 1O90A 1WKJA 4DV6F 2MQOA 4H4KC 1R0AB 2NLWA 1NK4A 6FD1A 1HL6A 5ETLA 3NMAA 1G4CA 4NI2A 2KM8C 1CJTA 1N0UA 3R5JB 2ZKTA 2QFIA 5SZTA 3CJ2A 1V5IB 1SUQA 5KFVA 5T8TA 3AF6A 1MDFA 1M1HA 2NZCA 2CQ3A 3ZTPA 1Q78A 4LF4J 2W7AA 1TR0A 5IT9U 1Y4ZB 4I0WA 4DPYA 3MUVP 3PTWA 4B3OB 3D3BJ 4ZPVR 2KZZA 3P3DA 1HBUA 2B4UA 3TUFA 2VA2A 3JYTA 3TZZA 4C8MA 4DV5J 1A6LA 5IFMA 2BANB 4CLPA 3C6TA 1RI7A 3W63A 4ZPWR 2B0GA 3LANA 5J2PB 5HL7Q 4PUGA 1T5DX 1RAIB 2BVZA 5E3QA 4QU6A 2PGCA 1WI6A 2CJBA 1JXVA 3THVA 3KLEA 4GXRA 4FYXB 3CCQS 2V50A 4DPOA 1P9YA 4QIWD 2F40A 4NDNA 1WORA 4PRFA 1IBLJ 3PJXA 2RS8A 4G1IA 1IKVB 2I6WA 4OYPA 2G9OA 2YKPA 4YB1P 4L6V3 3M2VA 2ONFA 2E1MC 4JP8A 3TR5A 2MZQA 4MAKA 1XJWB 1VHFA 3KJFB 3QSYB 1PYOB 2CZ9A 5G0RA 2YQ0A 4PEOA 3CW8X 2CJQA 2EBGA 2HGMA 1H0HB 3HDSA 3MTKA 2NS1B 4DF4A 1E6VB 3U7JA 3OHAA 3A25A 2CWXA 2O5DA 2L9NA 2FGCA 4Y00A 4EK2A 2XGPA 3O1LA 2QLXA 3CCSS 3FC9A 4W92B 3N4WA 1QM9A 3NCQA 2J0QD 2VPYB 1CEZA 4HHJA 2ASJA 5HVHA 3NBPA 4PG6A 3UN5A 1NKBA 4YS2A 3D6FB 1R8AA 4E8UA 2KG1A 3FZ2A 1BGXT 4H4OB 3RG6A 1ZAWA 4LFBJ 1Y9OA 4NCAA 3E51A 2VH7A 3DU6A 1DHMA 3ZZUA 4DV0C 2XBPA 1KVJA 4RW7B 4NA2A 4ZN1A 2XLIA 2Z2ZA 2FHMA 1KRPA 2EKYA 4IOCQ 1IKXA 1RU2A 2RVJA 4RNOA 1CG2A 2FLPA 3RUBL 2E29A 3NWRA 4R1LA 2C2ZB 4C8NA 3UPFA 3CJRA 1W25A 1W2BR 4B9MA 3HO1A 4DV4C 5J2MA 4GRSA 2VJUA 4GXQA 3DRRA 3K8VA 3I6PA 2VFUA 2BA9A 1BC6A 3SZ2A 1L3KA 4U7CA 5KT7A 4N7TA 2XMAA 5F9NA 2AJ2A 4PYDA 3ETOA 2QGFB 5M2UA 4GO5X 1AROP 1HNWJ 3ENWA 3LGMA 3JTPA 2DHGA 4IR9A 2YY3A 9ATCB 2DNOA 4WFNQ 1N8RT 2A0FB 3SIPB 3B8HA 1JLQA 2GQQA 2HBZB 1RTHB 2EG2A 1RWWB 2D1RA 3T1YC 1CJUB 3G86A 5DDPC 5GADI 4OXIA 5A8RB 1SB6A 2Y9HA 1IJEB 2LXIA 3MEDB 2K7KA 2GS8A 1H74A 4PQAA 2RRBA 5DG7A 4NLYA 1NSAA 1HFEL 3EXCX 5K8NA 3IM8A 3DXSX 1RWNB 3QZ7A 4ICLB 4YEAA 4EU0A 1P6TA 1WUUA 5FIIA 5ETKA 4PYAA 3G4SS 2KXHA 3SMZA 4LRDA 1NHUA 1SBRA 4DX6A 4BHQA 2ZE2A 3HX9A 4QZVB 2VPWB 3H98A 2EFQA 5FLXU 2AEMA 3IGNA 5I3QA 4KTQA 5IC6B 4YB5A 4ZPBA 2UXDC 5KFFA 1FJGC 3A3OB 5HP1A 3F41A 1VGYA 3CW2C 3QRRA 2QA2A 1HNZC 2VG5A 1NDPA 4ECQA 1MKYA 4H4KA 3UDLA 2HK2A 4O4RA 1V3ZA 1N33C 4PXCA 4R8UA 4JOUA 1KFDA 5D77A 1IM4A 2VICA 4TY8A 3PJWA 1F3VA 5JXSA 4DI6A 4ERDA 2NYIA 3EGWB 3ZNJ1 1S57A 2P8IA 2WB1D 4ITSA 2KN4A 5DQGA 1AFIA 4P7TA 2FZCB 1WEXA 3QJJA 4CZCA 3OXLA 2FLOA 2VF3A 2C3OA 1FDBA 2MLYA 4CDIA 2BJ7A 2E8EA 3SDEA 4BSZA 3MZIA 1R0BG 4ES2A 1D3WA 2C28A 1IBCB 2XZTB 1USPA 2A6OA 3HF5A 3HZGA 4I6AA 1G7CB 1B7YB 4DG1B 4C8OA 1NAQA 4I64A 3D1HA 1QE1B 3Q8UA 3FVYA 1B3TA 1D8ZA 2D41A 3NPDA 2HS4A 3MPDA 3RW7A 3HFKA 1FJEB 2DHHA 2ROEA 2V68A 4B9NA 1IQZA 3CJ4A 3OFGA 2CPYA 4JV5F 3DLEA 1UVLA 3KK2B 1FE0A 2K3IA 3NYQA 2KT5A 5H9EJ 4QR2A 3M1VB 5SUHA 5C42B 2CPJA 1OY8A 1Q81T 4DPUA 4WZMA 4UY8T 5GAGI 4DV3F 1WOPA 4X65F 1RK8A 2U1AA 1RT5A 2BQUA 1C1CB 3IP0A 4X4UA 5LMNC 3GKUA 4P7VA 1HR0F 4C0OC 2OPLB 2GVDA 3M7VA 2GNKA 2NCLA 2XHWA 2DT9A 2IAJB 3CJ8A 4DCSA 3FNNA 2CQPA 2BKNA 5HO4A 2I2YA 4ZVGA 1IBLC 2BM1A 5KAKA 2VKRA 1ULTA 4MKAA 5KEIA 2A2CA 4CM2A 4F2RA 1W2IA 5HBMB 1MWQA 3AY0A 4HEA9 1U0SA 2HHHC 4CO2A 4QR0A 2IPOB 1Z1ZA 3NEKA 4C3LA 2H5EA 3KXWA 4DF8A 3QRPA 1TKXB 2EW9A 5FJ4A 3DLHA 1IB8A 2FJWA 2YWBA 2E5LF 3IEVA 3CXCR 4K59A 3SFGA 3CC4S 2Y1LB 3AD8C 2RNEA 5D4LA 3W66A 1PA4A 3W9HA 1RWOB 1S48A 1FRJA 5C7PA 4RW8A 4I68A 1LFPA 3TUZC 5K14B 1X8DA 3EDQB 4JI0C 5M2PA 1IUJA 4B3MC 5KG5A 3H2VE 2PMHA 4ED3A 4PHTA 1TKTA 3M2UA 4RW9A 4EBDA 2YBVA 5KT6A 1F6TA 3AA8A 1DURA 1XTZA 2FJDB 1WHYA 4F2SA 2XMJA 2R2SA 3N5FA 5KG3A 3P45B 3UN3A 2V8VA 3IWLA 3VWSA 2DHAA 2BYCA 2DGOA 1VRUA 3BB5A 3LP2A 5DDOC 2Y1RI 2YWWA 1YDLA 3JQJA 1FDDA 1KVIA 1F3FA 4O44B 1N32C 2WVFA 1WF0A 1KQGB 2ZHAA 4J9LA 1YTYA 4AYBD 5L9NA 1LKZA 1KVKA 4PWUA 4ZVOB 4XAKA 3A8EA 3SCKE 2B4VA 1EB0A 1TL5A 2G0JA 2D9PA 3IWXA 5KFNA 5IS2A 2AF6A 3U02A 3D1OA 4ZCLA 1H38A 3CVKA 3MFIA 1K1QA 3M9MB 2ZEJA 3OQ2A 3D4JA 2RH3A 5CAAA 3K5NA 3CQ1A 1VC5A 2R9LA 4HPVA 3M2RA 1TTHB 4WE1B 4ZHRA 1L5UA 3OLBA 2YNIB 3W2VB 3DDIA 4DV7F 1AXQA 2DNLA 1KHVA 4UQGA 4DCJB 3VAHA 4C48A 1RT2B 1D8YA 1RE1B 2I5JB 2DR5A 4FUQA 2HLUA 1H7WA 3K7RA 2IRYA 4U7UK 4OL8A 3TP2A 3EGVA 3LAXA 3S01A 1HW9A 3D28A 2HS3A 4QWDA 3NWGA 5A2QD 3EE3A 4CCHA 3DHXA 2JL9A 3PZPA 3H59A 1Z4UA 1HARA 1JB0C 3LAKA 2X7IA 2C3UA 3QFHA 5HI7A 2CRLA 3QT6A 3L3CA 1B7FA 3D67A 3W65A 3ULHA 3LA0A 1F1BB 2CIMA 5T7LB 4BCAA 4X66J 2F4VF 2ZH8A 3UI3A 2FHOB 3ELHA 2HLTA 4M5DB 4LF9F 2ATCB 1UEKA 2ZC4A 1FXLA 5ETVA 5KG2A 4URGA 1FKAF 1A0OB 4JI1J 4ED0A 2HHSA 2BUNA 3LQVA 4OJ1A 2XZWA 3OTOF 3CJKA 3OW2R 2NXJA 1KQFB 5DQHA 3BREA 1XQIA 5CZVA 4IDKB 2IM1A 4KTTA 2P9EA 1B0PA 2MZTA 2DGVA 2Z30B 4C8LA 4P2FA 4D57A 3ADAC 4ZVEA 2YPYA 3BZQA 5HANA 2B9XA 1S76D 1HA1A 3EVWA 2QL7B 3M4XA 1RAFB 3KHLA 1M5KC 4QWBA 1WSRA 3R9WA 4C6AA 3FQLA 3H25A 1KBRA 4M95A 4IO1A 2V4JB 3GFXA 3BO4A 1RAAB 4BWMA 4IKAA 4DR1F 5KOXA 4KR0B 2MGZB 1YZ7A 3KJQB 3IRWP 2KVIA 1S6UA 1GMWD 2VBZA 3CIMA 1TL1B 1SL2A 5GVQA 2NSBA 4WIQA 1FJCA 5JMNA 3DFEA 3M30B 2OPPB 4PZPA 3GP9A 4HI1A 1ZAVA 1SC3B 5DLFA 1NPKA 3MM6A 3M8SA 2CXEA 1UW9A 2RE1A 2O67A 3MMBA 2H3EB 1EKSA 2KFYA 2YKNA 3R9XA 1KS2A 3IPLA 2XSFA 4I2QA 3W5ZA 2IYGA 1VCTA 4A48A 2J6TA 2OHDA 2Y8WA 2PMWA 3SSQA 3OVAA 3THPA 2MM9A 1UEUA 4GC6A 4R5PB 1NYEA 1SH2A 4G6VB 1VQLS 4OLPA 2ZWPA 1TUVA 2B9WA 1WHXA 1J2VA 1F9EB 2R8HA 7FDRA 2ZOFA 1ZPWX 3MEKA 1N5YB 3H20A 1GQEA 4QW8A 3M8QA 2QZ8A 1UFKA 1WC6A 4KT0C 1XNRJ 2A18A 2C2MB 2OP5A 2EK1A 2RKIA 5F8MA 3BGRB 3ITHB 3TAPA 2NPFA 2WAQD 3BGOP 1O92A 3DRSA 3LWMA 3NI2A 3D0IE 4ED7A 2RB7A 1GT8A 2YNFB 4A47A 1PSDA 1T02A 1FFWB 2M5OA 4JI8J 2CPEA 1CQNA 3DOLB 4M1KA 4CT8A 4AL5A 1OPZA 4ANEA 4JI7J 4YFUA 1CS4B 3A4IA 2E1AA 3X1LB 4QYRA 1S1UA 3RAXA 2VKZG 1TELA 4FNHA 1YX2A 3H2TA 4FP9A 1U2CA 3R5CA 4GKKF 2KKHA 3DI6B 4CLZA 4KFBA 4DU8A 1XEZA 1LWFB 2ZJPQ 3OSNA 5EHHA 3L4BC 4D56A 1NO8A 1T11A 2LQ9A 4RKUC 3WDOA 1RJJA 3OVBA 1ITPA 1XERA 4LF7J 3NGUA 2NR0A 5ETMA 4JI3F 1S49A 5LXYA 1HNIB 1OYDA 2FVSA 4OI2A 1TKZB 2AGPA 2UUBF 1S4FA 1NDKA 1PG3A 4C8YA 1TZ0A 3I08A 3HHNB 1FTRA 2V94A 2JFKA 3R44A 3EZUA 2YWFA 4P71A 2A10A 3EVMA 3N9UC 2MY7A 4Y2KA 2HVZA 3SCJE 4ECZA 4DV2J 4DL5A 2A6MA 3ILJA 5D3GA 4DR7F 3A9UA 1B0VA 1VQYA 1VK3A 3UD3P 5AXNA 1DQ8A 5BSUA 4HDHA 1VC6A 5EWGA 4KGXB 4Q2LA 3TA1A 3V6HA 1FKOA 2DR8A 1TQLA 4PKDB 1M1GA 2UXCF 3C6UB 3DXBA 4DCOB 4C3MA 2KG0A 1UJ4A 3CWJA 3ZZOA 4CLKA 5BR8F 5IV3A 2BX6A 1YGYA 3GPCA 4DFJA 1NDLA 1MROA 1I94J 4OX9J 1N34F 3T1HF 1YRXA 4NLQA 1RT6A 5B09A 1RWVB 3P8BB 2QA4G 5A8KA 5F8GA 2DH9A 2DHMA 4L74A 3DN9A 3JSMB 5AE2A 2NXEA 4JI5F 3IG1B 2FHJA 2HQDA 3MTJA 3M8WA 2CJXB 2OEMA 1LK5A 2K3KA 4DV7J 1TL3A 1U7LA 3DMJB 4JI4F 4HT5A 4WK1A 4WS9A 3GV8B 2FD2A 1VRQC 5A2QU 2RRNA 1YJNS 2RUGA 1JLEA 3ZZ0A 2V63A 1SXLA 4NLXA 3MEEA 2DNKA 5C2GA 2FC9A 2GAHC 3K8WA 1U8SA 3EUNA 3M9OB 1HBMB 4UT4A 1ZM3A 4BC9A 2NCKL 2Q79A 2EG1A 4ES3A 3BBFA 2RDIA 4ZJQA 2DD8S 2HQIA 3UDEA 4K7QA 1TH5A 3HFVA 2VD3A 4LVNP 4QCLA 4N8NA 1QSYA 1HBNB 5LXRA 2F3JA 3EWGA 2J5AA 5CD4H 2PT7G 3HMJG 3LNOA 2F4VJ 1KLMB 3J81j 1T3OA 3DLKA 2CQCA 3GWCA 3H4BA 1Y5NB 2CDRB 3VAKA 1VBZA 1DQ9A 4M8LA 3T3FA 1P9QC 3TEGA 4FF3A 3ENVA 3PBKA 2G2ZA 1JKHA 2JH3A 1MXCA 5C25A 2GMJA 5HROA 2OEJA 4LE5A 4J9MA 1NBEB 2MKKA 1Q8KA 2VU5A 2XCPA 4B3OA 1T9WA 3DCAA 5U47A 2CQIA 1N36F 2AJ1A 3R2DJ 4KHRA 3ZTSA 4LF6F 4B3TJ 2ZDPA 4TY9A 4DL6A 1X0FA 1WOSA 4C7QA 3WZ0A 2VV5A 4PQUB 4LF5J 1C4AA 2DR6A 5J2PA 4C8ZA 1NJXA 5JVGQ 1YBAA 5J2NA 4WYWA 4BS2A 1V25A 2H5IB 4OHZA 1GXUA 5HQ8A 1TFWA 3EYZA 2R7OA 3FJ2A 3GYNA 2RD5C 4IYQA 3DGPB 2CPXA 2K1RB 2PT0A 3FBCA 4MH4A 1NMEB 1O9TA 4NYZA 2HMIA 4CT9A 2CUYA 1AZSB 3BGLA 2FTRA 4ECVA 1G6BA 4JV5C 1Q5YA 2GVZA 2DRAA 1U47A 2AV5A 3LO3A 3PYEA 1EETB 4Y2CA 3OL8A 4ELVA 3MM8B 4O4GA 1U49A 3EVOA 3H5SA 3IC1A 3CJQA 3VGVA 2IRUA 3PW2A 2B8PA 1RT3B 4GKJJ 3PACA 4X65C 3MEGB 5CH7B 3T5JA 1SVDA 2XCAA 3U1MA 1JLCB 4CTAA 1O5JA 1YIJS 2H48B 2PA8D 5K8MA 3TVYA 1HR0C 3KG0A 2VG7B 1XNRC 1UPPA 4J9SA 3AH6A 4DCPB 1MMNA 4XK8C 2ALZA 2HVHA 3UCZP 1IWAA 4CLFA 5B0EA 2FLNA 1VQPS 3ILIA 4HHUA 1FRLA 2V2KA 4LSLA 4AD6A 5L46A 1IR0A 1H2VZ 2QX0A 4UUXA 3BM7A 4ETZA 4YR3A 4NWBA 3J7A1 2W2OP 3L7PA 4UF4A 1DQAA 4L72B 3M6UA 2QV6A 3GQCA 3JSBA 2E5LC 2DGUA 3PKMA 1IBMF 2YWKA 3OTCA 3AT1B 2NQPA 1RTIA 1KNZA 2ROPA 3S8SA 2IC3A 4ES1A 1CPZA 3MOJB 1MN7A 3KJNB 4N41A 2VJVA 4DX5A 2AX0A 1WCJA 2DNPA 2MSSA 3DC2A 4USIA 3G71S 4FNIA 2PSZA 3MECA 3HVWA 2ZUAA 2DRBA 5BYSA 1S9GA 1RTHA 4Z7YA 4GO7X 3C46A 2XSJB 1LNQA 1RTZA 1CJUA 1LXNA 1UP1A 3S7RA 3TUIC 2VZ9A 4UY85 3NYRA 2ZHBA 4TNOA 3Q8PB 3GG0A 1X9WA 4J9VA 2QRRA 4NXNJ 2CXCA 1KOOA 2R2UA 2IJFA 2MYFA 2DPIA 1UW4A 4CO3A 3A4TA 3IRXA 4FF1A 4FKYA 4M5MA 2J9CA 1E6YB 4KAIA 3BQ2A 2MQLA 2F1FA 5ETNA 5ETPA 1JJHA 5E0OA 2QYCA 4FYVB 3RRGA 1O6XA 1I94C 4K4WA 5DS7A 2GGPB 2B5JA 2H5JB 2I38A 1SC4B 3BPSP 4WFAQ 3G9CA 2V8GA 3W3SA 3GR1A 3EZOA 4DJBA 4AQYF 2KJWA 3DLJA 1N5VA 2KU7A 1MW7A 4A8FA 3ZZYA 1FO1A 3Q86A 3MURP 2AD9A 2D1CA 4B17A 2CWKA 2CFXA 1NM2A 2DGWA 3A1YG 1EARA 3TANA 2NUHA 3US5A 1EP4B 1FA0A 1LFWA 3HK2A 4OZ0A 1SC1B 1R43A 1RBAA 1YBTA 3R1HA 3O3LA 2BV3A 4C3KA 5A76A 4DV7C 3G6YA 4M5GA 4PCQA 2UU9J 3W2WA 4IOAQ 2C1EB 4QOTA 3VVUA 5EX0A 5D0HA 4LT6A 1S97A 1GAOA 3RR8A 4FTFA 1ULRA 1BY9A 4Z37A 1RTDA 4DR3J 4OV1A 4JI4J 3E7WA 3ENAA 1G3OA 1G2EA 2ZNYA 2CJYB 3PO5A 2VBWA 3MM5A 4L76A 4KGVB 3QYYA 4LJMA 2VFSA 4WXOA 2GQ2A 1S1WB 2EFVA 3TA0A 3TJ9A 5ETSA 4C98A 5CZXA 2ZUGA 3DM2B 1C0TA 2SXLA 4DR6J 3IXQA 2CPIA 2LVWA 5DZ6A 4DG1A 2OPSB 4DL3A 2UV8G 2F4VC 4P9SA 3KMQA 3KHGA 4NLDA 1UA1A 1T05B 3VAFA 4N56A 2DHXA 4LF9C 1DTQB 4KYZA 3FBBA 5KT2A 2YKAA 4A4JA 2AZ1A 2YNGB 1HWIA 3PW0A 1ZBTA 1AW0A 1XRAA 2ZJRQ 1JLAA 2IDLA 3I0RA 4OQJA 3LNVA 1F0XA 3OTOC 3KK2A 1SJRA 5J1NA 1HI0P 4DCVA 2HNZA 4F3QA 2Z8QA 3QJLA 3M1VA 4USVA 5C42A 4ZLJA 4OJGA 1JWWA 1YWXA 1YVFA 3DRPA 3KLIB 4OHYA 2HIYA 4IG0B 2H9ZA 2VOOA 3GFYA 1MN9A 4J9NA 1R8HA 1HD1A 3FZBA 3OL9A 3DYAA 3LP1A 2XC9A 2XMVA 3H0PA 4NLPA 3K5LA 5K20B 2KFNA 2BXJA 1S7IA 2MTLA 3O6QA 3ET6A 5KYTA 2DPJA 2VUGA 4YOEA 4B08A 4P73A 4ECXA 3E01B 2RRAA 4LF8J 4DR1C 5CYQB 4MK9A 1Y3JA 4WK3A 1URRA 3ISND 4OZ3A 2V5HG 4V1Ak 2XQCA 3E7XA 4OI6A 1LWEB 1RTJB 2GO9A 2DRDA 4IFYB 2BJEA 5IM0A 1UVNA 4B3RF 4K4ZA 1BQNA 3GJTB 5K9FA 3FKBA 2HQ3A 3MF5A 3FSYA 2GIRA 1TKXA 2AIRB 3KKFA 5F8NA 2CKWA 4DCTA 3AA9A 1T9TA 3HSGA 1R8CA 5BJRA 3GJQB 3KLHB 5A19A 4ATNA 3KTQA 2LU2A 4NRTA 3T41A 3G96A 3MMAA 1FKPB 1TVRB 5EDWA 4A8QA 3EGZA 5KFJA 4DUZF 3B78A 2AEFA 1ZM9A 3HVAA 2DEJA 1NEEA 4WFZA 1HMVA 5AJ3F 2K06A 4K4YA 2QSFA 4P10A 1TK8A 1U8WA 2XYGB 2ZDOA 4NCGB 1NZAA 1EZZB 3C5EA 2JZ5A 1FK9A 4RW4A 2F9DA 4ECWA 1QAXA 1XNQJ 2FJXA 5AXLA 2B6AB 4XPCA 4N76A 2QFJA 3PVXA 4FPRA 4Q0BB 3NGKA 1R8PA 3PM9A 2V0NA 1N56A 1XN9A 1X5OA 3TW0A 3C14A 3ZZTA 1PJ7A 2MZRA 4IR7A 1OQ3A 1UWAA 5IXUA 4GKKC 2CQGA 2IBOA 4U9RA 4JI6F 2EGTA 1SIZA 1OMSA 1Q0NA 1VQ9S 5I42B 2XTJP 2E5JA 4HYKA 4Z2XA 4OYOA 3IAS9 4NLSA 2WVBA 1NKCA 2HBQB 1I51B 3QAEA 3AB2B 4NYPA 2DNZA 1WC5A 3Q23A 5I3UB 5FD1A 1IKWA 4DQSA 2AKWB 1LCIA 3RB6A 4P6QA 1RISA 4JI3C 4QYZJ 2PN6A 2AYEA 4ZPAA 3EZ5A 3T1YF 2D3ZA 1P8GA 2UUBC 2ZH2A 3NOGA 4AT1B 4YY3J 2FVQA 2DY9A 3QT8A 3R5GA 7AT1B 2VPZB 1GMWA 4NXNC 1UETA 3LGXA 1DLOB 3TWZA 4KRWA 4RUBA 1GTEA 3IS9B 2C2NA 2QMWA 2I5JA 3V81A 1IN0A 4DR7C 4RBUA 4CIOA 1J5OA 4ECRA 2B3TB 2IVYA 2MKCA 3MM9B 1QWIA 1WDTA 2BR0A 4RWXA 3SCIE 4A8SA 3V4MA 4K0KF 2UXCC 1NH7A 2RQCA 3SQGA 5BR8C 3TI0A 5F8JA 2L41A 4R1MA 5DM7Q 3V6DB 1K0VA 1BQXA 2R8GA 1OS5A 1N34C 4GVBB 3T1HC 3P5BP 2M7SA 2R8JA 3UNGC 1U1KA 2ZFHA 3TAMB 1S10A 3V5RA 1B0TA 2K8GA 4HTIA 9RUBA 1REVB 2WK4A 2LXUA 1HPZB 1JJ2R 3BN7A 2R7VA 2HYIB 4Q45A 1LQLA 3H8YA 3QGPA 2RU9A 2R7SA 2WRMA 4JI5C 2F8HA 1FRHA 2UU9C 1HWLA 2P9CA 4CM0A 1XMQF 1RYRA 4ZPTR 3NCRA 3Q83A 2WBRA 4DG9A 3QATA 2UZAA 4LFAJ 1Y11A 4B3SJ 5GADU 3A9VA 1U1RA 4JI4C 3DOKA 1CJVB 1U0HA 1VLYA 2HHTA 2YH1A 3QWPA 2ABYA 1X7VA 1O93A 1RKJA 3MMCB 1C0UB 2IA6A 2XB2D 5D78A 4MIWA 1B4SA 3UR3C 2VQFJ 1GMVA 3KHHA 2MLXA 4RW6B 2V4QA 4M5HA 3W8PA 1TMMA 2VIHA 3OT9A 1KEKA 3EX7B 3ZZRA 4PXBA 4J9KA 4DFPA 1D9DA 1JLGB 3LP0A 3AOBA 3KDOA 4OYIA 4P74A 2V4JA 1D9FA 3UFCX 3QIPB 2VOPA 2W8KA 2R7XA 3MAAB 5KFOA 1VBYA 3CJTA 1VQ5S 4ZK7M 4O0IA 4X62J 4YP3A 2DCLA 4Y6IA 1F5CA 2OTJS 1N6QA 1Q7LB 4LF4F 4WFBQ 2RHSB 5HAOA 1LW0A 3VNRA 5J1EB 4I7FB 2NXUA 4KV8B 4K50A 3UWTA 1H72C 2KHCA 1Q8BA 1UEVA 2Y3YA 2XR1A 4ZP7A 4DV5F 1JXEA 1YKWA 3K89A 1XC9A 3LOUA 4RVNA 4R5PA 2OFGX 3KK1A 1N36C 3RBZA 1VQ4S 2QIFA 3Q24A 1AYEA 1WG1A 5BSRA 1EX8A 4ID5B 1R89A 1N5YA 4P2MA 2B9YA 2AQ4A 3AD9C 4LIRA 2Y0SD 2WZ1A 4LF8C 1FVSA 3SFUA 1IBLF 1CJKA 3BN4A 5H9FK 3OXGA 5M2RA 1R31A 3QLHB 1NHVA 1RT4B 2GMHA 2JJ4D 3HSJA 2AJ4A 2F7VA 4DZDA 3BR8A 1C1BB 5K8FA 1ROFA 3LGNA 3CO9A 3D68A 5L39A 4J90A 3M32A 3RBXA 3O2IA 4DOZA 1IM6A 3BO3A 4WKRA 1LWCA 3Q8QB 3PKYA 4NXMJ 2HVEA 3PO4A 5KFIA 2JMPA 3T6BA 2Q1LA 3QQCD 1VQSA 3OR2B 1D09B 4RX6A 2LA6A 4MK8A 5L38A 3H2LA 4YR2A 4B9SA 3H42A 3D1QA 2QT7A 2JEGA 5HSPA 1T3NA 2MPUA 4NEZA 2CNOB 3UO0A 2VG6A 2MJUA 3J81Y 5T8SA 3PRBA 2G0CA 3HSZA 1P1LA 2LECA 1WKKA 1GEHA 2WONB 3RYLA 1F2GA 2HVIA 3RGIA 1MD9A 1VS3A 5GAGU 4LFBF 2AZ3A 2LXFA 4G37A 1K73T 1LEOA 4WU3A 4ZLNA 3C16A 1RWXB 5DETA 3Q8VA 1M5VC 1ZOTA 3CE8A 2UUCJ 2PE8A 2KB2A 5HVFA 4UZCA 3C66A 3POTA 1ZM4A 4F67A 4I2PA 3KUEA 3E3XA 4NLOA 2HHQA 1RHQB 1YSJA 3QMQA 2QVYX 1GK8A 4NI2B 2VFRA 4M5NA 1D9AA 1XR6A 4LBIA 3DHWC 2FDNA 2QLJB 2HBRB 3TAQA 2L9WA 3SSSA 3UDVA 1H7XA 1IKYA 3K5PA 1YK9A 3WIUA 4DLGA 1HNWF 1PJ6A 1IBMC 2AGQA 2ZOMA 2VL1A 2LDYA 2BE2A 3WC0A 1H98A 2OMOA 4K4SA 2DNNA 1S1XB 3NKYA 3K5MA 3NNCA 2YPZA 4ENOA 4TPSB 2OGUA 4CRJA 1RWMB 2EFPA 2PEBA 1HBUB 3JYTB 4J91A 4ZITA 1TV6B 3OTBA 1KTQA 2ADCA 2Y4NA 3SEOA 3C6TB 3JSMA 4RUAA 3TARA 3HHLD 4MFBA 1RHMB 4Y34A 3VQTA 3VNSA 4ZA1A 3D5MA 1XMOJ 3WBZA 2HHPA 2I1RA 4ED5A 4JBCA 4EBCA 4DQIA 3D66A 2MSTA 1J27A 2IYIA 2OO4A 3BBBA 3DMJA 3KLEB 2FJVA 2HW3A 4PUOB 2EC2A 2IIHA 4LIWA 4AXJA 1RUSA 4ILMA 3CQ2A 4OYMA 1I6JA 2QO3A 2ZD1A 2N4DA 2CQ2A 4F0KA 3J80U 2HAFA 4R0JA 3D6HB 2LA4A 5G0RB 1PBUA 1RT1A 1N4LA 3HI9A 2BJ8A 4AQYC 4OYBA 3CO0P 2BJ3A 3BPDA 4JV0A 2OEKA 2V8PA 1S0NA 4IQXA 2KXFA 3SQOP 3PXGa 3I5BA 4ZJOA 2AT1B 1OY9A 3R7NB 3KYLA 3H90A 3TOQA 1B64A 1LW2A 2EVZA 3ISNC 3BGUA 1Q86T 1CBKA 1J5EJ 3KMSA 3GTYX 5LMUJ 3L09A 1RY2A 3NBPB 2UUAJ 5D15A 4CLSA 2AYMA 2OSQA 1M6XC 2ZZMA 2IM2A 2B8QA 2ZH4A 3GIMA 2P2FA 1WD6A 4EFAC 2VQEJ 4P52A 1TL7A 1HNVA 1UMJA 3A3PB 3LF0A 3B82A 3BSCA 1IKXB 2WB4A 2JEFA 3OUYA 3HP6A 4ECUA 3R6LB 4OMFG 1S9EA 2DR7A 1VJQA 3TZXA 1UJ5A 1ZAXA 3OR1A 1V26A 1HWJA 2C2EA 4OI0A 4X4QA 4LR9A 5J2MB 4TYAA 1NHKL 5IV4A 2ZITA 1S6QB 1LOUA 4HACA 1NJYA 4RU2A 3EXYA 4RL1A 4AE5A 4L75A 5DLGA 2EWHA 4WFYA 3PYGA 4X4VA 1VQOS 1JLQB 1OWXA 1U1NA 3HFZB 1ZZFA 1M5HA 2IJRA 4J9RA 1S0VA 3GFHA 4U5YD 2M5YA 2VONA 2R42A 3H5UA 5KFYA 4IUFA 3GONA 2M8HA 4ZVPB 2FY8A 2QVZX 4NZ6A 5KT3A 1O51A 2QG9B 1YBUA 3EQ6A 1T7PA 4HI2A 5E7OB 4K4TA 4ANDA 1SH3A 4QPTA 2X51A 3W64A 5C24A 3R97A 4YQWA 3EGNA 3G8QA 2G0IA 4XDCA 4EMDA 4RVOA 3ETMA 3R5AA 3KJVB 5GMDA 2ZE2B 1WDDA 1IR1A 3OTDA 2FHJD 3W9IA 2IVFB 3ENQA 1F5AA 2UVUA 3MAHA 3F73A 5HP1B 3HJFA 3PW5A 3DLPX 3EMTA 2KRRA 2VG5B 3CC2S 4B3RC 4D4GA 5BSVA 4O3SA 4A8KA 2ZVIA 3DLBA 1QUPA 2PROA 2D7SA 3JXOA 2M3DA 2AYAA 2W01A 2KM8B 2UVRA 4R8UB 1MXBA 3QFWA 2L9DA 5ETRA 3E2EA 1YJRA 2D1TA 3NNHA 2WCXA 3RW6A 3MMJA 3G6ES 2DTJA 4TY8B 1F5BA 3D0HE 2EFOA 1FRMA 1S79A 4DUZC 4MJKA 4V19J 1S6PA 2H54B 2ASDA 2HWHA 2YCBA 4YHHJ 2XLKA 3I5CA 1Q8IA 3TJ8A 4FVCA 3SDEB 2HFOA 4IRDA 2HNDA 5HQMA 2OELA 4ZCKA 1T9XA 3MR5A 3OSPA 4A8WA 5D6GA 3PX0A 5HLFB 3CULA 2W2QP 4UOGA 4B9VA 3DU5A 1ZS6A 4G36A 3NAIA 1U6FA 2R7RA 5DDRC 4OZJA 3TQ1A 1SC6A 2R2RA 1UVJA 3IFEA 3NP5A 2HS0A 4PR6A 2WOMB 1KD1T 1HHSA 1SCJB 2APOA 2W9AA 4F04B 3IBFB 3VHQA 1UVMA 4RR5A 1YHQS 3DLEB 1HQUA 3CEDA 3L7UA 4JI6C 3VGTA 1BLUA 1N52B 1HNXJ 2FPHX 2JC0A 4K2JA 3G7SA 4ZIWA 2IY5B 2GGPA 2WD9A 2G4BA 2D1SA 3TDEA 3DLGA 1WC4A 3LH2S 4DSJA 3K0JA 3UVJA 4K4UA 1K9MT 3J80Y 3PRVA 3VR1A 1RT5B 4OZLA 3CDEA 1YITS 1NSPA 1X4BA 1S59A 3PHEA 5D0GA 4O23A 1MU2A 1WI8A 3C15B 1UA0A 2GVDB 1HI1A 3IR5B 3CJEA 4ALZA 1QUVA 2DGQA 2V9WA 4DHVA 5HJYA 2AW0A 3ZTOA 1XMBA 3B4MA 2UXBF 1K47A 3IA0A 3VF0B 3K59A 5CCMA 3G82B 1M6XA 1VDHA 4RBTA 2L48A 1OQ6A 2RS2A 1NJWA 4KHMA 3TQEA 4EO6A 2CJ9A 4K0KC 1RWPB 4OLOA 3JAMU 4X66F 2EI5A 1KLNA 4RLFA 2W9BA 3FEYB 1XBWA 2H4YB 4TQRA 3CUNA 3HD2A 4MTPA 4WJBA 3OFFA 4F02A 5KFSA 4JI1F 2O1PA 2DYAA 2JNJA 4TVAB 3DAYA 4LBPA 4RW8B 4L73A 4NPOA 2OPQB 2HG4A 3Q22A 5CXTA 4DU7A 2V2ZA 1XIQA 3AXMA 3W5YA 2VFVA 1XMQC 1ZA1B 2ZBRA 4EATA 3G87A 4KBIA 2XI3A 2MKYA 1TKTB 4F25A 3M2UB 4RW9B 3M8YA 2ZZNA 2D7VA 4TYBA 3KLIA 4GMKA 4IG0A 3E8OA 4MIBA 4KH0B 4NLRA 1WHVA 4QW9A 3DKDA 3UEBA 2X1GA 1YJ9S 2JEIA 4LF2A 5IT9Y 3P6YC 2P2BA 5F3TA 1VOMA 5A6WA 4ZVHA 2M0GB 2QN6B 4DQQA 4LREA 3RR7A 5AXMA 2E8FA 1FNMA 2J9DE 1S1TB 3CT9A 4S0MA 4P2SA 4USTA 1ZPVA 3CC7S 3GCXP 2ZH3A 3ISZA 2GMLA 4IO9Q 2KYXA 4ANCA 4EI2A 3KHRA 4C8KA 1YLXA 5B0AA 4YUDA 4FF4A 5L9XA 5HATA 1SL0A 3GE9A 2HKEA 2F65A 4LF4C 3S6EA 3GV7B 4RZRA 1MXAA 2BW7A 2QMUB 4ISBA 4ZLLA 4PABA 2DHSA 2Z2YB 4ZHRB 4EYHB 3VAGA 1U25A 1LQ9A 3AHPA 3K5OA 1JJCB 2R7WA 4DR4J 2CPHA 3W8GA 2UUWA 1OSDA 4U96A 4XX2A 4DV5C 2G1DA 1SQGA 1T03A 3PR5B 3D6TB 1FKPA 4M5JA 4B9UA 4HKQA 4WXWA 2JLFA 1XR5A 2YVSA 3CMAS 3LWLA 2YKMA 2IRXA 2GHPA 1XNRF 4ILRA 4HT7A 3I32A 1H2UX 3BYRA 3CMES 1XHJA 2G2OA 2E7GA 3H5XA 3O8WA 3IR6B 2AX1A 4Q2MA 2Y27A 1RSCA 1RA6A 3I9ZA 3EICA 4HR2A 1WC3A 1H73A 5BSTA 2BOPA 3I9V9 5B0FA 5KFUA 1NB7A 2DH7A 1JNRB 3OD2A 4JI8F 4ECSA 4L7IA 1CVJA 2BBEA 1SIWB 4JI7F 1DBDA 4W4MA 2QLBB 1M5OC 2H51B 1UVKA 3HHLC 1UFWA 2QL8A 4Q0BA 2DGXA 4KKOA 5KG0A 3WX8A 2LEPA 3MR6A 4ED2A 2WHOA 5BSMA 1RBOB 3OPKA 2I9SA 1RGVA 3HT3A 3IWNC 2N3LA 3IM9A 2B7CB 8AT1B 3OL7A 4C11A 3CJKB 3P5TL 3R7BB 5I42A 4LF7F 3N28A 3UE2A 1KHWA 5CD4A 2NXCA 3GJRB 6FDRA 2RDJA 2HRYA 2N4CA 1DZ5A 4YHHC 5B0DA 4PPZA 3CJ5A 3QGHA 1PILA 3L8CA 1FI4A 4LFBC 1RAGB 1HYSA 4LR7A 2P6SA 1RABB 3AAWB 1N88A 3KLGA 2W7PA 4URQU 4DV2F 2R7UA 2BE9B 4BWJA 4NEYA 3QPIA 4ZPDA 3I4PA 2D27A 7FD1A 3PX6A 1P7LA 4O0NA 2EFGA 4U95A 4Q8EA 3KXDA 3VAMA 3FDSA 5DG8A 1UVIA 4CLTA 1M5SA 4J9PA 2W4DA 3AOAA 4CNYA 2CQ4A 5KT5A 2D3UA 4A8YA 1WACA 5A8WA 2MQNA 2DNRA 3KDNA 3J7YU 1I94F 3M8ZA 3KLFA 1ZM2A 4H54A 4ZP8A 4OX9F 3OVSA 1K44A 3MM6B 2ZM6J 2N7CA 1HNWC 1FXRA 2IBKA 3MMBB 2FZKB 3A12A 4HHHA 3V6DA 4USMA 4ELUA 1IR2A 2R8KA 2YKNB 1S1VA 4OJHA 1FNOA 2KH9A 1EQ0A 1UAWA 4I2QB 1K8AT 1X4CA 5FLXY 2KJVA 3R2CJ 3UX3A 1FRIA 5D8HB 2VB6A 3JAMY 3BYPA 1KONA 2C2KB 4L3KA 1X4FA 3UDCA 1ZTWA 4YMEA 2X1AA 2LQ8A 2FVPA 4MT1A 3M8QB 4QU7A 2P2MA 1FTCA 2E8CA 5EUHA 2RKIB 4FXWA 2LCWA 4WPAA 4FUTA 2OKQA 3PHTA 1CJVA 1DRZA 2UXBJ 3DRSB 2DY1A 3TVZA 3IN5A 4RM2A 3HVTA 1L3SA 2OI2A 3FFIA 4DV0J 3ZNUA 3G6XA 2W9CA 2HHWA 1KC8T 4RW6A 2C22A 1HBOA 3ZO7A 3I0SB 4G1PA 4ZCIA 1S1UB 3IEUA 1G1XA 1FDNA 2WVCA 3MR2A 4KFBB 3R9LA 1VRTA 3CCJS 4FS1A 1FF2A 2XY5A 1UWBA 2DH8A 5ETQA 4X64F 4DV4J 2CQBA 3QIPA 2E7VA 1WNEA 3MAAA 4OX7A 3CD0A 3A8KA 4PWDB 2Q66A 4LVOP 2DBBA 4F0MA 2DR9A 3Q0AA 1GXTA 1U09A 2CG8A 5T14A 5J1EA 4A8MP 2O66A 4EGLA 4Y65A 3C19A 2DXFA 2OD4A 1GTHA 3I31A 2DIVA 4KPCA 2JWNA 2YNHB 2HHXA 4B3TF 1WH9A 5KFQA 2ASYA 3J7ZT 5IWAF 5D3GB 4OX6A 5GMEA 3QO9A 5KG4A 4EUVA 4LF5F 1PKUA 4USHA 3TO8A 2IA0A 2W7OA 1BQMA 4I6WA 1X60A 4ZJZA 1FKOB 3BJYA 2ZBIA 2QC3A 4H4MA 3JSYA 1T95A 2RQMA 4DXLA 5DV9A 3ZTRA 4CP5A 1V5VA 2V4RA 4OI3A 2BRKA 4Q8FA 1FE4A 3MUTP 3TYTA 3AF5A 1MROB 3PIPQ 1ELOA 1N5QA 3HHKA 4Y2IA 5FLXD 1PJ5A 2OD6A 4IFVA 1Q8LA 2O3DA 1RT7A 4OJ3A 1RT6B 3RB4A 2UXDJ 5KFGA 4RBVA 1FJGJ 3KG4A 3T9NA 3HHLA 3FEZA 5LL6d 4NRUA 5A8KB 5L8RC 1HNZJ 4KO0B 1YJTA 1VIOA 3FMWA 1TUGB 1ZB9A 2RHQB 4OZ2A 2VDIA 4Y0FA 5ETTA 4IH5A 5F8LA 4GKJF 2F8MA 3ICLA 1V9OA 4X4OA 3T5LA 2FUG9 1WWHA 1MG7A 8ATCB 4RUCA 5KYVA 2ZC3A 3NOCA 1X5PA 2CQHA 3GLJA 3QT5A 2W4PA 3CDAA 1ZTTA 1T5HX 1JLEB 2D1QA 2MMAB 3MEEB 1WG5A 3DNCA 4F36A 5KFKA 2CPFA 3MCOA 1RB0A 4I9GA 3HZEA 2V34A 3LPEA 2XO6A 5B08A 4DV1J 4LF1A 2HEKA 2G2YA 3PNIA 2HRUA 5A1GA 4DR2J 1WELA 1HQEB 3OL6A 3M8PA 1FX4A 2LLZA 4X4PA 4EEYA 3A13A 3DLKB 4CYUA 2HQCA 3X3UA 3CD7A 2JLGA 2Q6BA 1DFDA 4RWWA 3R5BA 1JKHB 2DIUA 3D54A 5C25B 3NGSA 2E9ZA 5HROB 5DGAA 1FWPA 1S1XA 1UZHA 2JSXA 1P27B 5KFZA 2AJQA 4DZ6A 2BQRA 1VQ7S 1EHWA 2D74B 4NLVA 4ZVUB 1QM4A 2BOAA 1TV6A 5D4PA 4P75A 4X4NA 2MQPA 3SBMA 3HVRA 5E3PA 1FCAA 3CSKA 4D3GA 4NXNF 1YJVA 5LMNJ 4ELTA 5DZ7A 2FIUA 4DSIA 4DUYJ 2KXNB 2KT3A 4LSZB 5J2NB 2OH2A 1RZMA 5GTDA 1KP6A 2FGOA 2HJGA 3D2WA 4RNFA 4LSNA 4PUOA 3EDRB 2VODA 3OHBA 4RO0A 1IBKF 2DISA 3BF4A 4RUHA 2CNKB 1RHKB 4IG3B 2HMIB 1RKIA 2X1BA 1H3DA 2KI2A 2ZM6C 2MQ8A 4LQ9A 2HHHJ 2F8EX 2GVZB 3K58A 1YI2S 4XTTA 4Q5VA 2JNVA 1YQHA 2QEXS 2E9RX 2FVCA 3NMRA 4RM3A 4NLTA 2BMBA 1FD8A 3ZC4A 5GMKa 1TFYA 1JX4A 1NK6A 3FBEA 3FSXA 1M90T 4O4GB 4KB7A 2P2JA 2RAQA 2W25A 3PG9A 4BLGA 2J0WA 1I1GA 1P1TA 5L1LA 1Y10A 4KQZA 2UU9F 4CTAB 4WU2A 5HMYA 1SKRA 4FBTA 2LU1A 3VV2B 3S1TA 3FQKA 2CPZA 3GPAA 2AJFE 3W5XA 4JI0J 4PROC 4K4XA 3V2UC 4DR3F 2U2FA 2NPIA 2BKOA 4B3MJ 2QYGA 3MWBA 3LTOA 2UXBC 2EPIA 5D0EA 4I4BA 2YWGA 5KFRA 3EPGA 1XR7A 2RT3A 1NNDA 1U6ZA 4A8XA 4I6YA 4ZN3A 4DSLA 1F9FA 2FB0A 4G1QA 4PG5A 4C2MA 2XMTA 5IQQA 1R8BA 4M5IA 2IDEA 4LSLB 4NZ7A 1OYEA 2JHEA 1PO6A 4DR6F 4XPEA 3G8TA 3V6KA 4DDFA 1T9VA 4N5SA 2FJBB 2E7XA 2EEYA 2IJNA 4X66C 2PMZD 1YJ7A 1N32J 3NG8A 3FUYA 5CABA 3N6NA 1R0AA 1GPMA 2MKIA 3N01A 3UD4P 1S4EA 1S6QA 1PAEX 1RTIB 3KK3B 1HD0A 2VZEA 2MEWA 2VASA 3M6VA 1M1KT 2NYHA 1R0CB 4JI1C 4X64J 2QSWA 2IC3B 3CTRA 2B4PA 4WV3A 4ZS6A 1HH2P 2D28C 1MNEA 3KOAA 5KFHA 5T41A 3MECB 3GILA 4ZVFA 4ED8A 2YTCA 5E41A 1S9GB 2XEXA 5BYRA 3HHDA 1K0RA 2LYVA 3NS7B 3IMQJ 1ML8A 1N0VC 2CY1A 5KTQA 2KO1A 3QT7A 3FMBA 1DAXA 4CLLA 3QGIA 5EGYA 2Z2LA 5EWEA 4YN3B 3CGIA 3AQOA 3RB0A 1BWVA 2BANA 1YRTA 5IWAJ 3IRXB 4EBEA 3JS9A 1TMJA 5E3CA 1SJ4P 3RTVA 1U02A 3OFHA 1JLFB 4LF8F 2RQKA 1SKWA 1Q82T 2GCFA 4JYAJ 2AEJA 2IFXA 5H1SV 3TUJC 3GR0A 3KJVA 2ACMA 3RJMB 4YR0A 1NH8A 2B5JB 2E44A 4DL0C 1RHJB 2VHGA 5BUQA 3HSDA 2C2RA 2D3OR 1IKVA 2PDAA 5DM6Q 4EO8A 2LQ5A 2HWTA 8RUCA 2CNLB 4DL4A 1BHNA 2BJDA 2WP0C 3VTIA 2P5VA 3EPIA 3B7WA 1U1OA 1X4HA 3B54A 1V3RA 2CADA 1RHUB 2YX1A 3HPOA 1E6VA 3TZWA 4UOHA 3LUSA 4ZLPA 3FCVA 1V60A 3W2WB 4CLUA 2XG8A 3QBCA 3BGFA 4FXVA 1NB2A 2LKZA 5F41A 1RYSA 1RTDB 3MHYA 3NY0A 1IXKA 4W98A 2CVEA 2AMCB 2XO7A 3MM5B 1XNQF 2UVWA 3P49B 1VJWA 2NUUG 4H4OA 1N5TA 4DV1C 4DR5F 4YB7A 4KE5A 4UTGA 4AL6A 1KDNA 4FKXA 1ACMB 3W61A 4DUTA 1C0TB 4JI8C 5HLFA 3GJSB 4RW7A 2E5IA 4JI7C 1OSCA 4DR2C 1U2RA 3J7YI 2ZH5A 1HIYA 2ZZTA 1SL1A 3PESA 2LDIA 1IVZA 4DV6J 2HNYB 3MAQA 2IM0A 2ASLA 1KN6A 4DEZA 2WOMA 2ATWA 3CCRS 5DGBA 2BEFA 3CDWA 1RU1A 1AFJA 3CMQA 5H9UA 4WF9Q 5KFEA 1JLAB 5FDLB 3OV7A 3I0RB 1KTVA 3BSOA 3I56S 5K8PA 4LF7C 1UTAA 3I5AA 4USKA 5J2QB 3VAIA 3D0GE 3UCUP 2HNZB 4QBUA 1QVGR 3GYGA 2MHEA 4Q7AA 2B9EA 4J9UE 1FJ7A 4WWSA 3DRPB 1SV5B 3VALA 4YY3F 5LSLA 3CQ3A 3DYAB 4ZJLA 3LP1B 1FVQA 2E5HA 3NS5A 2ERRA 5H9EK 1VHIA 3R6GB 3GZ7A 5A8RA 4DV2C 4N8OA 3TEHB 3MEDA 1YJWS 1BUXA 5A0YB 2VC0A 4DUYC 3C15A 3ET6B 2M8DB 4FVMA 1NY8A 3GB0A 3R5DA 2Z57B 3RG2A 4USJC 1Q16B 4TLQA 3MI7X 2JVOA 2EBEA 4ICLA 3MR3A 1BA3A 3WHIA 3G82A 3GSDA 4LRBA 4L3NA 3IBCB 1SJQA 4C4WA 2PA3A 2QLFB 5IM0B 2BH1X 1IBKJ 4CO1A 5B7WA 1BQNB 4MIAA 5IZHA 1LK7A 4WTOB 3L95X 4OX9C 1HKAA 2LQBA 1C4CA 5KFMA 5A2QY 3L9ZA 2OTLS 1UKUA 2HZCA 3BDEA 4AUKA 1T94A 3NGDA 4F7VA 3QZ8A 3MXHP 2RQ4A 2CU6A 1MSWD 4KTVA 3MMAB 2B4OA 2B56A 1O0PA 4XO0A 4K5SA 1OIAA 5A1IA 1S0MA 3NLCA 4LFAF 5F0UA 4B3SF 2OLWA 3GIJA 2OPQA 2UV8A 1HMVB 1O8BA 1FERA 3PW4A 3VNQA 3JB9k 2I0XA 4FN5A 2IM3A 4IRKA 2OBVA 1FK9B 4KJIA 3MM7B 1Q1KA 2XS7A 4RW4B 2RMLA 4TU9A 1MWYA 2OJ3A 1NPRA 3HM9A 3TR3A 1XK8A 2VQFF 2ADBA 3BS9A 5I3PA 2K2PA 2DNYA 5A6PA 2GW8A 2MZJA 2HK3A 2IVMA 4DPTA 3SSRA 2HZAA 3MPVA 2RF2B 3C14B 4F0HA 4PWWA 1PYTA 2DGTA 3HXMA 4CNZA 2XMWA 2X3DA 1VQNS 3NNAA 3EJMA 3FGVA 4XDDA 1A7GE 3PRDA 1UFLA 3T9ZA 2V9KA 1QE1A 4X62F 1S1TA 2K7JA 1NZ8A 2F4FA 5C5JA 4X64C 2ZJQQ 1U2FA 1PC4A 2ACYA 1RAEB 3BR9A 5LSOA 4QIEA 4LRFA 1HLWA 3SO4A 1VQ8S 1IKWB 1R7IA 4ZKAA 1TK5A 3OFEA 3QSIA 1BXNA 5HJXA 2ZH7A 5KFWA 4ZDNA 1VK8A 2C2OB 2KFZA 2YWCA 2A2DA 3MCNA 1Y5IB 3AB4B 3TA2A 2FJEB 4C0HA 1H6KX 3LALA 4B3TC 4F26A 2BJ9A 4CI0B 1Y5LB 5IWAC 4PUHA 3V81B 1C1CA 4LF5C 2CNNB 4TLRA 1NXIA 1J5OB 4QWEA 4RJVA 2BJ1A 2XMKA 2OPLA 1F2HA 4F4ZA 3ETCA 4JYAC 2HPUA 2IAJA 1KKGA 3BSAA 1X4DA 2GHWA 3SQGB 1KFSA 3GIRA 2YQ3A 4CO0A 1NK9A 4M5KA 3VQSA 2HURA 4K5RA 2XULA 1YG0A 4XIUA 5HBMA 4NXMF 4FF2A 3M8RA 3DOMB 2E1RA 1WG4A 1Q7YT 4ZIVA 1RLDA 5BURA 4DCUA 3WC2A 3PYFA 2C42A 3WX4A 2DEIA 3CJ3A 2RJZA 4QIFA 2XI2A 4WBFA 3VZHA 4RNHA 4GKJC 4UOCA 1I3OB 2OFHX 3MR7A 5HN0A 1RAHB 1NUEA 4F4KA 4E2FB 5IT0A 4IQMA 3JQKA 1NU4A 3DOKB 5K14A 1U0HB 3HLUA 1FUGA 3SV4A 4LQ3A 3PW7A 1DTTB 3HULA 5CYMB 2M52A 3HKZD 4O3NA 4NMXA 1N5SA 4QIGA 2UUCF 4JUZA 4ID8A 3QJPA 3ZFVA 1U4BA 2GX8A 2Z51A 4NASA 1CULB 2YWHA 4JM1A 4I56A 2NZ4A 2RILA 1T9UA 2FQQB 1TP7A 3PEHA 1ZYQA 4ILLA 4DR5J 3J7Z5 5F9LA 2CJAA 3B4DA 3LP0B 4G65A 2C3MA 3K57A 5AXKA 2XYPB 4DV6C 4FPIA 2WTFA 2LEBA 4O44A 4USUA 2FLLA 3B6BA 3I55S 3Q89A 3TX8A 2GA7A 3RZAA 2PI4A 2XMUA 1PC5A 1N6QB 4N47A 2I8EA 1WC1A 2FVRA 3GU0A 1X4EA 4OX8A 1EAYC 4OIXA 3LUYA 1RHRB 1JNZB 4CH0S 2PI5A 2CQ0A 1LW0B 3RAQA 2MCQA 2YX7A 1L2FA 1Z2ZA 3KG1A 2W2PP 4JV5J 2VSQA 4CH7A 2JFDA 3A3NB 2GAGC 1WEZA 3PJ9A 2MKHA 5D4NA 2OIHA 2WSFC 4IR1A 5CYJA 4A46A 1QAIA 4I9FA 1SH0A 4QR1A 2RSQA 3U1LA 3KK1B 4CQ1A 4WE1A 3PFOA 1UJ6A 1XMOF 4DV3J 3RB3A 3G6VA 4X65J 2YNIA 3W2VA 3QIDA 2KZ0A 3VCDA 1AT1B 1RT2A 1PCAA 1HR0J 1RADB 4J5OA 1CJKB 4UOFA 3ZZPA 4ECYA 3PEJA 3PIOQ 1U45A 1KQKA 1U6BA 3KUHA 1QJHA 2XHCA 1WF3A 1IBKC 3V4IB 2UUTA 1MDBA 4NA3A 3M32B 4ZP9A 1TL4A 4X4SA 1LWCB 4PG4A 4WFXA 2NXNA 2DO4A 3I0SA 1ZH5A 2HZVA 5THWA 3FCHA 2IMOA 4NMLA 4F3MA 2BACA 3F56A 1KSPA 3VGUA 1S7HA 3N6LA 5T7LA 5E3RA 2J76E 4F8RA 5KOWA 2HIQA 1DY3A 2VG6B 1GMUA 4M5DA 3F0NA 2P20A 1J5EF 3M9NB 2E5LJ 1TAUA 5LMUF 1GX6A 1U1MA 3QNWB 4IOBA 2UUAF 4OI4A 2DXDA 1QSSA 3WIVA 4PWDA 1Y00A 4TQSA 5E33A 4LMZA 3TRGA 2V7BA 3C16B 3VGSA 3UNYA 4YDXA 2RUSA 2VQEF 2MXYA 2FJAB 4M5LA 4DR3C 4X4RA 3VAJA 1SQFA 2D3O1 4IDKA 1WJ9A 4GVLA 3V6JA 2HHVA 4DLEA 2J9EA 3POTB 2YNHA 4I2PB 2E5GA 2DYJA 4UW2A 1APSA 5K5MA 4MYTA 5D0RA 4ZVTB 4DR6C 2Y4OA 1BWEA 5F0WA 4DFKA 3AXKA 3AOCA 3IO1A 2ASBA 3N5BA 2GQCA 2MQMA 3R27A 2Y1JA 1WTFA 3CB4A 2VDHA 2RDDA 2HQFA 1QLNA 1P4EC 1RG9A 3BH6B 1IKYB 3KLVA 1FEHA 2MGZA 3NCPA 3FCCA 3BV8A 2BE2B 2LMIA 4HVZA 4OZ5A 1TL1A 2KRBA 2ALYB 2D69A 2HSEB 2M9KA 2KHDA 2HRTA 2OPRB 3M30A 2OPPA 5IFIA 3PFEA 3HT0A 3UR0A 4LBHA 1FRKA 4D4IA 2EFNA 4K8RA 4PUIA 4FYDA 2JDJA 4KO0A 2XMMA 2H4WB 1CSJA 1OJ4A 3MFHA 2J9DA 3K2YA 1RQ0A 4K4VA 4MFBB 5LM7E 2L08A 5RUBA 5HMZA 3CJSA 1UWDA 4QQBA 1QTNB 3DDNA 2BJOA 5H9FJ 4OZNA 2E0GA 2N7YA 1T8EA 3RRHA 2QW0X 2AYGA 3F44A 2W2NP 4KH1B 2MKJA 4J9OA 4KHPF 2EKNA 2EK6A 2YKOA 3SV3A 2ZD1B 1S12A 4J37A 4F3OA 3BGRA 2JRSA 2KL8A 4ED4A 3ITHA 2FHKA 3FEXB 5LCIA 1RT1B 2MZ1A 5F3ZA 4OI1A 2YNFA 2BABA 1KWMA 1EJ7L 3WQPA 5JUMA 3DOLA 3RAMA 3CCVS 4AL7A 3H2UB 4U6PA 4PXDA 1CS4A 2FYXA 2EC0A 4QWCA 1RCOB 3GMGA 1HQEA 3DI6A 4NCBA 2M4MA 2BQ3A 4UZBA 4LF9J 1LW2B 1H2TZ 5LJ3Y 3CIZA 2XS5A 1LWFA 4WCEQ 3IMLA 2F63A 2MB0B 1QVFR 5E3AA 4A8OA 3JSRA 2VFTA 2HWIA 5IQ6A 1URNA 3OTOJ 4YHHF 3CDUA 3T19A 3OBIA 1VQKS 2GIQA 4OYWA 2HFZA 4ZVSB 1TL7B 1HNVB 1HNIA 2ZH6A 4U67Q 1TKZA 5D4OA 1ZB8A 3MPUB 2COLA 4NLGA 1RDRA 1JLBB 3CF5Q 4ZOSA 1XNQC 1AMUA 3OUYB 1WKLA 2V6AA 1S9EB 3PX4A 1VYAA 1QY7A 4DR5C 3T5KA 3OR1B 2G1HA 1VMBA 1FHTA 5BUSA 2Q6CA 1PGZA 2QMXA 1L3UA 4DS4A 3H40A 4R0MA 4N77A 3NAHA 3D3CJ 1CJTB 5J1PA 4OFZA 4HACB 1QTMA 2AHOB 5DO2A 2V69A 2QJ3A 2CQ1A 4DR1J 1SUQB 4RMNA 2DXEA 2YWEA 4X2BA 3GFZA 1HNXF 1TU0B 5GAHU 4IG3A 3C6UA 3RBDA 1JIHA 5KFXA 5KG1A 2PFFB 3S82A 1S0OA 3UOWA 2AYBA 2MQQA 2JOQA 4F4XA 1L3TA 2CZ4A 5HMWA 5L1KA 3MDFA 6AT1B 3R3TA 1GXLA 4Z7CA 3GCWP 3SCLE 1GH8A 2F9JA 4JI2F 4RNNA 1SJ1A 2GJFA 1AUSL 1WHWA 4YY3C 1LV5A 1PBAA 2BDPA 4DV3C 2HAIA 2HFUA 1JQGA 4ETXA 2JC1A 1YZ6A 3HKWA 2PFDA 3IG1A 2OSRA 4L4QA 4JB8B 4R25A 1HW8A 5C24B 2FC8A 4ODJA 2B51A 1FFGB 2QA1A 2ZH1A 5KFCA 3QRQA 3LW5C 1RXOB 4HLBA 5EN1A 2KZFA 3SYZA 2XNRA 4OHVA 2WVEA 2ZKUA 2PIIA 3NGTA 3Q8SB 1R6VA 5F8HA 1JOSA 5HVGA 3MCSA 5GAEU 2QE5A 3M2VB 1HBMA 1NSKL 5DG9A 3CDBA 1NRKA 4Q44A 2Z2MA 5C2CA 3TJAA 1SQEA 2DK2A 2C2DA 3J81D 1RCXB 1B99A 4RLEA 1U26A 3CCWA 4R0EA 2XLJA 1K0TA 4NE9C 3I87A 4RPFA 4D3HA 2ATLA 4BBYA 4GKKJ 3RV2A 1HBNA 1V3SA 1U48A 1GX5A 5ETOA 4ECTA 1A9NB 2P6TA 3KK3A 3PCOB 1P4EA 5AE1A 1KLMA 1XWLA 4FDFA 4EWTA 2POKA 1WSVA 1R3NA 5E7QA 3MPYA 1NJZA 1S6PB 1VISA 4LFAC 3J7AN 4B3SC 1VBKA 5KG7A 5B0CA 4Y3CA 3W62A 4F4AA 1X9MA 1RAJA 4JI3J 1S9FA 2WW8A 4MK7A 5KFPA 1VIXA 3BKUA 2HNDB 4KGZB 4TU7A 1FT8A 2MMYA 4GS5A 2M5HA 2ZBPA 2P2QA 2UUBJ 2GJ2A 1QD1A 3NGRA 4KSEB 2VQFC 1PAUB 1HHQA 4ZP6A 4RNMA 2V8HA 3HD1A 3FSIA 4DWIA 4KIAA 1WC0A 3T5HA 1M5PC 4NZ0A 4DPWA 2J7WA 4LFCF 4IH7A 4PQUA 5JJBA 1VQ6S 4DR7J 3A8JA 2BW2A 2R7QA 2J6UA 2GIFA 1JLFA 3DRRB 4WIIA 3ILOA 3GIIA 4O3RA 3NL0A 1HQUB 3OXFA 4EZ6A 4X62C 4O3OA 2MDAA 4WTYA 4NOZA 3VZIA 4MMOA 2UXCJ 4WYLA 1X4AA 4HTJA 3U1NA 3DGPA 4DL7A 1QAYA 5BR8J 2M70A 2R3VA 2K1RA 5E2QA 3C8YA 2DNQA 3DLGB 2DPLA 4WP9A 2GJIA 1NPPA 3KWMA 4J7CA 3UVJB 1CC8A 1AZSA 4DSKA 3CD5A 4DPXA 2ZNZA 4UUWA 1N34J 3I82A 1NK7A 4LRAA 3T1HJ 4IRCA 1SPBP 4DR4F 4E98A 4NA1A 2CPDA 5B0BA 5KFAA 2CJKA 1F9HA 1VLAA 1FXDA 4KC5A 2BKPA 1W26A 1PG4A 3N2QA 1MU2B 1EETA 2FZGB 2C3PA 1PIEA 1YRUA 3MM8A 2ZHOA 4PG8A 1Z2LA 4JI5J 4LR8A 1SJ3P 3TQIA 1RT3A 3MEGA 4OHXA 5IOLA 1JLCA 3M05A 4X4TA 1T9YA 4E0DA 1NDCA 2AWZA 4PAAA 3GYXB 2DO0A 2VG7A 3I4HX 5L1JA 3MD1A 1NSQA 4KHPJ 4J9QA 2HGNA 2DVIA 3LAMA 4ZMMA 1Q5VA 1VI7A 2XYHB 1Q95G 1REGX 1Y0HA 1BE4A 1JXLA 1KOHA 2KVQE 2BRLA 5DRKA 2W9BB 1RBLA 4DL2A 4F50A 3W7BA 2LFVA 4NXMC 3UD5A 2ILZA 2OMLA 1W7WA 3SI8A 3IBWA 2Z58B 2XS2A 3DRYA 1X0PA 2HNYA 2ZOGA 3G8SA 3SXLA 3PROC 2Q43A 2VA3A 1SJFA 4B9LA 2Y1IA 3BSNA 3THTA 4AXIA 1K1SA 2DCUB 3Q2TC 4Y2AA 3AJDA 4DSEA 5FDLA 2BE7D 4Y28C 4NL5A 5CQGA 2HHUA 1X5TA 5J2QA 3OJUA 1FX2A 4DSFA 1BD6A 4YDDB
chains in the Genus database with same CATH topology
3EPGA 1XR7A 2RT3A 3BR8A 1NNDA 1U6ZA 1C1BB 1H38A 4A8XA 4DN9A 5K8FA 1ROFA 3LGNA 4I6YA 3CO9A 5L39A 3CVKA 5ADZA 4DSLA 3MFIA 1F9FA 1K1QA 4CH1A 3M32A 3M9MB 2FB0A 4G1QA 4PG5A 4C2MA 2P9GA 1SI9A 3OQ2A 1SV5A 2XMTA 4BC7A 2RH3A 3O2IA 4M94A 5IQQA 4DOZA 1R8BA 2XY6A 3K5NA 2UUCC 3BO3A 1VC5A 4WKRA 1LWCA 4LSLB 4NZ7A 3Q8QB 2JHEA 3PKYA 2JEJA 2R9LA 1PO6A 1XRCA 4HPVA 3CCES 3M2RA 1D0EA 3MGJA 4DR6F 2XSJA 4XPEA 3PO4A 5KFIA 3G8TA 4WE1B 4ZHRA 3T6BA 2JMPA 2Q1LA 3V6KA 1VQSA 1USPB 4DDFA 3OR2B 1L5UA 4FZVA 4RX6A 4N5SA 2LA6A 2FJBB 3DDKA 4MK8A 1RA7A 2E7XA 3H2LA 5L38A 2YNIB 4YR2A 3OLBA 1Q79A 3W2VB 4B9SA 2IJNA 4X66C 2PMZD 4DV7F 3D1QA 1YJ7A 1AXQA 3NG8A 5DJBA 2QT7A 2DNLA 5A0YA 2VBYA 1KHVA 4UQGA 2JEGA 3N6NA 2XNQA 1T3NA 1R0AA 3VAHA 4CO5A 2MPUA 1GPMA 1RT2B 2MKIA 2VG6A 1D8YA 3N01A 2MJUA 2ROGA 3J81Y 2I5JB 3UD4P 5T8SA 2DR5A 2ZH9A 3PRBA 1S6QA 2XWXA 4FUQA 1RTIB 2HLUA 4WKYA 3KK3B 1HD0A 2G0CA 2VZEA 1H7WA 2VASA 3M6VA 1M1KT 1P1LA 2B43A 3K7RA 4JI1C 2IRYA 2LECA 4U7UK 4OL8A 2QSWA 2IC3B 3CTRA 3TP2A 1E6YA 3BDPA 4MTNA 3LAXA 3IR7B 4MKYA 2WONB 1S6OA 3S01A 2B4PA 3RYLA 1F2GA 2HVIA 1HW9A 3D28A 4ZS6A 2HS3A 4WV3A 4QWDA 1HH2P 1MD9A 2ZM6F 1MNEA 3NWGA 2D28C 5A2QD 1VS3A 5GAGU 5KFHA 5T41A 3KOAA 1FDAA 4LFBF 1NKEA 5I4MA 2LXFA 4G37A 4PXEA 1K73T 4F4WA 3MECB 4WU3A 4MKBA 4ZVFA 2YTCA 3GILA 4ED8A 5E41A 1NJIT 4CCHA 3DHXA 2JL9A 5DETA 5BYQA 2CG4A 3UQSA 2QA4S 3H59A 3PZPA 3MPWA 1S9GB 1Z4UA 3OJSA 1M5VC 2XEXA 1ZOTA 5BYRA 1HARA 1JB0C 3CE8A 3HHDA 3LAKA 3KNAA 1K0RA 2LYVA 2CY1A 1ML8A 1N0VC 1S77D 2PE8A 2KB2A 5KTQA 5MLCV 2C3UA 5HI7A 2KO1A 2CRLA 3C66A 3POTA 1ZM4A 4F67A 3L3CA 1B7FA 3FMBA 4I2PA 3ULHA 1U1PA 2CIMA 2V8DA 3E3XA 5T7LB 4BCAA 3QAUA 1DAXA 3QGIA 4NLOA 1T03B 2F4VF 2HHQA 2CVIA 5EGYA 1YSJA 2ZH8A 2Z2LA 5EWEA 3UI3A 2FHOB 2NSCA 1MMDA 2HLTA 4M5DB 2HGLA 3QMQA 1FD2A 3CGIA 3AQOA 4LF9F 2QVYX 4I69A 2VFRA 3RB0A 1D9AA 2ZC4A 1XR6A 2BANA 1FXLA 1VQMS 1YRTA 3IRXB 4EBEA 1EP4A 5E3CA 2E66A 1DARA 4URGA 5KG2A 1FKAF 1SJ4P 3DHWC 2FDNA 3RTVA 1XMOC 3OFHA 3TAQA 2L9WA 1JLFB 2YKMB 3SSSA 1QSLA 2RQKA 2VC1A 4ED0A 4LF8F 5BSWA 1H7XA 2HHSA 2BUNA 4YB6A 3LQVA 1SKWA 4OJ1A 1Q82T 2XZWA 4IZ6A 3OTOF 3MD3A 3CJKA 4RU9A 3OW2R 2GCFA 1NK0A 1IKYA 3K5PA 2J8AA 4PG7A 1KQFB 2IFXA 5EX3A 5DQHA 4DLGA 1X5SA 5H1SV 1HNWF 3TUJC 3GR0A 3BREA 3KJVA 1IBMC 2Q3PA 3CCLS 4YR0A 2AGQA 2L3MA 1NH8A 2ZOMA 2VL1A 2LDYA 2BE2A 4KGMA 5CZVA 2B5JB 3WC0A 1H98A 2OMOA 3MM7A 4FBUA 4IDKB 2IM1A 4DV0F 4K4SA 2VPXB 2DNNA 2E44A 4KTTA 2P9EA 1B0PA 4DL0C 1WTBA 3JTOA 1S1XB 2MZTA 5BUQA 2DGVA 4KPYA 3IGVA 3NKYA 1WF2A 3K5MA 3NNCA 5KFTA 2C2RA 4URSA 2D3OR 1IKVA 4TPSB 3N79A 4QJVA 2PDAA 5DM6Q 4C8LA 2EFPA 4EO8A 4EZ9A 2LQ5A 1HBUB 2QLWA 2HWTA 2MJNA 4KKOB 3JYTB 4D57A 2RF2A 1TV6B 4ZVEA 3BZQA 1S1WA 2B9XA 3OTBA 4DL4A 1HA1A 1S76D 3BQ0A 3N0VA 1IJFB 1KTQA 4Q43A 3P96A 2BJDA 2IMWP 2AP6A 3BO2A 2WP0C 3M4XA 3KFWX 3VTIA 3DLLQ 3AQPA 2ADCA 3DM2A 2Y4NA 3SEOA 3KHLA 4OZ1A 3C6TB 2P5VA 3EPIA 1M5KC 3JSMA 4DV4F 3B7WA 2CYYA 4QWBA 4RUAA 3TARA 3R9WA 3HHLD 3AJ1A 1U1OA 1X4HA 3FQLA 4MFBA 4Y34A 3H25A 2M88A 4M95A 1V3RA 2YX1A 4IO1A 5KG6A 3HPOA 3VQTA 2AU0A 3VNSA 1E6VA 2V4JB 4ZA1A 3D5MA 4C11B 2M2BA 3GFXA 3WBZA 3BO4A 3LUSA 2OPSA 2HHPA 2I1RA 4DX8H 4ZLPA 4BWMA 4ED5A 4IKAA 4DR1F 3W2WB 4JBCA 4EBCA 5CCLA 4DQIA 5KOXA 2MSTA 1T05A 2IYIA 2OO4A 3DMJA 2XG8A 4KR0B 2MGZB 3KLEB 2FJVA 3BGFA 2LEAA 1DTQA 2HW3A 3GIKA 4PUOB 3L7OA 3IRWP 2KVIA 1S6UA 4FXVA 2VBZA 1J5EC 2LKZA 3RU0A 3CIMA 5LMUC 1FRXA 1TL1B 4LIWA 5CHCB 5F41A 4AXJA 1RYSA 1SL2A 5GVQA 1RTDB 2NSBA 2YNGA 2UUAC 1FJCA 3MHYA 3DFEA 4ILMA 1IXKA 3M30B 2CVEA 2OPPB 1KQSR 3BEGB 4O3QA 4DQRA 4PZPA 2W4CA 1I6JA 2R8IA 2QO3A 1ZAVA 2PC6A 2ZD1A 4HI1A 2XO7A 2N4DA 3CPWR 4EYIB 2KDOA 3MM5B 3TVKA 5DLFA 2UVWA 1XNQF 3P49B 3MM6A 2CQ2A 1VJWA 1HYSB 5L1IA 3M8SA 2NUUG 4H4OA 1N5TA 1JMTA 3KLGB 4DV1C 2VQEC 2RE1A 4NLWA 4DR5F 5HMXA 2O67A 3MMBA 4KE5A 4R0JA 1KR4A 4YB7A 4AL6A 2LA4A 5G0RB 2KFYA 2P02A 2CDQA 1RT1A 2YKNA 1N4LA 3R9XA 1C0TB 4JI8C 3HI9A 3ZZZA 5HLFA 3RRKA 2X1FA 4AQYC 1KS2A 4RW7A 3IPLA 4DFMA 2XSFA 4W90B 4I67A 4I2QA 2E5IA 4JI7C 2IYGA 5LSRA 5KFLA 1YJUA 2AJ0A 4A48A 2J6TA 1OSCA 2R4FA 4DR2C 4JV0A 3SSQA 1U2RA 3THPA 3OVAA 1UEUA 3J7YI 4TN2A 4GC6A 2ZH5A 4R5PB 1S0NA 4IQXA 1SH2A 1VRUB 3LP2B 2KXFA 4G6VB 1NYEA 3PXGa 3I5BA 3GV5B 3ONQA 1VQLS 4OLPA 1Y7PA 3C3LA 2J7KA 5F8IA 1SL1A 1TUVA 3PESA 2LDIA 3KYLA 2B9WA 3TOQA 2HNYB 1WHXA 1J2VA 2IM0A 5AE3A 3MAQA 2ASLA 1KN6A 2R8HA 4DEZA 7FDRA 2WOMA 2ZOFA 1B64A 1ZPWX 1AUDA 4C9DA 3CW9A 1V6HA 1CC7A 3MEKA 1N5YB 1LW2A 2EVZA 3ISNC 2ATWA 3H20A 3BGUA 3UCGA 1Q86T 3CCRS 5DGBA 1GQEA 3KMSA 3CDWA 3L09A 4QW8A 4TU8A 1RY2A 5A8WB 3CCZA 3PY8A 3M8QA 3NBPB 1AFJA 2QZ8A 1F60B 5H9UA 2FY1A 5KFEA 1JLAB 4KT0C 2C3YA 5FDLB 3KLFB 4WF9Q 2AYMA 2OSQA 3I0RB 1KTVA 3E01A 3OV7A 3BSOA 3I56S 5K8PA 1EGAA 4LF7C 2ZZMA 5CYQA 2A18A 3I5AA 2IM2A 2OP5A 2EK1A 3JTNA 2RKIA 2ZH4A 5J2QB 3GIMA 3VAIA 3D0GE 5F8MA 3UCUP 3BGRB 2HNZB 4QBUA 1QVGR 2UXDF 2KTQA 3CJ0A 2P2FA 2MHEA 1WD6A 3ITHB 4Q7AA 1FJGF 3TAPA 3J80D 2NPFA 1GNKA 2WAQD 4EFAC 3DRSA 1O92A 4LUBA 1LWEA 1RTJA 3LWMA 3NI2A 3D0IE 4ED7A 1S1VB 2RB7A 4IFYA 1RWUA 1FJ7A 1GT8A 1HNVA 2YNFB 3DRPB 1PSDA 4A47A 4F4YA 1UMJA 1HNZF 4JV1A 3O44A 3LF0A 1T02A 3B82A 1SV5B 3VALA 2GO8A 3DOMA 2CPEA 1CQNA 3BSCA 3DOLB 1M0SA 1TAQA 4M1KA 3CCMS 1LXJA 4YY3F 1HWKA 4CT8A 4AL5A 1OPZA 1IKXB 2WB4A 5LSLA 4OHWA 2JEFA 4CO4A 3M2RB 4YFUA 3OUYA 3HP6A 3DYAB 1UL3A 2HHTA 4ECUA 3A4IA 1DJ0A 3LP1B 1FVQA 2E1AA 2E5HA 3NS5A 4OMFG 3X1LB 2KYZA 1S9EA 4QYRA 2N3OA 2ERRA 1S1UA 3RAXA 2DR7A 2VKZG 2QVXX 4FNHA 1N33F 3H2TA 3GZ7A 5A8RA 1UJ5A 3H5YA 4C0BA 1ZAXA 4FP9A 3I07A 3OR1A 4DV2C 4N8OA 3R5CA 4GKKF 2KKHA 3DI6B 1V26A 1HWJA 3MEDA 1YJWS 2C2EA 5A0YB 2VC0A 4X4QA 4KFBA 3GG1A 4OI0A 3UZ0A 4DUYC 3TNVA 4HDGA 2M8DB 5J2MB 4TYAA 3KLHA 1XEZA 5K85A 1LWFB 2ZJPQ 3OSNA 4FVMA 2HFNA 3GB0A 3R5DA 5EHHA 1TVRA 3RG2A 2R7TA 2ZITA 4D56A 4USJC 1S6QB 4JV2A 1LOUA 1Q16B 4TLQA 2G13A 3MI7X 1NJYA 1C2PA 1NO8A 2KT2A 1HHTP 2JVOA 2EBEA 2UVVA 2LQ9A 2N82B 1N2FA 4ICLA 4RKUC 3WDOA 3MR3A 1RJJA 4RU2A 1BA3A 4FXDA 3EXYA 4NX9A 3GSDA 3OVBA 4AE5A 1XERA 3BQ1A 2NREA 4L3NA 1X9SA 4QIVA 1SJQA 5DLGA 2NR0A 4JI3F 1S49A 4C4WA 2EWHA 1DTTA 5LXYA 1HNIB 1FEEA 2PA3A 5CYMA 4WFYA 4AFFA 3FCEA 3HVTB 4KHPC 5IM0B 2BH1X 2FVSA 3FFIB 4CO1A 4OI2A 5B7WA 3KNGA 4DV1F 4NCGA 1TKZB 4X4VA 1BQNB 4MIAA