2OOCA

Crystal structure of histidine phosphotransferase shpa (np_419930.1) from caulobacter crescentus at 1.52 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
104
structure length
104
Chain Sequence
b'GAVDFAYLEGFAAGDFAVVDEVLALFREQAALWAPMLDPTHPGWKDAVHTVKGAARGVGAFNLGEVCERCEAGQESLEGVRTALDAALLDIAAYAHEQALRSLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine phosphotransferase
molecule tags Transferase
source organism Caulobacter crescentus
publication title Crystal structure of histidine phosphotransfer protein ShpA, an essential regulator of stalk biogenesis in Caulobacter crescentus.
pubmed doi rcsb
total genus 44
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature ec 2.7.3.-:
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 2oocA00
3MYFA 3IQTA 1BDJB 2LP4A 2LCHA 1OXKA 1YVIA 3KYIA 1C02A 3KYJA 4PACA 1TQGA 1C03A 2R25A 1Y6DA 1QSPA 3U3BA 4EUKB 2OOCA 2LD6A 1WN0A 2Q4FA 1SR2A 1I5NA 1A0BA 3US6A 4G78A 1OXBA 1FR0A 2A0BA
chains in the Genus database with same CATH superfamily
2EPNA 4C3EA 3K1HA 3UGPA 1SF8A 3CAXA 2G62A 1Z5ZA 3DWWA 3EGXA 4YK5A 1APCA 2DYSC 3ASNC 1BDJB 2B0HA 3C62A 4LDQA 1IZMA 1PV3A 1ZU4A 2CCYA 1O5HA 1OXKA 2J46A 3O55A 1C02A 4IARA 3LAYA 1LPEA 4MW3A 2WVNA 3HTKC 3EG9A 5L0FA 2R7XA 1LVKA 1WATA 2P6VA 1ZHYA 3SNHA 5D91A 2EINC 2Y3HA 4DOZA 5DVWA 4XLPF 1BR4A 2YRFA 4XPYA 4JW1A 5COFA 3DMDA 4J7TA 4LACB 4DBRA 3LS0A 1BZ4A 5COGA 3RH3A 3UMKA 5EHHA 2LFDA 1Z63A 5JP7A 1CGNA 1OXBA 3AQCA 3C18A 4XPWA 2HJ3A 2M64A 2CNWD 3MYFA 1LI7A 3QVYA 4LLEA 2IXPA 4EKWA 1T6UA 5F28E 1DOVA 1QKRA 3AGTA 5EGYA 4CSAC 1SMYF 2KW3C 4MQ9F 3PDMP 2IXOA 2XM0A 2Q00A 2R7UA 1D1CA 2OQMA 4XWJA 2E87A 3DE9A 1D0ZA 4AE4A 1TWHA 4D4NA 2YL0A 1E84A 2ZXRA 4WGZA 4Q5SF 3MFNA 1EA8A 2A68F 5L0DA 1K40A 1OW6A 3RF3A 4CS8A 1TWCA 5KYWA 1H7IA 1YZAA 4BEMJ 2IXNA 3W8IA 4HE8D 3NKDA 2BE5F 2R7OA 2OEVA 3ZG1A 3RQGA 4DXWA 5TJ5E 4IJJA 1CGOA 2HMQA 1GQAA 1V54C 3K7DA 4JRZA 4KNVA 2IBFA 2ZD9A 4IB4A 4BJ5A 1LS1A 2Q9CA 2YWAA 1OKKA 1AUEA 4NTFA 2P7VA 256BA 4PJMA 4KI2A 1JPJA 1Y4CA 3GM3A 1Q0KA 4XEVA 4E18A 2C03A 2KNHA 2Q9BA 5A6KA 3EFOB 3NYJA 4K7BA 2DB4A 3FMSA 4NY3A 3R7CA 2GFHA 4YT5A 1QSPA 3JSZA 5DLJA 5BQIA 3H2UA 1JPNA 1OR2A 2HSBA 3A11A 3TJ6A 4R32A 1E85A 3EFOA 3NMKA 1XWJA 2HSQA 3JT1A 4YT4A 3WAQA 3IQ6A 2H8AA 3QTHA 4Z9IA 4IWBA 4OINF 3DAFA 5A6JA 2YQYA 5A6AA 5JLIA 5JVEA 2TMVP 2ASRA 1VK5A 3C8ZA 4O6YA 3N2ZB 1FNTc 4ZLCA 3K6BA 2FAPB 2R9RB 4CJOA 5T3TA 1ZW3A 3POVA 2WZFA 4DRIB 4CBEA 3ABLC 2YL1A 4ONSA 2NUPA 1LI5A 4BJ5C 3CEXA 3L0IA 1MQVA 3GWLA 3GEIA 1MNEA 2OKUA 3SXZA 4BG0A 5KYYA 3C63A 4IAOA 2AU5A 4JIOA 3UMHA 2FGYA 3PCVA 1YVIA 3A9CA 2FFHA 3LNRA 3V5ZA 3I4UA 5KYYB 3G50A 4UDVA 3ABMC 2XLOA 1TWGA 1OQCA 3S0XA 5BQHA 1SYQA 3ZTZA 4U5EE 4LDKA 3ZQYA 2XM4A 1YYJA 1T6QA 1EKYA 3V5XA 1WN0A 3SEOA 2ZPAA 4I3MA 4GQHA 3OWTA 5A6BA 2EPKX 5E2QA 4XLNF 3AG1C 1Z3IX 2DGJA 4H4KC 1GM5A 2ZXOA 4EIYA 3GM1A 2GA0A 2CYDA 3ASOC 3GODA 1J8YF 1YA7O 3IQ5A 1DOWA 5E3CA 4AX2A 1CGME 3HJCA 4NTBA 3ZTMA 3FDQA 4JEAA 2HKVA 2Y69C 5E33A 1NFNA 3LLKA 4HEAJ 4O7GA 4WGYA 4C7OB 1ORYA 2UUIA 1D0YA 3QW1A 4P9TA 1C17M 1YDIA 4I1OB 4A2NB 3S90A 3S27A 4DRJB 3WG7C 1S05A 1Y6DA 2AWYA 1T6IA 1FAPB 2PP4A 3QMKA 2B0JA 3V7OA 4YT8A 3EG9B 2QLAA 3E70C 2R7WA 5CIVA 4W8PA 3DKAA 2L6HA 1SR2A 3WHNA 3U2MA 4OIRF 1MMNA 4XPXA 1ORJA 1H6GA 3PMRA 3NG1A 3QZCA 2L9JA 4HFFB 4IAQA 2WB7A 3UGOA 5CI9A 2YVKA 3M79A 5HV9A 3FOOA 2IXMA 1TKNA 1VYIA 3U8VA 5DS4A 1YAUO 4BJ1A 3KYJA 4J32B 4PFOA 4MS2A 5D92A 3K1IC 4EHPA 1WWPA 3T4RA 2RD9A 1M2VB 5DQTA 3FVYA 2Q7RA 4E17A 3SXYA 3NYMA 3HKKA 3AGUA 3RVZA 4N06A 3MYIA 1YZCA 2WL8A 4GEHA 2XLHA 4JE9A 4EUKB 1HMDA 2IOQA 2YLGA 3IPMO 4GYTA 2A6EF 1RCPA 4WABA 5F5FA 1OCCC 2KJGA 2EIMC 3DAGA 5BQGA 3U5SA 3LEOA 3WODF 5B3IA 2GWWA 4N6HA 4U5GA 2HV7A 3N0TA 4AK9A 2RSEB 5AC4A 3W8HA 2ZXWC 1M6TA 3C8GB 4CX9A 5AC5A 2L6FA 1PD0A 4MTGA 1V4AA 2GDCA 1Q0MA 2W4MA 4ULVA 3W4YA 1RKCA 5CI8A 1L3PA 3LS1A 4W8KA 2L7AA 3L8JA 1HY5A 1V55C 3GANA 4JTDB 2YLDA 3TOMA 5B3SC 4RBNA 3TD7A 2I8BA 3J06A 4PJNA 1E2XA 1I4ZA 1YLMA 3R2PA 3B9QA 3B0UX 5JS5A 5L0HA 4QI0A 1ZHTA 3KMIA 1ZW2A 1H9TA 4MVMA 2P61A 3ZQVA 2P0NA 2VCAA 1VMAA 2LD6A 1A7VA 3OEOA 3GEHA 3JRMO 2CW0F 4B6IA 1TFKB 4CIHA 5L3VA 1VLSA 3U3FA 1TWAA 4CSAA 2LSEA 1PD1A 2KGOA 1JMWA 1JR8A 2PFDA 2M4EA 2R02A 3O6XA 4LERA 4X0RA 3HNLA 3LEVA 4HFKB 3VM6A 3ZVRA 1RMVA 2YKZA 1A41A 2DI3A 4LDRA 3B0VC 2R7VA 2X0CA 4CS9A 3AQBA 4JCHA 3VYWA 1NU7D 1T01A 4OIPF 1RKEA 4NQFA 1TQGA 3UNGC 2AWCA 2VCCA 3HNKA 2R7SA 1K04A 3RQFA 4BJ6C 4DRHB 2OJQA 4U9DA 2F22A 1SZIA 2KYHA 4RDAA 1FMWA 1LM3B 4G0HA 3U2LA 4AL1A 4C7OA 3C8GD 3S29A 3ATPA 2WZLA 5FCLA 1R5ID 2D5RB 2HUJA 3L8IA 3MLGA 4ULWA 1EQ1A 1V74B 3IHUA 1T5OA 1YA9A 3NMIA 2W4BA 1FFHA 1OCOC 4MVRA 3K66A 2XL4A 2KQ9A 2H7BA 4XQ1A 4U5BE 2MHRA 1A7DA 4JJFA 5B1BC 3FOPA 3EH2A 3KPHA 4AE4B 1JRAA 2EIJC 2DYRC 1MNDA 3W2WA 1XZPA 4E7SA 3T9OA 4DBQA 2LFFA 3V5YA 2R7RA 5JUAA 2D4UA 4CS8C 4BEJA 1NSGB 3JRTA 4MTFA 1U6HA 3KYIA 3UMIA 2JD3A 2QUPA 1B68A 2KK1A 4FWVA 4MTOA 5KYWB 4EBJA 1WTYA 2A6HF 3TQOA 2CDQA 1VOMA 1LIHA 4PR9A 3RFYA 4AL0A 3FAJA 1NZEA 3DM9B 1RJ9A 2OEXA 2JX0A 3I5PA 3O10A 4G78A 2J8WA 1MMAA 1YJGA 2OJED 3ECSA 3JTLO 4L6RA 1KNYA 3NMJA 2Y3BA 2MYSA 2HZ8A 2P1AA 2NG1A 4MVQA 4CDVA 1J8MF 3FXHA 3M15A 4CDAA 2L6GA 3HNIA 1YARO 1WGWA 2O9XA 5GPGB 2A69F 3M4CA 5FZTA 4ER9A 4XEKA 1QQ3A 3G4XA 3LLIA 4PACA 3DZAA 5COMA 1Q0FA 1XZQA 4WJ0A 1KU2A 4I1MA 1JOGA 5T3WA 1NG1A 5L3QA 3DXJF 3M4BA 1K05A 3AG2C 1Q0GA 3LESA 2XL8A 1HE9A 2IM8A 3B71A 4LLCA 3U3BA 1FFTC 1MMDA 2QNLA 2HS5A 3CQZA 2J7PD 5DQZA 3HNJA 4EBBA 1PCXA 1M56C 2XLEA 2YL3A 3EZHA 2R7QA 4YL1A 3I5QA 1H9GA 1TFOB 2ICWG 5DS5A 3TJ5A 5B1AC 1CPQA 1VB5A 1MMGA 1FR0A 2NUPB 2Q3TA 2Y39A 1VTMP 3EGDA 4QDLA 3T6BA 4DJ9A 2H7OA 2XS1A 1Z7Qc 2J0XA 3X2QC 2Y3DA 3IQCA 3C8GA 2LCHA 5AGFA 3Q7GA 5HSWA 4G7HF 3EZIA 1L7CA 1VLTA 1F1MA 3O39A 3SXKA 4JC7A 1RJ9B 2EPOA 2AP3A 2JPUA 3LJBA 4DVYP 3DJNB 3C7JA 5JSLA 4Q4ZF 3SP1A 2J9VA 2NPUA 3N24A 1GGQA 3KKBA 3DJUB 1HW1A 3U9JA 3JZ0A 4PJLA 3SYNA 5IY5C 5BUOA 2KC3A 4Z9JA 5DS6A 1I5NA 1QPUA 4NTAA 1ZZPA 3CSKA 3DD7A 3NKEA 2XRHA 1HMOA 2YL7A 2QY9A 3JSEO 1WASA 4JTCB 4KBLA 4N4WA 2IYLD 3ZC4A 3AJMA 1NBBA 3QVZA 5JRAA 1E86A 2VH3A 3K1IA 1UG7A 1JAFA 4FESA 1QLEC 3RVYA 3MBGA 4D4XA 2XXAB 4J30B 3NYLA 3NRHA 1ZHWA 1UFBA 4FX5A 3U8PA 3ZSUA 2X51A 3NDBB 2LQGA 3U9MA 2XXAA 1OCRC 2J9UA 2EPMX 3HLZA 4U5FE 1LS4A 1C03A 2I15A 1VYKA 3L1MA 4DVZA 2WVQA 3KL4A 1A7EA 1QVXA 3BEHA 5F5HA 3RW0A 3BRJA 4FAPB 1CPRA 1TR2A 2QE9A 2KSFA 2Q4FA 4EWCA 2OU6A 1G4WR 4N6CA 1NFOA 2PF4E 4K1OA 4CDYA 3ITFA 1D1BA 4CIPA 1M57C 2HJMA 1RKEB 2G3VA 2Q9AA 4OD4A 3T6JA 4BJ6A 4YWQA 3U0CA 1KTMA 2XLDA 3AG4C 3DE8A 5A69A 1ORSC 2BL2A 5K0IA 3IQTA 4PJJA 1AVOB 4IGGA 4JZAA 4JKVA 4MVOA 3W2VA 1D0XA 4O6NA 4C3DA 3TULA 4MVSA 3GORA 4MNDA 2MWQA 1W2WA 1ZHXA 4MW8A 1OW8A 2ZXPA 2R03A 2C04A 4M63A 1FMVA 2LIGA 2OG2A 3EHMA 4JEBA 4JJGA 2V26A 2G3KA 2VC9A 2GAQA 4O79A 1ZYRF 3EH1A 3H2VA 4KC9A 5KYXB 3GM2A 4JTAB 1HW2A 2YHSA 3ZWIA 1WOLA 2YZSA 3CZ6A 3X1OA 4MVUA 4E0IA 4IRUA 2V3CC 3KH2A 1R4TA 4XTKA 3EGXB 3F46A 2YEVA 1AEPA 3E9VA 4EBKA 2EPLX 5L0IA 1OW7A 3Q7LA 2WZGA 3MX3A 4OD5A 5L0CA 1ST6A 3JCUQ 4ZLDA 4RD9A 2PX0A 3L34A 3OA1A 3Q6NA 4K0DA 2XLWA 1G8XA 3S9OA 4JCZA 4E7ZA 5JT4A 3VAYA 3SZRA 1U0BB 3QW0A 5L0JA 2R25A 3K33A 4A4AA 4F4BA 3M1CB 2A0UA 1OKKD 4ANJA 2VCBA 3EJNA 3ZDLA 4G7ZF 3G4ZA 3TK0A 1OR3A 3Q6MA 1D1AA 4C3BA 2J45A 4YN0B 4BPMA 5KYUA 2NUTB 4U5CE 2HV6A 1N1CA 3LUTB 1NLXA 1YYXA 3AG3C 1RXQA 2A0BA 1ZU5A 2ETSA 3RYLA 3EQLF 4H54A 3EPVA 1NU9C 1IW7F 4U5DE 2NUTA 2CGEA 4KNWA 1Z6AA 5T1DB 1Q0DA 1ZVZA 4JURI 2LP4A 2H7VC 1M2OA 1GS9A 3EGDB 2VB6A 4J7YA 4Q7CA 4U9EA 3AOUA 2EILC 5E3AA 2R05A 3PHF2 4O6MA 4Z9HA 3FHDA 4BJTA 3DM5A 3JYYA 2AVKA 2J0WA 4NCQA 4NC3A 1BR2A 3IEEA 2YLIA 5KYXA 3SXMA 4OIQF 1BBHA 3ZIBA 2EIKC 4YT2A 1E83A 3LNMB 2XLVA 2QTVA 2NSGA 2PNOA 2VASA 5EK0A 1Z23A 1A0BA 3H65A 3US6A 2BC5A 3VF0A 4CS7A 3EHNA 1LE4A 4PFPA 2HMZA 4P9FA 1ZHZA 2WVOA 4E0HA 1LKXA 2LK4A 5L0GA 3UR3C 4XEFA 5A6BD 4YJWA 2Y3GA 4I44A 3FAPB 3RIPA 3DI5A 1I4YA 3RKOF 3S84A 4CS9C 4PK4A 5KYUB 4OIOF 4U5HA 2XS8A 2J9WA 3GWNA 2L81A 4JVSA 4CJGA 2XSEA 3ABKC 1LE2A 2OCCC 2NSFA 2W45A 2XL6A 3VRCA 4G7OF 2A1DD 3JYHA 3B0PA 1T9KA 3GEEA 1G5ZA 1FTSA 1M2VA 2J9BA 3T6GB 4YL0A 5KYNA 2R7TA 3F47A 3TOLA 1O3UA 2HFIA 1EI7A 2OOCA 2W9YA 2XLMA 1U89A 4P6IC 2PX3A 4MVZA 1HE1A 2Z15A 3RQEA 1G4US 1O87A 4YL3A 1BR1A 2J7PA 1QZXA 4QI2A 1S7ZA 3S28A 2PBEA 2CNWA 3B29A 2UUHA 1OCZC
chains in the Genus database with same CATH topology
3MYFA 3IQTA 1BDJB 2LP4A 2LCHA 1OXKA 1YVIA 3KYIA 1C02A 3KYJA 4PACA 1TQGA 1C03A 2R25A 1Y6DA 1QSPA 3U3BA 4EUKB 2OOCA 2LD6A 1WN0A 2Q4FA 1SR2A 1I5NA 1A0BA 3US6A 4G78A 1OXBA 1FR0A 2A0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MYF A;  3IQT A;  1BDJ B;  2LP4 A;  2LCH A;  1OXK A;  1YVI A;  3KYI A;  1C02 A;  3KYJ A;  4PAC A;  1TQG A;  1C03 A;  2R25 A;  1Y6D A;  1QSP A;  3U3B A;  4EUK B;  2OOC A;  2LD6 A;  1WN0 A;  2Q4F A;  1SR2 A;  1I5N A;  1A0B A;  3US6 A;  4G78 A;  1OXB A;  1FR0 A;  2A0B A; 
#chains in the Genus database with same CATH topology
 2EPN A;  4C3E A;  3K1H A;  3UGP A;  1SF8 A;  3CAX A;  2G62 A;  1Z5Z A;  3DWW A;  3EGX A;  4YK5 A;  1APC A;  2DYS C;  3ASN C;  1BDJ B;  2B0H A;  3C62 A;  4LDQ A;  1IZM A;  1PV3 A;  1ZU4 A;  2CCY A;  1O5H A;  1OXK A;  2J46 A;  3O55 A;  1C02 A;  4IAR A;  3LAY A;  1LPE A;  4MW3 A;  2WVN A;  3HTK C;  3EG9 A;  5L0F A;  2R7X A;  1LVK A;  1WAT A;  2P6V A;  1ZHY A;  3SNH A;  5D91 A;  2EIN C;  2Y3H A;  4DOZ A;  5DVW A;  4XLP F;  1BR4 A;  2YRF A;  4XPY A;  4JW1 A;  5COF A;  3DMD A;  4J7T A;  4LAC B;  4DBR A;  3LS0 A;  1BZ4 A;  5COG A;  3RH3 A;  3UMK A;  5EHH A;  2LFD A;  1Z63 A;  5JP7 A;  1CGN A;  1OXB A;  3AQC A;  3C18 A;  4XPW A;  2HJ3 A;  2M64 A;  2CNW D;  3MYF A;  1LI7 A;  3QVY A;  4LLE A;  2IXP A;  4EKW A;  1T6U A;  5F28 E;  1DOV A;  1QKR A;  3AGT A;  5EGY A;  4CSA C;  1SMY F;  2KW3 C;  4MQ9 F;  3PDM P;  2IXO A;  2XM0 A;  2Q00 A;  2R7U A;  1D1C A;  2OQM A;  4XWJ A;  2E87 A;  3DE9 A;  1D0Z A;  4AE4 A;  1TWH A;  4D4N A;  2YL0 A;  1E84 A;  2ZXR A;  4WGZ A;  4Q5S F;  3MFN A;  1EA8 A;  2A68 F;  5L0D A;  1K40 A;  1OW6 A;  3RF3 A;  4CS8 A;  1TWC A;  5KYW A;  1H7I A;  1YZA A;  4BEM J;  2IXN A;  3W8I A;  4HE8 D;  3NKD A;  2BE5 F;  2R7O A;  2OEV A;  3ZG1 A;  3RQG A;  4DXW A;  5TJ5 E;  4IJJ A;  1CGO A;  2HMQ A;  1GQA A;  1V54 C;  3K7D A;  4JRZ A;  4KNV A;  2IBF A;  2ZD9 A;  4IB4 A;  4BJ5 A;  1LS1 A;  2Q9C A;  2YWA A;  1OKK A;  1AUE A;  4NTF A;  2P7V A;  256B A;  4PJM A;  4KI2 A;  1JPJ A;  1Y4C A;  3GM3 A;  1Q0K A;  4XEV A;  4E18 A;  2C03 A;  2KNH A;  2Q9B A;  5A6K A;  3EFO B;  3NYJ A;  4K7B A;  2DB4 A;  3FMS A;  4NY3 A;  3R7C A;  2GFH A;  4YT5 A;  1QSP A;  3JSZ A;  5DLJ A;  5BQI A;  3H2U A;  1JPN A;  1OR2 A;  2HSB A;  3A11 A;  3TJ6 A;  4R32 A;  1E85 A;  3EFO A;  3NMK A;  1XWJ A;  2HSQ A;  3JT1 A;  4YT4 A;  3WAQ A;  3IQ6 A;  2H8A A;  3QTH A;  4Z9I A;  4IWB A;  4OIN F;  3DAF A;  5A6J A;  2YQY A;  5A6A A;  5JLI A;  5JVE A;  2TMV P;  2ASR A;  1VK5 A;  3C8Z A;  4O6Y A;  3N2Z B;  1FNT c;  4ZLC A;  3K6B A;  2FAP B;  2R9R B;  4CJO A;  5T3T A;  1ZW3 A;  3POV A;  2WZF A;  4DRI B;  4CBE A;  3ABL C;  2YL1 A;  4ONS A;  2NUP A;  1LI5 A;  4BJ5 C;  3CEX A;  3L0I A;  1MQV A;  3GWL A;  3GEI A;  1MNE A;  2OKU A;  3SXZ A;  4BG0 A;  5KYY A;  3C63 A;  4IAO A;  2AU5 A;  4JIO A;  3UMH A;  2FGY A;  3PCV A;  1YVI A;  3A9C A;  2FFH A;  3LNR A;  3V5Z A;  3I4U A;  5KYY B;  3G50 A;  4UDV A;  3ABM C;  2XLO A;  1TWG A;  1OQC A;  3S0X A;  5BQH A;  1SYQ A;  3ZTZ A;  4U5E E;  4LDK A;  3ZQY A;  2XM4 A;  1YYJ A;  1T6Q A;  1EKY A;  3V5X A;  1WN0 A;  3SEO A;  2ZPA A;  4I3M A;  4GQH A;  3OWT A;  5A6B A;  2EPK X;  5E2Q A;  4XLN F;  3AG1 C;  1Z3I X;  2DGJ A;  4H4K C;  1GM5 A;  2ZXO A;  4EIY A;  3GM1 A;  2GA0 A;  2CYD A;  3ASO C;  3GOD A;  1J8Y F;  1YA7 O;  3IQ5 A;  1DOW A;  5E3C A;  4AX2 A;  1CGM E;  3HJC A;  4NTB A;  3ZTM A;  3FDQ A;  4JEA A;  2HKV A;  2Y69 C;  5E33 A;  1NFN A;  3LLK A;  4HEA J;  4O7G A;  4WGY A;  4C7O B;  1ORY A;  2UUI A;  1D0Y A;  3QW1 A;  4P9T A;  1C17 M;  1YDI A;  4I1O B;  4A2N B;  3S90 A;  3S27 A;  4DRJ B;  3WG7 C;  1S05 A;  1Y6D A;  2AWY A;  1T6I A;  1FAP B;  2PP4 A;  3QMK A;  2B0J A;  3V7O A;  4YT8 A;  3EG9 B;  2QLA A;  3E70 C;  2R7W A;  5CIV A;  4W8P A;  3DKA A;  2L6H A;  1SR2 A;  3WHN A;  3U2M A;  4OIR F;  1MMN A;  4XPX A;  1ORJ A;  1H6G A;  3PMR A;  3NG1 A;  3QZC A;  2L9J A;  4HFF B;  4IAQ A;  2WB7 A;  3UGO A;  5CI9 A;  2YVK A;  3M79 A;  5HV9 A;  3FOO A;  2IXM A;  1TKN A;  1VYI A;  3U8V A;  5DS4 A;  1YAU O;  4BJ1 A;  3KYJ A;  4J32 B;  4PFO A;  4MS2 A;  5D92 A;  3K1I C;  4EHP A;  1WWP A;  3T4R A;  2RD9 A;  1M2V B;  5DQT A;  3FVY A;  2Q7R A;  4E17 A;  3SXY A;  3NYM A;  3HKK A;  3AGU A;  3RVZ A;  4N06 A;  3MYI A;  1YZC A;  2WL8 A;  4GEH A;  2XLH A;  4JE9 A;  4EUK B;  1HMD A;  2IOQ A;  2YLG A;  3IPM O;  4GYT A;  2A6E F;  1RCP A;  4WAB A;  5F5F A;  1OCC C;  2KJG A;  2EIM C;  3DAG A;  5BQG A;  3U5S A;  3LEO A;  3WOD F;  5B3I A;  2GWW A;  4N6H A;  4U5G A;  2HV7 A;  3N0T A;  4AK9 A;  2RSE B;  5AC4 A;  3W8H A;  2ZXW C;  1M6T A;  3C8G B;  4CX9 A;  5AC5 A;  2L6F A;  1PD0 A;  4MTG A;  1V4A A;  2GDC A;  1Q0M A;  2W4M A;  4ULV A;  3W4Y A;  1RKC A;  5CI8 A;  1L3P A;  3LS1 A;  4W8K A;  2L7A A;  3L8J A;  1HY5 A;  1V55 C;  3GAN A;  4JTD B;  2YLD A;  3TOM A;  5B3S C;  4RBN A;  3TD7 A;  2I8B A;  3J06 A;  4PJN A;  1E2X A;  1I4Z A;  1YLM A;  3R2P A;  3B9Q A;  3B0U X;  5JS5 A;  5L0H A;  4QI0 A;  1ZHT A;  3KMI A;  1ZW2 A;  1H9T A;  4MVM A;  2P61 A;  3ZQV A;  2P0N A;  2VCA A;  1VMA A;  2LD6 A;  1A7V A;  3OEO A;  3GEH A;  3JRM O;  2CW0 F;  4B6I A;  1TFK B;  4CIH A;  5L3V A;  1VLS A;  3U3F A;  1TWA A;  4CSA A;  2LSE A;  1PD1 A;  2KGO A;  1JMW A;  1JR8 A;  2PFD A;  2M4E A;  2R02 A;  3O6X A;  4LER A;  4X0R A;  3HNL A;  3LEV A;  4HFK B;  3VM6 A;  3ZVR A;  1RMV A;  2YKZ A;  1A41 A;  2DI3 A;  4LDR A;  3B0V C;  2R7V A;  2X0C A;  4CS9 A;  3AQB A;  4JCH A;  3VYW A;  1NU7 D;  1T01 A;  4OIP F;  1RKE A;  4NQF A;  1TQG A;  3UNG C;  2AWC A;  2VCC A;  3HNK A;  2R7S A;  1K04 A;  3RQF A;  4BJ6 C;  4DRH B;  2OJQ A;  4U9D A;  2F22 A;  1SZI A;  2KYH A;  4RDA A;  1FMW A;  1LM3 B;  4G0H A;  3U2L A;  4AL1 A;  4C7O A;  3C8G D;  3S29 A;  3ATP A;  2WZL A;  5FCL A;  1R5I D;  2D5R B;  2HUJ A;  3L8I A;  3MLG A;  4ULW A;  1EQ1 A;  1V74 B;  3IHU A;  1T5O A;  1YA9 A;  3NMI A;  2W4B A;  1FFH A;  1OCO C;  4MVR A;  3K66 A;  2XL4 A;  2KQ9 A;  2H7B A;  4XQ1 A;  4U5B E;  2MHR A;  1A7D A;  4JJF A;  5B1B C;  3FOP A;  3EH2 A;  3KPH A;  4AE4 B;  1JRA A;  2EIJ C;  2DYR C;  1MND A;  3W2W A;  1XZP A;  4E7S A;  3T9O A;  4DBQ A;  2LFF A;  3V5Y A;  2R7R A;  5JUA A;  2D4U A;  4CS8 C;  4BEJ A;  1NSG B;  3JRT A;  4MTF A;  1U6H A;  3KYI A;  3UMI A;  2JD3 A;  2QUP A;  1B68 A;  2KK1 A;  4FWV A;  4MTO A;  5KYW B;  4EBJ A;  1WTY A;  2A6H F;  3TQO A;  2CDQ A;  1VOM A;  1LIH A;  4PR9 A;  3RFY A;  4AL0 A;  3FAJ A;  1NZE A;  3DM9 B;  1RJ9 A;  2OEX A;  2JX0 A;  3I5P A;  3O10 A;  4G78 A;  2J8W A;  1MMA A;  1YJG A;  2OJE D;  3ECS A;  3JTL O;  4L6R A;  1KNY A;  3NMJ A;  2Y3B A;  2MYS A;  2HZ8 A;  2P1A A;  2NG1 A;  4MVQ A;  4CDV A;  1J8M F;  3FXH A;  3M15 A;  4CDA A;  2L6G A;  3HNI A;  1YAR O;  1WGW A;  2O9X A;  5GPG B;  2A69 F;  3M4C A;  5FZT A;  4ER9 A;  4XEK A;  1QQ3 A;  3G4X A;  3LLI A;  4PAC A;  3DZA A;  5COM A;  1Q0F A;  1XZQ A;  4WJ0 A;  1KU2 A;  4I1M A;  1JOG A;  5T3W A;  1NG1 A;  5L3Q A;  3DXJ F;  3M4B A;  1K05 A;  3AG2 C;  1Q0G A;  3LES A;  2XL8 A;  1HE9 A;  2IM8 A;  3B71 A;  4LLC A;  3U3B A;  1FFT C;  1MMD A;  2QNL A;  2HS5 A;  3CQZ A;  2J7P D;  5DQZ A;  3HNJ A;  4EBB A;  1PCX A;  1M56 C;  2XLE A;  2YL3 A;  3EZH A;  2R7Q A;  4YL1 A;  3I5Q A;  1H9G A;  1TFO B;  2ICW G;  5DS5 A;  3TJ5 A;  5B1A C;  1CPQ A;  1VB5 A;  1MMG A;  1FR0 A;  2NUP B;  2Q3T A;  2Y39 A;  1VTM P;  3EGD A;  4QDL A;  3T6B A;  4DJ9 A;  2H7O A;  2XS1 A;  1Z7Q c;  2J0X A;  3X2Q C;  2Y3D A;  3IQC A;  3C8G A;  2LCH A;  5AGF A;  3Q7G A;  5HSW A;  4G7H F;  3EZI A;  1L7C A;  1VLT A;  1F1M A;  3O39 A;  3SXK A;  4JC7 A;  1RJ9 B;  2EPO A;  2AP3 A;  2JPU A;  3LJB A;  4DVY P;  3DJN B;  3C7J A;  5JSL A;  4Q4Z F;  3SP1 A;  2J9V A;  2NPU A;  3N24 A;  1GGQ A;  3KKB A;  3DJU B;  1HW1 A;  3U9J A;  3JZ0 A;  4PJL A;  3SYN A;  5IY5 C;  5BUO A;  2KC3 A;  4Z9J A;  5DS6 A;  1I5N A;  1QPU A;  4NTA A;  1ZZP A;  3CSK A;  3DD7 A;  3NKE A;  2XRH A;  1HMO A;  2YL7 A;  2QY9 A;  3JSE O;  1WAS A;  4JTC B;  4KBL A;  4N4W A;  2IYL D;  3ZC4 A;  3AJM A;  1NBB A;  3QVZ A;  5JRA A;  1E86 A;  2VH3 A;  3K1I A;  1UG7 A;  1JAF A;  4FES A;  1QLE C;  3RVY A;  3MBG A;  4D4X A;  2XXA B;  4J30 B;  3NYL A;  3NRH A;  1ZHW A;  1UFB A;  4FX5 A;  3U8P A;  3ZSU A;  2X51 A;  3NDB B;  2LQG A;  3U9M A;  2XXA A;  1OCR C;  2J9U A;  2EPM X;  3HLZ A;  4U5F E;  1LS4 A;  1C03 A;  2I15 A;  1VYK A;  3L1M A;  4DVZ A;  2WVQ A;  3KL4 A;  1A7E A;  1QVX A;  3BEH A;  5F5H A;  3RW0 A;  3BRJ A;  4FAP B;  1CPR A;  1TR2 A;  2QE9 A;  2KSF A;  2Q4F A;  4EWC A;  2OU6 A;  1G4W R;  4N6C A;  1NFO A;  2PF4 E;  4K1O A;  4CDY A;  3ITF A;  1D1B A;  4CIP A;  1M57 C;  2HJM A;  1RKE B;  2G3V A;  2Q9A A;  4OD4 A;  3T6J A;  4BJ6 A;  4YWQ A;  3U0C A;  1KTM A;  2XLD A;  3AG4 C;  3DE8 A;  5A69 A;  1ORS C;  2BL2 A;  5K0I A;  3IQT A;  4PJJ A;  1AVO B;  4IGG A;  4JZA A;  4JKV A;  4MVO A;  3W2V A;  1D0X A;  4O6N A;  4C3D A;  3TUL A;  4MVS A;  3GOR A;  4MND A;  2MWQ A;  1W2W A;  1ZHX A;  4MW8 A;  1OW8 A;  2ZXP A;  2R03 A;  2C04 A;  4M63 A;  1FMV A;  2LIG A;  2OG2 A;  3EHM A;  4JEB A;  4JJG A;  2V26 A;  2G3K A;  2VC9 A;  2GAQ A;  4O79 A;  1ZYR F;  3EH1 A;  3H2V A;  4KC9 A;  5KYX B;  3GM2 A;  4JTA B;  1HW2 A;  2YHS A;  3ZWI A;  1WOL A;  2YZS A;  3CZ6 A;  3X1O A;  4MVU A;  4E0I A;  4IRU A;  2V3C C;  3KH2 A;  1R4T A;  4XTK A;  3EGX B;  3F46 A;  2YEV A;  1AEP A;  3E9V A;  4EBK A;  2EPL X;  5L0I A;  1OW7 A;  3Q7L A;  2WZG A;  3MX3 A;  4OD5 A;  5L0C A;  1ST6 A;  3JCU Q;  4ZLD A;  4RD9 A;  2PX0 A;  3L34 A;  3OA1 A;  3Q6N A;  4K0D A;  2XLW A;  1G8X A;  3S9O A;  4JCZ A;  4E7Z A;  5JT4 A;  3VAY A;  3SZR A;  1U0B B;  3QW0 A;  5L0J A;  2R25 A;  3K33 A;  4A4A A;  4F4B A;  3M1C B;  2A0U A;  1OKK D;  4ANJ A;  2VCB A;  3EJN A;  3ZDL A;  4G7Z F;  3G4Z A;  3TK0 A;  1OR3 A;  3Q6M A;  1D1A A;  4C3B A;  2J45 A;  4YN0 B;  4BPM A;  5KYU A;  2NUT B;  4U5C E;  2HV6 A;  1N1C A;  3LUT B;  1NLX A;  1YYX A;  3AG3 C;  1RXQ A;  2A0B A;  1ZU5 A;  2ETS A;  3RYL A;  3EQL F;  4H54 A;  3EPV A;  1NU9 C;  1IW7 F;  4U5D E;  2NUT A;  2CGE A;  4KNW A;  1Z6A A;  5T1D B;  1Q0D A;  1ZVZ A;  4JUR I;  2LP4 A;  2H7V C;  1M2O A;  1GS9 A;  3EGD B;  2VB6 A;  4J7Y A;  4Q7C A;  4U9E A;  3AOU A;  2EIL C;  5E3A A;  2R05 A;  3PHF 2;  4O6M A;  4Z9H A;  3FHD A;  4BJT A;  3DM5 A;  3JYY A;  2AVK A;  2J0W A;  4NCQ A;  4NC3 A;  1BR2 A;  3IEE A;  2YLI A;  5KYX A;  3SXM A;  4OIQ F;  1BBH A;  3ZIB A;  2EIK C;  4YT2 A;  1E83 A;  3LNM B;  2XLV A;  2QTV A;  2NSG A;  2PNO A;  2VAS A;  5EK0 A;  1Z23 A;  1A0B A;  3H65 A;  3US6 A;  2BC5 A;  3VF0 A;  4CS7 A;  3EHN A;  1LE4 A;  4PFP A;  2HMZ A;  4P9F A;  1ZHZ A;  2WVO A;  4E0H A;  1LKX A;  2LK4 A;  5L0G A;  3UR3 C;  4XEF A;  5A6B D;  4YJW A;  2Y3G A;  4I44 A;  3FAP B;  3RIP A;  3DI5 A;  1I4Y A;  3RKO F;  3S84 A;  4CS9 C;  4PK4 A;  5KYU B;  4OIO F;  4U5H A;  2XS8 A;  2J9W A;  3GWN A;  2L81 A;  4JVS A;  4CJG A;  2XSE A;  3ABK C;  1LE2 A;  2OCC C;  2NSF A;  2W45 A;  2XL6 A;  3VRC A;  4G7O F;  2A1D D;  3JYH A;  3B0P A;  1T9K A;  3GEE A;  1G5Z A;  1FTS A;  1M2V A;  2J9B A;  3T6G B;  4YL0 A;  5KYN A;  2R7T A;  3F47 A;  3TOL A;  1O3U A;  2HFI A;  1EI7 A;  2OOC A;  2W9Y A;  2XLM A;  1U89 A;  4P6I C;  2PX3 A;  4MVZ A;  1HE1 A;  2Z15 A;  3RQE A;  1G4U S;  1O87 A;  4YL3 A;  1BR1 A;  2J7P A;  1QZX A;  4QI2 A;  1S7Z A;  3S28 A;  2PBE A;  2CNW A;  3B29 A;  2UUH A;  1OCZ C; 
#chains in the Genus database with same CATH homology
 3MYF A;  3IQT A;  1BDJ B;  2LP4 A;  2LCH A;  1OXK A;  1YVI A;  3KYI A;  1C02 A;  3KYJ A;  4PAC A;  1TQG A;  1C03 A;  2R25 A;  1Y6D A;  1QSP A;  3U3B A;  4EUK B;  2OOC A;  2LD6 A;  1WN0 A;  2Q4F A;  1SR2 A;  1I5N A;  1A0B A;  3US6 A;  4G78 A;  1OXB A;  1FR0 A;  2A0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...