2OOCA

Crystal structure of histidine phosphotransferase shpa (np_419930.1) from caulobacter crescentus at 1.52 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
104
structure length
104
Chain Sequence
GAVDFAYLEGFAAGDFAVVDEVLALFREQAALWAPMLDPTHPGWKDAVHTVKGAARGVGAFNLGEVCERCEAGQESLEGVRTALDAALLDIAAYAHEQALRSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine phosphotransferase
publication title Crystal structure of histidine phosphotransfer protein ShpA, an essential regulator of stalk biogenesis in Caulobacter crescentus.
pubmed doi rcsb
source organism Caulobacter crescentus
molecule tags Transferase
total genus 44
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature ec 2.7.3.-:
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 2oocA00
4G78A 1QSPA 1A0BA 1C03A 1WN0A 3KYJA 1YVIA 1OXKA 3IQTA 1Y6DA 2LCHA 1FR0A 2A0BA 2R25A 2LP4A 4EUKB 1SR2A 2LD6A 2OOCA 3MYFA 3KYIA 1TQGA 1BDJB 1I5NA 1OXBA 2Q4FA 3U3BA 1C02A 3US6A 4PACA
chains in the Genus database with same CATH superfamily
1MMNA 5DQTA 4H54A 5B3SC 1JPNA 2OG2A 4YT4A 3AQBA 1OCCC 1O3UA 1S7ZA 2XLHA 5KYUB 1RMVA 1Z23A 1OKKD 2HUJA 2JPUA 1RJ9B 1TR2A 1B68A 3K66A 3SZRA 1HW2A 3IQTA 2A68F 2EPMX 3CAXA 4H4KC 4U9DA 4DBRA 3S28A 3QVZA 2W45A 1LM3B 3M79A 4C7OA 2R7TA 1JOGA 1NSGB 2Y3BA 1GS9A 1QVXA 1UFBA 2PFDA 4XLNF 1D1CA 1XZQA 4EIYA 3EGDB 3DAGA 2ZXWC 3RVZA 5KYWA 2P61A 4CJOA 3C63A 1BDJB 3IPMO 2MWQA 2YL3A 5GPGB 3DI5A 3US6A 3EFOB 2XRHA 4NY3A 2L6HA 2P1AA 2YL1A 4JE9A 1FNTc 1QSPA 3PHF2 4LACB 1A0BA 2O9XA 4ULVA 4CSAA 1DOVA 4YWQA 2IXMA 2HJ3A 3I5PA 4O6MA 3GWLA 2L6FA 1I4ZA 5B3IA 1V4AA 2YLDA 3VRCA 4CIHA 1AUEA 1LPEA 3EGXB 4XLPF 4PK4A 4QI2A 1OW6A 2EPNA 1VOMA 3NKDA 3WODF 2R7OA 1H7IA 3JSEO 2G3VA 3EH1A 3L8IA 4XEVA 4ANJA 3LS0A 4MW8A 5JS5A 2J9UA 4P9TA 5F28E 2J45A 2PX3A 3T6JA 4YK5A 3ZQVA 1JPJA 3K33A 5CI8A 1IW7F 1FTSA 1H9TA 2KYHA 2XLOA 3OA1A 1NFNA 3NDBB 2L6GA 3DWWA 2R02A 3SXZA 3UR3C 2ZXRA 4E0HA 5AC4A 3AGUA 2L9JA 4O79A 3SNHA 4E0IA 2OKUA 1G4WR 3EHMA 2DYRC 5T1DB 4C3DA 2HV7A 5T3WA 1C03A 1OCOC 2IBFA 3I4UA 3LAYA 4YT5A 3T6BA 2QUPA 3O10A 4EHPA 5L0DA 1JAFA 2KJGA 5DVWA 3TK0A 2D5RB 1ORYA 2LIGA 4JIOA 4C3BA 3DD7A 3EGDA 3IEEA 3DM5A 2R7WA 1D0YA 3U3FA 4AL0A 3SP1A 1G8XA 5E33A 4JCZA 2XS8A 2YLGA 3JTLO 1U0BB 3EFOA 2RD9A 3FOOA 3K1IC 5EK0A 4DRHB 4CSAC 2R7XA 3U9MA 4XEFA 3SYNA 1C17M 2EIKC 1A7EA 4GQHA 3NYLA 4E17A 1K05A 3PMRA 1TFKB 4PJJA 4PJMA 1HE9A 1T9KA 3Q6NA 3NRHA 2JD3A 1O5HA 2GA0A 1TWAA 2V26A 1NU9C 2H7OA 3EGXA 2YWAA 3IQ6A 3MBGA 3NG1A 4FAPB 1EKYA 3SXYA 3UGPA 2Z15A 5KYXB 4IB4A 1Y6DA 3WAQA 3POVA 1BR2A 4E7ZA 4PJNA 4C3EA 4D4NA 4OINF 1LI7A 1DOWA 4JTCB 3Q6MA 1GQAA 4LDRA 2X51A 3NYMA 1M2OA 1UG7A 2OOCA 3MX3A 2C04A 2UUIA 1CGNA 2EIMC 3AJMA 1VYIA 3G4ZA 5E2QA 5K0IA 1YA9A 2WZGA 3J06A 3G4XA 4MTGA 3FAJA 2EILC 3X1OA 2QY9A 3IQCA 2KNHA 3E9VA 4PJLA 2YEVA 4LERA 1M6TA 2CNWA 4G78A 1M56C 2XS1A 2CYDA 1FMWA 2YZSA 4W8PA 4XPYA 3UNGC 4W8KA 2LSEA 2OQMA 4G7ZF 1H9GA 1TWGA 1J8YF 1ORJA 1NG1A 4LDQA 1ZU5A 4CS7A 2XL6A 3U5SA 4MVOA 4M63A 2IM8A 1M2VB 3PCVA 4IRUA 2HKVA 4BJ6A 1FAPB 2NPUA 5A6BD 2VASA 4KBLA 3JSZA 4CS9C 4N6CA 2GFHA 5BQGA 3HKKA 3HLZA 2WVOA 2PNOA 2XLMA 3FMSA 2LD6A 4XWJA 1JR8A 1EQ1A 1A7DA 3ECSA 5L0FA 2GWWA 3QTHA 3QVYA 3GODA 3RH3A 4BPMA 2WZLA 1K40A 1Q0DA 3A11A 4IGGA 1NZEA 3ZG1A 5COMA 3EZHA 4DXWA 2J0WA 3M1CB 4EKWA 4E7SA 5KYYB 1MMGA 2R03A 1VYKA 1A7VA 3RW0A 1CPRA 2YKZA 1NLXA 4IAQA 5KYXA 1TFOB 4ULWA 1ZYRF 5DS4A 3S84A 2J7PA 1E84A 3LS1A 3RQGA 2A69F 3QW1A 2D4UA 4Z9HA 3BRJA 2LP4A 5L3VA 4G0HA 1Y4CA 3CSKA 4J7YA 2GDCA 2YLIA 2FFHA 4JKVA 3RFYA 3TJ5A 4GYTA 1QPUA 3ZWIA 2XL4A 2Q9CA 2LFFA 3L34A 3DE8A 4MTFA 2LK4A 3EHNA 1E83A 2DB4A 2HSBA 3EPVA 4YJWA 2CNWD 3AQCA 3LUTB 3V5YA 3EG9B 4YT8A 1Q0MA 3JT1A 1ST6A 4PACA 3C8GB 4I3MA 1NFOA 1U6HA 4KNWA 1L3PA 4E18A 4BJ6C 4EBBA 2CGEA 3W4YA 2H7VC 1M2VA 3K1IA 3ZQYA 4U5HA 3DJNB 3L1MA 4MVSA 5L0CA 3F47A 1LE2A 1T6QA 3FXHA 4RD9A 2R7VA 3NMIA 4JJFA 3FOPA 2A0BA 3DXJF 4MVZA 2L7AA 4JZAA 4DVZA 3ZTZA 2HFIA 2I8BA 3CEXA 4EUKB 1WTYA 2P7VA 1SR2A 2J8WA 1ZU4A 3S29A 3B0VC 5JRAA 2MHRA 3HNLA 4JC7A 2W4BA 4LLEA 5A6AA 3R2PA 4OIOF 4X0RA 1YDIA 2DI3A 3ASOC 4U5GA 5KYYA 1YZCA 4PFOA 1OQCA 3SXKA 3AG3C 3U3BA 3RQEA 3MFNA 4P6IC 1D0ZA 2NSGA 2VB6A 2ZXOA 1F1MA 3AG2C 5KYUA 256BA 3L8JA 3RYLA 4BEMJ 4N06A 2L81A 2HJMA 3U0CA 1RJ9A 2Y3DA 3HNIA 3M15A 1OW7A 2CDQA 5EGYA 3KPHA 3TOLA 1WOLA 3ABMC 4CDAA 2YQYA 2BL2A 4D4XA 4IAOA 2DGJA 2OU6A 4I1OB 3UGOA 2LCHA 5A6KA 4DRIB 3WHNA 3B29A 3NMJA 3M4CA 4JJGA 2R7UA 4PFPA 4JW1A 5DS5A 1ZHYA 2NG1A 1SF8A 4HFFB 1ZHTA 4LLCA 5TJ5E 3RF3A 5FZTA 4RDAA 5EHHA 2EPOA 1VTMP 2P0NA 2P6VA 1RKEB 3EJNA 2DYSC 5CIVA 2R7SA 2PF4E 1APCA 3QZCA 3GM3A 4JTDB 4CS9A 3C8GA 3N24A 1OXBA 2XL8A 4NQFA 5A6JA 2F22A 4BG0A 1MNEA 4G7OF 2NUTB 1Q0FA 2Y39A 2R7QA 3NKEA 1VMAA 4Z9IA 1KNYA 3HJCA 4U5DE 2R9RB 1XWJA 1ORSC 5KYNA 3H2UA 4JRZA 2EPLX 1GM5A 3T4RA 4CBEA 3ABKC 2PX0A 3GEEA 4BJ5C 2PBEA 1JRAA 3JZ0A 3KYJA 4JEAA 2XSEA 3G50A 2HMZA 1YARO 3C18A 3O39A 2IYLD 3I5QA 4EBJA 3C8ZA 4YT2A 1AEPA 4CDVA 1MQVA 1T6UA 4BEJA 1V55C 3MYFA 4J30B 4XPWA 2C03A 3KKBA 3HNJA 1ZW2A 1K04A 1XZPA 3EZIA 1I5NA 2J9WA 2VC9A 4OD5A 2A6EF 4IJJA 3UMKA 3DMDA 2NUPB 1FMVA 5IY5C 3U8PA 1EA8A 2Y3GA 2FAPB 3IHUA 2R05A 2WVNA 4K7BA 4P9FA 2HMQA 4ZLDA 2VCCA 3DJUB 2A1DD 4FWVA 4ONSA 1E2XA 3FVYA 3HTKC 1YVIA 4RBNA 1OXKA 3A9CA 2EINC 4XEKA 3W2VA 4AK9A 1OKKA 1FR0A 4IARA 1VLTA 4EWCA 3NMKA 3U8VA 2Q3TA 4MVUA 4N4WA 1RKEA 2BC5A 2KSFA 1QKRA 1CPQA 4KC9A 1Q0GA 3RIPA 3JCUQ 5L0JA 4JTAB 2IOQA 4G7HF 3LESA 3NYJA 1TKNA 3FHDA 4N6HA 2J9BA 3LJBA 1CGOA 2J0XA 2Y69C 2AWCA 4JVSA 2NUTA 1HE1A 4Q4ZF 3OEOA 4YL3A 4O6NA 5COFA 2B0JA 3QMKA 1WWPA 3OWTA 4MVQA 2WB7A 1OCZC 4J7TA 4QDLA 3TOMA 5JLIA 1YJGA 2FGYA 4AE4B 1HMDA 1D1BA 3F46A 3B0PA 3ATPA 2MYSA 3AG4C 1HY5A 4AL1A 3O6XA 2ICWG 3V5ZA 1E85A 4JCHA 4NCQA 2ASRA 2VCAA 4MTOA 3C7JA 2BE5F 1VB5A 4A4AA 3LNRA 3S0XA 2WL8A 2WZFA 1WGWA 4U5CE 3C62A 2ZD9A 1RCPA 3KMIA 3O55A 2IXNA 3ABLC 4B6IA 1G4US 1TQGA 1BBHA 3GWNA 3T6GB 3UMIA 2TMVP 2NUPA 2QE9A 4UDVA 1MNDA 2XM0A 2UUHA 1NBBA 4F4BA 2YL0A 3K6BA 5F5HA 2X0CA 1W2WA 4CS8A 2A0UA 3B9QA 2ZXPA 1Z5ZA 4EBKA 2XXAB 1Z6AA 2HS5A 2W9YA 4BJ1A 1OW8A 3DZAA 3KH2A 3TQOA 4KI2A 5JSLA 3IQ5A 1T6IA 1ZHXA 1U89A 3LEOA 2R7RA 3E70C 1PD1A 1LVKA 2YVKA 2Q9AA 1BR4A 1YYXA 5DQZA 1LKXA 2LFDA 4AX2A 3CQZA 1VLSA 2E87A 2J46A 4I1MA 4BJ5A 1WATA 1SZIA 4OIPF 3DE9A 3ZTMA 1PCXA 3U2LA 4WABA 4Q5SF 2KW3C 2HZ8A 4YL0A 3S90A 3ASNC 1T01A 3HNKA 1LS4A 3U2MA 1E86A 1AVOB 4OIQF 2EIJC 5HSWA 4HE8D 3TJ6A 4AE4A 2IXPA 4DOZA 5JVEA 2CW0F 5AC5A 1LI5A 2M4EA 3LLKA 4HEAJ 4R32A 4WGZA 5BQIA 1KU2A 4NC3A 4PR9A 5L0HA 2J7PD 5DLJA 3MYIA 2CCYA 3W2WA 3ZIBA 3B0UX 2I15A 4NTFA 3V7OA 1YZAA 3Q7GA 2B0HA 1IZMA 1MMAA 5B1AC 3WG7C 5JUAA 2GAQA 1Z7Qc 2ZPAA 4K0DA 4U9EA 3DM9B 4FX5A 5L0IA 1R4TA 4I44A 1SYQA 1I4YA 4GEHA 4Z9JA 5JT4A 4LDKA 3PDMP 4CX9A 1BR1A 5COGA 4CS8C 1YAUO 5L0GA 4NTBA 2LQGA 3EG9A 1QZXA 2OCCC 4OD4A 3UMHA 1PD0A 1RXQA 4Q7CA 4J32B 3W8HA 1ZHZA 3K7DA 5A69A 1EI7A 4MNDA 2PP4A 3DKAA 1OCRC 1H6GA 2J9VA 2Y3HA 4XPXA 1R5ID 3SEOA 4WGYA 5L3QA 1YA7O 4XTKA 4DRJB 2XLVA 3AG1C 3ZVRA 2VH3A 2XLEA 3U9JA 5E3AA 5CI9A 3QW0A 2AVKA 4DVYP 4WJ0A 3RKOF 2EPKX 2Q9BA 1NU7D 5B1BC 4DBQA 3JYYA 3VAYA 3DAFA 2KK1A 1HW1A 3JYHA 3T9OA 1D1AA 1TWCA 1V74B 1JMWA 3LLIA 5A6BA 5HV9A 2XM4A 2M64A 4U5FE 3LEVA 3GEHA 1GGQA 1CGME 3EQLF 5DS6A 3ZC4A 2V3CC 2OJED 3Q7LA 3VF0A 2HV6A 5BQHA 1FFTC 5BUOA 1Z3IX 1O87A 3V5XA 1C02A 5F5FA 2OEVA 4O7GA 1QLEC 3GM2A 3FAPB 2QNLA 3GEIA 1ZZPA 4KNVA 4QI0A 5AGFA 1S05A 2XLWA 2ETSA 3ZDLA 1N1CA 1ZVZA 1WASA 2XLDA 2VCBA 1PV3A 3CZ6A 3RVYA 2A6HF 3M4BA 2JX0A 1OR3A 3BEHA 3LNMB 2XXAA 2KC3A 1LE4A 1LIHA 2R25A 2QTVA 5D92A 4HFKB 3N2ZB 2AP3A 3GM1A 4O6YA 5T3TA 3N0TA 1YYJA 3VM6A 3JRTA 2W4MA 4JURI 4C7OB 3AOUA 1G5ZA 3C8GD 1RKCA 1M57C 4MQ9F 3S9OA 1A41A 3AGTA 4YN0B 1BZ4A 3RQFA 2IXOA 3SXMA 1TWHA 2Q4FA 5D91A 1ZW3A 2H8AA 4CJGA 5KYWB 1VK5A 3ZSUA 4DJ9A 1L7CA 1MMDA 1OR2A 1SMYF 2AU5A 2NSFA 2OJQA 2WVQA 3KL4A 2Q7RA 3MLGA 4BJTA 3GORA 2KGOA 2G3KA 3FDQA 1FFHA 1WN0A 1Z63A 1KTMA 1ZHWA 4FESA 4MVRA 4YL1A 4A2NB 1J8MF 2HSQA 5E3CA 5JP7A 2G62A 2OEXA 3W8IA 1HMOA 3X2QC 2QLAA 4XQ1A 3S27A 4JEBA 3L0IA 1Q0KA 4ER9A 4L6RA 2RSEB 3TD7A 1T5OA 3K1HA 3H2VA 3ITFA 4NTAA 2H7BA 4U5BE 4CDYA 3KYIA 2YHSA 4K1OA 3B71A 3H65A 3JRMO 3VYWA 2YRFA 2Q00A 2KQ9A 4OIRF 2YL7A 4U5EE 3TULA 1YLMA 4MVMA 3R7CA 4CIPA 4ZLCA 1LS1A 5FCLA 1D0XA 2AWYA 4MW3A 3EH2A 4IWBA 3GANA 1V54C 1QQ3A 4MS2A
chains in the Genus database with same CATH topology
4G78A 1QSPA 1A0BA 1C03A 1WN0A 3KYJA 1YVIA 1OXKA 3IQTA 1Y6DA 2LCHA 1FR0A 2A0BA 2R25A 2LP4A 4EUKB 1SR2A 2LD6A 2OOCA 3MYFA 3KYIA 1TQGA 1BDJB 1I5NA 1OXBA 2Q4FA 3U3BA 1C02A 3US6A 4PACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G78 A;  1QSP A;  1A0B A;  1C03 A;  1WN0 A;  3KYJ A;  1YVI A;  1OXK A;  3IQT A;  1Y6D A;  2LCH A;  1FR0 A;  2A0B A;  2R25 A;  2LP4 A;  4EUK B;  1SR2 A;  2LD6 A;  2OOC A;  3MYF A;  3KYI A;  1TQG A;  1BDJ B;  1I5N A;  1OXB A;  2Q4F A;  3U3B A;  1C02 A;  3US6 A;  4PAC A; 
#chains in the Genus database with same CATH topology
 1MMN A;  5DQT A;  4H54 A;  5B3S C;  1JPN A;  2OG2 A;  4YT4 A;  3AQB A;  1OCC C;  1O3U A;  1S7Z A;  2XLH A;  5KYU B;  1RMV A;  1Z23 A;  1OKK D;  2HUJ A;  2JPU A;  1RJ9 B;  1TR2 A;  1B68 A;  3K66 A;  3SZR A;  1HW2 A;  3IQT A;  2A68 F;  2EPM X;  3CAX A;  4H4K C;  4U9D A;  4DBR A;  3S28 A;  3QVZ A;  2W45 A;  1LM3 B;  3M79 A;  4C7O A;  2R7T A;  1JOG A;  1NSG B;  2Y3B A;  1GS9 A;  1QVX A;  1UFB A;  2PFD A;  4XLN F;  1D1C A;  1XZQ A;  4EIY A;  3EGD B;  3DAG A;  2ZXW C;  3RVZ A;  5KYW A;  2P61 A;  4CJO A;  3C63 A;  1BDJ B;  3IPM O;  2MWQ A;  2YL3 A;  5GPG B;  3DI5 A;  3US6 A;  3EFO B;  2XRH A;  4NY3 A;  2L6H A;  2P1A A;  2YL1 A;  4JE9 A;  1FNT c;  1QSP A;  3PHF 2;  4LAC B;  1A0B A;  2O9X A;  4ULV A;  4CSA A;  1DOV A;  4YWQ A;  2IXM A;  2HJ3 A;  3I5P A;  4O6M A;  3GWL A;  2L6F A;  1I4Z A;  5B3I A;  1V4A A;  2YLD A;  3VRC A;  4CIH A;  1AUE A;  1LPE A;  3EGX B;  4XLP F;  4PK4 A;  4QI2 A;  1OW6 A;  2EPN A;  1VOM A;  3NKD A;  3WOD F;  2R7O A;  1H7I A;  3JSE O;  2G3V A;  3EH1 A;  3L8I A;  4XEV A;  4ANJ A;  3LS0 A;  4MW8 A;  5JS5 A;  2J9U A;  4P9T A;  5F28 E;  2J45 A;  2PX3 A;  3T6J A;  4YK5 A;  3ZQV A;  1JPJ A;  3K33 A;  5CI8 A;  1IW7 F;  1FTS A;  1H9T A;  2KYH A;  2XLO A;  3OA1 A;  1NFN A;  3NDB B;  2L6G A;  3DWW A;  2R02 A;  3SXZ A;  3UR3 C;  2ZXR A;  4E0H A;  5AC4 A;  3AGU A;  2L9J A;  4O79 A;  3SNH A;  4E0I A;  2OKU A;  1G4W R;  3EHM A;  2DYR C;  5T1D B;  4C3D A;  2HV7 A;  5T3W A;  1C03 A;  1OCO C;  2IBF A;  3I4U A;  3LAY A;  4YT5 A;  3T6B A;  2QUP A;  3O10 A;  4EHP A;  5L0D A;  1JAF A;  2KJG A;  5DVW A;  3TK0 A;  2D5R B;  1ORY A;  2LIG A;  4JIO A;  4C3B A;  3DD7 A;  3EGD A;  3IEE A;  3DM5 A;  2R7W A;  1D0Y A;  3U3F A;  4AL0 A;  3SP1 A;  1G8X A;  5E33 A;  4JCZ A;  2XS8 A;  2YLG A;  3JTL O;  1U0B B;  3EFO A;  2RD9 A;  3FOO A;  3K1I C;  5EK0 A;  4DRH B;  4CSA C;  2R7X A;  3U9M A;  4XEF A;  3SYN A;  1C17 M;  2EIK C;  1A7E A;  4GQH A;  3NYL A;  4E17 A;  1K05 A;  3PMR A;  1TFK B;  4PJJ A;  4PJM A;  1HE9 A;  1T9K A;  3Q6N A;  3NRH A;  2JD3 A;  1O5H A;  2GA0 A;  1TWA A;  2V26 A;  1NU9 C;  2H7O A;  3EGX A;  2YWA A;  3IQ6 A;  3MBG A;  3NG1 A;  4FAP B;  1EKY A;  3SXY A;  3UGP A;  2Z15 A;  5KYX B;  4IB4 A;  1Y6D A;  3WAQ A;  3POV A;  1BR2 A;  4E7Z A;  4PJN A;  4C3E A;  4D4N A;  4OIN F;  1LI7 A;  1DOW A;  4JTC B;  3Q6M A;  1GQA A;  4LDR A;  2X51 A;  3NYM A;  1M2O A;  1UG7 A;  2OOC A;  3MX3 A;  2C04 A;  2UUI A;  1CGN A;  2EIM C;  3AJM A;  1VYI A;  3G4Z A;  5E2Q A;  5K0I A;  1YA9 A;  2WZG A;  3J06 A;  3G4X A;  4MTG A;  3FAJ A;  2EIL C;  3X1O A;  2QY9 A;  3IQC A;  2KNH A;  3E9V A;  4PJL A;  2YEV A;  4LER A;  1M6T A;  2CNW A;  4G78 A;  1M56 C;  2XS1 A;  2CYD A;  1FMW A;  2YZS A;  4W8P A;  4XPY A;  3UNG C;  4W8K A;  2LSE A;  2OQM A;  4G7Z F;  1H9G A;  1TWG A;  1J8Y F;  1ORJ A;  1NG1 A;  4LDQ A;  1ZU5 A;  4CS7 A;  2XL6 A;  3U5S A;  4MVO A;  4M63 A;  2IM8 A;  1M2V B;  3PCV A;  4IRU A;  2HKV A;  4BJ6 A;  1FAP B;  2NPU A;  5A6B D;  2VAS A;  4KBL A;  3JSZ A;  4CS9 C;  4N6C A;  2GFH A;  5BQG A;  3HKK A;  3HLZ A;  2WVO A;  2PNO A;  2XLM A;  3FMS A;  2LD6 A;  4XWJ A;  1JR8 A;  1EQ1 A;  1A7D A;  3ECS A;  5L0F A;  2GWW A;  3QTH A;  3QVY A;  3GOD A;  3RH3 A;  4BPM A;  2WZL A;  1K40 A;  1Q0D A;  3A11 A;  4IGG A;  1NZE A;  3ZG1 A;  5COM A;  3EZH A;  4DXW A;  2J0W A;  3M1C B;  4EKW A;  4E7S A;  5KYY B;  1MMG A;  2R03 A;  1VYK A;  1A7V A;  3RW0 A;  1CPR A;  2YKZ A;  1NLX A;  4IAQ A;  5KYX A;  1TFO B;  4ULW A;  1ZYR F;  5DS4 A;  3S84 A;  2J7P A;  1E84 A;  3LS1 A;  3RQG A;  2A69 F;  3QW1 A;  2D4U A;  4Z9H A;  3BRJ A;  2LP4 A;  5L3V A;  4G0H A;  1Y4C A;  3CSK A;  4J7Y A;  2GDC A;  2YLI A;  2FFH A;  4JKV A;  3RFY A;  3TJ5 A;  4GYT A;  1QPU A;  3ZWI A;  2XL4 A;  2Q9C A;  2LFF A;  3L34 A;  3DE8 A;  4MTF A;  2LK4 A;  3EHN A;  1E83 A;  2DB4 A;  2HSB A;  3EPV A;  4YJW A;  2CNW D;  3AQC A;  3LUT B;  3V5Y A;  3EG9 B;  4YT8 A;  1Q0M A;  3JT1 A;  1ST6 A;  4PAC A;  3C8G B;  4I3M A;  1NFO A;  1U6H A;  4KNW A;  1L3P A;  4E18 A;  4BJ6 C;  4EBB A;  2CGE A;  3W4Y A;  2H7V C;  1M2V A;  3K1I A;  3ZQY A;  4U5H A;  3DJN B;  3L1M A;  4MVS A;  5L0C A;  3F47 A;  1LE2 A;  1T6Q A;  3FXH A;  4RD9 A;  2R7V A;  3NMI A;  4JJF A;  3FOP A;  2A0B A;  3DXJ F;  4MVZ A;  2L7A A;  4JZA A;  4DVZ A;  3ZTZ A;  2HFI A;  2I8B A;  3CEX A;  4EUK B;  1WTY A;  2P7V A;  1SR2 A;  2J8W A;  1ZU4 A;  3S29 A;  3B0V C;  5JRA A;  2MHR A;  3HNL A;  4JC7 A;  2W4B A;  4LLE A;  5A6A A;  3R2P A;  4OIO F;  4X0R A;  1YDI A;  2DI3 A;  3ASO C;  4U5G A;  5KYY A;  1YZC A;  4PFO A;  1OQC A;  3SXK A;  3AG3 C;  3U3B A;  3RQE A;  3MFN A;  4P6I C;  1D0Z A;  2NSG A;  2VB6 A;  2ZXO A;  1F1M A;  3AG2 C;  5KYU A;  256B A;  3L8J A;  3RYL A;  4BEM J;  4N06 A;  2L81 A;  2HJM A;  3U0C A;  1RJ9 A;  2Y3D A;  3HNI A;  3M15 A;  1OW7 A;  2CDQ A;  5EGY A;  3KPH A;  3TOL A;  1WOL A;  3ABM C;  4CDA A;  2YQY A;  2BL2 A;  4D4X A;  4IAO A;  2DGJ A;  2OU6 A;  4I1O B;  3UGO A;  2LCH A;  5A6K A;  4DRI B;  3WHN A;  3B29 A;  3NMJ A;  3M4C A;  4JJG A;  2R7U A;  4PFP A;  4JW1 A;  5DS5 A;  1ZHY A;  2NG1 A;  1SF8 A;  4HFF B;  1ZHT A;  4LLC A;  5TJ5 E;  3RF3 A;  5FZT A;  4RDA A;  5EHH A;  2EPO A;  1VTM P;  2P0N A;  2P6V A;  1RKE B;  3EJN A;  2DYS C;  5CIV A;  2R7S A;  2PF4 E;  1APC A;  3QZC A;  3GM3 A;  4JTD B;  4CS9 A;  3C8G A;  3N24 A;  1OXB A;  2XL8 A;  4NQF A;  5A6J A;  2F22 A;  4BG0 A;  1MNE A;  4G7O F;  2NUT B;  1Q0F A;  2Y39 A;  2R7Q A;  3NKE A;  1VMA A;  4Z9I A;  1KNY A;  3HJC A;  4U5D E;  2R9R B;  1XWJ A;  1ORS C;  5KYN A;  3H2U A;  4JRZ A;  2EPL X;  1GM5 A;  3T4R A;  4CBE A;  3ABK C;  2PX0 A;  3GEE A;  4BJ5 C;  2PBE A;  1JRA A;  3JZ0 A;  3KYJ A;  4JEA A;  2XSE A;  3G50 A;  2HMZ A;  1YAR O;  3C18 A;  3O39 A;  2IYL D;  3I5Q A;  4EBJ A;  3C8Z A;  4YT2 A;  1AEP A;  4CDV A;  1MQV A;  1T6U A;  4BEJ A;  1V55 C;  3MYF A;  4J30 B;  4XPW A;  2C03 A;  3KKB A;  3HNJ A;  1ZW2 A;  1K04 A;  1XZP A;  3EZI A;  1I5N A;  2J9W A;  2VC9 A;  4OD5 A;  2A6E F;  4IJJ A;  3UMK A;  3DMD A;  2NUP B;  1FMV A;  5IY5 C;  3U8P A;  1EA8 A;  2Y3G A;  2FAP B;  3IHU A;  2R05 A;  2WVN A;  4K7B A;  4P9F A;  2HMQ A;  4ZLD A;  2VCC A;  3DJU B;  2A1D D;  4FWV A;  4ONS A;  1E2X A;  3FVY A;  3HTK C;  1YVI A;  4RBN A;  1OXK A;  3A9C A;  2EIN C;  4XEK A;  3W2V A;  4AK9 A;  1OKK A;  1FR0 A;  4IAR A;  1VLT A;  4EWC A;  3NMK A;  3U8V A;  2Q3T A;  4MVU A;  4N4W A;  1RKE A;  2BC5 A;  2KSF A;  1QKR A;  1CPQ A;  4KC9 A;  1Q0G A;  3RIP A;  3JCU Q;  5L0J A;  4JTA B;  2IOQ A;  4G7H F;  3LES A;  3NYJ A;  1TKN A;  3FHD A;  4N6H A;  2J9B A;  3LJB A;  1CGO A;  2J0X A;  2Y69 C;  2AWC A;  4JVS A;  2NUT A;  1HE1 A;  4Q4Z F;  3OEO A;  4YL3 A;  4O6N A;  5COF A;  2B0J A;  3QMK A;  1WWP A;  3OWT A;  4MVQ A;  2WB7 A;  1OCZ C;  4J7T A;  4QDL A;  3TOM A;  5JLI A;  1YJG A;  2FGY A;  4AE4 B;  1HMD A;  1D1B A;  3F46 A;  3B0P A;  3ATP A;  2MYS A;  3AG4 C;  1HY5 A;  4AL1 A;  3O6X A;  2ICW G;  3V5Z A;  1E85 A;  4JCH A;  4NCQ A;  2ASR A;  2VCA A;  4MTO A;  3C7J A;  2BE5 F;  1VB5 A;  4A4A A;  3LNR A;  3S0X A;  2WL8 A;  2WZF A;  1WGW A;  4U5C E;  3C62 A;  2ZD9 A;  1RCP A;  3KMI A;  3O55 A;  2IXN A;  3ABL C;  4B6I A;  1G4U S;  1TQG A;  1BBH A;  3GWN A;  3T6G B;  3UMI A;  2TMV P;  2NUP A;  2QE9 A;  4UDV A;  1MND A;  2XM0 A;  2UUH A;  1NBB A;  4F4B A;  2YL0 A;  3K6B A;  5F5H A;  2X0C A;  1W2W A;  4CS8 A;  2A0U A;  3B9Q A;  2ZXP A;  1Z5Z A;  4EBK A;  2XXA B;  1Z6A A;  2HS5 A;  2W9Y A;  4BJ1 A;  1OW8 A;  3DZA A;  3KH2 A;  3TQO A;  4KI2 A;  5JSL A;  3IQ5 A;  1T6I A;  1ZHX A;  1U89 A;  3LEO A;  2R7R A;  3E70 C;  1PD1 A;  1LVK A;  2YVK A;  2Q9A A;  1BR4 A;  1YYX A;  5DQZ A;  1LKX A;  2LFD A;  4AX2 A;  3CQZ A;  1VLS A;  2E87 A;  2J46 A;  4I1M A;  4BJ5 A;  1WAT A;  1SZI A;  4OIP F;  3DE9 A;  3ZTM A;  1PCX A;  3U2L A;  4WAB A;  4Q5S F;  2KW3 C;  2HZ8 A;  4YL0 A;  3S90 A;  3ASN C;  1T01 A;  3HNK A;  1LS4 A;  3U2M A;  1E86 A;  1AVO B;  4OIQ F;  2EIJ C;  5HSW A;  4HE8 D;  3TJ6 A;  4AE4 A;  2IXP A;  4DOZ A;  5JVE A;  2CW0 F;  5AC5 A;  1LI5 A;  2M4E A;  3LLK A;  4HEA J;  4R32 A;  4WGZ A;  5BQI A;  1KU2 A;  4NC3 A;  4PR9 A;  5L0H A;  2J7P D;  5DLJ A;  3MYI A;  2CCY A;  3W2W A;  3ZIB A;  3B0U X;  2I15 A;  4NTF A;  3V7O A;  1YZA A;  3Q7G A;  2B0H A;  1IZM A;  1MMA A;  5B1A C;  3WG7 C;  5JUA A;  2GAQ A;  1Z7Q c;  2ZPA A;  4K0D A;  4U9E A;  3DM9 B;  4FX5 A;  5L0I A;  1R4T A;  4I44 A;  1SYQ A;  1I4Y A;  4GEH A;  4Z9J A;  5JT4 A;  4LDK A;  3PDM P;  4CX9 A;  1BR1 A;  5COG A;  4CS8 C;  1YAU O;  5L0G A;  4NTB A;  2LQG A;  3EG9 A;  1QZX A;  2OCC C;  4OD4 A;  3UMH A;  1PD0 A;  1RXQ A;  4Q7C A;  4J32 B;  3W8H A;  1ZHZ A;  3K7D A;  5A69 A;  1EI7 A;  4MND A;  2PP4 A;  3DKA A;  1OCR C;  1H6G A;  2J9V A;  2Y3H A;  4XPX A;  1R5I D;  3SEO A;  4WGY A;  5L3Q A;  1YA7 O;  4XTK A;  4DRJ B;  2XLV A;  3AG1 C;  3ZVR A;  2VH3 A;  2XLE A;  3U9J A;  5E3A A;  5CI9 A;  3QW0 A;  2AVK A;  4DVY P;  4WJ0 A;  3RKO F;  2EPK X;  2Q9B A;  1NU7 D;  5B1B C;  4DBQ A;  3JYY A;  3VAY A;  3DAF A;  2KK1 A;  1HW1 A;  3JYH A;  3T9O A;  1D1A A;  1TWC A;  1V74 B;  1JMW A;  3LLI A;  5A6B A;  5HV9 A;  2XM4 A;  2M64 A;  4U5F E;  3LEV A;  3GEH A;  1GGQ A;  1CGM E;  3EQL F;  5DS6 A;  3ZC4 A;  2V3C C;  2OJE D;  3Q7L A;  3VF0 A;  2HV6 A;  5BQH A;  1FFT C;  5BUO A;  1Z3I X;  1O87 A;  3V5X A;  1C02 A;  5F5F A;  2OEV A;  4O7G A;  1QLE C;  3GM2 A;  3FAP B;  2QNL A;  3GEI A;  1ZZP A;  4KNV A;  4QI0 A;  5AGF A;  1S05 A;  2XLW A;  2ETS A;  3ZDL A;  1N1C A;  1ZVZ A;  1WAS A;  2XLD A;  2VCB A;  1PV3 A;  3CZ6 A;  3RVY A;  2A6H F;  3M4B A;  2JX0 A;  1OR3 A;  3BEH A;  3LNM B;  2XXA A;  2KC3 A;  1LE4 A;  1LIH A;  2R25 A;  2QTV A;  5D92 A;  4HFK B;  3N2Z B;  2AP3 A;  3GM1 A;  4O6Y A;  5T3T A;  3N0T A;  1YYJ A;  3VM6 A;  3JRT A;  2W4M A;  4JUR I;  4C7O B;  3AOU A;  1G5Z A;  3C8G D;  1RKC A;  1M57 C;  4MQ9 F;  3S9O A;  1A41 A;  3AGT A;  4YN0 B;  1BZ4 A;  3RQF A;  2IXO A;  3SXM A;  1TWH A;  2Q4F A;  5D91 A;  1ZW3 A;  2H8A A;  4CJG A;  5KYW B;  1VK5 A;  3ZSU A;  4DJ9 A;  1L7C A;  1MMD A;  1OR2 A;  1SMY F;  2AU5 A;  2NSF A;  2OJQ A;  2WVQ A;  3KL4 A;  2Q7R A;  3MLG A;  4BJT A;  3GOR A;  2KGO A;  2G3K A;  3FDQ A;  1FFH A;  1WN0 A;  1Z63 A;  1KTM A;  1ZHW A;  4FES A;  4MVR A;  4YL1 A;  4A2N B;  1J8M F;  2HSQ A;  5E3C A;  5JP7 A;  2G62 A;  2OEX A;  3W8I A;  1HMO A;  3X2Q C;  2QLA A;  4XQ1 A;  3S27 A;  4JEB A;  3L0I A;  1Q0K A;  4ER9 A;  4L6R A;  2RSE B;  3TD7 A;  1T5O A;  3K1H A;  3H2V A;  3ITF A;  4NTA A;  2H7B A;  4U5B E;  4CDY A;  3KYI A;  2YHS A;  4K1O A;  3B71 A;  3H65 A;  3JRM O;  3VYW A;  2YRF A;  2Q00 A;  2KQ9 A;  4OIR F;  2YL7 A;  4U5E E;  3TUL A;  1YLM A;  4MVM A;  3R7C A;  4CIP A;  4ZLC A;  1LS1 A;  5FCL A;  1D0X A;  2AWY A;  4MW3 A;  3EH2 A;  4IWB A;  3GAN A;  1V54 C;  1QQ3 A;  4MS2 A; 
#chains in the Genus database with same CATH homology
 4G78 A;  1QSP A;  1A0B A;  1C03 A;  1WN0 A;  3KYJ A;  1YVI A;  1OXK A;  3IQT A;  1Y6D A;  2LCH A;  1FR0 A;  2A0B A;  2R25 A;  2LP4 A;  4EUK B;  1SR2 A;  2LD6 A;  2OOC A;  3MYF A;  3KYI A;  1TQG A;  1BDJ B;  1I5N A;  1OXB A;  2Q4F A;  3U3B A;  1C02 A;  3US6 A;  4PAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...