2OOKA

Crystal structure of a protein with unknown function (yp_749275.1) from shewanella frigidimarina ncimb 400 at 1.80 a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
125
structure length
125
Chain Sequence
DMKKHGLSIGINRIESVFFVTLKAIGTLTHEDYLVITPMLEGALSQVDQPKVSLFLDATELDGWDLRAAWDDLKLGLKHKSEFERVAILGNKDWQEWAAKIGSWFIAGEIKYFEDEDDALKWLRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Open and closed conformations of two SpoIIAA-like proteins (YP_749275.1 and YP_001095227.1) provide insights into membrane association and ligand binding.
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein
total genus 36
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11964 SpoIIAA-like SpoIIAA-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10600 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SpoIIaa-like domains 2ookA00
2OOKA 2Q3LA
chains in the Genus database with same CATH superfamily
1MOPA 2JD1A 1PQ4A 3R6TA 2IBTA 3VU9B 3AUKA 3PSAA 4B83A 2HA7A 2ZJ4A 1R0RE 5IT9A 1KZ4A 3JQ7A 3R8FA 3VZPA 2NG1A 4L0CA 2XQIA 3KQTA 4BO0A 4YASA 4W9MC 1CUZA 4YJKA 4X8LA 5IJZA 1RABA 3FYUA 2APJA 2IHJA 3QNMA 3VR2A 2V0CA 3GW8A 4Q9KA 1G7TA 2YJGA 3QEKA 4D3YA 1Y6FA 1DADA 5EP3A 3CVWA 4J7CA 4OQQA 3NTOA 3NWEA 3NPAA 4H0CA 4BVLA 3HMKA 1BXZA 1VJGA 4XYEA 2ATIA 1AA9A 2QDKA 3OCCA 3CT6A 3PC2A 3I9LA 4NBVA 1GLGA 4DJTA 4B9AA 1PE0A 2FUEA 4B8YA 1VHLA 1XZIA 1KH3A 3DFKA 2E85A 2EJTA 2OO3A 1RPNA 4U2CA 1KIAA 2G6BA 4R9VA 1P4JA 2ZRHA 1UM9B 4LBWA 3ONWA 2AHRA 4FNGA 4A0RA 4CT5A 3HDTA 3Q6MA 3JVDA 5LQSA 4RA6A 3E18A 1DOZA 4WXEA 1T13A 2ZB4A 3PEUA 3STYA 1TYZA 4OTZA 3ZD8A 1AKTA 1SVIA 4JGGA 1LPNA 4KQCA 4XGQA 3DAHA 4JT9A 3EOZA 2FWAA 1DQZA 1JIJA 1QK3A 4INOA 5LXTF 3WYBA 3CQ9A 2QNIA 4RACA 3T4XA 5BWNA 3JQDA 3DBHA 5DVZA 5KBYA 4KH1A 5E2BA 3HCWA 4F0JA 4KWIA 4ZXFA 4R0MA 1H6BA 1TVEA 3SYKA 4A5OA 3GLIE 3GMIA 3QMMA 2ALJA 3FTCA 3O7WA 1OJLA 4J7XA 2PG3A 3CRNA 1OXKB 3GNTA 3G6WA 4JVMA 4LG1A 4WSOA 4H0NA 2HWWA 3FB1A 4RKRA 2X3UA 2H65A 2O7VA 4KQ1A 4P36A 1KEUA 4NY1A 2PUFA 4XTCS 3U3DA 3UQYS 2G3YA 2ZYWX 4L0QA 4X8OA 2IUUA 1KP2A 3NM6B 3CWQA 3OWHA 4KG7A 4XIGS 2JZNA 3MUNA 2OA0A 4EA8A 3K6RA 4DANA 2ODBA 1KJWA 2VLIA 3N0XA 1THTA 2HIMA 4X45A 4XSGA 1AQJA 4DWVA 3W9YA 3WQQA 5A7HA 1TKAA 2JHGA 3HO1A 2X6QA 2Z8YM 4DZTA 2ZRBA 3DR5A 5DW3A 3CRZA 3PDWA 4Q05A 4OL0A 4TMYA 2X4GA 2XNJA 3QEMA 1CX9B 4O2AB 2I6XA 3U81A 3V1TC 5C8XA 2PT5A 3CPHA 3HLTA 2MWMA 3Q9SA 4PAQA 4C7KA 5EJAA 3RHTA 2GBCA 1AX9A 1RHJA 3SMQA 2VBIA 4ZP1A 4LRXA 3SJCA 3ACBA 4H27A 4LJAA 3W34A 3WP1B 5HCIA 1P5FA 1SVWA 1FNCA 4F97A 4V39A 5TPWB 2COKA 3EBOA 3L05A 2W71A 3ESZA 2KQUA 5DYWA 3TPFA 1E7QA 4B85A 4U7DA 4EHHA 1Q0RA 1BXRB 2X9VA 1EI9A 1OI4A 3TFOA 2Q3BA 4WPGA 1HGXA 4X8HA 1GA4A 2Q1TA 1QGZA 3RS7A 1U8EA 1PWZA 1PCXA 3I0MA 1AZWA 1CUFA 4FD2A 1N9KA 3R5SA 7AT1A 1BDBA 1BVUA 3UFXB 1RZRD 4TXHA 3GLGA 1Q0ZA 4MKHA 4GW3A 1DG1G 1XEAA 4KI7A 4LVNA 4NXNB 1JSCA 1KF0A 2I6SA 3O3OB 2Z6AA 3M81A 3BGDA 4NI5A 2IIPA 5KNCH 3BRWA 2OZPA 3ANLA 2XW6A 1AF7A 3ROGA 1J8QA 4GEKA 1RM0A 3WRWA 3U4QB 1WQ4A 1JQBA 1E3IA 2V8BA 4JXKA 4H6PA 3KQYA 4QHSA 2WLTA 3ERCA 1S02A 4XVCA 2QX9A 2NSJA 2O4UX 3NJ8A 1P2FA 2HL6A 1W0KA 4G07A 2QTBA 1JAZA 3U4CA 1FDWA 1PTKA 2CXPA 2NP6A 3B1JA 3PB3A 5DE3A 4DYHA 1XCPA 4TTIA 2NYAA 2FUG6 3DMGA 3RVQA 1BFUA 4RPJA 3HB0A 1W88A 4MYSA 3KZCA 3OQPA 5IJ0B 1EWKA 3GH1A 4WKPA 3T1OA 4E46A 4DMRA 3W5IA 3MGKA 3GDOA 3EIQA 3DUWA 1U2RA 3G2KA 3PI7A 4EG3A 2FEAA 4FM9A 4JI5B 5GJCA 2JPDA 2YWGA 4RL4A 4U02A 1F4LA 2ZIAA 5AESA 3DBLA 4N4AA 1LPBB 3TUJC 4UOEA 5BWLA 1UMDA 1TUBA 3JQGA 5J2TA 3KVNA 1JLHA 1WULS 1FMJA 2AMJA 1Y5NA 2XQGA 5M04A 3ZU6A 4DGSA 2M2IA 2E9SA 2NYUA 4EA6A 3R2JA 4O08A 4CLRA 1NXOA 1Q95A 5CD1A 4JELA 1JI0A 1H93A 3RCBA 4XGNA 3RUCA 2J3EA 1KOLA 3JWIA 3RS9A 3CLSD 2FSHA 3OQ1A 4W1PA 3CFYA 3KJXA 4HX2A 2H85A 5AW3A 2XE8A 1YB4A 3OX2A 2RE8A 3A26A 4FUQA 4KMOA 2JK0A 3HFSA 1NPTO 1WW8A 1AKWA 3F7NA 1EAYA 3RVDA 1K8YB 1DC7A 1K3TA 3O75A 1QX4A 3IURA 3ZUPA 3VR4D 3A8TA 3B2EA 4D9KA 3FCCA 2RGUA 2HZBA 3GO4A 4HGYA 2XTNA 3WRYA 3TI7A 4EKYA 1YS4A 2IUSA 4S2UA 1GSOA 2HMAA 2VP6A 1E2BA 2X0KA 4B6FA 1E2PA 1P7VA 4G9BA 1HSZA 5KQGA 3FMIA 2AUTA 4IV8A 4QGSA 4Z9AA 2AMYA 1M1NA 2R8RA 1S3SA 3E3OA 3HLYA 3QX3A 3G0OA 3NGLA 4B6EA 2KM1A 4KIUA 3P2IA 1CEYA 2JA2A 1WPRA 4IZHA 3QMWA 1FQWA 4RBNA 721PA 3RGWS 3IR5A 2P65A 3N8GA 4P3YA 4JDPA 1ISFA 1XTJA 2FRXA 3SDBA 1CS4C 4PYMA 3ES9A 1JFVA 4JNKA 3CURA 2QUZA 1ORDA 1RBZA 1KS2A 3ESYA 4M6WB 1LFDB 1P60A 3NKLA 1NIJA 4I5EA 4WI1A 4YR7A 3WDKA 2P7HA 1W47A 5CU7A 4QWWA 4AO6A 3I30X 2F4VB 3ZEAA 1JQ5A 1XZQA 3U61B 1P7ZA 4HXFB 2Q8QA 4OHUA 1EFKA 2GF9A 3H3JA 2RHMA 3W04A 5AVXA 4JXJA 1QRTA 1OYWA 5EXPA 1TYDE 3BD6A 2G1PA 4KQFA 1M8GA 4P6VF 2OQVA 2JVKA 4A8PA 4C7JA 3ZX4A 3UO8B 3LI2A 1LGYA 2FSFA 3OU2A 4CM1A 4E08A 3KD2A 1C4WA 1DQSA 1J0DA 3MCWA 4QOIA 3FHCB 1PAUA 5NLLA 3UC5A 1XBTA 2EGHA 3DHEA 5AP9A 4GZMA 2MMGA 2I5PO 5DWVA 5FOQA 4ND2A 2IIQA 1DJMA 1VKJA 4HFRA 1S2LA 2R7KA 1Z62A 3KEOA 1T5IA 4TQGA 3ER9A 3LQ2A 2OHGA 1YC2A 2P9JA 3MWFA 3FOZA 5K6TA 3CW9A 1UMKA 1XYVA 2WQZA 2P2NA 3OESA 4QNRA 1B2LA 2D1TA 1BHSA 4PO1A 5F5LA 2Q50A 1NSTA 1UOOA 4XFKA 1NUTA 3RF6A 1KI6A 1JLLA 3KOXA 2H92A 4AG3A 5KWEA 4PSCA 2ZRAA 3C16C 3TECE 2LWIA 4JB3A 2QL7A 5A3VA 4PC3A 4KLZA 4F7WA 4WJLA 2BGNA 1PT7A 2GRUA 5BN3B 2O1XA 2AR0A 3UHOA 4H1HA 2IU4A 2QU8A 2ZRGA 1KMHA 1JH9A 2O1EA 3D8TA 3W2FA 4HRXA 3PXEA 1UBFA 4NG5A 2OXIA 1E7MA 4ZT7A 2UVPB 5CFQA 2OT3B 5BMOA 3KXDA 3GRKA 3GPLA 1DV2A 3B36A 3VKVA 2H07A 4DNQA 4JGBA 2DPXA 3W8FA 2CXOA 2JDIA 1IPEA 5E6SB 1CY2A 3TQRA 3EXHA 2I66A 2CKDA 3E61A 3GGDA 2VPZA 1S2MA 2XTJA 3R7DA 4BNIA 5JMWA 2PX8A 4DKJA 3PV0A 3KYJB 3HXOA 5C8YF 2VT7A 4RMHA 1XCGB 4P4SB 4FCVA 4MVWA 4EY3A 1NMZA 2YRFA 3FVWA 4YWHA 3VUFA 4DR7B 3DHNA 4JLOA 5AH0A 2BH2A 3GX1A 1U2TA 4E1VA 2KBEA 1QH0A 4I1UA 5JWRA 4FQ8A 2YOHA 1V8BA 5TS3A 2H1FA 4BO2A 5JI3E 3DE3X 2JFHA 4JLSA 5FPSA 1X92A 6PFKA 4HMOA 4WY5A 2EZTA 2PO7A 2Y4NA 2R751 3FSEA 4J2TA 3PWTA 1C8VB 4NZMA 3PEWA 1KOGA 4WBXC 3G5AA 1IRIA 2DWPA 2FA9A 3SK0A 3I73A 5B30A 5B64A 1HPLA 1LNQA 3AFNA 3UIEA 2ZJ5A 3PFKA 1YVEI 4RZIA 3LT2A 3KZXA 4TT8A 5CR9A 5FLYA 1EU1A 4D56A 2HSJA 2XUQA 2VJKA 2B94A 2ZR8A 3IA7A 1SA0B 2DAPA 2OORA 3ANMA 4EX6A 5L8VA 2B34A 3P0HA 4LJ7A 5KQLA 4RH3A 3R3JA 3THXB 2ZRFA 1KARA 2NO7A 3NWOA 3ZC3A 3ZWXA 2IX3A 1G2QA 3IAEA 3ASUA 5T5QA 1J49A 4ECEA 2F59A 2WMYA 4AS1A 5AJWA 1XEWX 1F0YA 3K9GA 4JODA 4A8HA 4EZEA 4N5DA 2PD6A 5TQVA 1CWUA 3AH8A 1D6SA 2EKLA 2YMLA 1ABEA 3QV2A 1OZHA 2ZE7A 2I3ZA 1VBNA 1WEHA 1QHGA 3BB3A 2H11A 2R4QA 4LSZA 2W48A 1TK9A 1VLQA 2PS9A 4YRLA 4FN4A 5FULA 3ZDCA 4XD7A 1FRZA 1RS0A 3RG8A 2E21A 3GBSA 5IJ9A 3OAAD 4W82A 1BE6A 4IICA 4TV8B 1VRCA 3BWBA 1KXJA 3E9DA 2RGXA 5AM3A 1Z28A 5H3HA 2YZMA 3QKRA 2PGXA 1XCBA 2VDQB 4LDRA 5BRNA 1T4GA 5CA1A 4QZVA 1KC3A 1O1YA 2AE2A 3PKZA 3WWZA 3LECA 5E9AA 1MEEA 4ZTBA 4B6GA 4E30A 3D81A 2VYVD 4CV2A 4K9DA 3PT9A 2C7GA 4WLOA 3S6JA 2XXJA 4C4YA 1XXHA 2C2KA 5TJ9A 1V2HE 5HWSA 3U19A 4DIDA 1Z6PA 2ODWA 3EGDB 1IUKA 1C0IA 2H1LA 2HHAA 3EVTA 3IAM1 1GUDA 1FMLA 3DD1A 3MAJA 3V46A 3GVHA 4QJIA 3KSRA 1RLTA 2BFNA 2C9DA 3H4TA 3MMNA 4PAMA 1O97C 3VZQA 4KXFB 4LSMA 1RXYA 3CVYA 3LUGA 1IEQA 4MA5A 1DP4A 5BNWA 1B00A 2X19A 2GN8A 1SD1A 3DR3A 3IE2A 1E92A 4H7JA 4Q9AA 4QPZA 1DZ3A 3FDJA 5DF1A 2GAJA 3FF4A 1F1JA 1S2OA 1UJMA 2RSLA 3NTVA 1CIVA 4O5AA 1K88A 5JH7B 1QFJA 2FUKA 3DFZA 1XQ6A 3KJGA 4HUTA 2M98A 4YT4A 2VDOB 2W6OA 3BGIA 1PS9A 5TQJA 2VHVA 2WM3A 4AZ0B 4B3FX 1O57A 4TL9A 3UOAB 5C37A 1T29A 4CUJA 1KJZA 2VTEA 4NENB 4XDYA 1WPXA 3KR1A 2CJWA 3CY6A 4TZKA 2FPIB 2AEJA 1LSOA 2G28A 3TB4A 4BCCA 2WFAA 3GMDA 4HD8A 5IMSA 3HTXA 2BBWA 3AR6A 3U7QB 5IC4A 2Q2NA 1ISHA 3R7AA 5LQJA 4YCSA 1O5IA 4PFJA 2UAGA 3AJRA 3PGVA 5E3JA 3ZI0A 3ZKAA 4F1WA 5KYKA 1QHFA 3I9OA 3K9QO 3NOOA 1A3CA 4H77A 2C42A 4O1HA 2DQYA 4GMKA 5DB4A 5TQ2B 4BGUA 1YNSA 2G5PA 4C1BA 4R6WA 3ZQ6A 4AKEA 1W5TA 1EFRD 1SQ0A 1PK9A 4HGRA 1X13A 4Q7EA 4QUDA 1AUOA 5IG2A 3SBOA 2X9QA 2IHKA 4S0XA 3IS3A 4UHBA 2MYPA 1KI6B 2ZR0A 1QTRA 3PA6A 4LYEA 5LP6B 3IALA 2OAEA 2XYRA 2BEVB 3BBPA 1JAIA 1R6UA 1ULZA 3AFMA 3JW8A 4OXYA 2YN4A 3V2IA 1DAEA 5KYXA 2ZLBA 3TLGB 4OHBA 3HKDA 4RNCA 3E53A 4Z86A 3WIEA 2P77A 3LPMA 1L5HA 2CLLB 4C4OA 1NQXA 2LNDA 2OBLA 1LSJA 1ZOOA 2NU6A 2XIQA 3H19A 2VDNB 5CLHA 3UK7A 1XDUA 2CYBA 5H4HA 2PH1A 4LMPA 3A10A 4ZAWA 2HA0A 1EZ4A 3PC3A 1SKAA 3FWKA 1OX4B 4J3JA 2E49A 1WY7A 3OFNA 4JWKA 3CLRD 2NVOA 5CIYA 2R0QC 4DUZB 4P34A 2WAYA 1XTIA 3KQSA 4FNAA 3VR5H 4LKRA 3STWA 5BOSA 1QCYA 4K7JA 3DQPA 1TRHA 2HTEA 5LB2A 3SZGA 4RQUA 2D7DA 3DKPA 4X7BA 4B32A 3C24A 2BI8A 5CLGA 4FBLA 5BSWA 4L7VA 3MYRA 3LV8A 1WDKA 5I7WA 4M21A 5FWYA 3RHSA 3PNMA 1DS6A 2PWYA 1Z47A 3IFSA 3Q41A 4OJTA 4R51A 4NKRA 1U3VA 2G1UA 3LOUA 4JX9A 3B1VA 1P2BA 2HHJA 3G2HA 5AVSA 3DB1A 4LYFA 1CR4A 4X6UA 3SBXA 2AKEA 4KXQA 5ALSA 4C3ZA 1SXJB 4JSRA 2ZQZA 5A5EA 3JD2A 3SLKA 4HVLA 3G7NA 2OV6A 1R8SA 3MWDA 1QOPB 2Q5FA 1QG4A 3AJ8A 2OESA 3ICCA 1IQ0A 1B2RA 2QRZA 2QJFA 3L0IB 2YN2A 1NVKA 4BLVA 1EQ2A 5IJ9B 3LQKA 1VIDA 4OK3A 3QU9A 2FJUA 3CX7A 3B1YA 5TE9A 3TR0A 2XE7A 2G9RA 1R9NA 1BTOA 1BS1A 2POCA 1SXGA 3C6BA 3ST7A 2VZ9A 2HD4A 4N9WA 3B48A 1YTUA 2ORWA 2FW7A 4LKOA 2JFQA 1Z35A 3OI7A 4EL0A 4KQGA 1NVEA 5ALXA 4BVAA 4E70A 4RVOA 3L46A 1VMKA 4R8VA 3IDOA 4TROA 1B8OA 2JLBA 4TV8F 3BM5A 3L0CA 3USZA 2FX3A 2FWIA 1P3JA 4H1TA 4Z4GA 1ND5A 1M9NA 3A3OA 4LN1A 3OC0A 3DOFA 1E4VA 3EWSA 1E62A 5CXSA 4CL8A 3HWWA 4R01A 4DBLC 1PJTA 5CA1B 3LWBA 3P2OA 4GI1A 1VLVA 4MA0A 4JUIA 4NDNE 1OFGA 4IOLA 4QUAA 2ERXA 1T2UA 4OM7A 2PGIA 3DFIA 5KO2A 3G1WA 3LBIA 2VSFA 4KXNA 2EF1A 2XUJA 3G82C 4TUYB 4YHBA 3BC1A 3G8YA 1EP2B 1FRFS 1MR3F 1WZUA 4F86A 1O6FA 1V11A 2GS9A 4DFDA 5IM4A 2QJTA 3TXAA 4ZIRB 2R68A 3ESCA 3RUFA 4R8SA 4M9ZA 3PEEA 5E9WA 3UJ7A 3JATB 3H9EO 3QVUA 3OPMA 4X84A 1RKXA 2PKCA 4XUCA 2JHAA 1ZJ5A 1UPXA 2HU7A 3HKCA 3HM2A 4V0LA 1EXWA 1G64A 2FPMA 3BXFA 2DFVA 3QLUA 4IGKA 1EGHA 3QX9A 1DINA 2Q28A 2HRBA 2I7XA 3C8HA 3E7XA 3MZ0A 4MEJA 2NZ2A 2V55B 2YYYA 4G01B 4MKFA 5TMDA 1R5NA 1SZPA 3RKSA 3THXA 1P91A 4YREA 1RC0A 2JLSA 4A6DA 1I6KA 3HV2A 3DLPX 4AJ4A 1MX9A 5GGYA 1V8PA 5KDLA 3DOOA 3L8YA 2NUPA 2ESRA 3NIBA 3AJEA 2BZGA 3JALB 4UCXA 3W5VA 1NVGA 4H31A 1GPNA 1NF3A 2Q2VA 2XT6A 3ELWA 4I4TB 2WQ7A 2FTKE 3VHRA 3T7CA 2RK3A 1UPAA 2YH2A 1VI6A 4URVR 3FVQA 1GNPA 4OJQA 3DOIA 4NP6A 4C0BA 4UEKA 2JLXA 3OE7A 3RTBA 3ZCTA 4D3ZA 3A2MA 1TMOA 2O3UA 2O5RA 2X8BA 3Q1KA 3QHPA 1MB0A 2AZMA 4L5AA 5HF6A 2ZT6A 4R68A 4QXPA 1U0HC 1BW9B 1QNLA 3K96A 2J9RA 4JLMA 3BHNA 4N3NA 3X2FA 2H2WA 2RAPA 3C5WP 4EECA 1XKXA 1I7DA 1EBUA 4B31A 3QEMB 2XZOA 1QFXA 3VXKA 3T5BA 4DMFA 5FWAA 1T9GR 1ZN7A 1OAKA 1J6UA 2Y9MB 2XNKA 1LDNA 3GRZA 1N2CE 3M6WA 2M6LA 1TJ5A 4AS2A 2ARKA 3F98A 4DAEA 4BASA 3P2EA 1O54A 1W4LA 3E4CA 1GPUA 4JGIA 1PTJC 4RZXA 5WRFA 5C7IO 4D45A 5A71A 2QY9A 1Y1QA 2YWJA 3UAZA 1MEOA 2H1HA 2CUTA 2O4CA 4KO1S 5EPEA 4EJ6A 4AJHA 1J06A 1ZK4A 3HA5A 1W4RA 3ZIAD 1AA6A 1KVQA 1NSYA 1X80B 1QFMA 2H2HA 2I2AA 4IYRA 3CX3A 1JKJA 4ZCSA 5GZ6A 1I3LA 1FJ2A 1U90A 4PZEA 3RUPA 3UAOA 3HXQA 3ASZA 3AHIA 2QLMA 1NOJA 3UWMA 3NVMB 4IDQA 1MZPA 4WZAA 2WHXA 2PL9A 2H48A 4I55B 4M8KA 4EMUA 1B15A 1WS6A 2HY7A 2JS7A 2YY7A 3G0IA 4EMBA 5E7MA 1UFOA 5FBHA 3U4QA 3PC6A 3QWAA 1QP0A 1RR6A 3BS4A 1I6LA 4U5QA 1G8KA 2ORVA 2QD5A 4O2BF 1DFHA 1OWLA 2F3SA 1D1PA 1TC1A 2RHLA 2YZ2A 4M9CA 5TNXA 5YASA 3KQVA 1XLVA 3V8BA 1Y4UA 3CH5A 2WHQA 5LQUA 3S2GA 2ID4A 3IH5A 2O48X 5AR1A 5D3MA 2GN0A 3AHHA 3HN7A 4BP9A 2BFCA 1Q7CA 4Q12A 3SSOA 4AY4A 2FDCA 4TLCA 2ZRLA 4OA5A 5I9TA 2VA9A 2IYYA 5AW7A 1MDFA 1KBZA 3PDUA 3O82A 1AHHA 3UUEA 4NRDA 4NOMA 3H97A 1T8YA 1H2FA 2GF2A 3GLGB 3TZQA 1Z8DA 3BMQA 2JI8A 3PIDA 3MFYA 4P5EA 1O95D 1OX4A 3GRAA 3ZU3A 1ZD2P 1NVVR 3CV3A 4KIWA 4AM8A 4EGJA 1EWQA 1MH9A 2PD4A 4I50F 2D1RA 4FGKA 2H4YA 5A0FA 1NUSA 2GVDC 3ZI7A 5A3RA 1YTLA 4H2DA 2I6GA 4KX5A 1RFLA 1T8WA 4DN6A 2ZSFA 3PGLA 2V9ZA 4HDRB 3KXIA 4F4DA 5ERYA 5K3OA 2GNOA 1K5PA 4QYIB 3T6KA 5EZQA 4AUKA 4FXPA 5H70A 1P5RA 1P0MA 4TWAA 3SZRA 4LXIA 4JBHA 5H81A 4QTTB 1WXXA 2DXIA 3AHJA 2NP7A 1IB6A 5K0CA 1BMTA 1RQNA 1ST2A 2GVNA 4RWZA 1R8XA 5BO5A 3WSTA 1NBEA 1WXGA 3KKQA 4KGDA 3B5IA 4D8TA 5DHTA 3PVSA 1LDGA 5IVHA 2GTPA 2YHUA 4GQAA 4YA6A 2DH5A 2CL6X 2HADA 4TYYA 4OP1A 1V11B 3KELA 5C5EA 1FQKA 1NA5A 2WUEA 1ETUA 3CS3A 3MCZA 4NBNA 4WFJA 4E88A 3WWEA 3F6BX 4PQRA 5C1BA 3H13A 3DFFA 1XD2B 2JGNA 1CZKA 3UBTA 1JKFA 4I9HA 3MJ4A 4EUEA 3F5SA 1KJYA 3TRHA 2WTXA 2OZEA 4XVHA 5GJWC 2DPHA 4UZFA 2JGDB 3EG9B 5AW2A 1ZG3A 2EBWA 3GJXC 2ZSBA 1G3UA 3OBBA 3D6AA 1TB4A 4JVNA 4UTOA 1QRUA 1IK4A 1UPFA 4B33A 4LF8B 3RS5A 4C29A 2OCPA 4B6OA 4Q9DA 4H7HA 4Y18A 4JJEA 2IKQA 3S7TA 3GLKA 5ALLA 5E6RA 2BPOA 2VBFA 1OX6A 1BVHA 3ZHSA 4YCJA 3GNQA 4ZT3A 2OCKA 4E5NA 4DR3B 2HH9A 2P9QA 4R5MA 3EXAA 1UM8A 1YGYA 2V7XA 4YFYA 1CHNA 5AXCA 1GZSA 4CM5A 3ZGNA 3LY7A 4XA8A 5I9IA 1EWYA 2FGJA 1PP4A 2H2DA 4OCZA 1FNNA 1V1RB 1Y8QA 2ID9A 2QM3A 3K20A 1II9A 4IIYA 1TM2A 1UMBB 4OMCA 1Z4IA 1X1CA 2V58A 4XJXA 1XZMA 4R2JA 4PGFA 4RHXA 2X9NA 3C1AA 4PPFA 3FETA 3RHZA 2GAIA 5BSGA 1X7HA 1GPYA 1UK8A 3PZBA 4RH0A 4RDXA 2E4UA 3OT1A 2XXBA 4NAHA 1FVHA 4UPDA 2AR7A 5DX1A 2A9FA 3WIVA 4CPDA 1G98A 4KPEC 1QDEA 1V4BA 4P3KA 3BJIC 3NI2A 1BE0A 2O8EA 3UT5A 1DQNA 1MX3A 4RVDA 3PE4A 5HX7A 2RDMA 1YVUA 3SLGA 5JJKA 1CF2O 4U2GA 2XJ9A 2V4MA 3F74A 4WVLA 3WGVA 3AV0B 2X0FA 4UTRA 1N0WA 3T38A 1V5EA 3TMYA 4UNRA 4KXMA 3R0XA 2Y6VA 4B74A 1C9KA 1SG0A 4PZYA 5EZSA 1Q1GA 1Q0SA 2PE5A 1LK0A 1PR4A 2A94A 1VJTA 1YDWA 4I4NA 2P9TA 4NIMA 3A05A 1JTEA 5DULA 5F21A 3GUCA 1L5LA 4AJNA 5CNKA 4TUYA 4YFVA 3F3MA 2HCRA 3VC2A 4DUGD 5E4FA 2OGZA 4UEOA 5AW8A 4ZVLA 2FPWA 2E5FA 4YP7A 2VJNA 3PHBE 4RSHA 4B44A 3AO0B 2W4MA 3FOCA 5SICE 1M8FA 4XDGA 1X42A 4NU0A 3ZV3A 1YDEA 1Z25A 2RHTA 3QKWA 5IT4A 4MDYA 2YOFA 3H1PA 3HQ4O 3PC8C 4D9BA 3HI4A 4R2MA 1M2KA 4X41A 2NXNA 4LPKA 4R3NA 5AHXA 2NU8B 4D9IA 3VPSA 3H8WA 1UK7A 3NORA 4UMEA 1M34B 1JIKA 3ZLUA 1U2DA 3HUTA 4TT3A 5KYVA 4J7UA 2QTGA 1XAHA 4PIMA 4WXPA 1UKVY 1WETA 2WFZA 3BAFA 2ODTX 3GRRA 4M1EA 2DLNA 4HNGA 2VK4A 4WESB 4MUAA 1BD3A 4MYHA 3U9SA 3OZXA 1DVRA 4PSUA 1ENZA 1SCKA 3C3MA 4I6EA 5DN6A 1L1FA 1PUXA 3ZXSA 1QV6A 1UXHA 1TA0A 3P1JA 2QYTA 4E3ZA 3FR8A 1L7MA 1F3OA 2A0KA 5JQGB 1VTKA 3BH7A 3DZBA 4BE4A 4YHHB 2Q4TA 1SBZA 5JC1A 2FWPA 2V7EA 1U9JA 3HL4A 1VBKA 4X1KB 2Y0CA 4CIVA 3B1FA 2A92A 2FYTA 3S1LA 4CG1A 4J4TA 1NWHA 4BDSA 3GLIA 4A2QA 1S7GA 2CK3D 4UKDA 2I2CA 4DNPA 3BE8A 2F43A 4HEA1 1TJNA 4CMBA 3WISA 2JLQA 5DCYA 4L72A 4EYGA 4B87A 3HWRA 2NU9B 4YRQA 2NQ8A 4M1QA 2WWGA 5I7AA 1Y9JA 3CPEA 1T3LA 2HDHA 4MVJH 1Z34A 4C4AA 3IOCA 5A05A 1NHGA 2CW5A 3TD9A 2KX7A 4AFNA 2W5UA 4MR8B 2WKPA 3KUUA 2HMWA 4UAJA 2VF2A 4Y3UA 1LW7A 3HMQA 3WLRA 4B46A 2ZCJA 4D0SA 3M7IA 3ZZUA 3ZCXA 1MAWA 4GT1A 3WGUA 5BMVA 3ZK8A 1CIPA 1WUTA 3FZNA 3JD0A 5EESA 5HS6A 3I6YA 1E69A 4C7MA 2QAIA 5JT1A 3DEYX 4A7PA 4ND8B 2UUBB 1R0XA 2HI0A 3LP5A 4KLNA 1QCDA 4TYQA 4YONB 3T35A 2L18A 2R8EA 4DOMA 1KQFA 3U7FB 2ZI4A 3T0FA 2CNBA 4IUBS 4MAFA 4ZU6X 4L57A 1A2QA 2YMQA 3ILHA 3UW1A 1T36B 4AXBA 2F1RA 1T6ZA 1YXMA 3IVGA 4CQLB 5CNMA 3N2NA 5DM4A 5ENDA 3KKNA 4WAUA 1LNZA 2J3IA 4Y6OA 3TSCA 1AQIA 1W87A 1TQ4A 2XE4A 3DFMA 1FDOA 4O4JF 2I1QA 1IN8A 3QUSA 2QGFA 1LTHR 4Q9HA 4AUMA 4I1PA 3O73A 5DHAA 4AP9A 1C9NA 2PZLA 2CNNA 2O2YA 4FX2A 2ANCA 3OP4A 7YASA 4KZKA 4ABTA 3AI1A 3TJRA 2P2GA 1D4FA 5AKXA 1TKBA 1XZLA 4FCCA 5FQOA 2XE6A 4MUNA 3KLNA 1JEAA 2BFEA 3QQ5A 2DOKA 2GRJA 4LGVA 4S1OA 4XLTA 1CSEE 5KHAA 1NJSA 4ZHQF 1I7PA 4QGAA 3VU9A 3RC8A 2NSLA 3K0FA 3L0YA 3D2CA 1F0KA 1VG0B 1Y37A 4XVRA 4NU5A 1P1IA 1UPUA 2DPYA 1P72A 2D1SA 2WAMA 5DHFA 1U3DA 4NVRA 3FMGA 2FWBA 1QE5A 1P45A 3ICWA 2JASA 3M6VA 3N87A 4RXMA 1AIPA 5JCJD 4PHGA 3LC0A 1EE9A 3D3WB 1Y81A 2HK9A 4B4KA 2C4UA 5JZVA 1ZBQA 3MQFA 1N57A 2JANA 2RCYA 4GP9A 4TZTA 4RELA 4PQEA 3WLSA 1NI4A 2I3DA 4YS6A 5K0LA 3T7IA 4BO8A 2H57A 3CZRA 3R7LA 4B2YA 3VDRA 2D5BA 3MT0A 1F7UA 2VPTA 1RWOA 1TE2A 4RGYA 2YUIA 4ICIA 5KCZA 2ZJ1A 1RZVA 3T1TA 2J33A 3ZLTA 2IHBA 3MINB 1EFAA 1I51A 2JFPA 3DZCA 4BMSA 1WZEA 1R64A 2I7DA 1E3EA 1A27A 1DAMA 4OAPA 1N5DA 2XB2A 1RRVA 1W2HA 4ECAA 2BGLA 2WC1A 4L78A 2XKKA 4C4TA 3R7FA 3VOTA 1OTYA 1G3MA 3G0BA 4J90A 3IMKA 1Z38A 1AT1A 1NRXA 1TZ2A 3HXKA 3MMSA 4QUBA 1ZSNA 3F9RA 4EHDA 2MYNA 3FNGA 4ZI2A 1QYWA 2I2FA 4U2KA 5HFAA 1XEXA 1DOHA 3CX8A 2Z09A 4RYDA 3LDFA 3UAYA 7ADHA 5EEHA 1C0EA 4IIFA 5C1OA 3G9ZA 1SQ5A 3ABQB 3SIXA 1C8KA 1G8FA 2F3PA 2HREA 5BT9A 5LBUA 4ND6A 3A36A 1JALA 4FFWA 3WYAA 2C0PA 3WL4A 1C3OA 2C99A 1EUDB 5SYMA 1GEGA 3EXFA 3GMTA 1W73A 5JUWA 1UADA 2QTAA 4KGXA 2NYRA 5LWQA 4R2HA 1CJCA 3NIGB 3URMA 4LJYA 5E1OA 4BLQA 1DUSA 1J9EA 1Y63A 3WZLA 3I5MA 2QRGA 3OQHA 4W5JA 4HT3B 4ZDJA 4HUQB 2QTWB 4MV7A 5KSPA 5C8ZA 1DX6A 1YJQA 3I64A 5ALYA 4EL5A 1NBAA 4DQUA 4OOFA 5KNCA 2QTHA 4A0SA 2V8OA 2RHOA 4GZ3A 3D4NA 1LDBA 3DXZA 3F7MA 2B8EA 5CP8A 1CC1S 4PPQA 3M34A 2OD9A 3F9IA 2B82A 2F3TA 4KE8A 4BMCA 3GFBA 3L82B 3OU6A 1AJEA 2CF5A 4WT7A 5AKGA 4EG5A 2VJOA 2WTAA 1GUAA 2GFIA 3KB1A 5CUQA 3E3AA 4MPRA 3UHAA 1Y7IA 4F93B 4D25A 3LT5A 3FFTA 1CUWA 4KE9A 1OC4A 1CS0A 4LZAA 5KOYA 2AQKA 1W34A 2ZREA 4L6IA 4MB6A 1M6WA 2JRLA 3GLIB 3ZOKA 3SE0A 4UJ5A 3IPXA 1L5KA 1XP5A 1SKBA 3K09C 2JFZA 4RPCA 3HEAA 4AW9A 2R96A 3H2HA 4FYMA 2QT1A 2BE7A 3GEMA 1ZCZA 4RULA 3LTEA 4D9GA 2VSYA 2VHJA 3IP7A 2XYGA 2OLJA 1AK1A 2HR1A 1N6HA 3VJMA 4UCQA 4BVGA 2IYNA 2SKDA 4GP7A 3K9CA 4YLYA 1ODSA 2ZUSA 4PO3X 3EQZA 5TDHA 2GSDA 4HH4A 1WV0A 3UJBA 1YUMA 3ND8A 5HUJA 3PD1A 2LE0A 1EGVB 2W58A 2HU8A 3PX3A 4CLHA 1XZFA 4Y6LA 2GD0A 1LBSA 5FXMA 3H2GA 1ZZEA 3TRFA 4IDHA 5EHIA 1DWQA 1P7YA 2O05A 4KREA 1DFIA 1K7CA 3B7WA 3FRHA 1K5GA 4UNNA 3VYSB 4EEKA 4E1AA 5JATA 1RXCA 1FP4B 1NV8A 3IIIA 4QTUB 2BGGA 4M0UA 1XQXA 1Q84A 4C4XA 4L4YA 4KYVA 1F0PA 1VECA 4YYZA 1Q12A 1XLTA 3BDIA 1KQOA 2P8JA 2HQSA 5FTNA 2WIAA 2HU2A 2VNKA 2PFGA 3SYTA 2YWDA 4GZ6A 4XYGA 1WF6A 3QELA 1X7YB 2OAGA 3UV3A 3V42A 4BL5A 2FHPA 1HQKA 1E1CA 1YVPA 1JZTA 3NHKA 4QPDA 4MJ7A 3K73O 3BIWA 4P35A 3CIOA 4J4HA 4RCYA 1E0AA 1R6XA 1ZESA 2H3HA 2EKQA 1H2YA 4C08A 3A28A 2VPPA 1NMQA 3DE5X 2W11A 3OAAA 3QW4B 4HB4A 4E1BA 2JFXA 1WVMA 2QTMA 3DDNA 4R83A 5DGCA 2J5BA 4GRDA 3OJWA 5FNVF 5J2UF 4PYRA 3QFSA 3NTUA 4KNWA 2HKIA 1C9JA 4TTQA 1LZKA 2PWPA 3FZYA 4QRDA 4HNAB 1AXRA 3K5WA 2XB6A 4LC1A 1F2VA 2J9FB 3S99A 2XCSB 3H5TA 4Z8YA 3GJ8A 3GI1A 1WB5A 2Z0MA 4PM4A 3BIJA 5KHLB 4M9RA 1B6TA 4Y2UA 3H1TA 5FBWB 4D4MA 4AMYA 1BG6A 2R62A 3HLKA 5EJ6A 3EXEB 1G66A 2JFNA 3IMEA 3QXSA 3TK1A 4BX8A 4EHFA 5EHZA 4YRAA 2J30A 3B5EA 2GPYA 1BHQ1 1TCUA 2P90A 2YXBA 4KQIA 5JSFA 2XT0A 5SZHB 4WLFA 2Y1OA 2Y71A 4BFLA 3ZGZA 1Q0TA 3RREA 3HS3A 1OYVA 2QUJA 1FPMA 4WWHA 4QSHA 1LNSA 1NPDA 3W6NA 5GONB 3MT8A 5A0TA 3PNKA 3BMQB 3FGOA 1Z2DA 4QDUA 1E3WB 1I4LD 2QKYA 1TZKA 3I8XA 3KU4A 3LPAA 4TVSA 3EJ6A 2OM6A 5G02A 4O25A 3NPMA 4N82A 1PDVA 4IDAA 2GPBA 3T7JA 3ICEA 4MAAA 1GCOA 2DHRA 3R7BA 4DJJA 1CJBA 1EB9A 1LKZA 4CM4A 3EGWA 5GP1A 1HQCA 5F4ZA 5GJVC 1WDMA 3I01A 5EWJB 2ZETA 2C2XA 4ZKDA 1PVVA 4MA4A 4BMPB 1EFHA 5CB4A 3Q7QA 4LBZA 1TZJA 3MJCA 5EXDA 3R7WB 1Z56C 5I9MA 4HAWA 3LY5A 2H7YA 4AQDA 4BNLA 1U0OC 3MA0A 2CLFB 5AVTA 4KR3A 2NVUB 3BJRA 3W0LB 5LYJF 1H94A 1UBNA 3IAHA 4K1LA 3RSFA 3UWKA 2JJ1D 2OMKA 1YK0A 1E6CA 2QN8A 3OA0A 4EY8A 5JJIA 1BWPA 1IVYA 4UUAA 2PZFA 4RZ2A 2CT8A 1RJDA 2I4IA 1G16A 2J4CA 1RPTA 3GMSA 3HP4A 4DBLE 3WK7A 1J1IA 1RP7A 3HA3A 2VWPA 1F12A 1U9IA 3PTAA 2Y1LA 5PNTA 1IIBA 2X5JO 3FLAA 4OXRA 5DI9A 5JEEA 2XYPA 1QPGA 5FQNA 5I7SA 3S1SA 2BCEA 1GVNB 4YAWA 5I45A 4KDCA 4QDOA 1XCJA 3S44A 3OPYA 3IQZA 4IDBA 1RLUA 4HVTA 1Y9AA 1AC5A 4L1KA 4OIFA 2JGAA 4Q16A 4BNVA 3T5AA 4TTTS 1UBCA 4M8LA 2QMYA 4LJ6A 3FCSB 1VE5A 1YJ8A 3H84A 4XZ3A 2P6NA 3RVSA 1ZW6A 4J1TA 3UUWA 3WL7A 2XNDA 1PF7E 3AY3A 3CZ5A 2XOKA 1VA5A 1YK1A 1Z12A 4BNZA 4YX9A 1WUIS 2QZPA 3AT1A 2LDXA 1GPWB 1U2SA 4GP6A 5AI5A 4BLOA 1BC5A 3N8IA 1ZN8A 4HTFA 1F17A 3CXRA 3KFVA 2FW6A 1Z18A 3RFUA 3SIWA 3T41A 3AFHA 3OWOA 2WJVA 3WTBA 4DZRA 1TAUA 2GAFA 4RO0A 2Q6LA 4RTJA 3WLPA 3ZU5A 3FZQA 4Q3LA 2A3RA 2F9MA 1CETA 4G3XA 5IJ0A 1EVYA 4N1AA 3QKIA 3K9FC 2GCEA 4BQRA 3CUYA 3RFFA 4WV3A 4P7GA 5BYBA 4FDAA 1S3IA 3STHA 1HKUA 2VDPB 3NDPA 2ZTUA 5EFOA 4MVJF 4HFJA 1SCBA 1QE0A 4O2LA 1TAQA 3F4KA 3EZ7A 3LHDA 3HGMA 1TQ8A 4KPUB 1UBRS 1ZLXA 2I6TA 5BXYA 5M7EA 1W4ZA 5MGNA 5DNUA 3P20A 2DGDA 3M70A 4BZZA 4QTYA 4MV5A 4J94A 2ADOA 2OECA 5DBIA 1OAAA 2HLHA 5ALGA 1ZJJA 1SUFA 1NONA 1Z74A 1IYZA 2ST1A 1PEYA 3LA8A 1IEWA 2FE1A 3NBAA 3O2JA 4J2HA 3B52X 2IPOA 3CJTA 3HKBB 4DM3A 1TK3A 1ULHA 1X80A 3VR3A 4UBMA 1KDTA 2R8BA 2VWGA 5E1MA 4JVSB 5B37A 5HF8A 5IAJA 3RLIA 2VO1A 3CZMA 2W90A 4H60A 3M1IA 3A1EA 3LPCA 5JSUA 5K0TA 3O9ZA 1IAVA 3A1CA 4PZ9A 1UC8A 2H2GA 1GHTA 2NSHA 3GWZA 2XQKA 4WXYB 4F71A 5ISMA 1MX5A 1L8AA 1KAOA 4KHPB 2GZHA 4LHEA 2HF7A 2E18A 1PW5A 2OWDA 1YRLA 2VYND 4LE0A 4MEBA 2DECA 1E3LA 2Z8YA 3HSYA 3JQ9C 3PFWO 1KE1A 3HSKA 4J8PA 4J75A 1M54A 4QU9A 4A9AA 3OZ7A 3DH0A 2H7XA 2HHLA 3ELBA 3ZWAA 2H5IA 2AR9A 2CHUA 2DYKA 4XR4A 2Z56A 2XCOA 2QL5A 2LR0A 5KREA 4FZJA 5FI1B 4KO2S 3OFSA 2DQKA 3JVVA 4MZDA 4RZHA 4GX0A 4HQ6A 2PFSA 1H6DA 1GT6A 1BMQA 3AG5A 1KSJA 4YAIA 3N07A 3UZUA 2JJ8A 2BEKA 4EGAA 4BHTA 1D5WA 1EEXB 3G79A 3MN1A 5D5PA 1RWMA 5JPDA 5KJEA 5BUZA 1G2IA 1LUAA 4XE5A 1FFGA 2O50A 2AS0A 3LS2A 3TO5A 3DXFA 3S28A 2EATA 1WXWA 3R0QA 3UMRA 4RTQA 4YRPA 3A2LA 3E9NA 4TPKA 1FFWA 2W8ZA 3G02A 2C9ZA 1T6XA 4IHKA 4NAUA 4QUIA 4L0DA 3Q8WA 2QXYA 1NQ5A 4DMCA 1AN0A 3ORYA 3L8ZA 3BRWD 2PXXA 5ALDA 4R31A 5F1KA 3TZEA 2ZTSA 3MTAA 4PLYA 4DLXA 2IS6A 3G8DA 3T7AA 4EOGA 1TTTA 4GKKB 1Y3FE 4Z4FA 1I9CA 1I3KA 3BE5A 1OXXK 2ZJ7A 3PFBA 5DYYA 1F9EA 3ZDDA 2DCUA 2J6IA 4F8JA 9MHTA 1W25A 3RE1A 1ATIA 1YVRA 1L4KA 2P4HX 3TIGA 1IQRA 3OSZA 4MCHA 3U7QA 4EZBA 1G8PA 2DFNA 3BUSA 3LH5A 3N70A 4PWYA 3EXIB 4ROSA 3GPCA 1H0KA 4ZI7B 1Z5PA 2REOA 2C96A 3C1UA 1A4UA 1T24A 2AUMA 1QB8A 4ML3A 5F52A 2C00A 2X2EA 1PSDA 2IYFA 1GNSA 3EGEA 1AY0A 2JATA 4EELA 5BW8A 1PV2A 1BEEA 3D0RA 2O7SA 3CEMA 1JAHA 3N0VA 1U99A 4IDFA 3D3KA 3LVQE 1UOPA 5KVSA 3PUWA 3JASB 1ADJA 3C5EA 2WJAA 4YR9A 7REQB 3ADPA 4HCJA 2HSWA 5TPWA 4BS9A 3H18A 4DPLA 3AI2A 2Z1MA 3DZJA 2HIHA 3S2EA 3SFVA 2AOUB 1SQSA 3FHOA 1LTQA 3EZGA 4HXEB 5B3AA 1ZR2A 4FI3C 4ER0A 4BB0A 1MEJA 3M33A 5BN5B 2IHTA 1OXVA 1PR2A 1F06A 5LMNB 3AOEC 3H75A 3I9V6 3B1ZA 2GJKA 3MXTA 3QUBA 5T7BA 4CKZA 3TRDA 1JJBA 1H1TA 4DT1A 1T34A 1GU1A 1I36A 2E4WA 1L8XA 2QJWA 1P44A 3F67A 4RE5A 3RARA 4AMGA 3MSCA 2Z04A 3N2LA 3UBMA 2FV8A 3VPXA 1NMXA 1MBZA 1PLLA 3N28A 4GM1A 2EP5A 5A4KA 1ZCJA 3JWPA 2C1EA 4PXYA 3E2PA 2XNHA 1J33A 1Z6GA 2FU5C 2R5NA 3P4UA 4FZ3A 4QFBA 2G17A 5C1PA 3NGMA 1K3UB 4S1TA 1JR3D 1EMDA 4GLFA 3B1WA 4N48A 4OHKA 3NTLA 1JHDA 1M0TA 2REQB 1XN4A 4OQYA 3RK4A 4B0PA 4JX8A 3WRVA 1MXHA 4CMKA 1WOMA 2Y1KA 1FPQA 1Z5VA 1ZM3A 4Q66C 3TEJA 4DMGA 4FYIA 1KRWA 1ZH2A 1H8HA 5C1IA 1O0BA 3OPYI 4L3OA 5JFTA 4TKUA 5FWYB 4WKOA 5B6JA 2ASVA 2I0FA 1AUXA 2C9OA 3KR0A 1XPOA 4D9HA 4MGZR 2IU6A 1NBIA 4RU1A 3DKVA 2OCGA 2X5OA 1ZMXA 5BYKA 3OLWA 5KVAA 5B2ZA 4DWWA 1OHHA 2IYPA 3WO0A 2Z08A 4DIFA 1XA3A 3CONA 4KN8A 3KKLA 1N0IA 1M6HA 2X15A 2AK3A 4ID3A 4U8HA 3WIDA 2O8EB 1B6RA 4JVOA 4RETA 1L5VA 2JAQA 3BK2A 2GK4A 3EIEA 2ZYTX 4LE2A 4AS3A 1DL5A 4U8GA 3ND5A 2NU7A 2DRIA 4RMJA 4YV7A 1Q7EA 4AY5A 3INRA 4CM6A 4UM8B 3TN7A 4JIGA 2CE2X 1M34A 1P7WA 3AKCA 4B3CA 3H3XA 4C7BA 4QELA 4G26A 4IEEA 5LA6B 4GI3A 1BZYA 2AG6A 2CXTA 4DKXA 4DPKA 1G8JA 1EKXA 1ZHFA 2EIXA 2LV8A 1SU8A 4JD5A 4PX2A 3IBYA 4AMBA 4DCJA 3U40A 1S8NA 2X8LA 1NV9A 2PH5A 3JQEA 5F5XA 6REQB 5HUHA 3PDHA 1RPZA 5TRTA 3SKXA 3ZDRA 3IQXA 3CW2A 1U1DA 2HLNA 4UMDA 1JFTA 1MJGM 4PSDA 3FTPA 3LSYA 4ZOAA 1ILEA 3Q12A 2B30A 3I0NA 3NRJA 3UT5B 4Y1FA 4D92A 3SJ7A 5EVJA 3NLLA 3RAFC 3V7FA 3OZUA 3IC5A 3LK7A 1XZ8A 3EVBA 4NSNA 1RKUA 1KETA 2EERA 4IOMA 2P67A 2TMKA 3E2MA 4GGPA 4NFLA 4PLPA 4D97A 2XTAA 3TLZA 3CM0A 1WSBA 4NH4A 4C3VA 2X0IA 3K70C 1K5DA 1M2VB 2NTVA 5DV9A 4LNUB 1CYDA 1NXWA 1P73A 3RU3A 3U3OA 2A59A 1NOKA 1YZQA 2IGBA 4UHFA 16PKA 2I4LA 2BHTA 5CDFA 4C20A 3VVCA 2WF7A 1OROA 1J8VA 4FHZA 4V3BA 4BWGA 1CS0B 4QX6A 1D1QA 3A9TA 3GY0A 4OL9A 3RSHA 5EJ4A 5JARA 2C84A 3RWOA 3OMWA 3COJA 3F3KA 5DNDA 1SC4A 3LCJA 2P6MA 3ZIUA 3LX4A 3FJOA 1DO8A 4S0ZA 1L1RA 1T5OA 1YIAA 3N75A 4BE9A 1NAHA 4NYMR 2COUA 4FHFA 4NYIQ 4EJFA 4DR4B 4I5GA 4F06A 2HPAA 4M7WA 4UREA 2BFDB 1EX7A 2GI4A 5C4MA 1ZAYA 2OHOA 3EXG2 3CXUA 2BSAA 3ED1A 2C61A 2JI7A 3AJ9A 3JASA 4K05A 3RNLA 1SXJC 3ZZMA 3TEMA 5AVUA 4D3XA 3MIZA 1VIVA 1J1ZA 4KODA 4F6RB 3LBYA 3JQAD 5FYDA 1XZPA 5KKAA 3I6BA 2C2GA 1QJCA 3ETEA 4OAOA 2BV3A 2LUOA 2D4HA 5JD3A 1C8BA 3ZDYB 4OK5A 3WQBA 2M6RA 4MP6A 2B4KA 3HCBA 3U3ZA 2P6RA 3MTGA 1MT3A 4DTIA 3T5PA 3VFDA 1T3ZA 4DVGA 3DA8A 4B09A 1CRLA 3COVA 4BJHB 5DNVA 3L7JA 1TO2E 3A4VA 1H65A 4MW6A 2DG2A 5JCZA 1C7FA 3OZGA 5G4KA 3G68A 1SXJD 3GFOA 4OFXA 4IDCA 1I4EB 1IHPA 1CUDA 4DHEA 2VK8A 2BFEB 3AVQA 3FNEA 2J0UB 5FOVA 1ZOPA 3BWVA 5AJUA 1E63A 3EARA 1JTFA 5EFZA 1Y3IA 3KPUA 4GD3Q 4M76B 4I4CA 2FZWA 1CJKC 2IOFK 1H6CA 2MSWA 4RV9A 1GL6A 4I55F 5F7JA 3F4LA 4MS4A 2H3EA 4DQDA 2VOEA 3AVTA 1M1NB 2WM2A 4JNCA 5BUCA 5I4BA 5I8WA 1E7RA 2AMFA 4JLJA 4KNVA 2QLLA 5FR1A 4YMHA 4ZHQB 4PN7A 1TADA 3EXHC 3PKJA 4GOLD 5FO0A 2W98A 3AB7A 1XMOB 3F4BA 1AGNA 3QE2A 2EX0A 4XCQA 4I3HA 2Q6OA 1XTQA 2QRLA 3HH8A 5DYGA 1DC4A 1O58A 3CF2A 4MYDA 4N39A 5TR9A 3HYSA 2BF4A 4R81A 3K70D 1L8OA 4W9NA 4PYJA 3TI9A 4BNKA 3S55A 3WNCA 2I2BA 5CDGA 1GAXA 5EKUA 2WJHA 5MF6A 2I9KA 1HLPA 3HXTA 1CK4A 3NNNA 3IQFA 1YRYE 4I9UA 3AKZA 4PZCA 3VO1A 2DP4E 3C5CA 3GIWA 2WHPB 1WY5A 2SCUA 3JQ8B 5EJ9A 1RM5A 3EYWA 1YOVA 4LBYA 5D1HA 1T1EA 2JDID 3WGMA 2ERCA 1POXA 3VR3D 3B2NA 5AICA 2CF6A 1E2KA 3PQ2A 4HHEA 2BLNA 3L6EA 4NCHA 4OB6A 4QU5A 3ADDA 3WLEA 4KZPA 4BYGA 4DLVA 4B4DA 1N5JA 2HYDA 4YC7A 1UFKA 1YS6A 2XCIA 2DFTA 3TL2A 1Q44A 1IMOA 2VCYA 3KQPA 3X1JA 4OHWA 4KVFA 4EG8A 2ZXUA 2RONA 4Q1CA 3EVGA 3JD4A 1PW7A 1QKJA 3K0BA 4ZEOA 3LKBA 3IAXA 4XWTA 1UOQA 3UENA 1PO7A 2QV7A 3BFKA 1ZP6A 2QG6A 5SZKB 4RMGA 1ZHOA 3BCSA 3C48A 4CT4B 1MG0A 2G4VA 2GDJA 4ND1A 1YBMA 4GL4A 4HEA6 1QQ6A 1XP8A 2W8BB 3G17A 3ZD9A 5HRCA 3W3AA 1XK7A 2AOWA 1N9GA 4U0KA 4MZXA 4PAWA 4EHBA 3EFEA 1NHWA 4L5JA 4RIGA 1V3VA 5HDQA 3IDFA 1JKJB 4PYOA 5F3RA 4FOOA 4GC9A 1RAHA 3O90A 1XA0A 1Z26A 5DK4A 2OV1A 3V6MA 3SOZA 3W2IA 2GXQA 4QT4A 1XYGA 3QBVA 1XTPA 5LKRA 2G67A 2Q07A 1N1DA 3NOXA 5ITZA 5AQ1A 3C3KA 4WCDA 2IHNA 1PEAA 3PXXA 1S8FA 1R0KA 1WD7A 2CFCA 2Q99A 3DL7A 2X1HA 3MJVA 1YQWA 3L9XA 3K6KA 1MP0A 3R3UA 5DGIA 4O4IA 3O7MA 3QZUA 4G0PA 4HADA 3DMFA 3SZ3A 5HIJA 4F5DA 3BXEA 3AGPA 3GLRA 3QF4A 3TINA 4PGHA 1IY0A 4N7JA 3T9FA 3WJ2A 5I5EA 4L22A 2WJJA 3HR8A 2QY6A 4Z0TA 3A4IA 1KPGA 3INTA 1DJNA 3L1VA 4MKXA 3O2QB 4Q3DA 4OEHA 4YCDA 4OBWA 3K71B 4V0OA 1J07A 3CW8X 4U2EA 4OX9B 5EE0A 3IOEA 5CNJA 3GVXA 1W0JA 4ZO7A 1WWKA 2AG1A 2VP9A 1JHXA 2PZMA 3OCZA 2Q9CA 4MQUA 4YH1A 5FYQA 2X86A 4DLAA 3QIAA 3FKJA 1F4PA 3H7AA 1E5XA 3EDYA 1LPAB 3ZBUA 3AF6A 1RNLA 3HBFA 5IYZF 3WI7A 1XMJA 2AEMA 2HMTA 4MP8A 1HORA 5JAHA 2O2HA 4AI6A 2JH3A 3U1BA 4FGZA 4EYKA 1EJ6A 1RT9A 5DGTA 3ANSA 4HAVA 2OHJA 4K2AA 5EZYF 2ZYDA 3Q6IA 2ZE8A 4GX2A 2VQEB 2IS1A 1XQ9A 2GD2A 4NC9A 4JP2A 4CM3A 4ZCQA 4IMJB 5BXQC 4W5TA 2XQJA 1NDQA 4HSGA 4IF6A 3L4KA 3AFGA 3DVSX 3H11A 1FL9A 3QWBA 1Q83A 5EIAA 5CAEB 2VHXA 4FMCB 3GDWA 2YWFA 3R8CA 3OIWA 4ZHSA 5JS6A 2FHSA 1UMBA 4UOQA 1VJCA 2ZYUX 3HACA 1R0YA 4E6EA 1TLFA 5L45A 1NZFA 3F7TA 3IIJA 4X3PA 5CIWA 5AVQA 5KQSA 1G1MA 2ZT8A 3GN1A 4DLWA 1JA0A 1L1QA 3F47A 3O2NA 4D5GA 3A6PC 4LF6B 1VE7A 2W6MA 3PFFA 4X6LA 4DRXB 2WILA 3AEXA 3LQ4A 2B36A 1W581 3K05A 1DCFA 1ZUWA 4J1TC 1VHTA 3DLIA 1E1CB 3ZLJA 1FB5A 2FFHA 4J6EA 2H52A 1D5CA 4M3NA 4N5HX 1NAIA 3RK0A 4D57A 3SQNA 5BVGB 4ZQGA 4G9GA 1XFDA 4CIYA 3OZAA 5JY1A 3VAZA 2V0NA 4IIHA 5CPBA 3UVEA 3VSEA 5CXUA 5JJCA 5EIEA 1EDEA 5F9FA 3TJMA 4HDKA 2DLDA 3GFPA 4IV5A 3PICA 4X91A 5BQXA 1GP2A 4PCUA 3R7NA 4DQ0A 5JU6A 1CQIA 1Z4QA 2VXCA 3NAMA 2ZIGA 3CUSA 3W7VA 4EDFA 5B4VA 3D7RA 4LZZA 1KOJA 2LD4A 3PF8A 3U09A 1SAYA 3CRVA 1Q15A 5JXHA 3B9QA 4BDTA 5A6VA 3SXPA 5SYNA 3OUZA 1NWCA 3QTBA 2RKOA 1UZLA 3MWLA 4BFXA 3U5ZB 2OLEA 2WI8A 3O1HB 1KFEB 4GR5A 2BFAA 5BR8B 2PL1A 2Q5CA 1AQNA 4A16A 3QITA 2P30A 4Q39A 3RVPA 4BRWA 4F3KA 5C9ZA 1LDEA 3PR2B 4KL8S 4PQYA 3I23A 1ZUNA 1XRJA 2VQ3A 3CBGA 4ERXA 1BGWA 1HDXA 1CT9A 1N3LA 2XMPA 2XUPA 4HLUC 4UCWA 4BV8A 1H9AA 3FRIA 4LX0A 4ZMBA 1YIOA 3NDRA 3O8BA 2AF4C 4WOBA 2P3OA 3MUEA 4KXXA 3HN2A 5ALFA 4RPHA 1LDMA 2GETA 2WU4A 3CLKA 2Z6VA 5CB0A 1OAOC 4ZZ0A 1A0OA 1TMGE 1VGRA 3PFHA 4KAFA 3UPDA 1Y6GA 4YRKA 4NZYA 5T64A 1MJ5A 4BWVA 2D0OB 5K3SA 3ZHYA 4QECA 1N2ZA 2J3KA 2WK1A 1Z8FA 3PXUA 2J8ZA 3A6LA 3G0CA 5K8TA 4MVXA 2V6MA 2C7VA 2R48A 3NT4A 1MJNA 2QU7A 4EKEA 2K4MA 2ZYAA 1P2GA 2PTGA 4RA6B 1IONA 4XM1A 2E5WA 3FE2A 5IXJA 3KBBA 4W7HA 5A6SA 2GPAA 3MJSA 4AN0A 5AOBA 1G6HA 3E9YA 1PJZA 4IO1A 1SOWA 5H02A 5EIBC 1TYCA 2CUNA 2X4LA 1NKTA 2FEXA 4G4SP 1APBA 1XL0A 1NSFA 4ZT2A 5TJHA 1ODFA 4GVLA 4OHPA 4WN9A 5IH3A 3ZWBA 1TEXA 4EYQA 1L7PA 3A3PA 4JLUA 1EK5A 2FMKA 1W2WB 3CJRA 2BFFA 2J3MA 2Y76A 3LY8A 3ROXA 3V1MA 1KMMA 1HE5A 1C4XA 2A5GA 2WKWA 3E0QA 2UYOA 1NT2A 1XJWA 4G0XA 4H7FA 3AVWA 3HCCA 3REOA 1OWMA 1R74A 4O2BA 3ME5A 4XXHA 4B43A 4A4DA 5C52B 1TLLA 2F64A 2OE2A 5LP6F 2WZCA 2VQDA 1VMDA 1YR9A 4HLDA 4X1IB 1IJBA 1KZ6A 5D1NA 2WB2A 1FCJA 2ZI5A 4MITA 4LSGA 5DX0A 5E4YA 3BORA 1C4KA 4J29A 1NJ8A 1HKHA 5UKDA 3VMFA 2GK3A 1XUOA 4QIHA 1X2EA 4C2UA 1O95C 1UIRA 3HFGA 2HCBA 4JYBA 3VSBA 2C7RA 1A2KC 1TL7C 2QTLA 1C5KA 1TTQB 3QXCA 1FXUA 3WGGA 3AC0A 3IBGA 2V03A 1WLYA 4Q24A 3G0GA 3DD5A 4G25A 2B69A 3HJGA 4JFAA 4XW2A 5CVTA 1ZH0A 2CVQA 3L9WA 1HA3A 2JIQA 1JEOA 1UZUA 1XZHA 4S12A 3GN2A 4LCJA 5E7QA 5FOWA 1KEEA 3ZH2A 1SHLA 2WIJA 1L9KA 3AHCA 2OBNA 4ZZ3A 3A27A 2ONJA 4HDAA 1JU9A 1YS1X 4BNDB 1I7LA 1G3RA 1QMGA 1IFXA 4YUAA 2P9FA 4D44A 5JAQA 3WGIA 1QGYA 3A6GA 5TF4A 3AEYA 3S29A 3ZDFA 2AN1A 1NURA 3GNLA 3ENVA 4EFMA 3UAVA 2ZTVA 4IHQA 1D0VA 4RAOA 3VR5D 1E2UA 1EK2A 3ZQUA 3THYB 1VPTA 4FEYA 2XMRA 2C0CA 2EQBA 1KO8A 1N5RA 3EODA 3AF5A 1UM9A 4IOKA 2XZTA 4BVKA 3LKDA 2JKVA 4CL0A 4GQIA 3OQBA 2XUAA 1UEXC 4ZEMA 4ZAGA 4Z0NA 1O77A 3FCXA 3I12A 3KOUA 2BDUA 1V1MA 2VSQA 4GM0A 2DUNA 3H9QA 1CDEA 3JAMA 3GLQA 2UXCB 1TPZA 2RJ3A 3EW9A 2RG7A 3KPWA 2OR3A 2V7BA 2IPAB 1QAOA 3PL5A 5K3FA 2BM0A 1KMNA 1Z68A 3CRQA 2YXLA 4OQMA 5TQ0B 2B5WA 1WLSA 3BWCA 4M89A 4CEJA 1T1SA 4M1WA 5J2TF 3QPWA 1ULUA 3AUSA 1UWVA 2MIIA 1M2NA 1TMYA 2VAXA 3ACDA 3R77A 2TMGA 4WRRA 4EIWA 4GBED 4RK1A 5ERXA 3W1VA 4BRSA 4IYJA 2COEA 2WSSD 4U9HS 4EJSA 6YASA 1W9MA 2INGX 1WB6A 1ACLA 4R9RA 3GEHA 4GX5A 5DYIA 3NXSA 5L95A 2CZQA 2I1VB 1G291 1ORHA 2OHXA 4IFEA 1VJ1A 3B6KA 1IY9A 1FNSA 2V74B 1T6NA 2JJ1A 3NP7A 2CXHA 4YQYA 4DC0A 3WL5A 3PHCA 3EEFA 5JWOA 2G9NA 2X8JB 4MVJI 2PR7A 4QOGA 5JRZA 4HUQA 1N34B 1OV6A 5KC8A 3RHFA 4W5QA 2JIZD 1H4TA 4MUFA 2AWNA 2JI4A 1V9SA 1TQ6A 4FQ5A 5GAJA 3ROKA 4E11A 4WVFA 2O0JA 2IYAA 3UCXA 4JQYA 2IC5A 1XTUA 3GVCA 4NEHB 4KV7A 4AQYB 3D54D 5D8DA 2A3NA 3OMLA 3PGJA 3CR7A 2P9BA 1XX6A 4RY8A 3G9TA 2AVNA 4GYKA 3NRBA 1XZGA 3T7RA 4B40A 3R3VA 3P32A 4IJMA 2HHHB 1SBQA 3IDQA 3KYDA 4LZOA 1NTRA 2QMOA 3QX7A 2I2DA 1JLLB 5JSYA 1J42A 3EA0A 1S9HA 2R8ZA 2YIJA 5E0KB 2DEUA 1LY1A 2FXIA 2P8SA 1U8TA 4C04A 3OT4A 3GDHA 3HFJA 3OE4A 2AWOA 2QD1A 3SR4A 1I2MA 2HK8A 2Q2OA 3KSUA 3MB8A 2OKCA 1A8SA 1TM1E 4YT8A 3MERA 4OI4A 2XZDA 1XU9A 3HU5A 3CTMA 1YJBA 4RFVA 1E60A 1GAQA 1HDEA 1P4RA 4X7PA 3CCBA 2FDRA 3NEJA 5ICCA 4DV6B 1DQPA 2I6FA 2QWXA 3ANNA 5B1IA 5C0OE 1I6MA 4S1PA 2AFHA 3IUJA 2ZB8A 4LF7B 2W0MA 5IS2A 1EG7A 3LUFA 4HATA 1DEOA 1PWXA 4TKMA 5BSHA 4L08A 4RK6A 2O2ZA 2NNLD 3DL4A 3ESAA 3KKEA 2O14A 5CVVA 4UUNA 2XBMA 3OFND 4AROA 3V80A 4FZRA 3BL5A 5B3KA 1YR8A 3UK2A 2AZDA 2EFGA 3HRHA 2JGJA 1CPYA 3CVVA 2EFHB 3BCHA 3OQIB 2K7ZA 1FXWF 4PHFA 3RI3A 3JAWB 5FPPA 1Q3KA 4X1IA 3H9CA 1RJ9B 1IC6A 5U4QA 1E3TA 1OYOA 3TEFA 2QPTA 3ET4A 5C8YB 4TKUB 2BZ1A 1DBRA 1K0UA 1NGSA 1R6VA 3O8RA 4HDMB 1O95A 1DB3A 3PUJA 4I0WB 4LSWA 4QPPA 1FNBA 2H9YA 3JX9A 3F1KA 4QM7A 3JQFC 1SIOA 1E7SA 3BYZA 3G1TA 3OZWA 4C0AC 1ENYA 1VFNA 4OYRA 4B47A 2UU9B 3M6IA 1A5ZA 4ND7A 4YO8A 3QKUA 1GNRA 3TD6A 4F4UA 4CL2A 4ITVA 2PQMA 2IDMA 5KNDD 2E5LB 1D0SA 4W1QA 3RLFA 3KLOA 4R1OA 3WJ1A 1MZVA 2UZ4A 1GZ5A 2XRFA 2O57A 5I47A 4LMAA 2KSQA 2ISQA 2PU7A 4YP1A 3E3MA 1GRVA 2G71A 3MRTA 4AIRA 4C4PA 5IT0A 4KITB 4D79A 4TS4A 1T8PA 1EM8B 2ZS7A 1SQFA 4MQEB 3TZHA 3VZBA 3WAKA 1U2PA 3PYMA 2FR8A 1ZSVA 3A32A 1X74A 4OM8A 3EFOA 4DLSA 1PJBA 2B7LA 5F35A 5F33A 2X8WA 3LC1O 3QE4A 1ISJA 3QFCA 4BNFA 1IZ0A 1X7GA 4UBOA 5HZHA 2PX2A 3R44A 1NBWB 2FEMA 5ALUA 3RABA 3SYNA 4DCTA 1XZCA 3O21A 3C97A 3BTOA 4KPGA 3QVGB 3L8FA 3P7MA 2JGMA 3A37A 4NH0A 1CUCA 1YA8A 2AI2A 1RBQA 2RBGA 4P1ZA 2O2IA 4UATA 4Z9BA 3R20A 3W6ZA 1OBVA 2JIDA 3S3TA 5KX5A 4PIVA 4MR9A 4H1UA 5FIUA 4TS9A 5LJIA 2GCIA 1WTAA 1J2TA 1UUFA 1T9BA 3HCFA 5I9SA 2PRSA 1SXJE 2O19A 2KS6A 3OC6A 1AMOA 2C7QA 1ZUD1 5TXGA 2VP3A 4U7HA 1F8YA 1VLJA 1ZD4A 3NH6A 1T9CA 3UN1A 1DJPA 2ZVPX 5EWMA 3M5WA 3K31A 3G59A 3TOXA 3Q98A 5IP5A 2VH1A 1NQWA 3H0EA 2LVBA 1J9GA 1K6JA 1V39A 4C2BA 5E2IA 2P11A 3FAKA 3EVEA 3AU8A 3IV7A 2HA6A 3V7UA 3C8UA 3W6OA 4ARCA 1MXFA 1SRRA 1F14A 1ZX1A 1W2GA 1E0JA 2FEPA 3RK1A 4CMAA 4DA8A 4F92B 4RK4A 5INTA 2UUCB 4W5NA 2WWIA 1IBMB 1FW6A 1PVDA 2XODA 1I3CA 2HJRA 4I6GA 4YNBA 5JVDF 4ZHQA 4CVNA 2WF8A 1R9MA 3DP9A 1HLFA 2WWTA 3QOFA 4XIIA 4WOJA 3GXOA 4FGSA 3HJTA 1RI1A 1G41A 2RHJA 5FPQA 3E5HA 1Y6ZA 4HDRA 5L3QB 4KR0A 5JH7F 4GDMA 4RCZA 1IIRA 1XDWA 4N54A 2EGGA 2IKSA 1DG9A 3DZDA 4IQ0A 4E13A 1SIWA 1COZA 1HBJA 2BLLA 2YJ4A 3BN3A 1NN5A 1PKXA 4NG4A 5F7XA 3SS9X 3GLTA 4QOSA 3SC6A 5BSKA 4UXJA 2Z6QA 3H2BA 3RRXA 4MWGA 5DM0A 3U31A 1XU4A 1SKYE 4Q6BA 4CUZA 4PCLA 1QH9A 3VDXA 4LCBA 4LPSA 2FUCA 1UKBA 2Y1WA 5HRAA 4R3WA 3WL8A 2QX4A 4QU8A 2H8GA 4JJ8A 5F2EA 3OOEA 1SXIA 1U7DA 4LWOA 1GZUA 1VYUA 5BW5A 3ICOA 3N6RA 1I1OA 2R1TA 1E3SA 3CEHA 3UFXA 4REQA 4M9XA 5JS8A 3Q11A 1ZN2A 2ZU6A 5L4LA 1M2GA 2BEJA 4II7A 5AW5A 3BQ9A 4DGQA 4JJ4A 3MMZA 3KV1A 2DLCX 3CLUD 3KLPX 4E03A 3DV9A 5DTJA 1MG5A 2PJUA 4GOND 4Q1DA 2NGRA 2IF0A 1S8OA 1E2MA 1E4EB 1HE2A 4K9OA 4K6OA 5KYYB 2JL1A 1SA0A 2IRWA 5EJFA 3TTSA 4AICA 4CN9A 2V6JA 4N6OA 3HYNA 4H3HB 1VPEA 4Y98A 1KAEA 1Z2AA 4UAUA 2CMDA 2FMXA 2QX7A 4JLDA 5BVHA 3FPKA 4DLPA 4BJ5A 5LQKA 1JR6A 5A4IS 2ZIXA 3L7DA 2LXNA 1EFCA 2Y93A 3R0VA 3ZNPA 4E2WA 4EO7A 4JT2A 1U94A 2HEIA 1YWGO 4UEQA 4QAJA 1MNAA 3OKAA 3AYXB 4CTOA 2FPLA 1SBTA 4ZYZA 4PHHA 5AI4A 1VPLA 2PYZA 2HUPA 5GWXA 2IXEA 4O2AF 1EM6A 3WB1A 3KJEA 3LBFA 5KAPA 3FOWA 1WF3A 2R8YA 4FE7A 3FNBA 4BB9A 2E1RA 1VRWA 2YWHA 1H9BA 3IEUA 2EQAA 2I87A 2GVZC 4GM4A 3PDJA 2G4LA 5H16A 1AMNA 3EIFA 2OORC 3I42A 4RTRA 2Y66A 1QVRA 2Z5FA 4KHZA 2FZGA 2NUTB 1C29B 1JAYA 4NOJA 3R6LA 3ZWPA 4FPXA 1Z8HA 2F67A 5FH9A 4UPEA 2JF0A 4MVJP 2O8BB 2BF7A 1V1RA 1Y8QB 1QQ7A 1KS9A 2F00A 3W5DA 3KETA 2NV2B 3F5FA 2GZ3A 3E81A 1I5OA 3FPGA 4G0ZA 4G86A 5AVJA 3ET5A 1SU4A 1RI4A 4ESVA 4B3RB 1NJ2A 1EM8A 1UWKA 3C3XA 1QXSA 5HFJA 3WWPA 2AG0A 4FFBB 1YVDA 4O4IF 3T5GA 5FBQB 2XGMA 4D4GA 2C98A 4TMKA 4G63A 3MS2A 2CSUA 3L7AA 4B1FA 4H0FA 4IDDA 3NAQA 3AESA 1FDIA 4UD6A 1QSGA 4EYEA 1VL8A 1SKQA 1SOAA 1L5RA 3FNHA 3OUTA 1T35A 1UDCA 2G9QA 2R65A 4FFLA 4PANA 3UHJA 5A06A 3RAEC 2FFJA 1EVKA 1UZMA 5FL7D 2C3YA 2Z5LA 3O38A 3CSSA 4NZPA 1JAXA 5H82A 1HTWA 3DOHA 5ES3A 2YR0A 1MPTA 2WFLA 3IP6A 1A2BA 1CTQA 1CNMA 2XHEA 3WLKX 3LDHA 3HM9A 3J7AC 3R7WA 3Q7RA 4JEHA 3TQFA 2BC9A 2J87A 1NBME 4EMTA 4UOZA 4YXWA 2A9QA 3FDIA 2NO0A 2QTRA 3RYFB 4KBYA 4C21A 3P9PA 2ICAA 2GZDA 3PE3A 4PS1A 3D7MA 4B4UA 2GD6A 3DW1X 4L3VA 4P8RA 3UJDA 3CC8A 4X6XA 5E3HA 4MRRA 2I4OA 2ZR7A 4BFYA 5GVRA 1GG8A 4UM7A 4FP9A 5JPIA 4PPGA 3PVCA 4RDHA 2GGSA 1QYCA 1SQGA 2Y3IA 4PX5A 1K89A 4XLZA 3ZYCA 5GONF 3B9RA 2VDRB 4HLCA 4ZRNA 4M1ZA 3HB7A 2BTOA 4RZQA 2NYVA 5FNVB 4BNNA 4F12A 4K0KB 1QRAA 3AHFA 1AKVA 1LF0A 2IYEA 4B73A 3A11A 4LZPA 4Z5XA 1H2RS 1IDN1 3T0IA 3D6VA 1Q74A 2IYUA 3UK1A 1EWTA 1POWA 1MO5A 2QX8A 3NWBA 3ZHZA 1NKVA 5KSOA 4P2GA 3W8DA 4RH1A 2EDCA 4MV9A 2OFPA 3DOJA 3W9SA 4B4VA 1EZ1A 1U7TA 3ICQB 4HQNA 4ENUA 1CQIB 3LUKA 4NMLA 1GPLA 2X2PA 4WKNA 4RK7A 1L3CA 4MQLA 4L4XA 5LMZA 3NHLA 1G9TA 1ZK2A 4BMYA 1GFZA 1XVUA 3CLVA 3QF4B 3HA7A 4C07A 3IBFA 3RFTA 3T5MA 2WWYA 2AOUA 3D8NA 5K0BA 2ID7A 2C7OA 1F2UB 2BGJA 5D01A 3CB2A 4FNMA 1RWNA 2GBPA 3ROPA 2CDRA 1EUYA 3W5UA 4YP5A 3NOQA 2KLBA 1VKRA 1NVDA 4E3WA 1W4AA 3PJGA 4I4TA 2OCLA 2EKZA 1U9ZA 2L2QA 3R5FA 2IHZA 3RRZA 1T0BA 2FWRA 3RJTA 4AF8A 4AYXA 5L40A 4RIHA 4N12A 5K3CA 3AL2A 4O3FA 5CB4F 3MD0A 1I1HA 1QHIA 3QXHA 3E9MA 3OOYA 5K0FA 2B8NA 2ES4A 3H1AA 4NYJQ 3VTKA 4BX2A 4QXOA 3T3NA 1ORRA 2QZ9A 1XV5A 2EZ9A 3A1DA 5IWAB 3ODGA 1C3XA 1A9XB 1DARA 1EXMA 3RG2A 1JDNA 1KXZA 3R6DA 4Q4HB 3M4XA 4GH5A 2BT4A 4DRYA 4HEJA 5FLKA 2JAOA 1AH2A 2G80A 3RTDA 3O93A 3VR4H 1I7QB 1W88B 1RQ7A 1KY2A 3L1KA 1Z13A 4FFNA 4BBJA 1C3EA 5AKZA 3VZCA 3BPSA 2JK1A 2C92A 2NSDA 3ZV5A 3VAAA 3UMMA 4UTNA 3KKPA 2ON6A 1WP4A 2RHGB 5DT9A 1K4KA 4KU4A 2VRBA 2Z8ZA 3PFIA 4IIBA 4KUGA 4TN5A 4ZODA 3SHVA 3ZHRA 3RYTC 1ZQ9A 4M8IA 4AK9A 1GYPA 5ECGC 4I6JA 1XCOA 3IQHX 3OKFA 4WK0B 5LBIA 4BMOB 3BMXA 3NT2A 2HCTA 3L04A 4BNUA 1X1DA 3D8UA 3CRRA 4N01A 3GJQA 4J16A 1QKKA 1JPJA 3WNDA 3QVVA 1DTWA 3I53A 1RSZA 4NICA 1RVDA 1Z5UA 5B6IA 1U0RA 1Z16A 4NBRA 3CNLA 2XUHA 4OSOA 4BN4A 2EBHX 3GB9A 2PEZA 3D8RA 5J5CA 4US0R 3CLUC 2Y0PA 1V96A 1UJBA 1L9XA 4UUPA 1QBKC 4BGEA 5JS7A 3N3AC 3S8EA 5LXTA 3SM9A 1Y4ZA 1A8IA 1BN6A 1EH5A 1K4MA 4AMZA 1NNUA 4C2TA 3WAGA 1Y5MA 4H7KA 5CT4A 4A36A 1S01A 3USES 3VYVA 4CCYA 4DCCA 3HUFA 2Q1XA 3ZCQA 4EUSA 3CLTC 5A5FA 1GPBA 4AWXA 3H42B 2VUIB 3CGGA 4HB3A 1XZAA 3FBGA 3VGPA 1PGOA 3C43A 3KYCA 4B3DA 2WU3A 4B2LA 2FFRA 4XAQA 1LI7A 3BQNB 5B2EA 4WFKA 4BLRA 4C1NA 1A4XA 4MGIR 4NPHA 4ZOLA 3OM1A 2O5CA 1NVVQ 4BQSA 2DULA 5JADA 4C43A 1HLDA 3PL1A 4C7XA 1U7ZA 4Q3NA 4MQ4A 1E64A 1RI2A 2O2SA 2F2TA 2QW1A 4O3MA 1TIKA 3AY6A 4BB5A 4EVQA 2ZPTX 1ML3A 4RIFA 3IR7A 4BUZA 3VYUB 4KFRA 1PHRA 1B26A 3FMFA 5C5IA 2C57A 3TOZA 3THYA 3N8KA 1YI0A 3HNPA 4J0FA 2CWDA 4LMBA 4P7JA 1YR3A 4ZVKA 5C34B 2ZRKA 4TMXA 4IIJA 2HA3A 5FEMA 4H3KB 3WLOA 3D7LA 4LTDA 5CD9A 4ENTA 2PX5A 4HYYA 1UKYA 1JA1A 2W4IA 2QD2A 2VXYA 2ZSAA 3ABRB 5JIBA 4L50A 2RI6A 5FORA 1V1MB 3WGKA 3ZW8A 3K94A 3P4XA 2V1XA 1F48A 2ZPAA 4RKYA 4AJPA 2YMMA 3LFTA 5LCXA 2JFOA 3IB6A 1CUBA 2DE0X 4MAMA 2BKXA 2ONCA 3E9EA 2FK7A 1BH2A 2EX1A 4JHXA 4L3WA 1GA1A 5KB3A 3C7KA 3L40A 3IEVA 1JKIA 2ZWVA 4Y6RA 3LX8A 4HJRA 1ENOA 1TU0A 4DJEC 1I10A 2UZIR 5EJ7A 1BEUB 3O4IA 2CB9A 3N76A 3OEEA 4Y9TA 5CMLA 7GPBA 1IMJA 1OPRA 4LJRA 2C4KA 2FLKA 4IFIA 1S4QA 1YF3A 2LPMA 2Y1XA 1ADGA 3ZHTA 1F2TB 2QTTA 4JYCA 3IVAA 3O3NB 3PUIA 2AOXA 4LJ5A 2OC4A 1RHQA 2YQZA 3DAFA 3LHSA 1YQ9A 1YACA 4ZT6A 1XPRA 3UV7A 3FH0A 3KAJA 1CUIA 3Q7SA 3I1IA 2L82A 4MI3A 3LNCA 1RXEA 4F5EA 4IF4A 4XEHA 2Q6TA 1FYWA 1I80A 4FCTA 4LY3A 1L4FA 4Z0PA 4DIOA 5C80A 4OAQA 1EJ2A 5CVCA 2OO5A 2IOYA 3IJEB 5I7HA 3LCMA 2EFDB 3EZ6A 5LXTB 2GEUA 3K9NA 4Q0MA 3RJMA 1OY1A 3CCCA 3QYAA 4V03A 1VYTA 5JC8A 1SUIA 4GPAA 1S8AA 3NQ41 1E1YA 1G42A 2JIOA 3AUYA 3QKRB 4LJLA 3USCS 3DL2A 5JFOA 1RE1A 3KYIB 4INAA 4CM7A 4D9MA 2RAVA 2J7PD 5IANA 4P0QB 4KQEA 1O9GA 3H1BA 1KRXA 3FBTA 3R3HA 3OEHA 3D8BA 4FMDF 1Q50A 4O2BB 4PXAA 3QLVA 4XI9A 3VO8A 1PQUA 4RPIA 4IH9A 1BFDA 4IMIB 1UP4A 3PQCA 1RTKA 3JAWA 1ZN9A 5ALZA 1T4CB 2Z4SA 4WY2A 5ECDA 3DCJA 3H4MA 4N5NA 3L6DA 3X1ZA 1WEKA 2JIRA 4NJMA 3SQDA 4LV6A 1QZTA 5HE8A 4FZVA 4E0BA 3L84A 2VXOA 1V9LA 4HDQB 2HXGA 3G5UA 4LWPA 1LCIA 4FJ1A 2MINA 2H16A 3ABSB 2FDXA 3T94A 1GFWA 3RBXA 2F8LA 2W6CX 4GKJB 2XNDD 2DFPA 4QBHA 4TQ9A 2BTQA 4AJ9A 2Q3EA 4W63A 1P7CA 3DZGA 4LNHA 3JXEA 1DKPA 1I13A 1TECE 4DSOA 1U4OA 1YO6A 1T5BA 3IA2A 3VPCA 2BR5A 1YHZA 2DUMA 4P81A 4U6QA 1RYNA 5DBHX 5B1HA 3K15A 4BNMA 3Q3IA 4PLHA 2IUEA 5FV7A 4KWHA 1H22A 4DARA 3E7DA 1BMFA 2JGDA 4G4IA 4Q3OA 1SHKA 4ADSG 3ZJTA 3GK3A 1UXGA 5C8DA 3UJ6A 4D8VA 5CFLA 1FC0A 3PK0A 2J9XB 4LX8A 2X6RA 2C29D 5IKEA 4Y2SA 2MYTA 3KYCB 4G8BA 4B80A 3U44A 3G9UA 2QVCA 3O6VA 3E05A 1R3DA 2Z4RA 1M7BA 1T9HA 2ZAMA 3M6LA 5FA6A 4KWTA 2DC1A 3BF7A 1BAPA 5ITSA 1JWLA 2QZZA 3F3SA 3OCWA 4NZ9A 4YVFA 4XYLA 1H6AA 3JQRA 3EUFA 3N8HA 3DO6A 3WP0A 5DMXA 3MJRA 1K66A 4ALKA 2O3TA 3EIWA 5FUMA 1D07A 1UBLS 4XARA 3CMMA 3WFJA 2YVLA 1ISRA 2X8JA 1KYXA 1IJKA 2GUGA 2V54A 3C45A 3DLAA 1Z4NA 3OX1A 4ED9A 3PUKA 2D0IA 3T34A 1FLAA 4UMVA 4ZMRA 3F5QA 4F56A 5HPYB 4RLSA 2ZYSA 4G1BA 4LY9A 4TVOA 1H2HA 1I5RA 1QO0D 2ZJYA 3LCUA 3PI6A 1Z2OX 4F60A 1BDMA 1V7QA 1M6NA 3BGVA 5JYCA 2C59A 1G2PA 4H18A 3QVJA 3NU1A 1OREA 5KJ6A 5F1PA 3RRBA 3AL3A 3AUJB 5EIWA 3MGAA 1HMYA 3AR2A 4I1RA 4UHHA 3E84A 4Z3OA 4AY2A 3IPRA 2VNAA 1D2MA 1P77A 5K0SA 5H4GA 2L19A 1GCUA 4B3IA 3MAAC 3JYNA 2MOKA 1ESDA 4D5EA 5BY2A 5DYNA 5C31A 2GM4A 1U0LA 3FYDA 3RSCA 3WA6A 1N0UA 3NALA 4JB0A 4WCFC 3T8YA 1RYEA 1XTSA 2ZSUA 2X9GA 1ZMRA 1NBMD 3GGSA 621PA 3LBNA 2CEKA 3U7RA 1ZWKA 1GG9A 1N1MA 2BISA 3EEIA 4RE6A 4IGFA 4CKXA 5JSZB 4URWR 5FTWA 4FOLA 1QH1A 4RY0A 4ZYWA 5FUYA 4R16A 3HKBA 4RDIA 4I1VA 4UPVA 3ZHXA 5K0GA 1HR0B 3EPJA 2R87A 3TW0A 5B2FA 1ZNWA 4MWTA 4V0RA 3SJAA 5DHUA 3B85A 1I14A 2ROQA 4R1UA 4TMZA 2JAXA 1JE0A 3GEPA 3FUTA 5GIOE 4DXAA 3R5JA 1TF5A 3HY3A 3V9AA 4K8RB 5GJBA 4OUDA 5T8KC 4UUQA 4QBIA 3DDWA 3ZNNA 3MGGA 3JARA 2ACKA 2R86A 1R6TA 2C5SA 4UVDA 3TTYA 1QB7A 1OOEA 1R00A 5LQDA 1A7AA 2XCTB 4D8YA 1OFTA 3TQOA 2Y9PB 4YMIA 4O4LA 2BRUA 1MO6A 1RQGA 1N2EA 1EESA 1NJ6A 4M1OA 5IVDA 1LH0A 3VPDA 3IQGX 1YBAA 1FLNA 1P74A 1QQTA 1PFVA 3NVKI 2F3QA 1IUNA 3LXRA 3A6HA 4Q4HA 5HKLA 5IPFA 3ROEA 2RKWA 3DDZX 3II6X 1RC1A 4OOEA 3RSSA 2G7MC 3DLBA 1MOSA 3AETB 5IAGA 2B37A 3NEAA 3WFZA 1DAOA 3OHPA 5AVWA 2ZJZA 3RC1A 3GP8A 2E6UX 1SXQA 4KTTE 1V45E 1CY6A 2AC4A 1TC2A 4MV6A 1VMEA 4P33A 1J2JA 4RV5A 3GROA 4M0DA 4N0QA 1E2QA 5FNZA 5IAAA 2WV9A 4ZO4A 1KAQA 2XADA 2XHZA 5IW8A 3VR4A 5JVDA 4TYPA 4BUJA 1C9EA 4RJLA 4RVCA 2VPIA 3AUUA 4IQGA 4R69A 1NF8A 5JJLA 4H08A 4RD0A 1PD1A 3V4SA 5AKEA 1YC5A 3IT0A 3PCXA 1V25A 4KYIB 2XLCA 4YJGA 2OHVA 1E9AA 4P4NA 1ZJZA 2I6QA 3DVAA 2RCNA