2OOQA

Crystal structure of the human receptor phosphatase ptprt
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
280
structure length
278
Chain Sequence
MAIRVADLLQHITQMKRGQGYGFKEEYEALPEGQTASWDTAKEDENRNKNRYGNIISYDHSRVRLLVLDPHSDYINANYIDGYHRPRHYIATQGPMQETVKDFWRMIWQENSASIVMVTNLVEVGRVKCVRYWPDDTEVYGDIKVTLIETEPLAEYVIRTFTVQKKGYHEIRELRLFHFTSWPDHGVPCYATGLLGFVRQVKFLNPPEAGPIVVHCSAGAGRTGCFIAIDTMLDMAENEGVVDIFNCVRELRAQRVNLVQTEEQYVFVHDAILEACLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Large-scale structural analysis of the classical human protein tyrosine phosphatome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Receptor-type tyrosine-protein phosphatase T
total genus 93
structure length 278
sequence length 280
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2007-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00102 Y_phosphatase Protein-tyrosine phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 2ooqA00
1PTYA 4Z6BA 4RKKA 1PTVA 4KYQA 1OHDA 3O3LA 2BV5A 4KI9A 4GE2A 3CWEA 3ZM3A 2QCTA 1L8GA 3A5KA 4YAAA 2F6VA 4DGXA 1EENA 4ZI4A 1BZHA 4HJQA 4IKCA 1OEMX 2B49A 1C85A 1ZCLA 5IBSA 4WTYA 2H4VA 3D42A 3PS5A 1U25A 1U24A 1MKPA 4RH9A 1ZC0A 2B4PA 1M3GA 2CM8A 1PYNA 1Q1MA 3RO1A 3O5XA 1LYVA 5K9VA 4D3PA 2H02A 3M4UA 3MOWA 3QCNA 4OHHA 3B7OA 3ZMQA 2I6MA 2HNQA 4BPCA 1YZ4A 2QBSA 5KACA 1XXPA 1Q6SA 2RF6A 1ZCKA 1OEOX 2OZ5A 1WAXA 1V3AA 2E0TA 1YN9A 4D3RA 3F41A 2QBRA 1Q6JA 4HJPA 2HNPA 3D1QA 2CNIA 1VHRA 3EMUA 1YPTA 4QBWA 2QDCA 3AWFA 5GTJA 5J8RA 1JLNA 2DXPA 2HXPA 5KA8A 1JF7A 3V0HA 4R30A 4DGPA 2YDUA 3S3EA 3EZZA 4RH5A 1LQFA 2Y96A 1BZCA 2HC1A 2GP0A 2HC2A 4GS0A 1I9TA 4HRFA 5K9WA 5BZZA 4YR8B 3S3KA 5K23A 2QEPA 3OLRA 5KADA 2BZLA 2I5XA 3MMJA 1T4JA 2OC3A 3RGQA 2BGEA 1ECVA 2B07A 1G1GA 4WOHA 3ZM0A 2I1YA 1T48A 3BRHA 2QCJA 5KA7A 3MOZA 3ZV2A 3S3FA 2F70A 2NZ6A 4RI5A 1YGUA 4R0SA 4QUNA 1PXHA 4GE6A 5LXQB 2OUDA 4B04A 2H04A 1WRMA 1BZJA 2I3RA 4GRYA 1YGRA 4D3QA 3QCEA 2F71A 2QBPA 3ZMPA 2C7SA 1G1FA 3F9BA 4NNDA 2J16B 2ESBA 4QAPA 2CMAA 1NZ7A 2I6PA 2I75A 1X24A 4J51A 4RHGA 1XXVA 2VEWA 1D5RA 1ZZWA 4KYRA 2I3UA 2C46A 4BJOA 3BLTA 2R0BA 3QCMA 4NWFA 2QDMA 4NYHA 1KAVA 2CJZA 3I36A 2VEYA 1NNYA 2B4SA 2M3VA 2FJNA 2I42A 3AWGA 3S4EA 1C86A 4Y14A 3GXHA 2B4OA 4PVGA 1YTNA 4AZ1A 2CMBA 4GFUA 4ERCA 1G4WR 2CMCA 2NT7A 3GXGA 1NL9A 3ZM1A 2HCMA 2VEXA 5KABA 3F81A 4OHLA 3F9AA 3EAXA 3QCHA 4S0GA 1PH0A 1YWFA 1G4US 1EEOA 3NMEA 2P6XA 2CNEA 1NO6A 2A8BA 1YFOA 3RZ2A 1RPMA 4NX8A 5KA9A 3ZM2A 2F6ZA 1G1HA 1A5YA 2J17A 3QCFA 3V0JA 2H03A 1NWLA 2J16A 1XBOA 2Y2FA 4H34A 2ZN7A 1PTTA 2PSZA 2I6JA 3QCGA 2QBQA 3V0IA 2CM2A 2F46A 5K22A 1SUGA 1C88A 1Q6NA 2CNGA 3N0AA 3QCBA 3RGOA 5HDEA 1YTWA 1C83A 4WU2A 1QXKA 2I4EA 3LJ8A 2AZRA 2IMGA 2VEUA 1OESA 1T49A 1PA1A 2BGDA 1OHCA 5EHRA 1I57A 5KA0A 4JMKA 2GWOA 5KA4A 2HB1A 1LARA 2MBCA 2PI7A 1GWZA 2VEVA 1G7FA 2FH7A 2P4DA 1PTUA 1ONYA 3QCJA 3V0FA 5KAAA 3QCIA 4OHDA 1WCHA 2FJMA 1OEUA 3O4TA 3EB1A 1C84A 5KA1A 5BX1A 2HY3A 5EHPA 1C87A 2CFVA 5I6VA 2A3KA 1J4XA 2PBNA 1YTSA 2H4GA 2Q47A 2OOQA 3O4UA 3A5JA 1Q6PA 2PT0A 5K24A 1Q6MA 1NWEA 3QCCA 4JBCA 4ZN5A 1OHEA 5MMZB 4ICZA 1L8KA 2F6WA 2I4HA 2JJDA 3I80A 4QUMA 2CNFA 2G59A 3QCDA 1G7GA 2NTAA 4QAHA 4OHIA 1I9SA 2NLKA 2PA5A 3EU0A 2WGPA 2F6YA 3V0GA 3OMHA 4JNBA 4RDDA 1RXDA 1U26A 2Q05A 3I7ZA 4TVVA 4ZRTA 1OEVA 4GWFA 3V0DA 2CM7A 3V0EA 2GJTA 1FPZA 2PQ5A 2SHPA 4R0TA 2G6ZA 2I6IA 4Y2EA 1P15A 1XM2A 1PA9A 3BLUA 1QZ0A 2NV5A 4GRZA 3S4OA 5BUGA 1GFYA 3H2XA 5K25A 4NWGA 5M43A 2ZMMA 3QCKA 3SR9A 5IBMA 1FQ1A 3QKQA 4GE5A 4QBEA 2I4GA 3D1HA 2I6OA 4RI4A 4WU3A 4OHEA 4JMJA 3D44A 2QDPA 4MBBA 5AWXA 2BIJA 2B3OA 2H4KA 1ONZA 2NT2A 4PYHA 1XRIA 3S3HA 2B4UA 4H1OA 3F99A 5KA2A 1Q6TA 2AHSA 3QKPA 5BZXA 3CM3A 2F6FA 5KA3A 1AAXA 4GFVA 2F6TA 3D9CA 2CNHA 3BM8A 1KAKA 3SMEA 2CM3A 2HVLA 1OETA 3O4SA 3D1OA 3U96A 3QCLA 1R6HA 3AWEA 4I8NA 1FPRA
chains in the Genus database with same CATH superfamily
1PTYA 4Z6BA 4RKKA 1PTVA 4KYQA 1OHDA 3O3LA 2BV5A 4KI9A 4GE2A 3CWEA 3ZM3A 2QCTA 2AM2A 1L8GA 3A5KA 4YAAA 2UAGA 2F6VA 1E8CA 1FGSA 1EENA 4C12A 4DGXA 4ZI4A 1BZHA 4HJQA 4IKCA 1OEMX 2B49A 1C85A 1ZCLA 5IBSA 4WTYA 1JBWA 2H4VA 3D42A 3PS5A 1GQYA 1U25A 1U24A 2VOSA 1MKPA 4RH9A 1ZC0A 2B4PA 2AM1A 1M3GA 2CM8A 1PYNA 1Q1MA 3RO1A 3O5XA 1LYVA 3LK7A 5K9VA 4D3PA 2H02A 3M4UA 3MOWA 3QCNA 4OHHA 3B7OA 3ZMQA 2JFFA 2I6MA 2HNQA 4BPCA 1YZ4A 2JFGA 2QBSA 5KACA 1XXPA 1Q6SA 4BUCA 2RF6A 1ZCKA 1OEOX 2OZ5A 1WAXA 1V3AA 2E0TA 1YN9A 4D3RA 3F41A 2QBRA 3ZM6A 5A5EA 1Q6JA 4HJPA 2HNPA 3D1QA 2CNIA 1VHRA 3EMUA 2VORA 1YPTA 4QBWA 2QDCA 3AWFA 5GTJA 1P31A 1JLNA 2DXPA 3NRSA 5J8RA 2HXPA 5KA8A 1JF7A 4QDIA 3V0HA 4R30A 4DGPA 2YDUA 3S3EA 3EZZA 4RH5A 1LQFA 2Y96A 1BZCA 2HC1A 2GP0A 2HC2A 4GS0A 1I9TA 4HRFA 5K9WA 2Y67A 5BZZA 4YR8B 3S3KA 5K23A 2QEPA 3OLRA 5KADA 2BZLA 2I5XA 3MMJA 1T4JA 2OC3A 3RGQA 2BGEA 1ECVA 2B07A 1G1GA 4WOHA 3ZM0A 3BRHA 1T48A 2I1YA 2QCJA 5KA7A 3MOZA 3ZV2A 3S3FA 2F70A 2NZ6A 2Y66A 4RI5A 1YGUA 4R0SA 4QUNA 1PXHA 4GE6A 5LXQB 2OUDA 4B04A 2H04A 1WRMA 1BZJA 2I3RA 2F00A 4GRYA 1YGRA 4D3QA 3QCEA 2F71A 2QBPA 3ZMPA 2C7SA 1G1FA 2X5OA 3F9BA 4NNDA 4UAGA 2J16B 2ESBA 4QAPA 2CMAA 1NZ7A 2I6PA 2I75A 1X24A 4J51A 4RHGA 1XXVA 2VEWA 1D5RA 1O5ZA 1ZZWA 4KYRA 2I3UA 4CVMA 2C46A 4BJOA 3BLTA 2R0BA 3QCZA 3QCMA 4NWFA 2QDMA 4CVKA 4NYHA 1KAVA 2CJZA 3I36A 2VEYA 1NNYA 2XJAA 2B4SA 2M3VA 2FJNA 2I42A 3AWGA 3S4EA 1C86A 4Y14A 3GXHA 3HN7A 2B4OA 4PVGA 1YTNA 4AZ1A 3N2AA 2CMBA 4GFUA 4ERCA 4BUBA 1G4WR 2CMCA 2NT7A 2UUOA 3GXGA 1NL9A 3ZM1A 2HCMA 1W7KA 2VEXA 3ZL8A 3F81A 5KABA 4OHLA 3F9AA 3EAXA 3QCHA 4S0GA 1PH0A 1YWFA 1G4US 1EEOA 3NMEA 2P6XA 2CNEA 1NO6A 2A8BA 1YFOA 3RZ2A 1RPMA 4NX8A 5KA9A 3ZM2A 3ZM5A 2WJPA 2F6ZA 2GC5A 1G1HA 1A5YA 2J17A 3QCFA 3V0JA 2H03A 1NWLA 2J16A 1XBOA 2Y2FA 4H34A 2ZN7A 1PTTA 2PSZA 2I6JA 3QCGA 2QBQA 4C13A 3V0IA 2CM2A 2F46A 5K22A 1SUGA 1C88A 1Q6NA 2CNGA 3N0AA 3QCBA 3RGOA 5HDEA 1YTWA 1C83A 4WU2A 1QXKA 2I4EA 3LJ8A 2AZRA 2IMGA 2VEUA 1OESA 1UAGA 1T49A 1PA1A 2BGDA 1EEHA 4CVLA 4QF5A 1OHCA 5EHRA 1I57A 5KA0A 4JMKA 2GWOA 5KA4A 2HB1A 1GG4A 1LARA 2MBCA 2PI7A 1P3DA 1GWZA 2VEVA 1G7FA 2FH7A 2P4DA 1PTUA 1ONYA 3QCJA 3V0FA 5KAAA 3QCIA 4OHDA 1WCHA 2FJMA 1OEUA 3O4TA 3EB1A 1C84A 5KA1A 2XPCA 5BX1A 2HY3A 5EHPA 1C87A 2CFVA 5I6VA 2A3KA 1J4XA 2PBNA 1YTSA 2H4GA 2Q47A 2GCBA 2OOQA 1E0DA 3O4UA 3A5JA 1Q6PA 2PT0A 5K24A 1Q6MA 1NWEA 3QCCA 2VTEA 4JBCA 4ZN5A 1OHEA 5MMZB 4ICZA 1L8KA 2F6WA 2I4HA 2JJDA 3I80A 4QUMA 2CNFA 2G59A 2JFHA 3QCDA 1G7GA 2NTAA 4QAHA 4OHIA 1I9SA 2NLKA 2PA5A 3EU0A 2WGPA 2F6YA 3V0GA 3OMHA 4JNBA 4RDDA 1RXDA 1U26A 2Q05A 2Y1OA 3PYZA 3I7ZA 4TVVA 4ZRTA 1OEVA 4GWFA 3V0DA 2CM7A 3V0EA 2GJTA 1W78A 1JBVA 1FPZA 2PQ5A 2SHPA 2VTDA 4R0TA 1J6UA 2G6ZA 2I6IA 4Y2EA 1P15A 1XM2A 1PA9A 3BLUA 1QZ0A 2NV5A 4GRZA 3S4OA 5BUGA 2Y68A 1GFYA 3H2XA 5K25A 4NWGA 5M43A 2ZMMA 3QCKA 3SR9A 5IBMA 4HV4A 1FQ1A 3QKQA 4GE5A 4QBEA 2I4GA 3D1HA 2GC6A 2I6OA 4RI4A 4OHEA 4WU3A 5A5FA 4JMJA 3D44A 2QDPA 1GQQA 4MBBA 5AWXA 2BIJA 2B3OA 2GCAA 1ONZA 2H4KA 3UAGA 2NT2A 4PYHA 1XRIA 3S3HA 2B4UA 4H1OA 3F99A 5KA2A 1Q6TA 2AHSA 3MVNA 3QKPA 5BZXA 3CM3A 2F6FA 5KA3A 1AAXA 4GFVA 2F6TA 3D9CA 2CNHA 2WTZA 3BM8A 1KAKA 3SMEA 2UUPA 2CM3A 2HVLA 3O4SA 1OETA 3D1OA 4ZIYA 3U96A 3QCLA 1R6HA 3AWEA 4I8NA 1FPRA
chains in the Genus database with same CATH topology
1PTYA 4Z6BA 4RKKA 1PTVA 4KYQA 1OHDA 3O3LA 2BV5A 4KI9A 4GE2A 3CWEA 3ZM3A 2QCTA 1L8GA 3A5KA 4YAAA 2F6VA 4DGXA 1EENA 4ZI4A 1BZHA 4HJQA 4IKCA 1OEMX 2B49A 1C85A 1ZCLA 5IBSA 4WTYA 2H4VA 3D42A 3PS5A 1U25A 1U24A 1MKPA 4RH9A 1ZC0A 2B4PA 1M3GA 2CM8A 1PYNA 1Q1MA 3RO1A 3O5XA 1LYVA 5K9VA 4D3PA 2H02A 3M4UA 3MOWA 3QCNA 4OHHA 3B7OA 3ZMQA 2I6MA 2HNQA 4BPCA 1YZ4A 2QBSA 5KACA 1XXPA 1Q6SA 2RF6A 1ZCKA 1OEOX 2OZ5A 1WAXA 1V3AA 2E0TA 1YN9A 4D3RA 3F41A 2QBRA 1Q6JA 4HJPA 2HNPA 3D1QA 2CNIA 1VHRA 3EMUA 1YPTA 4QBWA 2QDCA 3AWFA 5GTJA 5J8RA 1JLNA 2DXPA 2HXPA 5KA8A 1JF7A 3V0HA 4R30A 4DGPA 2YDUA 3S3EA 3EZZA 4RH5A 1LQFA 2Y96A 1BZCA 2HC1A 2GP0A 2HC2A 4GS0A 1I9TA 4HRFA 5K9WA 5BZZA 4YR8B 3S3KA 5K23A 2QEPA 3OLRA 5KADA 2BZLA 2I5XA 3MMJA 1T4JA 2OC3A 3RGQA 2BGEA 1ECVA 2B07A 1G1GA 4WOHA 3ZM0A 2I1YA 1T48A 3BRHA 2QCJA 5KA7A 3MOZA 3ZV2A 3S3FA 2F70A 2NZ6A 4RI5A 1YGUA 4R0SA 4QUNA 1PXHA 4GE6A 5LXQB 2OUDA 4B04A 2H04A 1WRMA 1BZJA 2I3RA 4GRYA 1YGRA 4D3QA 3QCEA 2F71A 2QBPA 3ZMPA 2C7SA 1G1FA 3F9BA 4NNDA 2J16B 2ESBA 4QAPA 2CMAA 1NZ7A 2I6PA 2I75A 1X24A 4J51A 4RHGA 1XXVA 2VEWA 1D5RA 1ZZWA 4KYRA 2I3UA 2C46A 4BJOA 3BLTA 2R0BA 3QCMA 4NWFA 2QDMA 4NYHA 1KAVA 2CJZA 3I36A 2VEYA 1NNYA 2B4SA 2M3VA 2FJNA 2I42A 3AWGA 3S4EA 1C86A 4Y14A 3GXHA 2B4OA 4PVGA 1YTNA 4AZ1A 2CMBA 4GFUA 4ERCA 1G4WR 2CMCA 2NT7A 3GXGA 1NL9A 3ZM1A 2HCMA 2VEXA 5KABA 3F81A 4OHLA 3F9AA 3EAXA 3QCHA 4S0GA 1PH0A 1YWFA 1G4US 1EEOA 3NMEA 2P6XA 2CNEA 1NO6A 2A8BA 1YFOA 3RZ2A 1RPMA 4NX8A 5KA9A 3ZM2A 2F6ZA 1G1HA 1A5YA 2J17A 3QCFA 3V0JA 2H03A 1NWLA 2J16A 1XBOA 2Y2FA 4H34A 2ZN7A 1PTTA 2PSZA 2I6JA 3QCGA 2QBQA 3V0IA 2CM2A 2F46A 5K22A 1SUGA 1C88A 1Q6NA 2CNGA 3N0AA 3QCBA 3RGOA 5HDEA 1YTWA 1C83A 4WU2A 1QXKA 2I4EA 3LJ8A 2AZRA 2IMGA 2VEUA 1OESA 1T49A 1PA1A 2BGDA 1OHCA 5EHRA 1I57A 5KA0A 4JMKA 2GWOA 5KA4A 2HB1A 1LARA 2MBCA 2PI7A 1GWZA 2VEVA 1G7FA 2FH7A 2P4DA 1PTUA 1ONYA 3QCJA 3V0FA 5KAAA 3QCIA 4OHDA 1WCHA 2FJMA 1OEUA 3O4TA 3EB1A 1C84A 5KA1A 5BX1A 2HY3A 5EHPA 1C87A 2CFVA 5I6VA 2A3KA 1J4XA 2PBNA 1YTSA 2H4GA 2Q47A 2OOQA 3O4UA 3A5JA 1Q6PA 2PT0A 5K24A 1Q6MA 1NWEA 3QCCA 4JBCA 4ZN5A 1OHEA 5MMZB 4ICZA 1L8KA 2F6WA 2I4HA 2JJDA 3I80A 4QUMA 2CNFA 2G59A 3QCDA 1G7GA 2NTAA 4QAHA 4OHIA 1I9SA 2NLKA 2PA5A 3EU0A 2WGPA 2F6YA 3V0GA 3OMHA 4JNBA 4RDDA 1RXDA 1U26A 2Q05A 3I7ZA 4TVVA 4ZRTA 1OEVA 4GWFA 3V0DA 2CM7A 3V0EA 2GJTA 1FPZA 2PQ5A 2SHPA 4R0TA 2G6ZA 2I6IA 4Y2EA 1P15A 1XM2A 1PA9A 3BLUA 1QZ0A 2NV5A 4GRZA 3S4OA 5BUGA 1GFYA 3H2XA 5K25A 4NWGA 5M43A 2ZMMA 3QCKA 3SR9A 5IBMA 1FQ1A 3QKQA 4GE5A 4QBEA 2I4GA 3D1HA 2I6OA 4RI4A 4WU3A 4OHEA 4JMJA 3D44A 2QDPA 4MBBA 5AWXA 2BIJA 2B3OA 2H4KA 1ONZA 2NT2A 4PYHA 1XRIA 3S3HA 2B4UA 4H1OA 3F99A 5KA2A 1Q6TA 2AHSA 3QKPA 5BZXA 3CM3A 2F6FA 5KA3A 1AAXA 4GFVA 2F6TA 3D9CA 2CNHA 3BM8A 1KAKA 3SMEA 2CM3A 2HVLA 1OETA 3O4SA 3D1OA 3U96A 3QCLA 1R6HA 3AWEA 4I8NA 1FPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PTY A;  4Z6B A;  4RKK A;  1PTV A;  4KYQ A;  1OHD A;  3O3L A;  2BV5 A;  4KI9 A;  4GE2 A;  3CWE A;  3ZM3 A;  2QCT A;  1L8G A;  3A5K A;  4YAA A;  2F6V A;  4DGX A;  1EEN A;  4ZI4 A;  1BZH A;  4HJQ A;  4IKC A;  1OEM X;  2B49 A;  1C85 A;  1ZCL A;  5IBS A;  4WTY A;  2H4V A;  3D42 A;  3PS5 A;  1U25 A;  1U24 A;  1MKP A;  4RH9 A;  1ZC0 A;  2B4P A;  1M3G A;  2CM8 A;  1PYN A;  1Q1M A;  3RO1 A;  3O5X A;  1LYV A;  5K9V A;  4D3P A;  2H02 A;  3M4U A;  3MOW A;  3QCN A;  4OHH A;  3B7O A;  3ZMQ A;  2I6M A;  2HNQ A;  4BPC A;  1YZ4 A;  2QBS A;  5KAC A;  1XXP A;  1Q6S A;  2RF6 A;  1ZCK A;  1OEO X;  2OZ5 A;  1WAX A;  1V3A A;  2E0T A;  1YN9 A;  4D3R A;  3F41 A;  2QBR A;  1Q6J A;  4HJP A;  2HNP A;  3D1Q A;  2CNI A;  1VHR A;  3EMU A;  1YPT A;  4QBW A;  2QDC A;  3AWF A;  5GTJ A;  5J8R A;  1JLN A;  2DXP A;  2HXP A;  5KA8 A;  1JF7 A;  3V0H A;  4R30 A;  4DGP A;  2YDU A;  3S3E A;  3EZZ A;  4RH5 A;  1LQF A;  2Y96 A;  1BZC A;  2HC1 A;  2GP0 A;  2HC2 A;  4GS0 A;  1I9T A;  4HRF A;  5K9W A;  5BZZ A;  4YR8 B;  3S3K A;  5K23 A;  2QEP A;  3OLR A;  5KAD A;  2BZL A;  2I5X A;  3MMJ A;  1T4J A;  2OC3 A;  3RGQ A;  2BGE A;  1ECV A;  2B07 A;  1G1G A;  4WOH A;  3ZM0 A;  2I1Y A;  1T48 A;  3BRH A;  2QCJ A;  5KA7 A;  3MOZ A;  3ZV2 A;  3S3F A;  2F70 A;  2NZ6 A;  4RI5 A;  1YGU A;  4R0S A;  4QUN A;  1PXH A;  4GE6 A;  5LXQ B;  2OUD A;  4B04 A;  2H04 A;  1WRM A;  1BZJ A;  2I3R A;  4GRY A;  1YGR A;  4D3Q A;  3QCE A;  2F71 A;  2QBP A;  3ZMP A;  2C7S A;  1G1F A;  3F9B A;  4NND A;  2J16 B;  2ESB A;  4QAP A;  2CMA A;  1NZ7 A;  2I6P A;  2I75 A;  1X24 A;  4J51 A;  4RHG A;  1XXV A;  2VEW A;  1D5R A;  1ZZW A;  4KYR A;  2I3U A;  2C46 A;  4BJO A;  3BLT A;  2R0B A;  3QCM A;  4NWF A;  2QDM A;  4NYH A;  1KAV A;  2CJZ A;  3I36 A;  2VEY A;  1NNY A;  2B4S A;  2M3V A;  2FJN A;  2I42 A;  3AWG A;  3S4E A;  1C86 A;  4Y14 A;  3GXH A;  2B4O A;  4PVG A;  1YTN A;  4AZ1 A;  2CMB A;  4GFU A;  4ERC A;  1G4W R;  2CMC A;  2NT7 A;  3GXG A;  1NL9 A;  3ZM1 A;  2HCM A;  2VEX A;  5KAB A;  3F81 A;  4OHL A;  3F9A A;  3EAX A;  3QCH A;  4S0G A;  1PH0 A;  1YWF A;  1G4U S;  1EEO A;  3NME A;  2P6X A;  2CNE A;  1NO6 A;  2A8B A;  1YFO A;  3RZ2 A;  1RPM A;  4NX8 A;  5KA9 A;  3ZM2 A;  2F6Z A;  1G1H A;  1A5Y A;  2J17 A;  3QCF A;  3V0J A;  2H03 A;  1NWL A;  2J16 A;  1XBO A;  2Y2F A;  4H34 A;  2ZN7 A;  1PTT A;  2PSZ A;  2I6J A;  3QCG A;  2QBQ A;  3V0I A;  2CM2 A;  2F46 A;  5K22 A;  1SUG A;  1C88 A;  1Q6N A;  2CNG A;  3N0A A;  3QCB A;  3RGO A;  5HDE A;  1YTW A;  1C83 A;  4WU2 A;  1QXK A;  2I4E A;  3LJ8 A;  2AZR A;  2IMG A;  2VEU A;  1OES A;  1T49 A;  1PA1 A;  2BGD A;  1OHC A;  5EHR A;  1I57 A;  5KA0 A;  4JMK A;  2GWO A;  5KA4 A;  2HB1 A;  1LAR A;  2MBC A;  2PI7 A;  1GWZ A;  2VEV A;  1G7F A;  2FH7 A;  2P4D A;  1PTU A;  1ONY A;  3QCJ A;  3V0F A;  5KAA A;  3QCI A;  4OHD A;  1WCH A;  2FJM A;  1OEU A;  3O4T A;  3EB1 A;  1C84 A;  5KA1 A;  5BX1 A;  2HY3 A;  5EHP A;  1C87 A;  2CFV A;  5I6V A;  2A3K A;  1J4X A;  2PBN A;  1YTS A;  2H4G A;  2Q47 A;  2OOQ A;  3O4U A;  3A5J A;  1Q6P A;  2PT0 A;  5K24 A;  1Q6M A;  1NWE A;  3QCC A;  4JBC A;  4ZN5 A;  1OHE A;  5MMZ B;  4ICZ A;  1L8K A;  2F6W A;  2I4H A;  2JJD A;  3I80 A;  4QUM A;  2CNF A;  2G59 A;  3QCD A;  1G7G A;  2NTA A;  4QAH A;  4OHI A;  1I9S A;  2NLK A;  2PA5 A;  3EU0 A;  2WGP A;  2F6Y A;  3V0G A;  3OMH A;  4JNB A;  4RDD A;  1RXD A;  1U26 A;  2Q05 A;  3I7Z A;  4TVV A;  4ZRT A;  1OEV A;  4GWF A;  3V0D A;  2CM7 A;  3V0E A;  2GJT A;  1FPZ A;  2PQ5 A;  2SHP A;  4R0T A;  2G6Z A;  2I6I A;  4Y2E A;  1P15 A;  1XM2 A;  1PA9 A;  3BLU A;  1QZ0 A;  2NV5 A;  4GRZ A;  3S4O A;  5BUG A;  1GFY A;  3H2X A;  5K25 A;  4NWG A;  5M43 A;  2ZMM A;  3QCK A;  3SR9 A;  5IBM A;  1FQ1 A;  3QKQ A;  4GE5 A;  4QBE A;  2I4G A;  3D1H A;  2I6O A;  4RI4 A;  4WU3 A;  4OHE A;  4JMJ A;  3D44 A;  2QDP A;  4MBB A;  5AWX A;  2BIJ A;  2B3O A;  2H4K A;  1ONZ A;  2NT2 A;  4PYH A;  1XRI A;  3S3H A;  2B4U A;  4H1O A;  3F99 A;  5KA2 A;  1Q6T A;  2AHS A;  3QKP A;  5BZX A;  3CM3 A;  2F6F A;  5KA3 A;  1AAX A;  4GFV A;  2F6T A;  3D9C A;  2CNH A;  3BM8 A;  1KAK A;  3SME A;  2CM3 A;  2HVL A;  1OET A;  3O4S A;  3D1O A;  3U96 A;  3QCL A;  1R6H A;  3AWE A;  4I8N A;  1FPR A; 
#chains in the Genus database with same CATH topology
 1PTY A;  4Z6B A;  4RKK A;  1PTV A;  4KYQ A;  1OHD A;  3O3L A;  2BV5 A;  4KI9 A;  4GE2 A;  3CWE A;  3ZM3 A;  2QCT A;  2AM2 A;  1L8G A;  3A5K A;  4YAA A;  2UAG A;  2F6V A;  1E8C A;  1FGS A;  1EEN A;  4C12 A;  4DGX A;  4ZI4 A;  1BZH A;  4HJQ A;  4IKC A;  1OEM X;  2B49 A;  1C85 A;  1ZCL A;  5IBS A;  4WTY A;  1JBW A;  2H4V A;  3D42 A;  3PS5 A;  1GQY A;  1U25 A;  1U24 A;  2VOS A;  1MKP A;  4RH9 A;  1ZC0 A;  2B4P A;  2AM1 A;  1M3G A;  2CM8 A;  1PYN A;  1Q1M A;  3RO1 A;  3O5X A;  1LYV A;  3LK7 A;  5K9V A;  4D3P A;  2H02 A;  3M4U A;  3MOW A;  3QCN A;  4OHH A;  3B7O A;  3ZMQ A;  2JFF A;  2I6M A;  2HNQ A;  4BPC A;  1YZ4 A;  2JFG A;  2QBS A;  5KAC A;  1XXP A;  1Q6S A;  4BUC A;  2RF6 A;  1ZCK A;  1OEO X;  2OZ5 A;  1WAX A;  1V3A A;  2E0T A;  1YN9 A;  4D3R A;  3F41 A;  2QBR A;  3ZM6 A;  5A5E A;  1Q6J A;  4HJP A;  2HNP A;  3D1Q A;  2CNI A;  1VHR A;  3EMU A;  2VOR A;  1YPT A;  4QBW A;  2QDC A;  3AWF A;  5GTJ A;  1P31 A;  1JLN A;  2DXP A;  3NRS A;  5J8R A;  2HXP A;  5KA8 A;  1JF7 A;  4QDI A;  3V0H A;  4R30 A;  4DGP A;  2YDU A;  3S3E A;  3EZZ A;  4RH5 A;  1LQF A;  2Y96 A;  1BZC A;  2HC1 A;  2GP0 A;  2HC2 A;  4GS0 A;  1I9T A;  4HRF A;  5K9W A;  2Y67 A;  5BZZ A;  4YR8 B;  3S3K A;  5K23 A;  2QEP A;  3OLR A;  5KAD A;  2BZL A;  2I5X A;  3MMJ A;  1T4J A;  2OC3 A;  3RGQ A;  2BGE A;  1ECV A;  2B07 A;  1G1G A;  4WOH A;  3ZM0 A;  3BRH A;  1T48 A;  2I1Y A;  2QCJ A;  5KA7 A;  3MOZ A;  3ZV2 A;  3S3F A;  2F70 A;  2NZ6 A;  2Y66 A;  4RI5 A;  1YGU A;  4R0S A;  4QUN A;  1PXH A;  4GE6 A;  5LXQ B;  2OUD A;  4B04 A;  2H04 A;  1WRM A;  1BZJ A;  2I3R A;  2F00 A;  4GRY A;  1YGR A;  4D3Q A;  3QCE A;  2F71 A;  2QBP A;  3ZMP A;  2C7S A;  1G1F A;  2X5O A;  3F9B A;  4NND A;  4UAG A;  2J16 B;  2ESB A;  4QAP A;  2CMA A;  1NZ7 A;  2I6P A;  2I75 A;  1X24 A;  4J51 A;  4RHG A;  1XXV A;  2VEW A;  1D5R A;  1O5Z A;  1ZZW A;  4KYR A;  2I3U A;  4CVM A;  2C46 A;  4BJO A;  3BLT A;  2R0B A;  3QCZ A;  3QCM A;  4NWF A;  2QDM A;  4CVK A;  4NYH A;  1KAV A;  2CJZ A;  3I36 A;  2VEY A;  1NNY A;  2XJA A;  2B4S A;  2M3V A;  2FJN A;  2I42 A;  3AWG A;  3S4E A;  1C86 A;  4Y14 A;  3GXH A;  3HN7 A;  2B4O A;  4PVG A;  1YTN A;  4AZ1 A;  3N2A A;  2CMB A;  4GFU A;  4ERC A;  4BUB A;  1G4W R;  2CMC A;  2NT7 A;  2UUO A;  3GXG A;  1NL9 A;  3ZM1 A;  2HCM A;  1W7K A;  2VEX A;  3ZL8 A;  3F81 A;  5KAB A;  4OHL A;  3F9A A;  3EAX A;  3QCH A;  4S0G A;  1PH0 A;  1YWF A;  1G4U S;  1EEO A;  3NME A;  2P6X A;  2CNE A;  1NO6 A;  2A8B A;  1YFO A;  3RZ2 A;  1RPM A;  4NX8 A;  5KA9 A;  3ZM2 A;  3ZM5 A;  2WJP A;  2F6Z A;  2GC5 A;  1G1H A;  1A5Y A;  2J17 A;  3QCF A;  3V0J A;  2H03 A;  1NWL A;  2J16 A;  1XBO A;  2Y2F A;  4H34 A;  2ZN7 A;  1PTT A;  2PSZ A;  2I6J A;  3QCG A;  2QBQ A;  4C13 A;  3V0I A;  2CM2 A;  2F46 A;  5K22 A;  1SUG A;  1C88 A;  1Q6N A;  2CNG A;  3N0A A;  3QCB A;  3RGO A;  5HDE A;  1YTW A;  1C83 A;  4WU2 A;  1QXK A;  2I4E A;  3LJ8 A;  2AZR A;  2IMG A;  2VEU A;  1OES A;  1UAG A;  1T49 A;  1PA1 A;  2BGD A;  1EEH A;  4CVL A;  4QF5 A;  1OHC A;  5EHR A;  1I57 A;  5KA0 A;  4JMK A;  2GWO A;  5KA4 A;  2HB1 A;  1GG4 A;  1LAR A;  2MBC A;  2PI7 A;  1P3D A;  1GWZ A;  2VEV A;  1G7F A;  2FH7 A;  2P4D A;  1PTU A;  1ONY A;  3QCJ A;  3V0F A;  5KAA A;  3QCI A;  4OHD A;  1WCH A;  2FJM A;  1OEU A;  3O4T A;  3EB1 A;  1C84 A;  5KA1 A;  2XPC A;  5BX1 A;  2HY3 A;  5EHP A;  1C87 A;  2CFV A;  5I6V A;  2A3K A;  1J4X A;  2PBN A;  1YTS A;  2H4G A;  2Q47 A;  2GCB A;  2OOQ A;  1E0D A;  3O4U A;  3A5J A;  1Q6P A;  2PT0 A;  5K24 A;  1Q6M A;  1NWE A;  3QCC A;  2VTE A;  4JBC A;  4ZN5 A;  1OHE A;  5MMZ B;  4ICZ A;  1L8K A;  2F6W A;  2I4H A;  2JJD A;  3I80 A;  4QUM A;  2CNF A;  2G59 A;  2JFH A;  3QCD A;  1G7G A;  2NTA A;  4QAH A;  4OHI A;  1I9S A;  2NLK A;  2PA5 A;  3EU0 A;  2WGP A;  2F6Y A;  3V0G A;  3OMH A;  4JNB A;  4RDD A;  1RXD A;  1U26 A;  2Q05 A;  2Y1O A;  3PYZ A;  3I7Z A;  4TVV A;  4ZRT A;  1OEV A;  4GWF A;  3V0D A;  2CM7 A;  3V0E A;  2GJT A;  1W78 A;  1JBV A;  1FPZ A;  2PQ5 A;  2SHP A;  2VTD A;  4R0T A;  1J6U A;  2G6Z A;  2I6I A;  4Y2E A;  1P15 A;  1XM2 A;  1PA9 A;  3BLU A;  1QZ0 A;  2NV5 A;  4GRZ A;  3S4O A;  5BUG A;  2Y68 A;  1GFY A;  3H2X A;  5K25 A;  4NWG A;  5M43 A;  2ZMM A;  3QCK A;  3SR9 A;  5IBM A;  4HV4 A;  1FQ1 A;  3QKQ A;  4GE5 A;  4QBE A;  2I4G A;  3D1H A;  2GC6 A;  2I6O A;  4RI4 A;  4OHE A;  4WU3 A;  5A5F A;  4JMJ A;  3D44 A;  2QDP A;  1GQQ A;  4MBB A;  5AWX A;  2BIJ A;  2B3O A;  2GCA A;  1ONZ A;  2H4K A;  3UAG A;  2NT2 A;  4PYH A;  1XRI A;  3S3H A;  2B4U A;  4H1O A;  3F99 A;  5KA2 A;  1Q6T A;  2AHS A;  3MVN A;  3QKP A;  5BZX A;  3CM3 A;  2F6F A;  5KA3 A;  1AAX A;  4GFV A;  2F6T A;  3D9C A;  2CNH A;  2WTZ A;  3BM8 A;  1KAK A;  3SME A;  2UUP A;  2CM3 A;  2HVL A;  3O4S A;  1OET A;  3D1O A;  4ZIY A;  3U96 A;  3QCL A;  1R6H A;  3AWE A;  4I8N A;  1FPR A; 
#chains in the Genus database with same CATH homology
 1PTY A;  4Z6B A;  4RKK A;  1PTV A;  4KYQ A;  1OHD A;  3O3L A;  2BV5 A;  4KI9 A;  4GE2 A;  3CWE A;  3ZM3 A;  2QCT A;  1L8G A;  3A5K A;  4YAA A;  2F6V A;  4DGX A;  1EEN A;  4ZI4 A;  1BZH A;  4HJQ A;  4IKC A;  1OEM X;  2B49 A;  1C85 A;  1ZCL A;  5IBS A;  4WTY A;  2H4V A;  3D42 A;  3PS5 A;  1U25 A;  1U24 A;  1MKP A;  4RH9 A;  1ZC0 A;  2B4P A;  1M3G A;  2CM8 A;  1PYN A;  1Q1M A;  3RO1 A;  3O5X A;  1LYV A;  5K9V A;  4D3P A;  2H02 A;  3M4U A;  3MOW A;  3QCN A;  4OHH A;  3B7O A;  3ZMQ A;  2I6M A;  2HNQ A;  4BPC A;  1YZ4 A;  2QBS A;  5KAC A;  1XXP A;  1Q6S A;  2RF6 A;  1ZCK A;  1OEO X;  2OZ5 A;  1WAX A;  1V3A A;  2E0T A;  1YN9 A;  4D3R A;  3F41 A;  2QBR A;  1Q6J A;  4HJP A;  2HNP A;  3D1Q A;  2CNI A;  1VHR A;  3EMU A;  1YPT A;  4QBW A;  2QDC A;  3AWF A;  5GTJ A;  5J8R A;  1JLN A;  2DXP A;  2HXP A;  5KA8 A;  1JF7 A;  3V0H A;  4R30 A;  4DGP A;  2YDU A;  3S3E A;  3EZZ A;  4RH5 A;  1LQF A;  2Y96 A;  1BZC A;  2HC1 A;  2GP0 A;  2HC2 A;  4GS0 A;  1I9T A;  4HRF A;  5K9W A;  5BZZ A;  4YR8 B;  3S3K A;  5K23 A;  2QEP A;  3OLR A;  5KAD A;  2BZL A;  2I5X A;  3MMJ A;  1T4J A;  2OC3 A;  3RGQ A;  2BGE A;  1ECV A;  2B07 A;  1G1G A;  4WOH A;  3ZM0 A;  2I1Y A;  1T48 A;  3BRH A;  2QCJ A;  5KA7 A;  3MOZ A;  3ZV2 A;  3S3F A;  2F70 A;  2NZ6 A;  4RI5 A;  1YGU A;  4R0S A;  4QUN A;  1PXH A;  4GE6 A;  5LXQ B;  2OUD A;  4B04 A;  2H04 A;  1WRM A;  1BZJ A;  2I3R A;  4GRY A;  1YGR A;  4D3Q A;  3QCE A;  2F71 A;  2QBP A;  3ZMP A;  2C7S A;  1G1F A;  3F9B A;  4NND A;  2J16 B;  2ESB A;  4QAP A;  2CMA A;  1NZ7 A;  2I6P A;  2I75 A;  1X24 A;  4J51 A;  4RHG A;  1XXV A;  2VEW A;  1D5R A;  1ZZW A;  4KYR A;  2I3U A;  2C46 A;  4BJO A;  3BLT A;  2R0B A;  3QCM A;  4NWF A;  2QDM A;  4NYH A;  1KAV A;  2CJZ A;  3I36 A;  2VEY A;  1NNY A;  2B4S A;  2M3V A;  2FJN A;  2I42 A;  3AWG A;  3S4E A;  1C86 A;  4Y14 A;  3GXH A;  2B4O A;  4PVG A;  1YTN A;  4AZ1 A;  2CMB A;  4GFU A;  4ERC A;  1G4W R;  2CMC A;  2NT7 A;  3GXG A;  1NL9 A;  3ZM1 A;  2HCM A;  2VEX A;  5KAB A;  3F81 A;  4OHL A;  3F9A A;  3EAX A;  3QCH A;  4S0G A;  1PH0 A;  1YWF A;  1G4U S;  1EEO A;  3NME A;  2P6X A;  2CNE A;  1NO6 A;  2A8B A;  1YFO A;  3RZ2 A;  1RPM A;  4NX8 A;  5KA9 A;  3ZM2 A;  2F6Z A;  1G1H A;  1A5Y A;  2J17 A;  3QCF A;  3V0J A;  2H03 A;  1NWL A;  2J16 A;  1XBO A;  2Y2F A;  4H34 A;  2ZN7 A;  1PTT A;  2PSZ A;  2I6J A;  3QCG A;  2QBQ A;  3V0I A;  2CM2 A;  2F46 A;  5K22 A;  1SUG A;  1C88 A;  1Q6N A;  2CNG A;  3N0A A;  3QCB A;  3RGO A;  5HDE A;  1YTW A;  1C83 A;  4WU2 A;  1QXK A;  2I4E A;  3LJ8 A;  2AZR A;  2IMG A;  2VEU A;  1OES A;  1T49 A;  1PA1 A;  2BGD A;  1OHC A;  5EHR A;  1I57 A;  5KA0 A;  4JMK A;  2GWO A;  5KA4 A;  2HB1 A;  1LAR A;  2MBC A;  2PI7 A;  1GWZ A;  2VEV A;  1G7F A;  2FH7 A;  2P4D A;  1PTU A;  1ONY A;  3QCJ A;  3V0F A;  5KAA A;  3QCI A;  4OHD A;  1WCH A;  2FJM A;  1OEU A;  3O4T A;  3EB1 A;  1C84 A;  5KA1 A;  5BX1 A;  2HY3 A;  5EHP A;  1C87 A;  2CFV A;  5I6V A;  2A3K A;  1J4X A;  2PBN A;  1YTS A;  2H4G A;  2Q47 A;  2OOQ A;  3O4U A;  3A5J A;  1Q6P A;  2PT0 A;  5K24 A;  1Q6M A;  1NWE A;  3QCC A;  4JBC A;  4ZN5 A;  1OHE A;  5MMZ B;  4ICZ A;  1L8K A;  2F6W A;  2I4H A;  2JJD A;  3I80 A;  4QUM A;  2CNF A;  2G59 A;  3QCD A;  1G7G A;  2NTA A;  4QAH A;  4OHI A;  1I9S A;  2NLK A;  2PA5 A;  3EU0 A;  2WGP A;  2F6Y A;  3V0G A;  3OMH A;  4JNB A;  4RDD A;  1RXD A;  1U26 A;  2Q05 A;  3I7Z A;  4TVV A;  4ZRT A;  1OEV A;  4GWF A;  3V0D A;  2CM7 A;  3V0E A;  2GJT A;  1FPZ A;  2PQ5 A;  2SHP A;  4R0T A;  2G6Z A;  2I6I A;  4Y2E A;  1P15 A;  1XM2 A;  1PA9 A;  3BLU A;  1QZ0 A;  2NV5 A;  4GRZ A;  3S4O A;  5BUG A;  1GFY A;  3H2X A;  5K25 A;  4NWG A;  5M43 A;  2ZMM A;  3QCK A;  3SR9 A;  5IBM A;  1FQ1 A;  3QKQ A;  4GE5 A;  4QBE A;  2I4G A;  3D1H A;  2I6O A;  4RI4 A;  4WU3 A;  4OHE A;  4JMJ A;  3D44 A;  2QDP A;  4MBB A;  5AWX A;  2BIJ A;  2B3O A;  2H4K A;  1ONZ A;  2NT2 A;  4PYH A;  1XRI A;  3S3H A;  2B4U A;  4H1O A;  3F99 A;  5KA2 A;  1Q6T A;  2AHS A;  3QKP A;  5BZX A;  3CM3 A;  2F6F A;  5KA3 A;  1AAX A;  4GFV A;  2F6T A;  3D9C A;  2CNH A;  3BM8 A;  1KAK A;  3SME A;  2CM3 A;  2HVL A;  1OET A;  3O4S A;  3D1O A;  3U96 A;  3QCL A;  1R6H A;  3AWE A;  4I8N A;  1FPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...