2OOTA

A high resolution structure of ligand-free human glutamate carboxypeptidase ii
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
686
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title A high-resolution structure of ligand-free human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 265
structure length 686
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2ootA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2ootA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2ootA02
4C8UA 3I74A 2CTCA 4P6YA 1XFOA 4EFDA 3IIBA 3TX8A 5LYFA 1KWMA 3KGQA 2QJ8A 3KR5A 2HC9A 5K8NA 1ZG7A 4A39A 4P4JA 5ELYA 4UEFA 4UIBA 3S9NA 1ARMA 1TKHA 2PJ5A 1CP6A 2PJ2A 3FX6A 1F2PA 2PIZA 2PE3A 1H8LA 4OC2A 1XMBA 3WC7A 5LRJA 4ONWA 4R76A 3KZWA 4C8FA 2PJ1A 2OR4A 4H2KA 4C9UA 4UF4A 7CPAA 3KASA 2IMOA 3ISZA 1TKJA 3IJ3A 4GM5A 1EE3P 3HUVA 1YSJA 4R8FA 4UEEA 5F09A 1XBUA 3T8WA 1CPXA 4NJQA 3FH4A 4X8IA 3H8FA 4G1PA 4MCPA 3BI0A 2PJ8A 1LFWA 2C1CA 3CDXA 3SJGA 3B3TA 4NGQA 1CP7A 1YMEA 1DE4C 4YWYA 1Z8LA 3SI2A 4UEZA 2CIJA 2IJZA 3MN8A 2ZEGA 4PXEA 2DEAA 1Z5RA 2Q4ZA 5K8OA 4TNUA 4KNGE 5I4MA 1TXRA 5IB9A 1Y9ZA 2I3CA 4EMEA 5LYIA 3BHXA 1JQGA 4A38A 4NGPA 3K9TA 2PJCA 4C9EA 2EK8A 2BOAA 2XEIA 3D7HA 4DYOA 2PJ9A 2CTBA 3EIFA 3SJXA 3SI0A 1QQ9A 4MXUA 4PQAA 4A94A 1YW4A 4IK2A 2POKA 3S9MA 5K8PA 3BI1A 1CPSA 2ZEEA 1ARLA 3KQZA 3KHZA 2BO9A 3JRUA 4TJVA 3ICUA 1Y0RA 2IQ6A 2QYVA 4MMOA 2V8VA 3TC8A 3CPAA 1LOKA 2ZEFA 3GUXA 2PVVA 4NGNA 3B7IA 4C86A 4NJRA 2CF4A 3VARA 4P4IA 3QNVA 3WC6A 2C6GA 3B35A 3I6SA 4W9YA 2GLFA 1BPMA 3FVLA 1ZG9A 3FJUA 3VATA 3FEEA 1TF9A 3N5FA 5D8NA 4IAVA 1BLLE 4MHYA 5J1QA 1NSAA 2AFUA 2V77A 5JH9A 5HVFA 2XEJA 2C6CA 1ZLIA 5HVGA 3D68A 4OC5A 4B6ZA 3B2YA 4X2TA 2WZNA 4A37A 2WYRA 1F2OA 1LAPA 4ZY1A 3PB9X 3SJEA 4C8TA 1ZG8A 2Q43A 2GLJA 2NSMA 4C99A 3K2KA 4P44A 4WWVA 3NH4A 4OC0A 4FUUA 4PXDA 4ZYQA 3BXMA 2F7VA 3B3WA 3WC5A 4ZY0A 4C8CA 4MCRA 2RFHA 4P4EA 3I1UA 4FAIA 4OIWA 4O23A 2HB6A 1UWYA 3GB0A 3V38A 2PJBA 3VH9A 1LCPA 4C9VA 2V8GA 2AFSA 3PBEA 3D7DA 2PIYA 3RAMA 1IY7A 4NGMA 3NA6A 4MHZA 1R3NA 3H8GA 3MRUA 3D67A 3CT9A 1RTQA 5D29A 4P4FA 2QVPA 4TJXA 4F8ZA 1GYTA 4NGTA 2PVWA 2V8HA 4PXBA 2PJ4A 1ELMP 4C84A 1HDUA 3FEDA 4PXCA 1WVMA 5HVHA 1FNOA 4JYWA 1Y0YA 3V7ZA 1OBRA 2ZEOA 2ZENA 2EWBA 4DUKA 3PRTA 3WABA 4C9AA 1Y7EA 5HXDA 4ZX9A 4FBEA 4LQGA 3KQXA 1YW6A 1HDQA 2C6PA 4MHPA 1ZLHA 4F9VA 2PJ7A 1VHEA 3RBUA 3IEHA 3FECA 4AXVA 5JGFA 1VHOA 4OC4A 3ISXA 4YN3A 4R6TA 1LANA 2AFZA 4RUHA 3GLJA 4P4DA 2F8HA 4NFRA 3KHXA 4C85A 3L2NA 1Z2LA 2BCOA 4CDJA 3IWWA 5LYDA 1PCAA 4MCQA 1HEEA 3PB6X 2ANPA 4IHMA 5LYLA 1VGYA 3B3VA 4CPAA 2RB7A 1IGBA 3LWUA 2VL1A 1AYEA 3KR4A 2JBJA 5DS0A 4MRIA 1TF8A 1CX8A 2AFXA 4P45A 4TWEA 2AFOA 3D4UA 4K3NA 4R7MA 1XRYA 5THWA 1Q7LA 2PJ0A 4F9UA 4C9RA 5LRKA 2ZOFA 4JZ0A 2EK9A 3IO1A 1LAMA 3PFEA 1R43A 4OIDA 2XEGA 3CPXA 4ZX8A 2JEWA 3D7FA 2O4HA 4PPZA 1XF1A 2OOTA 2AFWA 3KL9A 2G9DA 1ELLP 3PB4X 2V8DA 4C8PA 3IC1A 1BPNA 2NYQA 3SI1A 4OC1A 3IFEA 2GU2A 2J9AA 3HLPA 3B3SA 3NFZA 4P10A 1M4LA 4WJBA 4ZI6A 4BD9A 3FF3A 4P4BA 2JBKA 3NH5A 4DJLA 1DTDA 2PRQA 1V6CA 3SJFA 3DGVA 1CBXA 3PBBA 3PFOA 5CBMA 4OMEA 3D7GA 3RZAA 3FMCA 3S9LA 1QMUA 8CPAA 3VTAA 2O53A 3KI9A 4Q7AA 1TKFA 2PJ6A 2PJAA 1CG2A 3DLJA 4KSIA 4OP4A 1XJOA 2ZOGA 1BAVA 4UIAA 1F57A 1PYTB 4MCSA 5CPAA 4Z65A 1FT7A 4C8AA 3H8EA 3PEIA 2AFMA 2GREA 4YU9A 2Q51A 3D66A 2ZEDA 4EWTA 4NGSA 1VIXA 1YLOA 4NGRA 2ZEPA 4OC3A 4X3RA 2ZELA 3LMSA 4OKOA 4FWUA 1AMPA 2FVGA 3B3CA 3PB8X 3WT4A 2ZEHA 6CPAA 4CDKA 2XEFA 5LRGA 5K8MA 2PJ3A 5JM6A 4MHNA 4ZY2A 2PCUA 3NH8A 2ZEMA 2ABZA 3PB7X
chains in the Genus database with same CATH superfamily
4C8UA 3I74A 2CTCA 4C7IA 4P6YA 3TLBA 1XFOA 2VZZA 2Z0ZA 4MBUA 3ZNIA 4A4CA 4M3SA 3CXPA 4EFDA 5IV0A 3IIBA 5F1YA 3TX8A 4DNCA 1Q2CA 3RNZA 4CZ1A 4F0YA 5LYFA 2B4DA 4RN7A 3K4IA 1KWMA 3KGQA 2QJ8A 5I0CA 3KR5A 3MGDA 4QBJA 4NF1A 2HC9A 4UCNA 4L89A 5K8NA 5ISVA 1ZG7A 3GIUA 5AG6A 4A39A 4QUSA 3T05A 2ZW5A 4COGA 4P4JA 5ELYA 1NMTA 2Q0YA 4UEFA 5A28A 4UIBA 5EBVA 3S9NA 1ARMA 1TKHA 2PJ5A 4CAWA 1CP6A 2PJ2A 3FX6A 1F2PA 2PIZA 2PE3A 1H8LA 3H4QA 4R87A 4OC2A 1XMBA 3WC7A 3UY5A 3FIXA 3TFYA 5LRJA 1NXJA 1VBHA 1QSRA 1S3ZA 4ONWA 4CRYB 4R76A 2GIVA 3EC4A 3SR3A 2J8NA 3KZWA 4C8FA 3O8ZA 2GE3A 2PJ1A 2YJVA 4B10A 2J8MA 5EC4A 2OR4A 4ORFA 4H2KA 4C9UA 1Q2DA 4A30A 1LRZA 3BLNA 4UF4A 7CPAA 3GY9A 1J4JA 5IX3A 2R1IA 4QVTA 4AVCA 2Z3OA 3KASA 2IMOA 3ISZA 4J0NA 3SI0A 2PR8A 1TKJA 3IJ3A 1IB1E 1R57A 4GM5A 5F48A 1EE3P 3HUVA 2ZPAA 1IICA 4CAFA 3K9UA 4CRZB 3EZAA 1YSJA 2QECA 1MJBA 4CGLA 4R8FA 4UEEA 5F09A 4II9A 1XBUA 3T8WA 3TLGB 4E94A 4EVYA 1CPXA 3OP0A 2PR1A 4BPUB 4BPXB 4NJQA 3FH4A 5IB0A 4X8IA 1YVOA 2FIWA 2G3TA 2P6EA 4GXHA 2YNEA 3H8FA 5JPHA 4G1PA 4MCPA 2B3VA 4E2AA 3H5ZA 3BI0A 2PJ8A 3DR8A 3I3GA 1LFWA 2C1CA 1VKCA 1FBVA 2OZHA 3SJGA 3B3TA 3CDXA 2Y0MA 4NGQA 1CP7A 1YMEA 4CS0B 1DE4C 4YWYA 1Z8LA 4XPDC 3SI2A 1RO5A 4UEZA 3G23A 2CIJA 2X7BA 2IJZA 4KLVA 5F49A 3MN8A 2ZEGA 4PXEA 2DEAA 1S7KA 4AVAA 4MFPA 1Z5RA 2P6FA 4KOYA 2Q4ZA 1CS0B 3EZBA 5K8OA 4TNUA 4KNGE 1BO4A 3VGOA 3TTHA 5I4MA 1XE4A 3DNSA 1TXRA 3LACA 5IB9A 2I3CA 2J8RA 2ODFA 1IIDA 4XNHC 4EMEA 1Y9ZA 3TLGA 3P2HA 5LYIA 3BHXA 1JQGA 2R7HA 3WR7A 4B14A 2REEA 4NGPA 3K9TA 4A38A 3BUOB 2PJCA 2EK8A 1C3OB 2BOAA 4C9EA 2YNCC 2OH1A 1AUGA 3C26A 1JDEA 2XEIA 3D7HA 2B4JC 1M4GA 4DYOA 2PJ9A 2CTBA 3EIFA 3P2FA 4HKFA 3SJXA 2DXQA 2OZGA 2VQYA 3D3SA 4QC6A 1QSMA 4U9YA 1QQ9A 4GS4A 4MXUA 4JWPA 4PQAA 4C7HA 3GKRA 3GJZA 4A94A 4AVBA 1QSOA 2G0BA 5IR2A 1YW4A 4IK2A 2POKA 3S9MA 3EXNA 2NMTA 1P4NA 5K8PA 3BUXB 1KBLA 2I79A 3BI1A 4MY3A 1CPSA 3VWDA 1UFHA 1ARLA 2ZEEA 3KQZA 1P0HA 5A27A 1S5KA 3KHZA 4F6AA 2BO9A 2B5GB 3JRUA 4CO9A 3B8GA 3BJ7A 4E8OA 1IYKA 4UWIA 1EO0A 5FVJA 2CY2A 2FXFA 3ICUA 4TJVA 1Y0RA 3TO9A 2IQ6A 2QYVA 4MFLA 2Y1NA 3HPHE 4KSFA 4MMOA 3ZZIA 2V8VA 3TYXA 2GP4A 3TO6A 3TC8A 2DF5A 1KC7A 3CPAA 1LOKA 2ZEFA 3GUXA 2R8VA 5GCNA 2PVVA 4NGNA 3OAKA 1Y9WA 3B7IA 4R9MA 4C86A 4YGOA 2PSWA 2AUMA 3JTKA 2OLSA 1YVHA 1YGHA 2CF4A 4H6UA 4NJRA 1EZAA 4KOWA 3VARA 5KTDA 2BUEA 1RXTA 4P4IA 4Q36A 2OU2A 3QNVA 2AJ6A 2C6GA 3WC6A 4C68A 4CAVA 1Q5XA 1ZL0A 3B35A 1YQEA 4MFZA 3I6SA 4W9YA 2GLFA 5JQ4A 2FE7A 1BPMA 3BUNB 2B5GA 3FVLA 3W6SA 1ZG9A 1GHEA 3IWGA 3HMJG 1PUAA 3FJUA 4CGPA 3NFQA 5CNPA 3VATA 3FEEA 3DSBA 2ARHA 2ATRA 4NCZA 1TF9A 3N5FA 3PZJA 1JWQA 5D8NA 3TOAA 4IAVA 1BLLE 4MHYA 4KUBA 1VHSA 5H84A 1ZYMA 3QAHA 3NE8A 5J1QA 5AXIA 2EVNA 3W91A 4PK2A 1NSAA 2AFUA 2V77A 5G22A 4KOTA 5HVFA 5JH9A 5AG5A 2XEJA 1OZPA 2C6CA 1ZLIA 3FRMA 5HVGA 3D68A 2P6GA 4OC5A 4B6ZA 4UBRA 3B2YA 2WUUA 2ZW6A 3T90A 2DLAA 2QMLA 4X2TA 4R3KA 3G3SA 2Z3LA 2WZNA 2JLMA 2JDDA 3D8PA 4A37A 2WYRA 2P0WA 1F2OA 1LAPA 3S6HA 2EBJA 4IUSA 1WWZA 1ZO0A 2B58A 5G20A 4KUAA 3PB9X 4LQ6A 3IU2A 1KUVA 4ZY1A 3SJEA 3D2PA 1A2ZA 4C8TA 1M4IA 2PCNA 1ZG8A 2Q43A 1FY7A 2GLJA 2NSMA 4C99A 3R95A 3K2KA 4XPKA 2IL4A 2KCWA 4C2ZA 4P44A 3IWEA 3PT1A 3NH4A 4WWVA 2YGWA 1Y9KA 5HMNA 3TOBA 4OC0A 1Z8XA 3EY5A 3VRRA 4FUUA 4PXDA 3QB8A 2ZXVA 3BXMA 4ZYQA 4JD6A 2Y1MA 2F7VA 3B3WA 2VI7A 3FXTA 4CAXA 3WC5A 2B4BA 4ZY0A 4C8CA 1Q2YA 4MCRA 2FS5A 4X5KA 2AE6A 2RFHA 2Z11A 4AG7A 3TLYA 4P4EA 3I1UA 4FAIA 4XPLA 4OIWA 4O23A 3F9KC 2HB6A 2AUNA 1UWYA 2PRBA 2BL1A 3W6XA 3VRQA 2Z3NA 3GB0A 3V38A 4KLWA 4C2YA 2PJBA 1M4DA 1U6MA 3SXOA 3VH9A 3KRVA 2XPLA 1LCPA 4INJA 4KOSA 4C9VA 2O28A 3GYAA 5HH1A 5HKWA 1T36B 5K99A 1X12A 2AFSA 2V8GA 5FD8A 4MJ8A 3PBEA 2JEVA 3PGPA 3S6KA 3D7DA 1PU9A 4BD9A 2QIRA 4BINA 2PIYA 1DIKA 3RAMA 1NBWA 4B13A 1IY7A 4H1HA 4NGMA 3NA6A 1TIQA 4FD5A 4HNWB 4MHZA 3CZXA 1R3NA 2Q7SA 3H8GA 4EYSA 3MRUA 2VBQA 3D67A 3CT9A 4I49A 1RTQA 4KOVA 5D29A 4PSXA 3NE7A 4P4FA 4A31A 1J3LA 1YREA 2QVPA 1M44A 3E0KA 1BXRB 3PB7X 4TJXA 2BEIA 4U9ZA 4UFVA 3TLCA 1S7FA 4F8ZA 1GYTA 3SHPA 4NGTA 3SXNA 5EMIA 4JJXA 4UA3A 2PVWA 2HWGA 2V8HA 3OB2B 1N71A 4PXBA 2PJ4A 4CGMA 1ELMP 4C84A 2N3AB 1HDUA 5F47A 3F8KA 4HNYB 3FEDA 4MY0A 4KORA 4NSQA 1C30B 2HV2A 4UFWA 4PXCA 2B0AA 1WVMA 2YNCA 5C82A 5E96A 4MJXA 4COBA 2Z3MA 1FNOA 3BUWB 4YFJA 5HVHA 3C8OA 1VBGA 4F0XA 5F13A 2FCKA 4JYWA 1Y0YA 3V7ZA 3TT2A 3T07A 1OBRA 1B47A 2ZEOA 2ZENA 2EWBA 4KVME 4R3LA 5J3XA 4DUKA 2BSWA 3PRTA 3F5BA 3DR6A 3WABA 3BJ8A 2EZBA 5F9MA 4C9AA 2VKZG 1Y7EA 2DPSA 3A9LA 4ZX9A 4FBEA 5HXDA 4LQGA 3KQXA 2PQ8A 3R9GA 1YW6A 5JVLA 1HDQA 1S7NA 2C6PA 1CJWA 1YX0A 4MHPA 1ZLHA 2CXAA 4B5OA 1XEBA 4CGNA 2HROA 3LD2A 1I12A 1VHEA 2PJ7A 3DDDA 4F9VA 4UCMA 2EZCA 3RBUA 4MFKA 3FYNA 2UV8G 3IEHA 3FECA 4AXVA 2PC1A 1VHOA 4OC4A 3ISXA 5JGFA 3FNCA 4QB9A 4CGOA 4UWJA 3OWCA 4YRHA 1IU8A 4YN3A 2Q4VA 4RR2B 2R98A 2ZW4A 4M6GA 4R6TA 5BWAB 2OB0A 3PLFB 1LANA 1NE9A 2AFZA 1Z8TA 4A32A 4RUHA 3GLJA 4P4DA 1XMTA 2F8HA 3KHXA 4NFRA 1KUXA 4RI1A 4C85A 3TCVA 3L2NA 1EZBA 1Z2LA 5AG4A 2Q7BA 2BCOA 4KOUA 4CDJA 3IWWA 2Z10A 5LYDA 1PCAA 4MCQA 1B6BA 4CYOA 4CYQA 1HEEA 3PB6X 4IF5A 2RC4A 2ANPA 2EZAA 3RYOA 2VXKA 4IHMA 1CE8B 5LYLA 1VGYA 3VRPA 5C88A 3B3VA 4CPAA 4KZTA 5BY0A 2RB7A 1IGBA 3LWUA 2HI6A 2WPXA 2VL1A 1AYEA 1S60A 5DWMA 2EO8A 3JVNA 5F46A 2YJTA 1XOVA 1NSLA 1B87A 3TLEA 2JBJA 3I9SA 3KR4A 1I21A 5DS0A 4MRIA 1TF8A 4MI4A 1Y7RA 1CX8A 1KUYA 4P45A 2AFXA 2JDCA 2AFOA 3D4UA 4TWEA 4K3NA 4Y49C 1Z4RA 4R7MA 3V8IA 3U1BA 1XIXA 1VI4A 1XRYA 1IOIA 4LUAA 4R57A 5THWA 1Q7LA 2PJ0A 4JXRA 4F9UA 5LRKA 4C9RA 2ZOFA 4JZ0A 3TE4A 3T0TA 4KVOE 2EK9A 2WSAA 2Q04A 1BOBA 3IO1A 1LAMA 1M6VB 2D4PA 3PFEA 1R43A 4M85A 4OIDA 2XEGA 2C27A 3CPXA 2JEWA 4Q38A 3D7FA 2O4HA 4ZX8A 3ZJ0A 4ZGYB 3EZEA 4PPZA 5H86A 1XF1A 2WPWA 2OOTA 2AFWA 1MJAA 2G9DA 1ELLP 3KL9A 1I1DA 4XPDB 3PB4X 1IYLA 2V8DA 3S6GA 1ZRSA 2HQYA 4C8PA 4KS9A 4IIYA 2FT0A 3R9EA 1K4JA 1R61A 3IC1A 1BPNA 3IU1A 2NYQA 4PK3A 4CAEA 3PFVA 5AG7A 2A4NA 1Z9EA 3R1KA 5AGEA 3SI1A 5HKZA 1YR0A 3CXSA 1MK4A 4OC1A 1A9XB 3IFEA 1KEEB 2GU2A 4NEXA 2J9AA 2OZUA 3HLPA 4XNHB 3B3SA 1JDBC 3IGRA 3NFZA 4P10A 1YK3A 2CNTA 2XPPA 4HPSA 1M4LA 4WJBA 2R82A 1V0CA 2PDOA 4ZI6A 2VEZA 3FF3A 4P4BA 2JBKA 3NH5A 2CNMA 2HUZA 4PSWA 5G21A 1DTDA 1Z4EA 4DJLA 2PRQA 3OB1B 3FBUA 2YNDA 1WK4A 1V6CA 3SJFA 1CBXA 1KZFA 2Z3PA 3DGVA 3PBBA 3PFOA 4FD4A 3LODA 4KVXA 4A2ZA 5CBMA 4BTFA 1XF8A 4U5YA 4M6IA 4C2XA 4OMEA 3D7GA 4ONUA 3R96A 3RZAA 5F5XA 3FMCA 4J3GA 3BUMB 3S9LA 1WJTA 1QMUA 4E0AA 8CPAA 4UFXA 3VTAA 2O53A 3KI9A 4MFJA 4MHDA 4AG9A 4Q7AA 3VWEA 1TKFA 3CXQA 4KSAA 4BMHA 2PJ6A 4JXQA 1GGOA 2I00A 2PJAA 4UCPA 4A95A 2F5IA 5KTAA 2Q4YA 5JYBA 2XPOA 1CG2A 3DLJA 5J8CA 2DIKA 2MP0A 4KSIA 1QSTA 1XJOA 4OP4A 4A33A 2ZOGA 1BAVA 4UIAA 4A4BA 2Q44A 3R9FA 4NXYA 2D0PA 1F57A 1MJ9A 4OLLA 3U88C 1PYTB 3VRNA 3TLAA 4B12A 4MCSA 4K30A 3S6FA 5CPAA 4Z65A 1FT7A 4C8AA 3H8EA 2EUIA 2G3AA 4B11A 2FM4A 2X0SA 1S7LA 3PEIA 5J8FA 4MI1A 1ON0A 3PP9A 3F0AA 2AFMA 4OADA 1YVKA 3D2MA 4GPLB 5HKYA 2GREA 2D0OA 4YU9A 4BPWB 3KKWA 2Q51A 1Z8WA 3D66A 2C5QA 3RO0A 2ZEDA 4EWTA 4LX9A 4NGSA 1VIXA 2H5MA 3QAYA 1CM0A 1X10A 3VROA 4RS2A 2E28A 4H89A 2XPNA 1QSNA 4B5PB 3G8WA 5KTCA 2ZW7A 1YLOA 4NGRA 1YLEA 3EO4A 3N7ZA 3NOJA 4IIXA 2FSRA 4M8DA 4L8AA 3TLZA 2ZEPA 2CBLA 2Z3KA 2VZYA 4OC3A 5G1ZA 4HNXB 4E5SA 5DWNA 2GFQA 4X3RA 2ZELA 3TO7A 4M6HA 4CYNA 3LMSA 4AB7A 4OKOA 4FWUA 2CNSA 4KOXA 1AMPA 2FVGA 3B3CA 2B4DB 3PB8X 2K5TA 2FL4A 3WT4A 2ZEHA 3FB3A 1L0CA 1Z9UA 1SQHA 2DPTA 2FIAA 4H6ZA 1IOFA 1M1DA 6CPAA 4JLYA 4CDKA 4CYPA 2B3UA 4FD7A 4JVOA 2REFA 4PV6A 4OAEA 2XEFA 4Y49B 5LRGA 2D4OA 2PJ3A 5K8MA 4FD6A 4MHNA 4ZY2A 4B5PA 4MFQA 3T9YA 4BBHA 5JM6A 2PCUA 3T5MA 3NH8A 3EFAA 2ZEMA 2ABZA 2GANA 4ZBGA 3HPGG 3JUWA
chains in the Genus database with same CATH topology
4C8UA 3I74A 2CTCA 4P6YA 1XFOA 4EFDA 3IIBA 3TX8A 5LYFA 1KWMA 3KGQA 2QJ8A 3KR5A 2HC9A 5K8NA 1ZG7A 4A39A 4P4JA 5ELYA 4UEFA 4UIBA 3S9NA 1ARMA 1TKHA 2PJ5A 1CP6A 2PJ2A 3FX6A 1F2PA 2PIZA 2PE3A 1H8LA 4OC2A 1XMBA 3WC7A 5LRJA 4ONWA 4R76A 3KZWA 4C8FA 2PJ1A 2OR4A 4H2KA 4C9UA 4UF4A 7CPAA 3KASA 2IMOA 3ISZA 1TKJA 3IJ3A 4GM5A 1EE3P 3HUVA 1YSJA 4R8FA 4UEEA 5F09A 1XBUA 3T8WA 1CPXA 4NJQA 3FH4A 4X8IA 3H8FA 4G1PA 4MCPA 3BI0A 2PJ8A 1LFWA 2C1CA 3CDXA 3SJGA 3B3TA 4NGQA 1CP7A 1YMEA 1DE4C 4YWYA 1Z8LA 3SI2A 4UEZA 2CIJA 2IJZA 3MN8A 2ZEGA 4PXEA 2DEAA 1Z5RA 2Q4ZA 5K8OA 4TNUA 4KNGE 5I4MA 1TXRA 5IB9A 1Y9ZA 2I3CA 4EMEA 5LYIA 3BHXA 1JQGA 4A38A 4NGPA 3K9TA 2PJCA 4C9EA 2EK8A 2BOAA 2XEIA 3D7HA 4DYOA 2PJ9A 2CTBA 3EIFA 3SJXA 3SI0A 1QQ9A 4MXUA 4PQAA 4A94A 5IR2A 1YW4A 4IK2A 2POKA 3S9MA 5K8PA 3BI1A 1CPSA 2ZEEA 1ARLA 3KQZA 3KHZA 2BO9A 3JRUA 4TJVA 3ICUA 1Y0RA 2IQ6A 2QYVA 4MMOA 2V8VA 2GP4A 3TC8A 3CPAA 1LOKA 2ZEFA 3GUXA 2PVVA 4NGNA 3B7IA 4C86A 4NJRA 2CF4A 3VARA 4P4IA 3QNVA 3WC6A 2C6GA 3B35A 3I6SA 4W9YA 2GLFA 1BPMA 3FVLA 1ZG9A 3FJUA 3VATA 3FEEA 1TF9A 3N5FA 5D8NA 4IAVA 1BLLE 4MHYA 5J1QA 1NSAA 2AFUA 2V77A 5JH9A 5HVFA 2XEJA 2C6CA 1ZLIA 5HVGA 3D68A 4OC5A 4B6ZA 3B2YA 4X2TA 2WZNA 4A37A 2WYRA 1F2OA 1LAPA 4ZY1A 3PB9X 3SJEA 4C8TA 1ZG8A 2Q43A 2GLJA 2NSMA 4C99A 3K2KA 4P44A 4WWVA 3NH4A 4OC0A 4FUUA 4PXDA 4ZYQA 3BXMA 2F7VA 3B3WA 3WC5A 4ZY0A 4C8CA 4MCRA 2RFHA 4P4EA 3I1UA 4FAIA 4OIWA 4O23A 2HB6A 1UWYA 3GB0A 3V38A 2PJBA 3VH9A 1LCPA 4C9VA 2V8GA 2AFSA 3PBEA 3D7DA 2PIYA 3RAMA 1IY7A 4NGMA 3NA6A 4MHZA 1R3NA 3H8GA 3MRUA 3D67A 3CT9A 1RTQA 5D29A 4P4FA 2QVPA 4TJXA 4F8ZA 1GYTA 4NGTA 2PVWA 2V8HA 4PXBA 2PJ4A 1ELMP 4C84A 1HDUA 3FEDA 4PXCA 1WVMA 5HVHA 1FNOA 4JYWA 1Y0YA 3V7ZA 1OBRA 2ZEOA 2ZENA 2EWBA 4DUKA 3PRTA 3WABA 4C9AA 1Y7EA 5HXDA 4ZX9A 4FBEA 4LQGA 3KQXA 1YW6A 1HDQA 2C6PA 4MHPA 1ZLHA 4F9VA 2PJ7A 1VHEA 3RBUA 3IEHA 3FECA 4AXVA 5JGFA 1VHOA 4OC4A 3ISXA 4YN3A 4R6TA 1LANA 2AFZA 4RUHA 3GLJA 4P4DA 2F8HA 4NFRA 3KHXA 4C85A 3L2NA 1Z2LA 2BCOA 4CDJA 3IWWA 5LYDA 1PCAA 4MCQA 1HEEA 3PB6X 2ANPA 4IHMA 5LYLA 1VGYA 3B3VA 4CPAA 2RB7A 1IGBA 3LWUA 2VL1A 1AYEA 3KR4A 2JBJA 5DS0A 4MRIA 1TF8A 1CX8A 2AFXA 4P45A 4TWEA 2AFOA 3D4UA 4K3NA 4R7MA 1XRYA 5THWA 1Q7LA 2PJ0A 4F9UA 4C9RA 5LRKA 2ZOFA 4JZ0A 2EK9A 3IO1A 1LAMA 3PFEA 1R43A 4OIDA 2XEGA 3CPXA 4ZX8A 2JEWA 3D7FA 2O4HA 4PPZA 1XF1A 2OOTA 2AFWA 3KL9A 2G9DA 1ELLP 3PB4X 2V8DA 4C8PA 3IC1A 1BPNA 2NYQA 3SI1A 4OC1A 3IFEA 2GU2A 2J9AA 3HLPA 3B3SA 3NFZA 4P10A 1M4LA 4WJBA 4ZI6A 4BD9A 3FF3A 4P4BA 2JBKA 3NH5A 4DJLA 1DTDA 2PRQA 1V6CA 3SJFA 3DGVA 1CBXA 3PBBA 3PFOA 5CBMA 4OMEA 3D7GA 3RZAA 3FMCA 3S9LA 1QMUA 8CPAA 3VTAA 2O53A 3KI9A 4Q7AA 1TKFA 2PJ6A 2PJAA 1CG2A 3DLJA 4KSIA 4OP4A 1XJOA 2ZOGA 1BAVA 4UIAA 1F57A 1PYTB 4MCSA 5CPAA 4Z65A 1FT7A 4C8AA 3H8EA 3PEIA 2AFMA 2GREA 4YU9A 2Q51A 3D66A 2C5QA 2ZEDA 4EWTA 4NGSA 1VIXA 1YLOA 4NGRA 2ZEPA 4OC3A 4X3RA 2ZELA 3LMSA 4OKOA 4FWUA 1AMPA 2FVGA 3B3CA 3PB8X 3WT4A 2ZEHA 6CPAA 4CDKA 2XEFA 5LRGA 5K8MA 2PJ3A 5JM6A 4MHNA 4ZY2A 2PCUA 3NH8A 2ZEMA 2ABZA 3PB7X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8U A;  3I74 A;  2CTC A;  4P6Y A;  1XFO A;  4EFD A;  3IIB A;  3TX8 A;  5LYF A;  1KWM A;  3KGQ A;  2QJ8 A;  3KR5 A;  2HC9 A;  5K8N A;  1ZG7 A;  4A39 A;  4P4J A;  5ELY A;  4UEF A;  4UIB A;  3S9N A;  1ARM A;  1TKH A;  2PJ5 A;  1CP6 A;  2PJ2 A;  3FX6 A;  1F2P A;  2PIZ A;  2PE3 A;  1H8L A;  4OC2 A;  1XMB A;  3WC7 A;  5LRJ A;  4ONW A;  4R76 A;  3KZW A;  4C8F A;  2PJ1 A;  2OR4 A;  4H2K A;  4C9U A;  4UF4 A;  7CPA A;  3KAS A;  2IMO A;  3ISZ A;  1TKJ A;  3IJ3 A;  4GM5 A;  1EE3 P;  3HUV A;  1YSJ A;  4R8F A;  4UEE A;  5F09 A;  1XBU A;  3T8W A;  1CPX A;  4NJQ A;  3FH4 A;  4X8I A;  3H8F A;  4G1P A;  4MCP A;  3BI0 A;  2PJ8 A;  1LFW A;  2C1C A;  3CDX A;  3SJG A;  3B3T A;  4NGQ A;  1CP7 A;  1YME A;  1DE4 C;  4YWY A;  1Z8L A;  3SI2 A;  4UEZ A;  2CIJ A;  2IJZ A;  3MN8 A;  2ZEG A;  4PXE A;  2DEA A;  1Z5R A;  2Q4Z A;  5K8O A;  4TNU A;  4KNG E;  5I4M A;  1TXR A;  5IB9 A;  1Y9Z A;  2I3C A;  4EME A;  5LYI A;  3BHX A;  1JQG A;  4A38 A;  4NGP A;  3K9T A;  2PJC A;  4C9E A;  2EK8 A;  2BOA A;  2XEI A;  3D7H A;  4DYO A;  2PJ9 A;  2CTB A;  3EIF A;  3SJX A;  3SI0 A;  1QQ9 A;  4MXU A;  4PQA A;  4A94 A;  1YW4 A;  4IK2 A;  2POK A;  3S9M A;  5K8P A;  3BI1 A;  1CPS A;  2ZEE A;  1ARL A;  3KQZ A;  3KHZ A;  2BO9 A;  3JRU A;  4TJV A;  3ICU A;  1Y0R A;  2IQ6 A;  2QYV A;  4MMO A;  2V8V A;  3TC8 A;  3CPA A;  1LOK A;  2ZEF A;  3GUX A;  2PVV A;  4NGN A;  3B7I A;  4C86 A;  4NJR A;  2CF4 A;  3VAR A;  4P4I A;  3QNV A;  3WC6 A;  2C6G A;  3B35 A;  3I6S A;  4W9Y A;  2GLF A;  1BPM A;  3FVL A;  1ZG9 A;  3FJU A;  3VAT A;  3FEE A;  1TF9 A;  3N5F A;  5D8N A;  4IAV A;  1BLL E;  4MHY A;  5J1Q A;  1NSA A;  2AFU A;  2V77 A;  5JH9 A;  5HVF A;  2XEJ A;  2C6C A;  1ZLI A;  5HVG A;  3D68 A;  4OC5 A;  4B6Z A;  3B2Y A;  4X2T A;  2WZN A;  4A37 A;  2WYR A;  1F2O A;  1LAP A;  4ZY1 A;  3PB9 X;  3SJE A;  4C8T A;  1ZG8 A;  2Q43 A;  2GLJ A;  2NSM A;  4C99 A;  3K2K A;  4P44 A;  4WWV A;  3NH4 A;  4OC0 A;  4FUU A;  4PXD A;  4ZYQ A;  3BXM A;  2F7V A;  3B3W A;  3WC5 A;  4ZY0 A;  4C8C A;  4MCR A;  2RFH A;  4P4E A;  3I1U A;  4FAI A;  4OIW A;  4O23 A;  2HB6 A;  1UWY A;  3GB0 A;  3V38 A;  2PJB A;  3VH9 A;  1LCP A;  4C9V A;  2V8G A;  2AFS A;  3PBE A;  3D7D A;  2PIY A;  3RAM A;  1IY7 A;  4NGM A;  3NA6 A;  4MHZ A;  1R3N A;  3H8G A;  3MRU A;  3D67 A;  3CT9 A;  1RTQ A;  5D29 A;  4P4F A;  2QVP A;  4TJX A;  4F8Z A;  1GYT A;  4NGT A;  2PVW A;  2V8H A;  4PXB A;  2PJ4 A;  1ELM P;  4C84 A;  1HDU A;  3FED A;  4PXC A;  1WVM A;  5HVH A;  1FNO A;  4JYW A;  1Y0Y A;  3V7Z A;  1OBR A;  2ZEO A;  2ZEN A;  2EWB A;  4DUK A;  3PRT A;  3WAB A;  4C9A A;  1Y7E A;  5HXD A;  4ZX9 A;  4FBE A;  4LQG A;  3KQX A;  1YW6 A;  1HDQ A;  2C6P A;  4MHP A;  1ZLH A;  4F9V A;  2PJ7 A;  1VHE A;  3RBU A;  3IEH A;  3FEC A;  4AXV A;  5JGF A;  1VHO A;  4OC4 A;  3ISX A;  4YN3 A;  4R6T A;  1LAN A;  2AFZ A;  4RUH A;  3GLJ A;  4P4D A;  2F8H A;  4NFR A;  3KHX A;  4C85 A;  3L2N A;  1Z2L A;  2BCO A;  4CDJ A;  3IWW A;  5LYD A;  1PCA A;  4MCQ A;  1HEE A;  3PB6 X;  2ANP A;  4IHM A;  5LYL A;  1VGY A;  3B3V A;  4CPA A;  2RB7 A;  1IGB A;  3LWU A;  2VL1 A;  1AYE A;  3KR4 A;  2JBJ A;  5DS0 A;  4MRI A;  1TF8 A;  1CX8 A;  2AFX A;  4P45 A;  4TWE A;  2AFO A;  3D4U A;  4K3N A;  4R7M A;  1XRY A;  5THW A;  1Q7L A;  2PJ0 A;  4F9U A;  4C9R A;  5LRK A;  2ZOF A;  4JZ0 A;  2EK9 A;  3IO1 A;  1LAM A;  3PFE A;  1R43 A;  4OID A;  2XEG A;  3CPX A;  4ZX8 A;  2JEW A;  3D7F A;  2O4H A;  4PPZ A;  1XF1 A;  2OOT A;  2AFW A;  3KL9 A;  2G9D A;  1ELL P;  3PB4 X;  2V8D A;  4C8P A;  3IC1 A;  1BPN A;  2NYQ A;  3SI1 A;  4OC1 A;  3IFE A;  2GU2 A;  2J9A A;  3HLP A;  3B3S A;  3NFZ A;  4P10 A;  1M4L A;  4WJB A;  4ZI6 A;  4BD9 A;  3FF3 A;  4P4B A;  2JBK A;  3NH5 A;  4DJL A;  1DTD A;  2PRQ A;  1V6C A;  3SJF A;  3DGV A;  1CBX A;  3PBB A;  3PFO A;  5CBM A;  4OME A;  3D7G A;  3RZA A;  3FMC A;  3S9L A;  1QMU A;  8CPA A;  3VTA A;  2O53 A;  3KI9 A;  4Q7A A;  1TKF A;  2PJ6 A;  2PJA A;  1CG2 A;  3DLJ A;  4KSI A;  4OP4 A;  1XJO A;  2ZOG A;  1BAV A;  4UIA A;  1F57 A;  1PYT B;  4MCS A;  5CPA A;  4Z65 A;  1FT7 A;  4C8A A;  3H8E A;  3PEI A;  2AFM A;  2GRE A;  4YU9 A;  2Q51 A;  3D66 A;  2ZED A;  4EWT A;  4NGS A;  1VIX A;  1YLO A;  4NGR A;  2ZEP A;  4OC3 A;  4X3R A;  2ZEL A;  3LMS A;  4OKO A;  4FWU A;  1AMP A;  2FVG A;  3B3C A;  3PB8 X;  3WT4 A;  2ZEH A;  6CPA A;  4CDK A;  2XEF A;  5LRG A;  5K8M A;  2PJ3 A;  5JM6 A;  4MHN A;  4ZY2 A;  2PCU A;  3NH8 A;  2ZEM A;  2ABZ A;  3PB7 X; 
#chains in the Genus database with same CATH topology
 4C8U A;  3I74 A;  2CTC A;  4C7I A;  4P6Y A;  3TLB A;  1XFO A;  2VZZ A;  2Z0Z A;  4MBU A;  3ZNI A;  4A4C A;  4M3S A;  3CXP A;  4EFD A;  5IV0 A;  3IIB A;  5F1Y A;  3TX8 A;  4DNC A;  1Q2C A;  3RNZ A;  4CZ1 A;  4F0Y A;  5LYF A;  2B4D A;  4RN7 A;  3K4I A;  1KWM A;  3KGQ A;  2QJ8 A;  5I0C A;  3KR5 A;  3MGD A;  4QBJ A;  4NF1 A;  2HC9 A;  4UCN A;  4L89 A;  5K8N A;  5ISV A;  1ZG7 A;  3GIU A;  5AG6 A;  4A39 A;  4QUS A;  3T05 A;  2ZW5 A;  4COG A;  4P4J A;  5ELY A;  1NMT A;  2Q0Y A;  4UEF A;  5A28 A;  4UIB A;  5EBV A;  3S9N A;  1ARM A;  1TKH A;  2PJ5 A;  4CAW A;  1CP6 A;  2PJ2 A;  3FX6 A;  1F2P A;  2PIZ A;  2PE3 A;  1H8L A;  3H4Q A;  4R87 A;  4OC2 A;  1XMB A;  3WC7 A;  3UY5 A;  3FIX A;  3TFY A;  5LRJ A;  1NXJ A;  1VBH A;  1QSR A;  1S3Z A;  4ONW A;  4CRY B;  4R76 A;  2GIV A;  3EC4 A;  3SR3 A;  2J8N A;  3KZW A;  4C8F A;  3O8Z A;  2GE3 A;  2PJ1 A;  2YJV A;  4B10 A;  2J8M A;  5EC4 A;  2OR4 A;  4ORF A;  4H2K A;  4C9U A;  1Q2D A;  4A30 A;  1LRZ A;  3BLN A;  4UF4 A;  7CPA A;  3GY9 A;  1J4J A;  5IX3 A;  2R1I A;  4QVT A;  4AVC A;  2Z3O A;  3KAS A;  2IMO A;  3ISZ A;  4J0N A;  3SI0 A;  2PR8 A;  1TKJ A;  3IJ3 A;  1IB1 E;  1R57 A;  4GM5 A;  5F48 A;  1EE3 P;  3HUV A;  2ZPA A;  1IIC A;  4CAF A;  3K9U A;  4CRZ B;  3EZA A;  1YSJ A;  2QEC A;  1MJB A;  4CGL A;  4R8F A;  4UEE A;  5F09 A;  4II9 A;  1XBU A;  3T8W A;  3TLG B;  4E94 A;  4EVY A;  1CPX A;  3OP0 A;  2PR1 A;  4BPU B;  4BPX B;  4NJQ A;  3FH4 A;  5IB0 A;  4X8I A;  1YVO A;  2FIW A;  2G3T A;  2P6E A;  4GXH A;  2YNE A;  3H8F A;  5JPH A;  4G1P A;  4MCP A;  2B3V A;  4E2A A;  3H5Z A;  3BI0 A;  2PJ8 A;  3DR8 A;  3I3G A;  1LFW A;  2C1C A;  1VKC A;  1FBV A;  2OZH A;  3SJG A;  3B3T A;  3CDX A;  2Y0M A;  4NGQ A;  1CP7 A;  1YME A;  4CS0 B;  1DE4 C;  4YWY A;  1Z8L A;  4XPD C;  3SI2 A;  1RO5 A;  4UEZ A;  3G23 A;  2CIJ A;  2X7B A;  2IJZ A;  4KLV A;  5F49 A;  3MN8 A;  2ZEG A;  4PXE A;  2DEA A;  1S7K A;  4AVA A;  4MFP A;  1Z5R A;  2P6F A;  4KOY A;  2Q4Z A;  1CS0 B;  3EZB A;  5K8O A;  4TNU A;  4KNG E;  1BO4 A;  3VGO A;  3TTH A;  5I4M A;  1XE4 A;  3DNS A;  1TXR A;  3LAC A;  5IB9 A;  2I3C A;  2J8R A;  2ODF A;  1IID A;  4XNH C;  4EME A;  1Y9Z A;  3TLG A;  3P2H A;  5LYI A;  3BHX A;  1JQG A;  2R7H A;  3WR7 A;  4B14 A;  2REE A;  4NGP A;  3K9T A;  4A38 A;  3BUO B;  2PJC A;  2EK8 A;  1C3O B;  2BOA A;  4C9E A;  2YNC C;  2OH1 A;  1AUG A;  3C26 A;  1JDE A;  2XEI A;  3D7H A;  2B4J C;  1M4G A;  4DYO A;  2PJ9 A;  2CTB A;  3EIF A;  3P2F A;  4HKF A;  3SJX A;  2DXQ A;  2OZG A;  2VQY A;  3D3S A;  4QC6 A;  1QSM A;  4U9Y A;  1QQ9 A;  4GS4 A;  4MXU A;  4JWP A;  4PQA A;  4C7H A;  3GKR A;  3GJZ A;  4A94 A;  4AVB A;  1QSO A;  2G0B A;  5IR2 A;  1YW4 A;  4IK2 A;  2POK A;  3S9M A;  3EXN A;  2NMT A;  1P4N A;  5K8P A;  3BUX B;  1KBL A;  2I79 A;  3BI1 A;  4MY3 A;  1CPS A;  3VWD A;  1UFH A;  1ARL A;  2ZEE A;  3KQZ A;  1P0H A;  5A27 A;  1S5K A;  3KHZ A;  4F6A A;  2BO9 A;  2B5G B;  3JRU A;  4CO9 A;  3B8G A;  3BJ7 A;  4E8O A;  1IYK A;  4UWI A;  1EO0 A;  5FVJ A;  2CY2 A;  2FXF A;  3ICU A;  4TJV A;  1Y0R A;  3TO9 A;  2IQ6 A;  2QYV A;  4MFL A;  2Y1N A;  3HPH E;  4KSF A;  4MMO A;  3ZZI A;  2V8V A;  3TYX A;  2GP4 A;  3TO6 A;  3TC8 A;  2DF5 A;  1KC7 A;  3CPA A;  1LOK A;  2ZEF A;  3GUX A;  2R8V A;  5GCN A;  2PVV A;  4NGN A;  3OAK A;  1Y9W A;  3B7I A;  4R9M A;  4C86 A;  4YGO A;  2PSW A;  2AUM A;  3JTK A;  2OLS A;  1YVH A;  1YGH A;  2CF4 A;  4H6U A;  4NJR A;  1EZA A;  4KOW A;  3VAR A;  5KTD A;  2BUE A;  1RXT A;  4P4I A;  4Q36 A;  2OU2 A;  3QNV A;  2AJ6 A;  2C6G A;  3WC6 A;  4C68 A;  4CAV A;  1Q5X A;  1ZL0 A;  3B35 A;  1YQE A;  4MFZ A;  3I6S A;  4W9Y A;  2GLF A;  5JQ4 A;  2FE7 A;  1BPM A;  3BUN B;  2B5G A;  3FVL A;  3W6S A;  1ZG9 A;  1GHE A;  3IWG A;  3HMJ G;  1PUA A;  3FJU A;  4CGP A;  3NFQ A;  5CNP A;  3VAT A;  3FEE A;  3DSB A;  2ARH A;  2ATR A;  4NCZ A;  1TF9 A;  3N5F A;  3PZJ A;  1JWQ A;  5D8N A;  3TOA A;  4IAV A;  1BLL E;  4MHY A;  4KUB A;  1VHS A;  5H84 A;  1ZYM A;  3QAH A;  3NE8 A;  5J1Q A;  5AXI A;  2EVN A;  3W91 A;  4PK2 A;  1NSA A;  2AFU A;  2V77 A;  5G22 A;  4KOT A;  5HVF A;  5JH9 A;  5AG5 A;  2XEJ A;  1OZP A;  2C6C A;  1ZLI A;  3FRM A;  5HVG A;  3D68 A;  2P6G A;  4OC5 A;  4B6Z A;  4UBR A;  3B2Y A;  2WUU A;  2ZW6 A;  3T90 A;  2DLA A;  2QML A;  4X2T A;  4R3K A;  3G3S A;  2Z3L A;  2WZN A;  2JLM A;  2JDD A;  3D8P A;  4A37 A;  2WYR A;  2P0W A;  1F2O A;  1LAP A;  3S6H A;  2EBJ A;  4IUS A;  1WWZ A;  1ZO0 A;  2B58 A;  5G20 A;  4KUA A;  3PB9 X;  4LQ6 A;  3IU2 A;  1KUV A;  4ZY1 A;  3SJE A;  3D2P A;  1A2Z A;  4C8T A;  1M4I A;  2PCN A;  1ZG8 A;  2Q43 A;  1FY7 A;  2GLJ A;  2NSM A;  4C99 A;  3R95 A;  3K2K A;  4XPK A;  2IL4 A;  2KCW A;  4C2Z A;  4P44 A;  3IWE A;  3PT1 A;  3NH4 A;  4WWV A;  2YGW A;  1Y9K A;  5HMN A;  3TOB A;  4OC0 A;  1Z8X A;  3EY5 A;  3VRR A;  4FUU A;  4PXD A;  3QB8 A;  2ZXV A;  3BXM A;  4ZYQ A;  4JD6 A;  2Y1M A;  2F7V A;  3B3W A;  2VI7 A;  3FXT A;  4CAX A;  3WC5 A;  2B4B A;  4ZY0 A;  4C8C A;  1Q2Y A;  4MCR A;  2FS5 A;  4X5K A;  2AE6 A;  2RFH A;  2Z11 A;  4AG7 A;  3TLY A;  4P4E A;  3I1U A;  4FAI A;  4XPL A;  4OIW A;  4O23 A;  3F9K C;  2HB6 A;  2AUN A;  1UWY A;  2PRB A;  2BL1 A;  3W6X A;  3VRQ A;  2Z3N A;  3GB0 A;  3V38 A;  4KLW A;  4C2Y A;  2PJB A;  1M4D A;  1U6M A;  3SXO A;  3VH9 A;  3KRV A;  2XPL A;  1LCP A;  4INJ A;  4KOS A;  4C9V A;  2O28 A;  3GYA A;  5HH1 A;  5HKW A;  1T36 B;  5K99 A;  1X12 A;  2AFS A;  2V8G A;  5FD8 A;  4MJ8 A;  3PBE A;  2JEV A;  3PGP A;  3S6K A;  3D7D A;  1PU9 A;  4BD9 A;  2QIR A;  4BIN A;  2PIY A;  1DIK A;  3RAM A;  1NBW A;  4B13 A;  1IY7 A;  4H1H A;  4NGM A;  3NA6 A;  1TIQ A;  4FD5 A;  4HNW B;  4MHZ A;  3CZX A;  1R3N A;  2Q7S A;  3H8G A;  4EYS A;  3MRU A;  2VBQ A;  3D67 A;  3CT9 A;  4I49 A;  1RTQ A;  4KOV A;  5D29 A;  4PSX A;  3NE7 A;  4P4F A;  4A31 A;  1J3L A;  1YRE A;  2QVP A;  1M44 A;  3E0K A;  1BXR B;  3PB7 X;  4TJX A;  2BEI A;  4U9Z A;  4UFV A;  3TLC A;  1S7F A;  4F8Z A;  1GYT A;  3SHP A;  4NGT A;  3SXN A;  5EMI A;  4JJX A;  4UA3 A;  2PVW A;  2HWG A;  2V8H A;  3OB2 B;  1N71 A;  4PXB A;  2PJ4 A;  4CGM A;  1ELM P;  4C84 A;  2N3A B;  1HDU A;  5F47 A;  3F8K A;  4HNY B;  3FED A;  4MY0 A;  4KOR A;  4NSQ A;  1C30 B;  2HV2 A;  4UFW A;  4PXC A;  2B0A A;  1WVM A;  2YNC A;  5C82 A;  5E96 A;  4MJX A;  4COB A;  2Z3M A;  1FNO A;  3BUW B;  4YFJ A;  5HVH A;  3C8O A;  1VBG A;  4F0X A;  5F13 A;  2FCK A;  4JYW A;  1Y0Y A;  3V7Z A;  3TT2 A;  3T07 A;  1OBR A;  1B47 A;  2ZEO A;  2ZEN A;  2EWB A;  4KVM E;  4R3L A;  5J3X A;  4DUK A;  2BSW A;  3PRT A;  3F5B A;  3DR6 A;  3WAB A;  3BJ8 A;  2EZB A;  5F9M A;  4C9A A;  2VKZ G;  1Y7E A;  2DPS A;  3A9L A;  4ZX9 A;  4FBE A;  5HXD A;  4LQG A;  3KQX A;  2PQ8 A;  3R9G A;  1YW6 A;  5JVL A;  1HDQ A;  1S7N A;  2C6P A;  1CJW A;  1YX0 A;  4MHP A;  1ZLH A;  2CXA A;  4B5O A;  1XEB A;  4CGN A;  2HRO A;  3LD2 A;  1I12 A;  1VHE A;  2PJ7 A;  3DDD A;  4F9V A;  4UCM A;  2EZC A;  3RBU A;  4MFK A;  3FYN A;  2UV8 G;  3IEH A;  3FEC A;  4AXV A;  2PC1 A;  1VHO A;  4OC4 A;  3ISX A;  5JGF A;  3FNC A;  4QB9 A;  4CGO A;  4UWJ A;  3OWC A;  4YRH A;  1IU8 A;  4YN3 A;  2Q4V A;  4RR2 B;  2R98 A;  2ZW4 A;  4M6G A;  4R6T A;  5BWA B;  2OB0 A;  3PLF B;  1LAN A;  1NE9 A;  2AFZ A;  1Z8T A;  4A32 A;  4RUH A;  3GLJ A;  4P4D A;  1XMT A;  2F8H A;  3KHX A;  4NFR A;  1KUX A;  4RI1 A;  4C85 A;  3TCV A;  3L2N A;  1EZB A;  1Z2L A;  5AG4 A;  2Q7B A;  2BCO A;  4KOU A;  4CDJ A;  3IWW A;  2Z10 A;  5LYD A;  1PCA A;  4MCQ A;  1B6B A;  4CYO A;  4CYQ A;  1HEE A;  3PB6 X;  4IF5 A;  2RC4 A;  2ANP A;  2EZA A;  3RYO A;  2VXK A;  4IHM A;  1CE8 B;  5LYL A;  1VGY A;  3VRP A;  5C88 A;  3B3V A;  4CPA A;  4KZT A;  5BY0 A;  2RB7 A;  1IGB A;  3LWU A;  2HI6 A;  2WPX A;  2VL1 A;  1AYE A;  1S60 A;  5DWM A;  2EO8 A;  3JVN A;  5F46 A;  2YJT A;  1XOV A;  1NSL A;  1B87 A;  3TLE A;  2JBJ A;  3I9S A;  3KR4 A;  1I21 A;  5DS0 A;  4MRI A;  1TF8 A;  4MI4 A;  1Y7R A;  1CX8 A;  1KUY A;  4P45 A;  2AFX A;  2JDC A;  2AFO A;  3D4U A;  4TWE A;  4K3N A;  4Y49 C;  1Z4R A;  4R7M A;  3V8I A;  3U1B A;  1XIX A;  1VI4 A;  1XRY A;  1IOI A;  4LUA A;  4R57 A;  5THW A;  1Q7L A;  2PJ0 A;  4JXR A;  4F9U A;  5LRK A;  4C9R A;  2ZOF A;  4JZ0 A;  3TE4 A;  3T0T A;  4KVO E;  2EK9 A;  2WSA A;  2Q04 A;  1BOB A;  3IO1 A;  1LAM A;  1M6V B;  2D4P A;  3PFE A;  1R43 A;  4M85 A;  4OID A;  2XEG A;  2C27 A;  3CPX A;  2JEW A;  4Q38 A;  3D7F A;  2O4H A;  4ZX8 A;  3ZJ0 A;  4ZGY B;  3EZE A;  4PPZ A;  5H86 A;  1XF1 A;  2WPW A;  2OOT A;  2AFW A;  1MJA A;  2G9D A;  1ELL P;  3KL9 A;  1I1D A;  4XPD B;  3PB4 X;  1IYL A;  2V8D A;  3S6G A;  1ZRS A;  2HQY A;  4C8P A;  4KS9 A;  4IIY A;  2FT0 A;  3R9E A;  1K4J A;  1R61 A;  3IC1 A;  1BPN A;  3IU1 A;  2NYQ A;  4PK3 A;  4CAE A;  3PFV A;  5AG7 A;  2A4N A;  1Z9E A;  3R1K A;  5AGE A;  3SI1 A;  5HKZ A;  1YR0 A;  3CXS A;  1MK4 A;  4OC1 A;  1A9X B;  3IFE A;  1KEE B;  2GU2 A;  4NEX A;  2J9A A;  2OZU A;  3HLP A;  4XNH B;  3B3S A;  1JDB C;  3IGR A;  3NFZ A;  4P10 A;  1YK3 A;  2CNT A;  2XPP A;  4HPS A;  1M4L A;  4WJB A;  2R82 A;  1V0C A;  2PDO A;  4ZI6 A;  2VEZ A;  3FF3 A;  4P4B A;  2JBK A;  3NH5 A;  2CNM A;  2HUZ A;  4PSW A;  5G21 A;  1DTD A;  1Z4E A;  4DJL A;  2PRQ A;  3OB1 B;  3FBU A;  2YND A;  1WK4 A;  1V6C A;  3SJF A;  1CBX A;  1KZF A;  2Z3P A;  3DGV A;  3PBB A;  3PFO A;  4FD4 A;  3LOD A;  4KVX A;  4A2Z A;  5CBM A;  4BTF A;  1XF8 A;  4U5Y A;  4M6I A;  4C2X A;  4OME A;  3D7G A;  4ONU A;  3R96 A;  3RZA A;  5F5X A;  3FMC A;  4J3G A;  3BUM B;  3S9L A;  1WJT A;  1QMU A;  4E0A A;  8CPA A;  4UFX A;  3VTA A;  2O53 A;  3KI9 A;  4MFJ A;  4MHD A;  4AG9 A;  4Q7A A;  3VWE A;  1TKF A;  3CXQ A;  4KSA A;  4BMH A;  2PJ6 A;  4JXQ A;  1GGO A;  2I00 A;  2PJA A;  4UCP A;  4A95 A;  2F5I A;  5KTA A;  2Q4Y A;  5JYB A;  2XPO A;  1CG2 A;  3DLJ A;  5J8C A;  2DIK A;  2MP0 A;  4KSI A;  1QST A;  1XJO A;  4OP4 A;  4A33 A;  2ZOG A;  1BAV A;  4UIA A;  4A4B A;  2Q44 A;  3R9F A;  4NXY A;  2D0P A;  1F57 A;  1MJ9 A;  4OLL A;  3U88 C;  1PYT B;  3VRN A;  3TLA A;  4B12 A;  4MCS A;  4K30 A;  3S6F A;  5CPA A;  4Z65 A;  1FT7 A;  4C8A A;  3H8E A;  2EUI A;  2G3A A;  4B11 A;  2FM4 A;  2X0S A;  1S7L A;  3PEI A;  5J8F A;  4MI1 A;  1ON0 A;  3PP9 A;  3F0A A;  2AFM A;  4OAD A;  1YVK A;  3D2M A;  4GPL B;  5HKY A;  2GRE A;  2D0O A;  4YU9 A;  4BPW B;  3KKW A;  2Q51 A;  1Z8W A;  3D66 A;  2C5Q A;  3RO0 A;  2ZED A;  4EWT A;  4LX9 A;  4NGS A;  1VIX A;  2H5M A;  3QAY A;  1CM0 A;  1X10 A;  3VRO A;  4RS2 A;  2E28 A;  4H89 A;  2XPN A;  1QSN A;  4B5P B;  3G8W A;  5KTC A;  2ZW7 A;  1YLO A;  4NGR A;  1YLE A;  3EO4 A;  3N7Z A;  3NOJ A;  4IIX A;  2FSR A;  4M8D A;  4L8A A;  3TLZ A;  2ZEP A;  2CBL A;  2Z3K A;  2VZY A;  4OC3 A;  5G1Z A;  4HNX B;  4E5S A;  5DWN A;  2GFQ A;  4X3R A;  2ZEL A;  3TO7 A;  4M6H A;  4CYN A;  3LMS A;  4AB7 A;  4OKO A;  4FWU A;  2CNS A;  4KOX A;  1AMP A;  2FVG A;  3B3C A;  2B4D B;  3PB8 X;  2K5T A;  2FL4 A;  3WT4 A;  2ZEH A;  3FB3 A;  1L0C A;  1Z9U A;  1SQH A;  2DPT A;  2FIA A;  4H6Z A;  1IOF A;  1M1D A;  6CPA A;  4JLY A;  4CDK A;  4CYP A;  2B3U A;  4FD7 A;  4JVO A;  2REF A;  4PV6 A;  4OAE A;  2XEF A;  4Y49 B;  5LRG A;  2D4O A;  2PJ3 A;  5K8M A;  4FD6 A;  4MHN A;  4ZY2 A;  4B5P A;  4MFQ A;  3T9Y A;  4BBH A;  5JM6 A;  2PCU A;  3T5M A;  3NH8 A;  3EFA A;  2ZEM A;  2ABZ A;  2GAN A;  4ZBG A;  3HPG G;  3JUW A; 
#chains in the Genus database with same CATH homology
 4C8U A;  3I74 A;  2CTC A;  4P6Y A;  1XFO A;  4EFD A;  3IIB A;  3TX8 A;  5LYF A;  1KWM A;  3KGQ A;  2QJ8 A;  3KR5 A;  2HC9 A;  5K8N A;  1ZG7 A;  4A39 A;  4P4J A;  5ELY A;  4UEF A;  4UIB A;  3S9N A;  1ARM A;  1TKH A;  2PJ5 A;  1CP6 A;  2PJ2 A;  3FX6 A;  1F2P A;  2PIZ A;  2PE3 A;  1H8L A;  4OC2 A;  1XMB A;  3WC7 A;  5LRJ A;  4ONW A;  4R76 A;  3KZW A;  4C8F A;  2PJ1 A;  2OR4 A;  4H2K A;  4C9U A;  4UF4 A;  7CPA A;  3KAS A;  2IMO A;  3ISZ A;  1TKJ A;  3IJ3 A;  4GM5 A;  1EE3 P;  3HUV A;  1YSJ A;  4R8F A;  4UEE A;  5F09 A;  1XBU A;  3T8W A;  1CPX A;  4NJQ A;  3FH4 A;  4X8I A;  3H8F A;  4G1P A;  4MCP A;  3BI0 A;  2PJ8 A;  1LFW A;  2C1C A;  3CDX A;  3SJG A;  3B3T A;  4NGQ A;  1CP7 A;  1YME A;  1DE4 C;  4YWY A;  1Z8L A;  3SI2 A;  4UEZ A;  2CIJ A;  2IJZ A;  3MN8 A;  2ZEG A;  4PXE A;  2DEA A;  1Z5R A;  2Q4Z A;  5K8O A;  4TNU A;  4KNG E;  5I4M A;  1TXR A;  5IB9 A;  1Y9Z A;  2I3C A;  4EME A;  5LYI A;  3BHX A;  1JQG A;  4A38 A;  4NGP A;  3K9T A;  2PJC A;  4C9E A;  2EK8 A;  2BOA A;  2XEI A;  3D7H A;  4DYO A;  2PJ9 A;  2CTB A;  3EIF A;  3SJX A;  3SI0 A;  1QQ9 A;  4MXU A;  4PQA A;  4A94 A;  5IR2 A;  1YW4 A;  4IK2 A;  2POK A;  3S9M A;  5K8P A;  3BI1 A;  1CPS A;  2ZEE A;  1ARL A;  3KQZ A;  3KHZ A;  2BO9 A;  3JRU A;  4TJV A;  3ICU A;  1Y0R A;  2IQ6 A;  2QYV A;  4MMO A;  2V8V A;  2GP4 A;  3TC8 A;  3CPA A;  1LOK A;  2ZEF A;  3GUX A;  2PVV A;  4NGN A;  3B7I A;  4C86 A;  4NJR A;  2CF4 A;  3VAR A;  4P4I A;  3QNV A;  3WC6 A;  2C6G A;  3B35 A;  3I6S A;  4W9Y A;  2GLF A;  1BPM A;  3FVL A;  1ZG9 A;  3FJU A;  3VAT A;  3FEE A;  1TF9 A;  3N5F A;  5D8N A;  4IAV A;  1BLL E;  4MHY A;  5J1Q A;  1NSA A;  2AFU A;  2V77 A;  5JH9 A;  5HVF A;  2XEJ A;  2C6C A;  1ZLI A;  5HVG A;  3D68 A;  4OC5 A;  4B6Z A;  3B2Y A;  4X2T A;  2WZN A;  4A37 A;  2WYR A;  1F2O A;  1LAP A;  4ZY1 A;  3PB9 X;  3SJE A;  4C8T A;  1ZG8 A;  2Q43 A;  2GLJ A;  2NSM A;  4C99 A;  3K2K A;  4P44 A;  4WWV A;  3NH4 A;  4OC0 A;  4FUU A;  4PXD A;  4ZYQ A;  3BXM A;  2F7V A;  3B3W A;  3WC5 A;  4ZY0 A;  4C8C A;  4MCR A;  2RFH A;  4P4E A;  3I1U A;  4FAI A;  4OIW A;  4O23 A;  2HB6 A;  1UWY A;  3GB0 A;  3V38 A;  2PJB A;  3VH9 A;  1LCP A;  4C9V A;  2V8G A;  2AFS A;  3PBE A;  3D7D A;  2PIY A;  3RAM A;  1IY7 A;  4NGM A;  3NA6 A;  4MHZ A;  1R3N A;  3H8G A;  3MRU A;  3D67 A;  3CT9 A;  1RTQ A;  5D29 A;  4P4F A;  2QVP A;  4TJX A;  4F8Z A;  1GYT A;  4NGT A;  2PVW A;  2V8H A;  4PXB A;  2PJ4 A;  1ELM P;  4C84 A;  1HDU A;  3FED A;  4PXC A;  1WVM A;  5HVH A;  1FNO A;  4JYW A;  1Y0Y A;  3V7Z A;  1OBR A;  2ZEO A;  2ZEN A;  2EWB A;  4DUK A;  3PRT A;  3WAB A;  4C9A A;  1Y7E A;  5HXD A;  4ZX9 A;  4FBE A;  4LQG A;  3KQX A;  1YW6 A;  1HDQ A;  2C6P A;  4MHP A;  1ZLH A;  4F9V A;  2PJ7 A;  1VHE A;  3RBU A;  3IEH A;  3FEC A;  4AXV A;  5JGF A;  1VHO A;  4OC4 A;  3ISX A;  4YN3 A;  4R6T A;  1LAN A;  2AFZ A;  4RUH A;  3GLJ A;  4P4D A;  2F8H A;  4NFR A;  3KHX A;  4C85 A;  3L2N A;  1Z2L A;  2BCO A;  4CDJ A;  3IWW A;  5LYD A;  1PCA A;  4MCQ A;  1HEE A;  3PB6 X;  2ANP A;  4IHM A;  5LYL A;  1VGY A;  3B3V A;  4CPA A;  2RB7 A;  1IGB A;  3LWU A;  2VL1 A;  1AYE A;  3KR4 A;  2JBJ A;  5DS0 A;  4MRI A;  1TF8 A;  1CX8 A;  2AFX A;  4P45 A;  4TWE A;  2AFO A;  3D4U A;  4K3N A;  4R7M A;  1XRY A;  5THW A;  1Q7L A;  2PJ0 A;  4F9U A;  4C9R A;  5LRK A;  2ZOF A;  4JZ0 A;  2EK9 A;  3IO1 A;  1LAM A;  3PFE A;  1R43 A;  4OID A;  2XEG A;  3CPX A;  4ZX8 A;  2JEW A;  3D7F A;  2O4H A;  4PPZ A;  1XF1 A;  2OOT A;  2AFW A;  3KL9 A;  2G9D A;  1ELL P;  3PB4 X;  2V8D A;  4C8P A;  3IC1 A;  1BPN A;  2NYQ A;  3SI1 A;  4OC1 A;  3IFE A;  2GU2 A;  2J9A A;  3HLP A;  3B3S A;  3NFZ A;  4P10 A;  1M4L A;  4WJB A;  4ZI6 A;  4BD9 A;  3FF3 A;  4P4B A;  2JBK A;  3NH5 A;  4DJL A;  1DTD A;  2PRQ A;  1V6C A;  3SJF A;  3DGV A;  1CBX A;  3PBB A;  3PFO A;  5CBM A;  4OME A;  3D7G A;  3RZA A;  3FMC A;  3S9L A;  1QMU A;  8CPA A;  3VTA A;  2O53 A;  3KI9 A;  4Q7A A;  1TKF A;  2PJ6 A;  2PJA A;  1CG2 A;  3DLJ A;  4KSI A;  4OP4 A;  1XJO A;  2ZOG A;  1BAV A;  4UIA A;  1F57 A;  1PYT B;  4MCS A;  5CPA A;  4Z65 A;  1FT7 A;  4C8A A;  3H8E A;  3PEI A;  2AFM A;  2GRE A;  4YU9 A;  2Q51 A;  3D66 A;  2C5Q A;  2ZED A;  4EWT A;  4NGS A;  1VIX A;  1YLO A;  4NGR A;  2ZEP A;  4OC3 A;  4X3R A;  2ZEL A;  3LMS A;  4OKO A;  4FWU A;  1AMP A;  2FVG A;  3B3C A;  3PB8 X;  3WT4 A;  2ZEH A;  6CPA A;  4CDK A;  2XEF A;  5LRG A;  5K8M A;  2PJ3 A;  5JM6 A;  4MHN A;  4ZY2 A;  2PCU A;  3NH8 A;  2ZEM A;  2ABZ A;  3PB7 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...