2OOTA

A high resolution structure of ligand-free human glutamate carboxypeptidase ii
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
686
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title A high-resolution structure of ligand-free human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 265
structure length 686
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 2ootA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2ootA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 2ootA02
3KQZA 2O4HA 1IGBA 2PJ9A 5D29A 2CTCA 1Z8LA 1F2OA 1JQGA 3I1UA 4F8ZA 5HVHA 5D8NA 3BI1A 1KWMA 4A38A 4TWEA 2ZENA 4P4EA 2JBKA 4MXUA 4R7MA 4P4BA 3H8FA 5LYIA 4F9VA 3V38A 1LAMA 4JYWA 4MHPA 2XEGA 1VIXA 4A39A 2O53A 2QVPA 2V8HA 2FVGA 2C6PA 2PVWA 4BD9A 1H8LA 2AFXA 5JGFA 3D68A 3IEHA 1BPNA 3NH5A 4C8PA 4R8FA 4UIAA 2BOAA 4MRIA 4NGPA 2PCUA 2Q43A 2PJ4A 3NH4A 2AFOA 2AFMA 3BI0A 3QNVA 4EMEA 3PB7X 1CPSA 4UIBA 5HVFA 2RFHA 3RAMA 4OP4A 2C6CA 3D7GA 4C8AA 1CP7A 4NGMA 1ELMP 1Y9ZA 4IK2A 1YW4A 1TF9A 3SI2A 1XFOA 2PVVA 3B2YA 3BXMA 4DUKA 1VHOA 2F8HA 4C86A 3K2KA 4OKOA 2BO9A 3H8GA 3FF3A 3NH8A 1M4LA 2ZOFA 3WT4A 3N5FA 4KNGE 2ZEMA 3HUVA 4IAVA 3PEIA 4OC4A 5K8NA 3B7IA 5LYDA 2PJ2A 1TXRA 1F57A 2AFUA 3LMSA 4LQGA 3EIFA 5K8OA 4UEFA 3IJ3A 3FEDA 3TX8A 4IHMA 4A94A 2GLJA 2DEAA 4ZYQA 2GREA 4OC5A 4ZX8A 1BAVA 1YW6A 2QYVA 2EWBA 4R76A 4CPAA 4MCPA 1Z2LA 4X2TA 1ZLIA 2PJBA 3NFZA 1FT7A 2POKA 5HVGA 3ISXA 5LRJA 4OC1A 1LFWA 2G9DA 2PJ3A 3D7HA 3V7ZA 3D7DA 4P44A 2AFWA 2PE3A 1XRYA 3GB0A 5CBMA 3KHZA 5LYFA 2PIYA 3S9LA 1HDQA 2ABZA 2ZEOA 2PJ7A 3PB4X 4OMEA 4AXVA 3SJGA 2PJ1A 4OC2A 3WC6A 2GLFA 4C9UA 1LCPA 2WZNA 3JRUA 2Q51A 3L2NA 4UEEA 4P4IA 3KL9A 3PRTA 1CG2A 4P45A 4JZ0A 3CPAA 3H8EA 1Q7LA 2AFZA 1TKHA 1ELLP 1LOKA 1VHEA 4NFRA 2ZEGA 4MCSA 4CDKA 4DJLA 3WC7A 3FX6A 3K9TA 3KGQA 2C1CA 2J9AA 4C8UA 3GLJA 2ZEEA 3BHXA 2OOTA 4OIDA 3KHXA 4MHYA 3B3VA 5J1QA 3IC1A 3VATA 2QJ8A 4P4FA 1LANA 1LAPA 2PJAA 4ZX9A 1CP6A 2PJ0A 2EK8A 4EWTA 4NJRA 3IO1A 4FAIA 1WVMA 3IIBA 4FUUA 2NYQA 4P4JA 3VARA 2I3CA 3B3SA 2Q4ZA 5I4MA 5K8MA 1R43A 4C84A 4C9RA 2IQ6A 1HDUA 4C9AA 3DGVA 2IJZA 1AYEA 2ZELA 2ANPA 3RBUA 4MHZA 2EK9A 2ZEHA 4O23A 1DE4C 3MRUA 3FH4A 3IFEA 2HB6A 3GUXA 4X8IA 4CDJA 1Y7EA 2V8GA 3FMCA 1YMEA 2XEIA 2IMOA 4MCRA 1EE3P 4W9YA 4PXDA 2GU2A 2PIZA 7CPAA 2PJ8A 2ZEDA 4P10A 3KR5A 4OC3A 4GM5A 1OBRA 4C8TA 5LRGA 1V6CA 2VL1A 1PYTB 4ZI6A 2XEJA 2V8VA 3I6SA 3D66A 2CF4A 4FWUA 4R6TA 3CDXA 5CPAA 4NGNA 3VTAA 2WYRA 3RZAA 2RB7A 2F7VA 5HXDA 4K3NA 1XBUA 1QQ9A 4TNUA 4H2KA 5IB9A 3SJEA 3I74A 2ZEFA 4C9EA 3HLPA 5F09A 4UEZA 4P4DA 4OIWA 4YWYA 1XMBA 5JM6A 2JBJA 1IY7A 1HEEA 2C6GA 2CTBA 3CT9A 3PB8X 3SI0A 4A37A 4NGTA 1TF8A 4YN3A 4UF4A 3D4UA 1ARMA 1NSAA 2V8DA 3PB9X 2ZEPA 5LYLA 2NSMA 3FEEA 3S9NA 3MN8A 4ZY1A 4P6YA 3VH9A 1ZG7A 1Y0RA 4PPZA 1FNOA 3NA6A 4MCQA 3DLJA 4DYOA 3B35A 8CPAA 3SJXA 4TJVA 4NGSA 1F2PA 3PBBA 4X3RA 4C85A 6CPAA 4EFDA 1PCAA 3WC5A 1R3NA 1YLOA 3ICUA 4F9UA 4PXEA 1BLLE 3KQXA 3S9MA 1ZG8A 1DTDA 3KZWA 2PJ6A 4G1PA 4PXBA 4NJQA 1QMUA 4PXCA 4C8FA 4TJXA 4NGQA 1ZG9A 4ZY0A 2CIJA 4WJBA 1ZLHA 3PB6X 3D67A 4MHNA 3PBEA 3FECA 5ELYA 3B3CA 4PQAA 4C8CA 3KASA 1CPXA 4YU9A 4FBEA 3T8WA 3SJFA 1VGYA 2XEFA 3LWUA 2JEWA 3FVLA 1ARLA 4B6ZA 3FJUA 3WABA 3IWWA 4ONWA 1GYTA 4OC0A 3PFEA 3PFOA 1BPMA 2V77A 5THWA 5LRKA 1TKJA 4WWVA 2OR4A 1XF1A 3SI1A 4MMOA 2ZOGA 4Z65A 3KI9A 3D7FA 3B3WA 4C99A 1YSJA 3TC8A 4RUHA 1Z5RA 2PJCA 1TKFA 1UWYA 3B3TA 4NGRA 4ZY2A 1Y0YA 5DS0A 4KSIA 1RTQA 2AFSA 1CX8A 2HC9A 1XJOA 2PRQA 1CBXA 3CPXA 5K8PA 2BCOA 3KR4A 3ISZA 5JH9A 4Q7AA 1AMPA 4C9VA 2PJ5A
chains in the Genus database with same CATH superfamily
3KQZA 4FD6A 2XPLA 2O4HA 1IGBA 1B6BA 2PJ9A 4R9MA 1IOIA 3TO6A 3S6HA 2ZXVA 2MP0A 2ZW5A 4HKFA 4C2ZA 3OP0A 5D29A 2CTCA 3I9SA 1Z8LA 3F0AA 1F2OA 3LACA 5AG7A 1JQGA 1PUAA 3I1UA 1M4GA 2JEVA 1IB1E 4B13A 2F5IA 4F8ZA 5HVHA 4U5YA 2PC1A 1P0HA 5D8NA 1A2ZA 2CXAA 3PP9A 2B0AA 2QECA 4RI1A 5BWAB 3BI1A 1KWMA 4A38A 1VBGA 4TWEA 3S6KA 2ZENA 5H86A 1JDEA 4P4EA 2JBKA 4MXUA 3IU2A 4LQ6A 4JD6A 4R7MA 4C9VA 2FCKA 4P4BA 2WPWA 4A33A 1IYKA 3H8FA 5LYIA 4F9VA 3V38A 2VEZA 3TO9A 1LAMA 4JYWA 4XPDC 2B4DA 4MHPA 3S6GA 2XEGA 3T9YA 2Y1NA 1VIXA 3VWEA 3S6FA 1NE9A 1P4NA 1R57A 2O53A 4A39A 2QVPA 2V8HA 2FVGA 1U6MA 2C6PA 2PVWA 5G20A 4II9A 4BPUB 4BD9A 1H8LA 5G21A 2CY2A 2AFXA 2YNEA 3D2PA 3MGDA 4JXQA 5JGFA 3D68A 3IEHA 1BPNA 4CAFA 2Y1MA 4BTFA 3NH5A 4C8PA 5GCNA 4R8FA 3JVNA 4RN7A 4UIAA 2X0SA 2BOAA 4MRIA 2P6GA 3GKRA 4NGPA 4QC6A 2PCUA 2Z11A 2Q43A 2PJ4A 3NH4A 4H6ZA 4KSAA 4Q38A 2HUZA 2J8NA 2B5GA 2AFOA 2AFMA 5A27A 3BI0A 3QNVA 2DPSA 1Y7RA 1MJ9A 4BPWB 1Z4RA 2YGWA 4B5OA 4EMEA 3TLAA 4R87A 3K9UA 3PB7X 1CPSA 4KVOE 2D4OA 3GY9A 4HNYB 3G23A 4RS2A 4UIBA 5HVFA 2RFHA 3VRQA 4OADA 4OP4A 4Q36A 3NE8A 2C6CA 3D7GA 1J4JA 1Z8TA 3RAMA 1CP7A 3LODA 3W91A 4E8OA 1A9XB 4NGMA 3FYNA 1ELMP 1XE4A 4IK2A 3EXNA 1Y9ZA 5ISVA 1YW4A 3CXQA 1TF9A 3SI2A 4E0AA 1XFOA 2PVVA 1EO0A 2C27A 2OB0A 3B2YA 2VQYA 4JWPA 3BXMA 1X10A 1VHOA 2F8HA 2YNCA 4Y49C 4DUKA 4C86A 2B3VA 3K2KA 4OKOA 2BO9A 1JDBC 3H8GA 2GP4A 3F9KC 3H5ZA 4HNWB 3TO7A 3FIXA 3FF3A 3NH8A 1M4LA 1S5KA 5C88A 2HI6A 2ZOFA 2CNSA 3WT4A 1QSNA 3N5FA 4KNGE 2ZEMA 3HUVA 2GFQA 2J8RA 4AVCA 4IAVA 3PEIA 5J3XA 1IOFA 4OC4A 3G3SA 3T07A 1Z9UA 3VRPA 1YLEA 5K8NA 4COGA 4ORFA 4B10A 1Q2YA 5HKWA 4KOTA 2DF5A 2Q7SA 2OZUA 3B7IA 3QB8A 5F49A 4CGLA 3F8KA 5LYDA 2PJ2A 4F0XA 2YJTA 2IL4A 1TXRA 4IUSA 4CRZB 1F57A 2AFUA 2K5TA 2ZW4A 5G22A 2HWGA 3DNSA 3FXTA 4LQGA 3LMSA 5F5XA 3TLZA 4MJXA 4B12A 4QVTA 2AE6A 3EIFA 5K8OA 4UEFA 5G1ZA 1CJWA 3EFAA 2CNMA 3IJ3A 3FEDA 1FY7A 2FIWA 2GANA 1YVKA 2A4NA 2FIAA 3TX8A 4IHMA 4A94A 1M44A 2GLJA 5IX3A 4U9ZA 2DEAA 3C8OA 4KOWA 2GREA 3SHPA 4OC5A 4ZYQA 5KTAA 2BL1A 5EBVA 1BAVA 5DWNA 4ZX8A 1YW6A 5HMNA 2QYVA 4UCNA 2OU2A 2HV2A 3D2MA 2EWBA 4XNHB 4R76A 4CPAA 4MCPA 1Z2LA 2GE3A 1VBHA 4X2TA 3R9FA 2VZZA 3T0TA 4EYSA 5JVLA 1ZLIA 2D4PA 2PJBA 3NFZA 1FT7A 3TT2A 2DLAA 5H84A 2POKA 2JDCA 5HVGA 4BMHA 3ISXA 4IIXA 2Z3PA 4MFLA 4PSWA 5AGEA 3TTHA 5LRJA 2Z3KA 5F1YA 4FBEA 3VWDA 1XF8A 4OC1A 4HPSA 1LFWA 2G9DA 1KUVA 1QSRA 2Q04A 3OB2B 1EZAA 4I49A 1ZYMA 2BUEA 3I3GA 5I0CA 2I79A 2PJ3A 2VXKA 3D7HA 3V7ZA 3D7DA 4P44A 2AFWA 4B5PB 2PE3A 3NE7A 2OZGA 1XRYA 3GB0A 2GIVA 5CBMA 5IV0A 2DIKA 2E28A 3KHZA 5LYFA 2PIYA 3S9LA 1HDQA 2ABZA 2ZEOA 2PJ7A 3PB4X 4KLVA 3DR6A 4NF1A 3WR7A 3R1KA 1XOVA 1M4DA 4OMEA 4AXVA 3B8GA 3SJGA 2PJ1A 5J8FA 4OC2A 2KCWA 3WC6A 2GLFA 1SQHA 4CYQA 4GS4A 2ZW7A 4MY3A 5E96A 2Z3OA 4C9UA 4JJXA 1LCPA 4MBUA 4ZGYB 3PGPA 2WZNA 3JRUA 2Q51A 3ZZIA 2XPOA 4NXYA 3JUWA 3HMJG 3L2NA 4UEEA 3EZEA 4P4IA 3KL9A 3PRTA 4KOVA 3TLGB 1CG2A 1WJTA 4P45A 1K4JA 4JZ0A 5CNPA 3CPAA 5FVJA 1MJAA 1YK3A 3H8EA 4MFJA 1KC7A 1Q7LA 3TLEA 3IWEA 2Z3NA 4AG9A 2AFZA 1M6VB 1I21A 1TKHA 3P2HA 1R61A 1ELLP 4UFVA 1LOKA 1VHEA 1S7FA 3EO4A 4IF5A 1YGHA 4NFRA 2ZEGA 4KOSA 2PDOA 4MCSA 4M85A 4CDKA 4DJLA 5J8CA 3EZAA 2Q0YA 3WC7A 2B4BA 4C8AA 3FX6A 1UFHA 4INJA 3K9TA 3KGQA 4NSQA 2C1CA 2J9AA 5JPHA 4C8UA 3GLJA 1MK4A 3BHXA 2OOTA 2ZEEA 3QAHA 4OIDA 3KHXA 5F13A 4MHYA 4A31A 1M1DA 3B3VA 1YVOA 5J1QA 3IGRA 3IC1A 3VATA 5HKZA 5F9MA 4MI1A 4CYOA 2QJ8A 4LX9A 3GYAA 3A9LA 4P4FA 3NOJA 1C3OB 1LANA 4UFXA 1IIDA 1LAPA 1KZFA 2PJAA 4XNHC 4ZX9A 2EZBA 5IB0A 4B5PA 1GGOA 1CP6A 2PJ0A 1X12A 2EK8A 4UCMA 4A95A 5EMIA 4EWTA 4NEXA 4NJRA 5FD8A 1B87A 3BJ8A 3IO1A 4FAIA 2G3AA 3IIBA 3N7ZA 1WVMA 1RXTA 3FNCA 4FUUA 1EZBA 2EZAA 3W6XA 2NYQA 4P4JA 3U1BA 4A30A 2JLMA 3VARA 4KOYA 1ON0A 1YREA 2DPTA 1S3ZA 2I3CA 2Q4ZA 3B3SA 3TOAA 4AVBA 4CAEA 2D0OA 2FL4A 5JYBA 3PZJA 2DXQA 5I4MA 4M8DA 5K8MA 2R8VA 1R43A 4UFWA 3V8IA 4C84A 4C2XA 4C9RA 2IQ6A 1HDUA 1N71A 5AG6A 4XPKA 4CGMA 3O8ZA 4OAEA 4A4BA 4C9AA 2FT0A 1PU9A 2Q44A 1Z8WA 3DGVA 2EUIA 2IJZA 4CGNA 4EVYA 3TLGA 2BEIA 1I1DA 1AYEA 2ZELA 2ANPA 3SR3A 2OZHA 1NXJA 3RBUA 2B4JC 4F0YA 1NMTA 3BUXB 4MHZA 2EK9A 2ZEHA 4KUAA 4O23A 4E5SA 1DE4C 3MRUA 1CS0B 2H5MA 3FH4A 4CRYB 3IFEA 2HB6A 3GUXA 4X8IA 4CDJA 3NFQA 1J3LA 4K30A 1S7KA 1IYLA 1Y7EA 4BPXB 4BINA 2V8GA 2Z3MA 3VRNA 3FMCA 1YMEA 2XEIA 3EY5A 2IMOA 4KSFA 3VGOA 2QIRA 4RR2B 4MCRA 1EE3P 5F48A 4KZTA 4A4CA 3FB3A 4W9YA 4PXDA 1YX0A 2GU2A 2G0BA 2PIZA 4U9YA 2PJ8A 2ZEDA 2VKZG 4P10A 3KR5A 7CPAA 4OC3A 4GXHA 4KVXA 1YR0A 3CXSA 4GM5A 1OBRA 4C8TA 3BJ7A 4R3LA 5LRGA 4M6HA 2VL1A 1V6CA 4FD5A 3BLNA 4C68A 2YJVA 1PYTB 4KORA 1CM0A 4MHDA 4ZI6A 2XEJA 2V8VA 3CXPA 2FM4A 3I6SA 3D66A 3TLYA 2PR8A 2CF4A 4FD7A 4FWUA 3CDXA 4R6TA 5CPAA 4NGNA 4DNCA 3P2FA 5C82A 3VTAA 2OLSA 1S7NA 4BBHA 4B11A 2WYRA 1XEBA 2BSWA 4MFKA 3RZAA 2RB7A 2Y0MA 2PCNA 2QMLA 4AB7A 3SXNA 3PFVA 2ZW6A 2F7VA 4UA3A 4K3NA 1XBUA 5HXDA 2NMTA 4H6UA 2B5GB 4C7HA 1QQ9A 4TNUA 4H2KA 3R9GA 5F47A 5IB9A 4LUAA 3SJEA 1WK4A 1GHEA 1VHSA 3RYOA 3I74A 4KLWA 3FBUA 2ZEFA 4C9EA 2ARHA 3HLPA 2PQ8A 4YFJA 1Q5XA 4M3SA 5F09A 1MJBA 4CAWA 3TYXA 4UEZA 1S7LA 4P4DA 2ATRA 1S60A 4OIWA 2R1IA 4OLLA 4YWYA 2B58A 3SXOA 2PRBA 4QUSA 1XMBA 4ZBGA 3R95A 5JM6A 2JBJA 2FS5A 1IY7A 1HEEA 2C6GA 2CTBA 3CT9A 1AUGA 2CNTA 3PB8X 4UWJA 3SI0A 4NGTA 4A37A 4FD4A 3KRVA 1TF8A 4YN3A 1KUYA 3D8PA 1WWZA 4UF4A 3R96A 3BUNB 1VKCA 3D4UA 1BOBA 4ONUA 1Y9KA 2HQYA 2Q7BA 5DWMA 4M6GA 1YVHA 2HROA 4MFQA 2RC4A 3GJZA 1ARMA 1NSAA 2V8DA 4J3GA 1NSLA 3TE4A 3PB9X 4CGOA 1BXRB 2ZEPA 5LYLA 2NSMA 4QB9A 2FE7A 4COBA 4AG7A 4E94A 3FEEA 3S9NA 3MN8A 4NCZA 4ZY1A 2R7HA 4P6YA 3T05A 3VH9A 2REFA 1ZG7A 2C5QA 3HPGG 1Y0RA 4PPZA 2WUUA 1FNOA 3W6SA 4KOUA 3NA6A 3BUWB 4MCQA 3TOBA 3DLJA 4DYOA 3B35A 8CPAA 4J0NA 3SJXA 1Q2CA 4CAXA 1YQEA 5JQ4A 1NBWA 1M4IA 5AG4A 3TFYA 2Q4YA 4TJVA 4NGSA 4L8AA 3PLFB 5EC4A 1F2PA 3QAYA 3ZJ0A 3PBBA 4IIYA 4JVOA 4R3KA 3VROA 1Z8XA 3EZBA 4X3RA 4C85A 6CPAA 4EFDA 3R9EA 1PCAA 3WC5A 2R82A 1R3NA 1YLOA 3F5BA 2AUNA 1LRZA 4F9UA 3ICUA 3T5MA 3IWGA 2FXFA 4CZ1A 3T90A 4H1HA 4PXEA 1BLLE 2N3AB 3KQXA 3UY5A 4UBRA 3S9MA 4CYNA 5F46A 1ZG8A 5A28A 4AVAA 2XPPA 4PK3A 4C7IA 4YRHA 1DTDA 2VI7A 3KZWA 2G3TA 4F6AA 1QSMA 2OH1A 3LD2A 2P0WA 4A32A 2Q4VA 2PJ6A 4KS9A 1IICA 2B3UA 1BO4A 4G1PA 4PXBA 2CBLA 2ODFA 1OZPA 4NJQA 4JLYA 2PR1A 1CE8B 3H4QA 2R98A 1QMUA 3IU1A 3K4IA 3DSBA 2EO8A 4PXCA 4YGOA 5KTDA 4C8FA 4TJXA 2XPNA 5K99A 4NGQA 2VBQA 2J8MA 1ZG9A 1VI4A 2EZCA 5AXIA 4ZY0A 4L89A 2CIJA 1JWQA 1KUXA 4WJBA 1QSTA 1ZLHA 3PB6X 3D67A 4MHNA 4A2ZA 4X5KA 3PBEA 3TCVA 3FECA 5ELYA 5HKYA 2Z0ZA 1T36B 2Z10A 3OB1B 2P6EA 3GIUA 3B3CA 4PQAA 1Z9EA 4C8CA 3EC4A 3KASA 1CPXA 1L0CA 1QSOA 4XPDB 4YU9A 1Y9WA 2VZYA 3T8WA 3SJFA 1IU8A 1VGYA 4PV6A 4C2YA 3OAKA 2XEFA 1ZO0A 3PT1A 2REEA 2ZPAA 4E2AA 1RO5A 2WPXA 1C30B 3LWUA 5KTCA 3ZNIA 3HPHE 2UV8G 1ARLA 2JEWA 3FVLA 4MJ8A 3FJUA 4B6ZA 3WABA 4JXRA 2X7BA 2WSAA 4MFPA 4UWIA 3RO0A 3IWWA 1TIQA 2YNCC 4ONWA 1GYTA 1KBLA 4OC0A 1ZL0A 3PFEA 3PFOA 1BPMA 4HNXB 2V77A 1Q2DA 5THWA 4XPLA 3D3SA 2B4DB 4GPLB 5LRKA 1TKJA 4WWVA 2OR4A 3OWCA 1XF1A 3KKWA 5AG5A 3SI1A 3TLBA 2AUMA 3DDDA 4PK2A 4MMOA 2ZOGA 1ZRSA 4QBJA 4Z65A 1DIKA 3CZXA 3D7FA 3KI9A 1Z4EA 3B3WA 4B14A 4M6IA 2D0PA 3TLCA 3G8WA 4MI4A 2EBJA 4C99A 1YSJA 2I00A 3DR8A 4MFZA 3TC8A 3BUOB 4RUHA 2AJ6A 4H89A 4KOXA 1Z5RA 2PJCA 1TKFA 1XIXA 3FRMA 3E0KA 3JTKA 1UWYA 3VRRA 1B47A 4NGRA 3B3TA 4ZY2A 1Y0YA 5DS0A 4KSIA 1RTQA 2O28A 2AFSA 1CX8A 2HC9A 1XJOA 2PRQA 3U88C 2YNDA 1CBXA 2PSWA 3C26A 4PSXA 4UCPA 4Y49B 5HH1A 2JDDA 4CYPA 3CPXA 4MY0A 4R57A 5BY0A 2BCOA 3KR4A 2P6FA 4CS0B 5K8PA 5IR2A 2FSRA 4KUBA 4KVME 1FBVA 4CAVA 2EVNA 1XMTA 3ISZA 3RNZA 4CGPA 1KEEB 3BUMB 4CO9A 1I12A 4Q7AA 5JH9A 1AMPA 1V0CA 2PJ5A 2Z3LA
chains in the Genus database with same CATH topology
3KQZA 2O4HA 1IGBA 2PJ9A 5D29A 2CTCA 1Z8LA 1F2OA 1JQGA 3I1UA 4F8ZA 5HVHA 5D8NA 3BI1A 1KWMA 4A38A 4TWEA 2ZENA 4P4EA 2JBKA 4MXUA 4R7MA 4P4BA 3H8FA 5LYIA 4F9VA 3V38A 1LAMA 4JYWA 4MHPA 2XEGA 1VIXA 4A39A 2O53A 2QVPA 2V8HA 2FVGA 2C6PA 2PVWA 4BD9A 1H8LA 2AFXA 5JGFA 3D68A 3IEHA 1BPNA 3NH5A 4C8PA 4R8FA 4UIAA 2BOAA 4MRIA 4NGPA 2PCUA 2Q43A 2PJ4A 3NH4A 2AFOA 2AFMA 3BI0A 3QNVA 4EMEA 3PB7X 1CPSA 4UIBA 5HVFA 2RFHA 3RAMA 4OP4A 2C6CA 3D7GA 4C8AA 1CP7A 4NGMA 1ELMP 1Y9ZA 4IK2A 1YW4A 1TF9A 3SI2A 1XFOA 2PVVA 3B2YA 3BXMA 4DUKA 1VHOA 2F8HA 4C86A 3K2KA 4OKOA 2BO9A 2GP4A 3H8GA 3FF3A 3NH8A 1M4LA 2ZOFA 3WT4A 3N5FA 4KNGE 2ZEMA 3HUVA 4IAVA 3PEIA 4OC4A 5K8NA 3B7IA 5LYDA 2PJ2A 1TXRA 1F57A 2AFUA 3LMSA 4LQGA 3EIFA 5K8OA 4UEFA 3IJ3A 3FEDA 3TX8A 4IHMA 4A94A 2GLJA 2DEAA 4ZYQA 2GREA 4OC5A 4ZX8A 1BAVA 1YW6A 2QYVA 2EWBA 4R76A 4CPAA 4MCPA 1Z2LA 4X2TA 1ZLIA 2PJBA 3NFZA 1FT7A 2POKA 5HVGA 3ISXA 5LRJA 4OC1A 1LFWA 2G9DA 2PJ3A 3D7HA 3V7ZA 3D7DA 4P44A 2AFWA 2PE3A 1XRYA 3GB0A 5CBMA 3KHZA 5LYFA 2PIYA 3S9LA 1HDQA 2ABZA 2ZEOA 2PJ7A 3PB4X 4OMEA 4AXVA 3SJGA 2PJ1A 4OC2A 3WC6A 2GLFA 4C9UA 1LCPA 2WZNA 3JRUA 2Q51A 3L2NA 4UEEA 4P4IA 3KL9A 3PRTA 1CG2A 4P45A 4JZ0A 3CPAA 3H8EA 1Q7LA 2AFZA 1TKHA 1ELLP 1LOKA 1VHEA 4NFRA 2ZEGA 4MCSA 4CDKA 4DJLA 3WC7A 3FX6A 3K9TA 3KGQA 2C1CA 2J9AA 4C8UA 3GLJA 2ZEEA 3BHXA 2OOTA 4OIDA 3KHXA 4MHYA 3B3VA 5J1QA 3IC1A 3VATA 2QJ8A 4P4FA 1LANA 1LAPA 2PJAA 4ZX9A 1CP6A 2PJ0A 2EK8A 4EWTA 4NJRA 3IO1A 4FAIA 1WVMA 3IIBA 4FUUA 2NYQA 4P4JA 3VARA 2I3CA 3B3SA 2Q4ZA 5I4MA 5K8MA 1R43A 4C84A 4C9RA 2IQ6A 1HDUA 4C9AA 3DGVA 2IJZA 1AYEA 2ZELA 2ANPA 3RBUA 4MHZA 2EK9A 2ZEHA 4O23A 1DE4C 3MRUA 3FH4A 3IFEA 2HB6A 3GUXA 4X8IA 4CDJA 1Y7EA 2V8GA 3FMCA 1YMEA 2XEIA 2IMOA 4MCRA 1EE3P 4W9YA 4PXDA 2GU2A 2PIZA 7CPAA 2PJ8A 2ZEDA 4P10A 3KR5A 4OC3A 4GM5A 1OBRA 4C8TA 5LRGA 1V6CA 2VL1A 1PYTB 4ZI6A 2XEJA 2V8VA 3I6SA 3D66A 2CF4A 4FWUA 4R6TA 3CDXA 5CPAA 4NGNA 3VTAA 2WYRA 3RZAA 2RB7A 2F7VA 5HXDA 4K3NA 1XBUA 1QQ9A 4TNUA 4H2KA 5IB9A 3SJEA 3I74A 2ZEFA 4C9EA 3HLPA 5F09A 4UEZA 4P4DA 4OIWA 4YWYA 1XMBA 5JM6A 2JBJA 1IY7A 1HEEA 2C6GA 2CTBA 3CT9A 3PB8X 3SI0A 4A37A 4NGTA 1TF8A 4YN3A 4UF4A 3D4UA 1ARMA 1NSAA 2V8DA 3PB9X 2ZEPA 5LYLA 2NSMA 3FEEA 3S9NA 3MN8A 4ZY1A 4P6YA 3VH9A 1ZG7A 2C5QA 1Y0RA 4PPZA 1FNOA 3NA6A 4MCQA 3DLJA 4DYOA 3B35A 8CPAA 3SJXA 4TJVA 4NGSA 1F2PA 3PBBA 4X3RA 4C85A 6CPAA 4EFDA 1PCAA 3WC5A 1R3NA 1YLOA 3ICUA 4F9UA 4PXEA 1BLLE 3KQXA 3S9MA 1ZG8A 1DTDA 3KZWA 2PJ6A 4G1PA 4PXBA 4NJQA 1QMUA 4PXCA 4C8FA 4TJXA 4NGQA 1ZG9A 4ZY0A 2CIJA 4WJBA 1ZLHA 3PB6X 3D67A 4MHNA 3PBEA 3FECA 5ELYA 3B3CA 4PQAA 4C8CA 3KASA 1CPXA 4YU9A 4FBEA 3T8WA 3SJFA 1VGYA 2XEFA 3LWUA 2JEWA 3FVLA 1ARLA 4B6ZA 3FJUA 3WABA 3IWWA 4ONWA 1GYTA 4OC0A 3PFEA 3PFOA 1BPMA 2V77A 5THWA 5LRKA 1TKJA 4WWVA 2OR4A 1XF1A 3SI1A 4MMOA 2ZOGA 4Z65A 3KI9A 3D7FA 3B3WA 4C99A 1YSJA 3TC8A 4RUHA 1Z5RA 2PJCA 1TKFA 1UWYA 3B3TA 4NGRA 4ZY2A 1Y0YA 5DS0A 4KSIA 1RTQA 2AFSA 1CX8A 2HC9A 1XJOA 2PRQA 1CBXA 3CPXA 5K8PA 2BCOA 3KR4A 5IR2A 3ISZA 5JH9A 4Q7AA 1AMPA 4C9VA 2PJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KQZ A;  2O4H A;  1IGB A;  2PJ9 A;  5D29 A;  2CTC A;  1Z8L A;  1F2O A;  1JQG A;  3I1U A;  4F8Z A;  5HVH A;  5D8N A;  3BI1 A;  1KWM A;  4A38 A;  4TWE A;  2ZEN A;  4P4E A;  2JBK A;  4MXU A;  4R7M A;  4P4B A;  3H8F A;  5LYI A;  4F9V A;  3V38 A;  1LAM A;  4JYW A;  4MHP A;  2XEG A;  1VIX A;  4A39 A;  2O53 A;  2QVP A;  2V8H A;  2FVG A;  2C6P A;  2PVW A;  4BD9 A;  1H8L A;  2AFX A;  5JGF A;  3D68 A;  3IEH A;  1BPN A;  3NH5 A;  4C8P A;  4R8F A;  4UIA A;  2BOA A;  4MRI A;  4NGP A;  2PCU A;  2Q43 A;  2PJ4 A;  3NH4 A;  2AFO A;  2AFM A;  3BI0 A;  3QNV A;  4EME A;  3PB7 X;  1CPS A;  4UIB A;  5HVF A;  2RFH A;  3RAM A;  4OP4 A;  2C6C A;  3D7G A;  4C8A A;  1CP7 A;  4NGM A;  1ELM P;  1Y9Z A;  4IK2 A;  1YW4 A;  1TF9 A;  3SI2 A;  1XFO A;  2PVV A;  3B2Y A;  3BXM A;  4DUK A;  1VHO A;  2F8H A;  4C86 A;  3K2K A;  4OKO A;  2BO9 A;  3H8G A;  3FF3 A;  3NH8 A;  1M4L A;  2ZOF A;  3WT4 A;  3N5F A;  4KNG E;  2ZEM A;  3HUV A;  4IAV A;  3PEI A;  4OC4 A;  5K8N A;  3B7I A;  5LYD A;  2PJ2 A;  1TXR A;  1F57 A;  2AFU A;  3LMS A;  4LQG A;  3EIF A;  5K8O A;  4UEF A;  3IJ3 A;  3FED A;  3TX8 A;  4IHM A;  4A94 A;  2GLJ A;  2DEA A;  4ZYQ A;  2GRE A;  4OC5 A;  4ZX8 A;  1BAV A;  1YW6 A;  2QYV A;  2EWB A;  4R76 A;  4CPA A;  4MCP A;  1Z2L A;  4X2T A;  1ZLI A;  2PJB A;  3NFZ A;  1FT7 A;  2POK A;  5HVG A;  3ISX A;  5LRJ A;  4OC1 A;  1LFW A;  2G9D A;  2PJ3 A;  3D7H A;  3V7Z A;  3D7D A;  4P44 A;  2AFW A;  2PE3 A;  1XRY A;  3GB0 A;  5CBM A;  3KHZ A;  5LYF A;  2PIY A;  3S9L A;  1HDQ A;  2ABZ A;  2ZEO A;  2PJ7 A;  3PB4 X;  4OME A;  4AXV A;  3SJG A;  2PJ1 A;  4OC2 A;  3WC6 A;  2GLF A;  4C9U A;  1LCP A;  2WZN A;  3JRU A;  2Q51 A;  3L2N A;  4UEE A;  4P4I A;  3KL9 A;  3PRT A;  1CG2 A;  4P45 A;  4JZ0 A;  3CPA A;  3H8E A;  1Q7L A;  2AFZ A;  1TKH A;  1ELL P;  1LOK A;  1VHE A;  4NFR A;  2ZEG A;  4MCS A;  4CDK A;  4DJL A;  3WC7 A;  3FX6 A;  3K9T A;  3KGQ A;  2C1C A;  2J9A A;  4C8U A;  3GLJ A;  2ZEE A;  3BHX A;  2OOT A;  4OID A;  3KHX A;  4MHY A;  3B3V A;  5J1Q A;  3IC1 A;  3VAT A;  2QJ8 A;  4P4F A;  1LAN A;  1LAP A;  2PJA A;  4ZX9 A;  1CP6 A;  2PJ0 A;  2EK8 A;  4EWT A;  4NJR A;  3IO1 A;  4FAI A;  1WVM A;  3IIB A;  4FUU A;  2NYQ A;  4P4J A;  3VAR A;  2I3C A;  3B3S A;  2Q4Z A;  5I4M A;  5K8M A;  1R43 A;  4C84 A;  4C9R A;  2IQ6 A;  1HDU A;  4C9A A;  3DGV A;  2IJZ A;  1AYE A;  2ZEL A;  2ANP A;  3RBU A;  4MHZ A;  2EK9 A;  2ZEH A;  4O23 A;  1DE4 C;  3MRU A;  3FH4 A;  3IFE A;  2HB6 A;  3GUX A;  4X8I A;  4CDJ A;  1Y7E A;  2V8G A;  3FMC A;  1YME A;  2XEI A;  2IMO A;  4MCR A;  1EE3 P;  4W9Y A;  4PXD A;  2GU2 A;  2PIZ A;  7CPA A;  2PJ8 A;  2ZED A;  4P10 A;  3KR5 A;  4OC3 A;  4GM5 A;  1OBR A;  4C8T A;  5LRG A;  1V6C A;  2VL1 A;  1PYT B;  4ZI6 A;  2XEJ A;  2V8V A;  3I6S A;  3D66 A;  2CF4 A;  4FWU A;  4R6T A;  3CDX A;  5CPA A;  4NGN A;  3VTA A;  2WYR A;  3RZA A;  2RB7 A;  2F7V A;  5HXD A;  4K3N A;  1XBU A;  1QQ9 A;  4TNU A;  4H2K A;  5IB9 A;  3SJE A;  3I74 A;  2ZEF A;  4C9E A;  3HLP A;  5F09 A;  4UEZ A;  4P4D A;  4OIW A;  4YWY A;  1XMB A;  5JM6 A;  2JBJ A;  1IY7 A;  1HEE A;  2C6G A;  2CTB A;  3CT9 A;  3PB8 X;  3SI0 A;  4A37 A;  4NGT A;  1TF8 A;  4YN3 A;  4UF4 A;  3D4U A;  1ARM A;  1NSA A;  2V8D A;  3PB9 X;  2ZEP A;  5LYL A;  2NSM A;  3FEE A;  3S9N A;  3MN8 A;  4ZY1 A;  4P6Y A;  3VH9 A;  1ZG7 A;  1Y0R A;  4PPZ A;  1FNO A;  3NA6 A;  4MCQ A;  3DLJ A;  4DYO A;  3B35 A;  8CPA A;  3SJX A;  4TJV A;  4NGS A;  1F2P A;  3PBB A;  4X3R A;  4C85 A;  6CPA A;  4EFD A;  1PCA A;  3WC5 A;  1R3N A;  1YLO A;  3ICU A;  4F9U A;  4PXE A;  1BLL E;  3KQX A;  3S9M A;  1ZG8 A;  1DTD A;  3KZW A;  2PJ6 A;  4G1P A;  4PXB A;  4NJQ A;  1QMU A;  4PXC A;  4C8F A;  4TJX A;  4NGQ A;  1ZG9 A;  4ZY0 A;  2CIJ A;  4WJB A;  1ZLH A;  3PB6 X;  3D67 A;  4MHN A;  3PBE A;  3FEC A;  5ELY A;  3B3C A;  4PQA A;  4C8C A;  3KAS A;  1CPX A;  4YU9 A;  4FBE A;  3T8W A;  3SJF A;  1VGY A;  2XEF A;  3LWU A;  2JEW A;  3FVL A;  1ARL A;  4B6Z A;  3FJU A;  3WAB A;  3IWW A;  4ONW A;  1GYT A;  4OC0 A;  3PFE A;  3PFO A;  1BPM A;  2V77 A;  5THW A;  5LRK A;  1TKJ A;  4WWV A;  2OR4 A;  1XF1 A;  3SI1 A;  4MMO A;  2ZOG A;  4Z65 A;  3KI9 A;  3D7F A;  3B3W A;  4C99 A;  1YSJ A;  3TC8 A;  4RUH A;  1Z5R A;  2PJC A;  1TKF A;  1UWY A;  3B3T A;  4NGR A;  4ZY2 A;  1Y0Y A;  5DS0 A;  4KSI A;  1RTQ A;  2AFS A;  1CX8 A;  2HC9 A;  1XJO A;  2PRQ A;  1CBX A;  3CPX A;  5K8P A;  2BCO A;  3KR4 A;  3ISZ A;  5JH9 A;  4Q7A A;  1AMP A;  4C9V A;  2PJ5 A; 
#chains in the Genus database with same CATH topology
 3KQZ A;  4FD6 A;  2XPL A;  2O4H A;  1IGB A;  1B6B A;  2PJ9 A;  4R9M A;  1IOI A;  3TO6 A;  3S6H A;  2ZXV A;  2MP0 A;  2ZW5 A;  4HKF A;  4C2Z A;  3OP0 A;  5D29 A;  2CTC A;  3I9S A;  1Z8L A;  3F0A A;  1F2O A;  3LAC A;  5AG7 A;  1JQG A;  1PUA A;  3I1U A;  1M4G A;  2JEV A;  1IB1 E;  4B13 A;  2F5I A;  4F8Z A;  5HVH A;  4U5Y A;  2PC1 A;  1P0H A;  5D8N A;  1A2Z A;  2CXA A;  3PP9 A;  2B0A A;  2QEC A;  4RI1 A;  5BWA B;  3BI1 A;  1KWM A;  4A38 A;  1VBG A;  4TWE A;  3S6K A;  2ZEN A;  5H86 A;  1JDE A;  4P4E A;  2JBK A;  4MXU A;  3IU2 A;  4LQ6 A;  4JD6 A;  4R7M A;  4C9V A;  2FCK A;  4P4B A;  2WPW A;  4A33 A;  1IYK A;  3H8F A;  5LYI A;  4F9V A;  3V38 A;  2VEZ A;  3TO9 A;  1LAM A;  4JYW A;  4XPD C;  2B4D A;  4MHP A;  3S6G A;  2XEG A;  3T9Y A;  2Y1N A;  1VIX A;  3VWE A;  3S6F A;  1NE9 A;  1P4N A;  1R57 A;  2O53 A;  4A39 A;  2QVP A;  2V8H A;  2FVG A;  1U6M A;  2C6P A;  2PVW A;  5G20 A;  4II9 A;  4BPU B;  4BD9 A;  1H8L A;  5G21 A;  2CY2 A;  2AFX A;  2YNE A;  3D2P A;  3MGD A;  4JXQ A;  5JGF A;  3D68 A;  3IEH A;  1BPN A;  4CAF A;  2Y1M A;  4BTF A;  3NH5 A;  4C8P A;  5GCN A;  4R8F A;  3JVN A;  4RN7 A;  4UIA A;  2X0S A;  2BOA A;  4MRI A;  2P6G A;  3GKR A;  4NGP A;  4QC6 A;  2PCU A;  2Z11 A;  2Q43 A;  2PJ4 A;  3NH4 A;  4H6Z A;  4KSA A;  4Q38 A;  2HUZ A;  2J8N A;  2B5G A;  2AFO A;  2AFM A;  5A27 A;  3BI0 A;  3QNV A;  2DPS A;  1Y7R A;  1MJ9 A;  4BPW B;  1Z4R A;  2YGW A;  4B5O A;  4EME A;  3TLA A;  4R87 A;  3K9U A;  3PB7 X;  1CPS A;  4KVO E;  2D4O A;  3GY9 A;  4HNY B;  3G23 A;  4RS2 A;  4UIB A;  5HVF A;  2RFH A;  3VRQ A;  4OAD A;  4OP4 A;  4Q36 A;  3NE8 A;  2C6C A;  3D7G A;  1J4J A;  1Z8T A;  3RAM A;  1CP7 A;  3LOD A;  3W91 A;  4E8O A;  1A9X B;  4NGM A;  3FYN A;  1ELM P;  1XE4 A;  4IK2 A;  3EXN A;  1Y9Z A;  5ISV A;  1YW4 A;  3CXQ A;  1TF9 A;  3SI2 A;  4E0A A;  1XFO A;  2PVV A;  1EO0 A;  2C27 A;  2OB0 A;  3B2Y A;  2VQY A;  4JWP A;  3BXM A;  1X10 A;  1VHO A;  2F8H A;  2YNC A;  4Y49 C;  4DUK A;  4C86 A;  2B3V A;  3K2K A;  4OKO A;  2BO9 A;  1JDB C;  3H8G A;  2GP4 A;  3F9K C;  3H5Z A;  4HNW B;  3TO7 A;  3FIX A;  3FF3 A;  3NH8 A;  1M4L A;  1S5K A;  5C88 A;  2HI6 A;  2ZOF A;  2CNS A;  3WT4 A;  1QSN A;  3N5F A;  4KNG E;  2ZEM A;  3HUV A;  2GFQ A;  2J8R A;  4AVC A;  4IAV A;  3PEI A;  5J3X A;  1IOF A;  4OC4 A;  3G3S A;  3T07 A;  1Z9U A;  3VRP A;  1YLE A;  5K8N A;  4COG A;  4ORF A;  4B10 A;  1Q2Y A;  5HKW A;  4KOT A;  2DF5 A;  2Q7S A;  2OZU A;  3B7I A;  3QB8 A;  5F49 A;  4CGL A;  3F8K A;  5LYD A;  2PJ2 A;  4F0X A;  2YJT A;  2IL4 A;  1TXR A;  4IUS A;  4CRZ B;  1F57 A;  2AFU A;  2K5T A;  2ZW4 A;  5G22 A;  2HWG A;  3DNS A;  3FXT A;  4LQG A;  3LMS A;  5F5X A;  3TLZ A;  4MJX A;  4B12 A;  4QVT A;  2AE6 A;  3EIF A;  5K8O A;  4UEF A;  5G1Z A;  1CJW A;  3EFA A;  2CNM A;  3IJ3 A;  3FED A;  1FY7 A;  2FIW A;  2GAN A;  1YVK A;  2A4N A;  2FIA A;  3TX8 A;  4IHM A;  4A94 A;  1M44 A;  2GLJ A;  5IX3 A;  4U9Z A;  2DEA A;  3C8O A;  4KOW A;  2GRE A;  3SHP A;  4OC5 A;  4ZYQ A;  5KTA A;  2BL1 A;  5EBV A;  1BAV A;  5DWN A;  4ZX8 A;  1YW6 A;  5HMN A;  2QYV A;  4UCN A;  2OU2 A;  2HV2 A;  3D2M A;  2EWB A;  4XNH B;  4R76 A;  4CPA A;  4MCP A;  1Z2L A;  2GE3 A;  1VBH A;  4X2T A;  3R9F A;  2VZZ A;  3T0T A;  4EYS A;  5JVL A;  1ZLI A;  2D4P A;  2PJB A;  3NFZ A;  1FT7 A;  3TT2 A;  2DLA A;  5H84 A;  2POK A;  2JDC A;  5HVG A;  4BMH A;  3ISX A;  4IIX A;  2Z3P A;  4MFL A;  4PSW A;  5AGE A;  3TTH A;  5LRJ A;  2Z3K A;  5F1Y A;  4FBE A;  3VWD A;  1XF8 A;  4OC1 A;  4HPS A;  1LFW A;  2G9D A;  1KUV A;  1QSR A;  2Q04 A;  3OB2 B;  1EZA A;  4I49 A;  1ZYM A;  2BUE A;  3I3G A;  5I0C A;  2I79 A;  2PJ3 A;  2VXK A;  3D7H A;  3V7Z A;  3D7D A;  4P44 A;  2AFW A;  4B5P B;  2PE3 A;  3NE7 A;  2OZG A;  1XRY A;  3GB0 A;  2GIV A;  5CBM A;  5IV0 A;  2DIK A;  2E28 A;  3KHZ A;  5LYF A;  2PIY A;  3S9L A;  1HDQ A;  2ABZ A;  2ZEO A;  2PJ7 A;  3PB4 X;  4KLV A;  3DR6 A;  4NF1 A;  3WR7 A;  3R1K A;  1XOV A;  1M4D A;  4OME A;  4AXV A;  3B8G A;  3SJG A;  2PJ1 A;  5J8F A;  4OC2 A;  2KCW A;  3WC6 A;  2GLF A;  1SQH A;  4CYQ A;  4GS4 A;  2ZW7 A;  4MY3 A;  5E96 A;  2Z3O A;  4C9U A;  4JJX A;  1LCP A;  4MBU A;  4ZGY B;  3PGP A;  2WZN A;  3JRU A;  2Q51 A;  3ZZI A;  2XPO A;  4NXY A;  3JUW A;  3HMJ G;  3L2N A;  4UEE A;  3EZE A;  4P4I A;  3KL9 A;  3PRT A;  4KOV A;  3TLG B;  1CG2 A;  1WJT A;  4P45 A;  1K4J A;  4JZ0 A;  5CNP A;  3CPA A;  5FVJ A;  1MJA A;  1YK3 A;  3H8E A;  4MFJ A;  1KC7 A;  1Q7L A;  3TLE A;  3IWE A;  2Z3N A;  4AG9 A;  2AFZ A;  1M6V B;  1I21 A;  1TKH A;  3P2H A;  1R61 A;  1ELL P;  4UFV A;  1LOK A;  1VHE A;  1S7F A;  3EO4 A;  4IF5 A;  1YGH A;  4NFR A;  2ZEG A;  4KOS A;  2PDO A;  4MCS A;  4M85 A;  4CDK A;  4DJL A;  5J8C A;  3EZA A;  2Q0Y A;  3WC7 A;  2B4B A;  4C8A A;  3FX6 A;  1UFH A;  4INJ A;  3K9T A;  3KGQ A;  4NSQ A;  2C1C A;  2J9A A;  5JPH A;  4C8U A;  3GLJ A;  1MK4 A;  3BHX A;  2OOT A;  2ZEE A;  3QAH A;  4OID A;  3KHX A;  5F13 A;  4MHY A;  4A31 A;  1M1D A;  3B3V A;  1YVO A;  5J1Q A;  3IGR A;  3IC1 A;  3VAT A;  5HKZ A;  5F9M A;  4MI1 A;  4CYO A;  2QJ8 A;  4LX9 A;  3GYA A;  3A9L A;  4P4F A;  3NOJ A;  1C3O B;  1LAN A;  4UFX A;  1IID A;  1LAP A;  1KZF A;  2PJA A;  4XNH C;  4ZX9 A;  2EZB A;  5IB0 A;  4B5P A;  1GGO A;  1CP6 A;  2PJ0 A;  1X12 A;  2EK8 A;  4UCM A;  4A95 A;  5EMI A;  4EWT A;  4NEX A;  4NJR A;  5FD8 A;  1B87 A;  3BJ8 A;  3IO1 A;  4FAI A;  2G3A A;  3IIB A;  3N7Z A;  1WVM A;  1RXT A;  3FNC A;  4FUU A;  1EZB A;  2EZA A;  3W6X A;  2NYQ A;  4P4J A;  3U1B A;  4A30 A;  2JLM A;  3VAR A;  4KOY A;  1ON0 A;  1YRE A;  2DPT A;  1S3Z A;  2I3C A;  2Q4Z A;  3B3S A;  3TOA A;  4AVB A;  4CAE A;  2D0O A;  2FL4 A;  5JYB A;  3PZJ A;  2DXQ A;  5I4M A;  4M8D A;  5K8M A;  2R8V A;  1R43 A;  4UFW A;  3V8I A;  4C84 A;  4C2X A;  4C9R A;  2IQ6 A;  1HDU A;  1N71 A;  5AG6 A;  4XPK A;  4CGM A;  3O8Z A;  4OAE A;  4A4B A;  4C9A A;  2FT0 A;  1PU9 A;  2Q44 A;  1Z8W A;  3DGV A;  2EUI A;  2IJZ A;  4CGN A;  4EVY A;  3TLG A;  2BEI A;  1I1D A;  1AYE A;  2ZEL A;  2ANP A;  3SR3 A;  2OZH A;  1NXJ A;  3RBU A;  2B4J C;  4F0Y A;  1NMT A;  3BUX B;  4MHZ A;  2EK9 A;  2ZEH A;  4KUA A;  4O23 A;  4E5S A;  1DE4 C;  3MRU A;  1CS0 B;  2H5M A;  3FH4 A;  4CRY B;  3IFE A;  2HB6 A;  3GUX A;  4X8I A;  4CDJ A;  3NFQ A;  1J3L A;  4K30 A;  1S7K A;  1IYL A;  1Y7E A;  4BPX B;  4BIN A;  2V8G A;  2Z3M A;  3VRN A;  3FMC A;  1YME A;  2XEI A;  3EY5 A;  2IMO A;  4KSF A;  3VGO A;  2QIR A;  4RR2 B;  4MCR A;  1EE3 P;  5F48 A;  4KZT A;  4A4C A;  3FB3 A;  4W9Y A;  4PXD A;  1YX0 A;  2GU2 A;  2G0B A;  2PIZ A;  4U9Y A;  2PJ8 A;  2ZED A;  2VKZ G;  4P10 A;  3KR5 A;  7CPA A;  4OC3 A;  4GXH A;  4KVX A;  1YR0 A;  3CXS A;  4GM5 A;  1OBR A;  4C8T A;  3BJ7 A;  4R3L A;  5LRG A;  4M6H A;  2VL1 A;  1V6C A;  4FD5 A;  3BLN A;  4C68 A;  2YJV A;  1PYT B;  4KOR A;  1CM0 A;  4MHD A;  4ZI6 A;  2XEJ A;  2V8V A;  3CXP A;  2FM4 A;  3I6S A;  3D66 A;  3TLY A;  2PR8 A;  2CF4 A;  4FD7 A;  4FWU A;  3CDX A;  4R6T A;  5CPA A;  4NGN A;  4DNC A;  3P2F A;  5C82 A;  3VTA A;  2OLS A;  1S7N A;  4BBH A;  4B11 A;  2WYR A;  1XEB A;  2BSW A;  4MFK A;  3RZA A;  2RB7 A;  2Y0M A;  2PCN A;  2QML A;  4AB7 A;  3SXN A;  3PFV A;  2ZW6 A;  2F7V A;  4UA3 A;  4K3N A;  1XBU A;  5HXD A;  2NMT A;  4H6U A;  2B5G B;  4C7H A;  1QQ9 A;  4TNU A;  4H2K A;  3R9G A;  5F47 A;  5IB9 A;  4LUA A;  3SJE A;  1WK4 A;  1GHE A;  1VHS A;  3RYO A;  3I74 A;  4KLW A;  3FBU A;  2ZEF A;  4C9E A;  2ARH A;  3HLP A;  2PQ8 A;  4YFJ A;  1Q5X A;  4M3S A;  5F09 A;  1MJB A;  4CAW A;  3TYX A;  4UEZ A;  1S7L A;  4P4D A;  2ATR A;  1S60 A;  4OIW A;  2R1I A;  4OLL A;  4YWY A;  2B58 A;  3SXO A;  2PRB A;  4QUS A;  1XMB A;  4ZBG A;  3R95 A;  5JM6 A;  2JBJ A;  2FS5 A;  1IY7 A;  1HEE A;  2C6G A;  2CTB A;  3CT9 A;  1AUG A;  2CNT A;  3PB8 X;  4UWJ A;  3SI0 A;  4NGT A;  4A37 A;  4FD4 A;  3KRV A;  1TF8 A;  4YN3 A;  1KUY A;  3D8P A;  1WWZ A;  4UF4 A;  3R96 A;  3BUN B;  1VKC A;  3D4U A;  1BOB A;  4ONU A;  1Y9K A;  2HQY A;  2Q7B A;  5DWM A;  4M6G A;  1YVH A;  2HRO A;  4MFQ A;  2RC4 A;  3GJZ A;  1ARM A;  1NSA A;  2V8D A;  4J3G A;  1NSL A;  3TE4 A;  3PB9 X;  4CGO A;  1BXR B;  2ZEP A;  5LYL A;  2NSM A;  4QB9 A;  2FE7 A;  4COB A;  4AG7 A;  4E94 A;  3FEE A;  3S9N A;  3MN8 A;  4NCZ A;  4ZY1 A;  2R7H A;  4P6Y A;  3T05 A;  3VH9 A;  2REF A;  1ZG7 A;  2C5Q A;  3HPG G;  1Y0R A;  4PPZ A;  2WUU A;  1FNO A;  3W6S A;  4KOU A;  3NA6 A;  3BUW B;  4MCQ A;  3TOB A;  3DLJ A;  4DYO A;  3B35 A;  8CPA A;  4J0N A;  3SJX A;  1Q2C A;  4CAX A;  1YQE A;  5JQ4 A;  1NBW A;  1M4I A;  5AG4 A;  3TFY A;  2Q4Y A;  4TJV A;  4NGS A;  4L8A A;  3PLF B;  5EC4 A;  1F2P A;  3QAY A;  3ZJ0 A;  3PBB A;  4IIY A;  4JVO A;  4R3K A;  3VRO A;  1Z8X A;  3EZB A;  4X3R A;  4C85 A;  6CPA A;  4EFD A;  3R9E A;  1PCA A;  3WC5 A;  2R82 A;  1R3N A;  1YLO A;  3F5B A;  2AUN A;  1LRZ A;  4F9U A;  3ICU A;  3T5M A;  3IWG A;  2FXF A;  4CZ1 A;  3T90 A;  4H1H A;  4PXE A;  1BLL E;  2N3A B;  3KQX A;  3UY5 A;  4UBR A;  3S9M A;  4CYN A;  5F46 A;  1ZG8 A;  5A28 A;  4AVA A;  2XPP A;  4PK3 A;  4C7I A;  4YRH A;  1DTD A;  2VI7 A;  3KZW A;  2G3T A;  4F6A A;  1QSM A;  2OH1 A;  3LD2 A;  2P0W A;  4A32 A;  2Q4V A;  2PJ6 A;  4KS9 A;  1IIC A;  2B3U A;  1BO4 A;  4G1P A;  4PXB A;  2CBL A;  2ODF A;  1OZP A;  4NJQ A;  4JLY A;  2PR1 A;  1CE8 B;  3H4Q A;  2R98 A;  1QMU A;  3IU1 A;  3K4I A;  3DSB A;  2EO8 A;  4PXC A;  4YGO A;  5KTD A;  4C8F A;  4TJX A;  2XPN A;  5K99 A;  4NGQ A;  2VBQ A;  2J8M A;  1ZG9 A;  1VI4 A;  2EZC A;  5AXI A;  4ZY0 A;  4L89 A;  2CIJ A;  1JWQ A;  1KUX A;  4WJB A;  1QST A;  1ZLH A;  3PB6 X;  3D67 A;  4MHN A;  4A2Z A;  4X5K A;  3PBE A;  3TCV A;  3FEC A;  5ELY A;  5HKY A;  2Z0Z A;  1T36 B;  2Z10 A;  3OB1 B;  2P6E A;  3GIU A;  3B3C A;  4PQA A;  1Z9E A;  4C8C A;  3EC4 A;  3KAS A;  1CPX A;  1L0C A;  1QSO A;  4XPD B;  4YU9 A;  1Y9W A;  2VZY A;  3T8W A;  3SJF A;  1IU8 A;  1VGY A;  4PV6 A;  4C2Y A;  3OAK A;  2XEF A;  1ZO0 A;  3PT1 A;  2REE A;  2ZPA A;  4E2A A;  1RO5 A;  2WPX A;  1C30 B;  3LWU A;  5KTC A;  3ZNI A;  3HPH E;  2UV8 G;  1ARL A;  2JEW A;  3FVL A;  4MJ8 A;  3FJU A;  4B6Z A;  3WAB A;  4JXR A;  2X7B A;  2WSA A;  4MFP A;  4UWI A;  3RO0 A;  3IWW A;  1TIQ A;  2YNC C;  4ONW A;  1GYT A;  1KBL A;  4OC0 A;  1ZL0 A;  3PFE A;  3PFO A;  1BPM A;  4HNX B;  2V77 A;  1Q2D A;  5THW A;  4XPL A;  3D3S A;  2B4D B;  4GPL B;  5LRK A;  1TKJ A;  4WWV A;  2OR4 A;  3OWC A;  1XF1 A;  3KKW A;  5AG5 A;  3SI1 A;  3TLB A;  2AUM A;  3DDD A;  4PK2 A;  4MMO A;  2ZOG A;  1ZRS A;  4QBJ A;  4Z65 A;  1DIK A;  3CZX A;  3D7F A;  3KI9 A;  1Z4E A;  3B3W A;  4B14 A;  4M6I A;  2D0P A;  3TLC A;  3G8W A;  4MI4 A;  2EBJ A;  4C99 A;  1YSJ A;  2I00 A;  3DR8 A;  4MFZ A;  3TC8 A;  3BUO B;  4RUH A;  2AJ6 A;  4H89 A;  4KOX A;  1Z5R A;  2PJC A;  1TKF A;  1XIX A;  3FRM A;  3E0K A;  3JTK A;  1UWY A;  3VRR A;  1B47 A;  4NGR A;  3B3T A;  4ZY2 A;  1Y0Y A;  5DS0 A;  4KSI A;  1RTQ A;  2O28 A;  2AFS A;  1CX8 A;  2HC9 A;  1XJO A;  2PRQ A;  3U88 C;  2YND A;  1CBX A;  2PSW A;  3C26 A;  4PSX A;  4UCP A;  4Y49 B;  5HH1 A;  2JDD A;  4CYP A;  3CPX A;  4MY0 A;  4R57 A;  5BY0 A;  2BCO A;  3KR4 A;  2P6F A;  4CS0 B;  5K8P A;  5IR2 A;  2FSR A;  4KUB A;  4KVM E;  1FBV A;  4CAV A;  2EVN A;  1XMT A;  3ISZ A;  3RNZ A;  4CGP A;  1KEE B;  3BUM B;  4CO9 A;  1I12 A;  4Q7A A;  5JH9 A;  1AMP A;  1V0C A;  2PJ5 A;  2Z3L A; 
#chains in the Genus database with same CATH homology
 3KQZ A;  2O4H A;  1IGB A;  2PJ9 A;  5D29 A;  2CTC A;  1Z8L A;  1F2O A;  1JQG A;  3I1U A;  4F8Z A;  5HVH A;  5D8N A;  3BI1 A;  1KWM A;  4A38 A;  4TWE A;  2ZEN A;  4P4E A;  2JBK A;  4MXU A;  4R7M A;  4P4B A;  3H8F A;  5LYI A;  4F9V A;  3V38 A;  1LAM A;  4JYW A;  4MHP A;  2XEG A;  1VIX A;  4A39 A;  2O53 A;  2QVP A;  2V8H A;  2FVG A;  2C6P A;  2PVW A;  4BD9 A;  1H8L A;  2AFX A;  5JGF A;  3D68 A;  3IEH A;  1BPN A;  3NH5 A;  4C8P A;  4R8F A;  4UIA A;  2BOA A;  4MRI A;  4NGP A;  2PCU A;  2Q43 A;  2PJ4 A;  3NH4 A;  2AFO A;  2AFM A;  3BI0 A;  3QNV A;  4EME A;  3PB7 X;  1CPS A;  4UIB A;  5HVF A;  2RFH A;  3RAM A;  4OP4 A;  2C6C A;  3D7G A;  4C8A A;  1CP7 A;  4NGM A;  1ELM P;  1Y9Z A;  4IK2 A;  1YW4 A;  1TF9 A;  3SI2 A;  1XFO A;  2PVV A;  3B2Y A;  3BXM A;  4DUK A;  1VHO A;  2F8H A;  4C86 A;  3K2K A;  4OKO A;  2BO9 A;  2GP4 A;  3H8G A;  3FF3 A;  3NH8 A;  1M4L A;  2ZOF A;  3WT4 A;  3N5F A;  4KNG E;  2ZEM A;  3HUV A;  4IAV A;  3PEI A;  4OC4 A;  5K8N A;  3B7I A;  5LYD A;  2PJ2 A;  1TXR A;  1F57 A;  2AFU A;  3LMS A;  4LQG A;  3EIF A;  5K8O A;  4UEF A;  3IJ3 A;  3FED A;  3TX8 A;  4IHM A;  4A94 A;  2GLJ A;  2DEA A;  4ZYQ A;  2GRE A;  4OC5 A;  4ZX8 A;  1BAV A;  1YW6 A;  2QYV A;  2EWB A;  4R76 A;  4CPA A;  4MCP A;  1Z2L A;  4X2T A;  1ZLI A;  2PJB A;  3NFZ A;  1FT7 A;  2POK A;  5HVG A;  3ISX A;  5LRJ A;  4OC1 A;  1LFW A;  2G9D A;  2PJ3 A;  3D7H A;  3V7Z A;  3D7D A;  4P44 A;  2AFW A;  2PE3 A;  1XRY A;  3GB0 A;  5CBM A;  3KHZ A;  5LYF A;  2PIY A;  3S9L A;  1HDQ A;  2ABZ A;  2ZEO A;  2PJ7 A;  3PB4 X;  4OME A;  4AXV A;  3SJG A;  2PJ1 A;  4OC2 A;  3WC6 A;  2GLF A;  4C9U A;  1LCP A;  2WZN A;  3JRU A;  2Q51 A;  3L2N A;  4UEE A;  4P4I A;  3KL9 A;  3PRT A;  1CG2 A;  4P45 A;  4JZ0 A;  3CPA A;  3H8E A;  1Q7L A;  2AFZ A;  1TKH A;  1ELL P;  1LOK A;  1VHE A;  4NFR A;  2ZEG A;  4MCS A;  4CDK A;  4DJL A;  3WC7 A;  3FX6 A;  3K9T A;  3KGQ A;  2C1C A;  2J9A A;  4C8U A;  3GLJ A;  2ZEE A;  3BHX A;  2OOT A;  4OID A;  3KHX A;  4MHY A;  3B3V A;  5J1Q A;  3IC1 A;  3VAT A;  2QJ8 A;  4P4F A;  1LAN A;  1LAP A;  2PJA A;  4ZX9 A;  1CP6 A;  2PJ0 A;  2EK8 A;  4EWT A;  4NJR A;  3IO1 A;  4FAI A;  1WVM A;  3IIB A;  4FUU A;  2NYQ A;  4P4J A;  3VAR A;  2I3C A;  3B3S A;  2Q4Z A;  5I4M A;  5K8M A;  1R43 A;  4C84 A;  4C9R A;  2IQ6 A;  1HDU A;  4C9A A;  3DGV A;  2IJZ A;  1AYE A;  2ZEL A;  2ANP A;  3RBU A;  4MHZ A;  2EK9 A;  2ZEH A;  4O23 A;  1DE4 C;  3MRU A;  3FH4 A;  3IFE A;  2HB6 A;  3GUX A;  4X8I A;  4CDJ A;  1Y7E A;  2V8G A;  3FMC A;  1YME A;  2XEI A;  2IMO A;  4MCR A;  1EE3 P;  4W9Y A;  4PXD A;  2GU2 A;  2PIZ A;  7CPA A;  2PJ8 A;  2ZED A;  4P10 A;  3KR5 A;  4OC3 A;  4GM5 A;  1OBR A;  4C8T A;  5LRG A;  1V6C A;  2VL1 A;  1PYT B;  4ZI6 A;  2XEJ A;  2V8V A;  3I6S A;  3D66 A;  2CF4 A;  4FWU A;  4R6T A;  3CDX A;  5CPA A;  4NGN A;  3VTA A;  2WYR A;  3RZA A;  2RB7 A;  2F7V A;  5HXD A;  4K3N A;  1XBU A;  1QQ9 A;  4TNU A;  4H2K A;  5IB9 A;  3SJE A;  3I74 A;  2ZEF A;  4C9E A;  3HLP A;  5F09 A;  4UEZ A;  4P4D A;  4OIW A;  4YWY A;  1XMB A;  5JM6 A;  2JBJ A;  1IY7 A;  1HEE A;  2C6G A;  2CTB A;  3CT9 A;  3PB8 X;  3SI0 A;  4A37 A;  4NGT A;  1TF8 A;  4YN3 A;  4UF4 A;  3D4U A;  1ARM A;  1NSA A;  2V8D A;  3PB9 X;  2ZEP A;  5LYL A;  2NSM A;  3FEE A;  3S9N A;  3MN8 A;  4ZY1 A;  4P6Y A;  3VH9 A;  1ZG7 A;  2C5Q A;  1Y0R A;  4PPZ A;  1FNO A;  3NA6 A;  4MCQ A;  3DLJ A;  4DYO A;  3B35 A;  8CPA A;  3SJX A;  4TJV A;  4NGS A;  1F2P A;  3PBB A;  4X3R A;  4C85 A;  6CPA A;  4EFD A;  1PCA A;  3WC5 A;  1R3N A;  1YLO A;  3ICU A;  4F9U A;  4PXE A;  1BLL E;  3KQX A;  3S9M A;  1ZG8 A;  1DTD A;  3KZW A;  2PJ6 A;  4G1P A;  4PXB A;  4NJQ A;  1QMU A;  4PXC A;  4C8F A;  4TJX A;  4NGQ A;  1ZG9 A;  4ZY0 A;  2CIJ A;  4WJB A;  1ZLH A;  3PB6 X;  3D67 A;  4MHN A;  3PBE A;  3FEC A;  5ELY A;  3B3C A;  4PQA A;  4C8C A;  3KAS A;  1CPX A;  4YU9 A;  4FBE A;  3T8W A;  3SJF A;  1VGY A;  2XEF A;  3LWU A;  2JEW A;  3FVL A;  1ARL A;  4B6Z A;  3FJU A;  3WAB A;  3IWW A;  4ONW A;  1GYT A;  4OC0 A;  3PFE A;  3PFO A;  1BPM A;  2V77 A;  5THW A;  5LRK A;  1TKJ A;  4WWV A;  2OR4 A;  1XF1 A;  3SI1 A;  4MMO A;  2ZOG A;  4Z65 A;  3KI9 A;  3D7F A;  3B3W A;  4C99 A;  1YSJ A;  3TC8 A;  4RUH A;  1Z5R A;  2PJC A;  1TKF A;  1UWY A;  3B3T A;  4NGR A;  4ZY2 A;  1Y0Y A;  5DS0 A;  4KSI A;  1RTQ A;  2AFS A;  1CX8 A;  2HC9 A;  1XJO A;  2PRQ A;  1CBX A;  3CPX A;  5K8P A;  2BCO A;  3KR4 A;  5IR2 A;  3ISZ A;  5JH9 A;  4Q7A A;  1AMP A;  4C9V A;  2PJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...