2OOXA

Crystal structure of the adenylate sensor from amp-activated protein kinase complexed with amp
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
128
structure length
128
Chain Sequence
RNKWHFGVRCRGDAPEILLAVYRALQRAGAQFTVPKPVNGKYRSDMYTIKSRWEIPHCKREGKNTYAYIELQLYEVMPGCFMLDVKSNGYKDIYSHPERTADHGMDDLKSSFPFLDLCAMLVCKLFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SNF1-like protein kinase ssp2
publication title Crystal structures of the adenylate sensor from fission yeast AMP-activated protein kinase.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 29
structure length 128
sequence length 128
chains with identical sequence C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16579 AdenylateSensor Adenylate sensor of SNF1-like protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2ooxA00
4EAIA 3TE5A 2QRCA 2EHBD 2V9JA 3TDHA 2Y8QA 2V92A 2OOYA 3OSEA 4EAJA 4EAGA 2OOXA 2V8QA 2QREA 2QLVA 2QR1A 1UL7A 2YA3A 2Y8LA 2QRDA 2ZFDB 3T4NA 4CFFA 4EAKA 4EALA 1V5SA
chains in the Genus database with same CATH superfamily
4EAIA 1VOKA 3F10A 5BMPA 1B9KA 2DKAA 4Q11A 2NOBA 2V92A 1XSZA 3KRMA 1CDWA 2OOYA 5EPCA 1YQMA 2I5WA 1MP9A 3OSEA 1N39A 1RM1A 1QNBA 3UW2A 1AISA 2DKCA 4C7PA 2D0AA 4EAJA 3CWUA 1QN3A 1EUVA 1YTFA 1QNEA 2HL8A 2F7LA 3BKQX 1R4XA 2QREA 1T6AA 1KO9A 1EBMA 4HJHA 1N3CA 5JMVD 1C9BB 2LAEA 3DPUA 4WXAA 3D4VA 4DULA 1K2YX 1VTLE 4MRQA 2R5XA 4ROEB 1TGHA 1V5SA 2JHJA 2FGTA 2V9JA 3N89A 2H5AX 5JN5A 1YQKA 2Y8QA 1C4GA 2H4LX 1LWVA 4ROCB 1QTSA 3CVTA 1NVPA 2PWWA 2NVMA 3OSTA 3SNSA 3C04A 3RPJA 3KTUA 2IV8A 4PY5A 2HZSA 1DIZA 1JFIC 2G30A 2Z8UA 1YQLA 1VOLB 2OOXA 3D7QA 1W80A 4IL8A 4QG5A 1K35A 3OSMA 2QLVA 3ULXA 1N3AA 1QNCA 2XHIA 1UL7A 2HZMA 2YA3A 1KYUA 3ENCA 4I8OA 3EIKA 3HS8A 2ZFDB 3T4NA 4BJUA 4CFFA 4EAKA 3DPTA 1KFIA 2QRCA 2EHBD 2D0CA 3CVSA 1QN5A 1QNAA 1VTOA 3CWSA 1HU0A 1KYDA 2HKPA 3TDHA 2FKMX 2NWVA 1LXTA 2HL9A 5F9CA 3CWAA 1D3UA 1P5GX 1M3QA 1KY6A 1KY7A 5HSHA 1KFQA 1WQAA 4WX8A 1QN9A 2YH5A 1QTPA 1Q9UA 3F0ZA 3OC3C 1J3MA 1PCMX 5IYDP 4EAGA 2Z0FA 2D0BA 1E42A 5IYBP 1YTBA 2NOEA 2V8QA 1UT7A 3VN5A 2FUVA 2NLVA 2QR1A 5IYCP 3OCIA 4EJYA 2JOIA 2QRDA 1UT4A 2NOHA 3EAYA 2NOZA 5AN4A 3TE5A 1MPGA 1PZDA 3OGDA 3I0WA 2JHNA 3OH6A 3NA5A 1QN4A 1WJWA 1M3HA 2DKDA 4B0AA 2NOIA 5BMNA 3OH9A 2VJ0A 3OLPA 1QN8A 1TUOA 1VKLA 4TPSA 1QN6A 3ENOC 1PCZA 2NOFA 1YQRA 2FKFA 1QN7A 1P5DX 1TBAB 1KYFA 3I3WA 4WZSD 3IH7A 1PCJX 2O3OA 1FN7A 5KL0A 4RODB 4D7QA 1PVSA 2MJ7A 3H1ZA 3RSMA 3PMGA 1LWWA 1JDYA 3PDKA 2IV9A 2MZ8A 3CWTA 2NOLA 2Y8LA 3I0XA 1C47A 2JPIA 1NH2A 1LWYA 1TBPA 1NGMA 3HS9A 3CW7A 4EALA 4EJZA 3ASMA 4D7RA 1M5Q1
chains in the Genus database with same CATH topology
4EAIA 3TE5A 2QRCA 2EHBD 2V9JA 3TDHA 2Y8QA 2V92A 2OOYA 3OSEA 4EAJA 4EAGA 2OOXA 2V8QA 2QREA 2QLVA 2QR1A 1UL7A 2YA3A 2Y8LA 2QRDA 2ZFDB 3T4NA 4CFFA 4EAKA 4EALA 1V5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EAI A;  3TE5 A;  2QRC A;  2EHB D;  2V9J A;  3TDH A;  2Y8Q A;  2V92 A;  2OOY A;  3OSE A;  4EAJ A;  4EAG A;  2OOX A;  2V8Q A;  2QRE A;  2QLV A;  2QR1 A;  1UL7 A;  2YA3 A;  2Y8L A;  2QRD A;  2ZFD B;  3T4N A;  4CFF A;  4EAK A;  4EAL A;  1V5S A; 
#chains in the Genus database with same CATH topology
 4EAI A;  1VOK A;  3F10 A;  5BMP A;  1B9K A;  2DKA A;  4Q11 A;  2NOB A;  2V92 A;  1XSZ A;  3KRM A;  1CDW A;  2OOY A;  5EPC A;  1YQM A;  2I5W A;  1MP9 A;  3OSE A;  1N39 A;  1RM1 A;  1QNB A;  3UW2 A;  1AIS A;  2DKC A;  4C7P A;  2D0A A;  4EAJ A;  3CWU A;  1QN3 A;  1EUV A;  1YTF A;  1QNE A;  2HL8 A;  2F7L A;  3BKQ X;  1R4X A;  2QRE A;  1T6A A;  1KO9 A;  1EBM A;  4HJH A;  1N3C A;  5JMV D;  1C9B B;  2LAE A;  3DPU A;  4WXA A;  3D4V A;  4DUL A;  1K2Y X;  1VTL E;  4MRQ A;  2R5X A;  4ROE B;  1TGH A;  1V5S A;  2JHJ A;  2FGT A;  2V9J A;  3N89 A;  2H5A X;  5JN5 A;  1YQK A;  2Y8Q A;  1C4G A;  2H4L X;  1LWV A;  4ROC B;  1QTS A;  3CVT A;  1NVP A;  2PWW A;  2NVM A;  3OST A;  3SNS A;  3C04 A;  3RPJ A;  3KTU A;  2IV8 A;  4PY5 A;  2HZS A;  1DIZ A;  1JFI C;  2G30 A;  2Z8U A;  1YQL A;  1VOL B;  2OOX A;  3D7Q A;  1W80 A;  4IL8 A;  4QG5 A;  1K35 A;  3OSM A;  2QLV A;  3ULX A;  1N3A A;  1QNC A;  2XHI A;  1UL7 A;  2HZM A;  2YA3 A;  1KYU A;  3ENC A;  4I8O A;  3EIK A;  3HS8 A;  2ZFD B;  3T4N A;  4BJU A;  4CFF A;  4EAK A;  3DPT A;  1KFI A;  2QRC A;  2EHB D;  2D0C A;  3CVS A;  1QN5 A;  1QNA A;  1VTO A;  3CWS A;  1HU0 A;  1KYD A;  2HKP A;  3TDH A;  2FKM X;  2NWV A;  1LXT A;  2HL9 A;  5F9C A;  3CWA A;  1D3U A;  1P5G X;  1M3Q A;  1KY6 A;  1KY7 A;  5HSH A;  1KFQ A;  1WQA A;  4WX8 A;  1QN9 A;  2YH5 A;  1QTP A;  1Q9U A;  3F0Z A;  3OC3 C;  1J3M A;  1PCM X;  5IYD P;  4EAG A;  2Z0F A;  2D0B A;  1E42 A;  5IYB P;  1YTB A;  2NOE A;  2V8Q A;  1UT7 A;  3VN5 A;  2FUV A;  2NLV A;  2QR1 A;  5IYC P;  3OCI A;  4EJY A;  2JOI A;  2QRD A;  1UT4 A;  2NOH A;  3EAY A;  2NOZ A;  5AN4 A;  3TE5 A;  1MPG A;  1PZD A;  3OGD A;  3I0W A;  2JHN A;  3OH6 A;  3NA5 A;  1QN4 A;  1WJW A;  1M3H A;  2DKD A;  4B0A A;  2NOI A;  5BMN A;  3OH9 A;  2VJ0 A;  3OLP A;  1QN8 A;  1TUO A;  1VKL A;  4TPS A;  1QN6 A;  3ENO C;  1PCZ A;  2NOF A;  1YQR A;  2FKF A;  1QN7 A;  1P5D X;  1TBA B;  1KYF A;  3I3W A;  4WZS D;  3IH7 A;  1PCJ X;  2O3O A;  1FN7 A;  5KL0 A;  4ROD B;  4D7Q A;  1PVS A;  2MJ7 A;  3H1Z A;  3RSM A;  3PMG A;  1LWW A;  1JDY A;  3PDK A;  2IV9 A;  2MZ8 A;  3CWT A;  2NOL A;  2Y8L A;  3I0X A;  1C47 A;  2JPI A;  1NH2 A;  1LWY A;  1TBP A;  1NGM A;  3HS9 A;  3CW7 A;  4EAL A;  4EJZ A;  3ASM A;  4D7R A;  1M5Q 1; 
#chains in the Genus database with same CATH homology
 4EAI A;  3TE5 A;  2QRC A;  2EHB D;  2V9J A;  3TDH A;  2Y8Q A;  2V92 A;  2OOY A;  3OSE A;  4EAJ A;  4EAG A;  2OOX A;  2V8Q A;  2QRE A;  2QLV A;  2QR1 A;  1UL7 A;  2YA3 A;  2Y8L A;  2QRD A;  2ZFD B;  3T4N A;  4CFF A;  4EAK A;  4EAL A;  1V5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...