2OOYA

Crystal structure of the adenylate sensor from amp-activated protein kinase complexed with atp
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
129
structure length
129
Chain Sequence
SRRNKWHFGVRCRGDAPEILLAVYRALQRAGAQFTVPKPVNGKYRSDMYTIKSRWEIPHCKREGKNTYAYIELQLYEVMPGCFMLDVKSNGYKDIYSHPERTADHGMDDLKSSFPFLDLCAMLVCKLFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SNF1-like protein kinase ssp2
publication title Crystal structures of the adenylate sensor from fission yeast AMP-activated protein kinase.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 27
structure length 129
sequence length 129
chains with identical sequence C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16579 AdenylateSensor Adenylate sensor of SNF1-like protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2ooyA00
3OSEA 1V5SA 2QRCA 3TE5A 2V9JA 2EHBD 2Y8QA 2YA3A 4EALA 1UL7A 4EAIA 2OOXA 4EAJA 2V8QA 2OOYA 2QLVA 3T4NA 2V92A 2QREA 2ZFDB 2QRDA 2QR1A 4EAGA 2Y8LA 4CFFA 3TDHA 4EAKA
chains in the Genus database with same CATH superfamily
3D4VA 2QRCA 2PWWA 3DPUA 3RSMA 5BMNA 1YQMA 3N89A 3TE5A 1RM1A 3CWTA 1WJWA 2NWVA 2V9JA 3PDKA 4WXAA 1NH2A 4QG5A 3CVTA 3NA5A 1YQKA 4ROCB 3OCIA 4HJHA 2YA3A 1YQLA 3RPJA 2OOXA 2V8QA 2HKPA 3DPTA 3OH6A 4ROEB 5BMPA 1QN3A 1KFIA 3OH9A 2QLVA 1LWYA 1D3UA 1UT4A 1WQAA 1QNCA 1PCZA 1C47A 2HL9A 3UW2A 4EAGA 2NOBA 2IV8A 1QTPA 3BKQX 4PY5A 1M3HA 2NLVA 1YTBA 3OSEA 2FKMX 1W80A 1V5SA 3F0ZA 1KYUA 1NGMA 1KY6A 2FKFA 3I0WA 1EBMA 2EHBD 3KRMA 2VJ0A 5IYDP 1P5DX 3PMGA 2HL8A 4EJYA 1M5Q1 1M3QA 4WX8A 1QN4A 4BJUA 1T6AA 3OSMA 3OGDA 2IV9A 4EAIA 1DIZA 4RODB 1JDYA 3IH7A 3H1ZA 1VTOA 1PVSA 2JHJA 3T4NA 2DKAA 1J3MA 2V92A 3OLPA 4DULA 4D7QA 2NVMA 1N3AA 1LWVA 1QN5A 1NVPA 2QRDA 2D0BA 2FGTA 2QR1A 1LXTA 2Y8LA 3CWUA 1VOKA 1FN7A 4IL8A 1QNAA 2DKCA 5EPCA 1K2YX 4Q11A 2F7LA 1PCMX 1HU0A 2Z0FA 1QN6A 1YTFA 4WZSD 2NOLA 2HZSA 3HS9A 1C9BB 1MP9A 5AN4A 1B9KA 3CVSA 2MZ8A 1VTLE 1EUVA 1QNBA 3C04A 1Q9UA 4EALA 3I3WA 1XSZA 3CW7A 1P5GX 1VKLA 4EAJA 1N39A 3ENCA 3SNSA 5IYCP 2YH5A 1E42A 1TUOA 2NOIA 2JPIA 5F9CA 3OSTA 3OC3C 2QREA 2XHIA 4B0AA 2ZFDB 3ULXA 1CDWA 2NOEA 1QTSA 2HZMA 2D0AA 2H5AX 4TPSA 3TDHA 1JFIC 3CWSA 5KL0A 5JN5A 1N3CA 5JMVD 4EAKA 2H4LX 3CWAA 1R4XA 1KYFA 2O3OA 2D0CA 2NOFA 1LWWA 2Z8UA 1K35A 3I0XA 3VN5A 2DKDA 4D7RA 1C4GA 1AISA 1TBPA 5IYBP 1MPGA 3ENOC 1QNEA 3F10A 3EAYA 2Y8QA 1QN8A 1KO9A 4EJZA 1UL7A 1PZDA 4I8OA 1VOLB 1PCJX 3ASMA 3EIKA 2FUVA 2MJ7A 1TBAB 3KTUA 4MRQA 2OOYA 1QN7A 1TGHA 1QN9A 2R5XA 3HS8A 2NOHA 2JHNA 2I5WA 2NOZA 1KY7A 3D7QA 1KYDA 2G30A 1UT7A 4CFFA 1YQRA 2LAEA 2JOIA 4C7PA 5HSHA 1KFQA
chains in the Genus database with same CATH topology
3OSEA 1V5SA 2QRCA 3TE5A 2V9JA 2EHBD 2Y8QA 2YA3A 4EALA 1UL7A 4EAIA 2OOXA 4EAJA 2V8QA 2OOYA 2QLVA 3T4NA 2V92A 2QREA 2ZFDB 2QRDA 2QR1A 4EAGA 2Y8LA 4CFFA 3TDHA 4EAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OSE A;  1V5S A;  2QRC A;  3TE5 A;  2V9J A;  2EHB D;  2Y8Q A;  2YA3 A;  4EAL A;  1UL7 A;  4EAI A;  2OOX A;  4EAJ A;  2V8Q A;  2OOY A;  2QLV A;  3T4N A;  2V92 A;  2QRE A;  2ZFD B;  2QRD A;  2QR1 A;  4EAG A;  2Y8L A;  4CFF A;  3TDH A;  4EAK A; 
#chains in the Genus database with same CATH topology
 3D4V A;  2QRC A;  2PWW A;  3DPU A;  3RSM A;  5BMN A;  1YQM A;  3N89 A;  3TE5 A;  1RM1 A;  3CWT A;  1WJW A;  2NWV A;  2V9J A;  3PDK A;  4WXA A;  1NH2 A;  4QG5 A;  3CVT A;  3NA5 A;  1YQK A;  4ROC B;  3OCI A;  4HJH A;  2YA3 A;  1YQL A;  3RPJ A;  2OOX A;  2V8Q A;  2HKP A;  3DPT A;  3OH6 A;  4ROE B;  5BMP A;  1QN3 A;  1KFI A;  3OH9 A;  2QLV A;  1LWY A;  1D3U A;  1UT4 A;  1WQA A;  1QNC A;  1PCZ A;  1C47 A;  2HL9 A;  3UW2 A;  4EAG A;  2NOB A;  2IV8 A;  1QTP A;  3BKQ X;  4PY5 A;  1M3H A;  2NLV A;  1YTB A;  3OSE A;  2FKM X;  1W80 A;  1V5S A;  3F0Z A;  1KYU A;  1NGM A;  1KY6 A;  2FKF A;  3I0W A;  1EBM A;  2EHB D;  3KRM A;  2VJ0 A;  5IYD P;  1P5D X;  3PMG A;  2HL8 A;  4EJY A;  1M5Q 1;  1M3Q A;  4WX8 A;  1QN4 A;  4BJU A;  1T6A A;  3OSM A;  3OGD A;  2IV9 A;  4EAI A;  1DIZ A;  4ROD B;  1JDY A;  3IH7 A;  3H1Z A;  1VTO A;  1PVS A;  2JHJ A;  3T4N A;  2DKA A;  1J3M A;  2V92 A;  3OLP A;  4DUL A;  4D7Q A;  2NVM A;  1N3A A;  1LWV A;  1QN5 A;  1NVP A;  2QRD A;  2D0B A;  2FGT A;  2QR1 A;  1LXT A;  2Y8L A;  3CWU A;  1VOK A;  1FN7 A;  4IL8 A;  1QNA A;  2DKC A;  5EPC A;  1K2Y X;  4Q11 A;  2F7L A;  1PCM X;  1HU0 A;  2Z0F A;  1QN6 A;  1YTF A;  4WZS D;  2NOL A;  2HZS A;  3HS9 A;  1C9B B;  1MP9 A;  5AN4 A;  1B9K A;  3CVS A;  2MZ8 A;  1VTL E;  1EUV A;  1QNB A;  3C04 A;  1Q9U A;  4EAL A;  3I3W A;  1XSZ A;  3CW7 A;  1P5G X;  1VKL A;  4EAJ A;  1N39 A;  3ENC A;  3SNS A;  5IYC P;  2YH5 A;  1E42 A;  1TUO A;  2NOI A;  2JPI A;  5F9C A;  3OST A;  3OC3 C;  2QRE A;  2XHI A;  4B0A A;  2ZFD B;  3ULX A;  1CDW A;  2NOE A;  1QTS A;  2HZM A;  2D0A A;  2H5A X;  4TPS A;  3TDH A;  1JFI C;  3CWS A;  5KL0 A;  5JN5 A;  1N3C A;  5JMV D;  4EAK A;  2H4L X;  3CWA A;  1R4X A;  1KYF A;  2O3O A;  2D0C A;  2NOF A;  1LWW A;  2Z8U A;  1K35 A;  3I0X A;  3VN5 A;  2DKD A;  4D7R A;  1C4G A;  1AIS A;  1TBP A;  5IYB P;  1MPG A;  3ENO C;  1QNE A;  3F10 A;  3EAY A;  2Y8Q A;  1QN8 A;  1KO9 A;  4EJZ A;  1UL7 A;  1PZD A;  4I8O A;  1VOL B;  1PCJ X;  3ASM A;  3EIK A;  2FUV A;  2MJ7 A;  1TBA B;  3KTU A;  4MRQ A;  2OOY A;  1QN7 A;  1TGH A;  1QN9 A;  2R5X A;  3HS8 A;  2NOH A;  2JHN A;  2I5W A;  2NOZ A;  1KY7 A;  3D7Q A;  1KYD A;  2G30 A;  1UT7 A;  4CFF A;  1YQR A;  2LAE A;  2JOI A;  4C7P A;  5HSH A;  1KFQ A; 
#chains in the Genus database with same CATH homology
 3OSE A;  1V5S A;  2QRC A;  3TE5 A;  2V9J A;  2EHB D;  2Y8Q A;  2YA3 A;  4EAL A;  1UL7 A;  4EAI A;  2OOX A;  4EAJ A;  2V8Q A;  2OOY A;  2QLV A;  3T4N A;  2V92 A;  2QRE A;  2ZFD B;  2QRD A;  2QR1 A;  4EAG A;  2Y8L A;  4CFF A;  3TDH A;  4EAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...