2OP5A

Crystal structure of a dimeric ferredoxin-like protein (jcvi_pep_1096672785533) from uncultured marine organism at 2.20 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
112
structure length
112
Chain Sequence
TDETAFLNSLFMDFTSENELELFLKSLDEVWSEDLYSRLSAAGLIRHVISKVWNKEQHRISMVFEYDSKEGYQKCQEIIDKEFGITLKEKLKKFVFKIHNNRGVVVSEFIRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Crystal structure of hypothetical protein (JCVI_PEP_1096672785533) from an environmental metagenome (unidentified marine microbe), Sorcerer II Global Ocean Sampling experiment at 2.20 A resolution
rcsb
source organism Uncultured marine organism
molecule tags Oxidoreductase
total genus 30
structure length 112
sequence length 112
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2op5A01
3KNGA 2LXFA 2OFHX 2VV5A 1R6YA 1VQSA 2XMMA 2XMTA 3HHLB 4HL9A 2KKHA 1TL4A 2OAUA 3T9NA 3K7RA 5B0EA 2ZDPA 1FE4A 2BYCA 3E8OA 5F0WA 1OPZA 4Y2KA 3LGNA 2IYGA 1OSDA 1SQEA 5B0AA 1Q8LA 1Y3KA 1FESA 1N5SA 2XMKA 3HFKA 3HHLA 4HI1A 5A6WA 4Y2IA 3FGVA 1K0VA 2XMUA 2N7YA 4HH0A 2RMLA 2ROGA 2OD6A 3F44A 3BGUA 2OD4A 4NL5A 5B0DA 1P8GA 2AJ0A 1Q53A 2K2PA 1X0PA 4Q2LA 1GXTA 2GA7A 1TL5A 2JDJA 3BDEA 4OJ1A 4OJ3A 1APSA 1YJTA 2LQBA 2RSQA 5B0FA 5T7LA 3UDCA 2XMJA 2GV1A 1FVQA 3HX9A 5B08A 1JWWA 3CJKB 2K7JA 3HHLD 3I9ZA 2GGPB 4DPOA 1OQ3A 1WD6A 3KG1A 3TRGA 1Y3JA 1AFJA 1YG0A 2HLTA 3TOQA 4F67A 1AFIA 1SI9A 1S6OA 1FE0A 2AJ1A 1URRA 2LDIA 2Q3PA 3HDSA 1S6UA 3TNVA 2FHMA 3WDOA 3CJKA 2HFOA 1W2IA 3IWXA 2FTRA 4OJGA 3LO3A 1AW0A 2N4CA 2IYIA 2ASYA 2RILA 2N4DA 1TUVA 3QMQA 2HIQA 1QUPA 2BJEA 4NPOA 2QLXA 4YDXA 1X7VA 2KT2A 1CC7A 1N5QA 3DCAA 1VQYA 2ZDOA 3FMBA 1YRXA 2L3MA 4ZA1A 2K7KA 5B0CA 1IUJA 1X8DA 2BJDA 3FRYA 4A47A 1CPZA 2OKQA 4DL0C 2QLWA 2ROEA 1Y9OA 3GZ7A 4ZOSA 3HHLC 1Y0HA 1ULRA 1XBWA 2ROPA 2W4CA 2PD1A 2XMWA 4A48A 1FVSA 2KYZA 5B0GA 5IXUA 2BUNA 1YJVA 2GCFA 2QYCA 3BF4A 2EW9A 4QOTA 5KAKA 2OMOA 2K1RB 1MWYA 2QIFA 1JK9B 1N5TA 1LQ9A 2CRLA 2GO8A 1TR0A 2GGPA 2IFXA 3BM7A 1CC8A 4Q2MA 4EFAC 5A6PA 1GXUA 3KG0A 1FD8A 1YJUA 1Q4RA 2RU9A 4HH1A 3LGMA 4HI2A 1V3ZA 5B09A 5F0UA 2HFNA 1YJRA 1KVIA 2GFFA 2KT3A 3QGPA 2G9OA 5B0BA 4Y2MA 1KQKA 2FB0A 2BBEA 2W4DA 4OJHA 1SB6A 3KKFA 4YEAA 1TZ0A 1N5VA 2LQ9A 3HF5A 5K9FA 2AW0A 2HLUA 4FNIA 1OQ6A 1Q8BA 4FNHA 2FIUA 2AP6A 3VTIA 2ACYA 2PGCA 3MCSA 1P6TA 2OP5A 3BB5A 1RJJA 1U7LA 1MWZA 3MZIA 4OIXA 5T7LB 2VH7A 1FEEA 2HQIA 2XMVA 4U9RA 4A46A 2OFGX 3BR8A 3BN7A 3DXSX 4DN9A 2K1RA 4A4JA 3IWLA 1KVJA 2W4PA
chains in the Genus database with same CATH superfamily
1R27B 1VQSA 2XSJA 1S1XA 5KFTA 3V5RA 3FQLA 3E8OA 2IYGA 1Q8LA 1KVKA 4WXOA 3LP2B 4I7FA 1KN6A 1Q79A 3H4DA 2X1FA 3CW2C 2OI2A 2CAJA 2DIUA 4Z37A 1B3TA 4OYMA 1WC0A 3D2WA 3TYTA 4P72A 2WVFA 4DX6A 4I64A 1VRTA 4ED0A 4F26A 1GT8A 1T3OA 1F9EB 2P9GA 1YJNS 2CQ2A 4GRSA 2CRLA 2YWKA 2ZITA 4CM0A 4Y00A 4WU2A 2LA6A 2R8KA 1WTBA 4NOHA 3KHLA 3SSQA 1RXOB 4R5PA 3NS5A 1KTQA 3JQKA 1BQMB 3I82A 5KG0A 1OQ6A 2CA9A 2RF2A 5HQ8A 4ZVPB 4OIXA 1S7HA 4H4KC 3NS6A 5LMUF 2R3VA 2VASA 4PKDB 2DCUB 4UY85 1R7IA 1X9SA 3SBMA 4RBUA 2YQ1A 9ATCB 4LSNB 4IO1A 1FX2A 4OV1A 1RAAB 1X5TA 3EVOA 1B7FA 3IMQJ 3AH6A 2MKJA 2OJ3A 1NCLA 4F67A 3HPOA 1H73A 1S1VA 2DHHA 3EVWA 1GH8A 3Q8SB 1D09B 1Q95G 3M9MB 2JX2A 4PWUA 1TKDA 2AWZA 3RU0A 2OHDA 2MXYA 1SIWB 2KRRA 1RZMA 2BZ2A 1JLCA 3IAM9 1KVIA 2KT3A 1S1UB 1O8BA 2BX6A 4CRJA 1FRXA 4QYZK 1IVZA 1KDNA 1BQNB 3PR5B 3EPIA 1N5YB 2RH3A 1Y00A 3ZNJ1 3GV7B 4CT9A 4WXWA 3VAIA 1QD1A 1U1OA 2OFGX 1B4SA 3CJSA 3W7BA 1RA7A 1K1SA 3JSMB 2ACMA 4PYAA 1RT5B 1FWLA 3VAKA 4IUFA 2VG5B 1NUEA 2FLPA 3B8HA 1DTQA 3VWSA 1GMWA 3FSYA 3KK2A 1N32F 3OUYA 3DN9A 2LKZA 5C24B 2OTLS 1CG2A 4WFBQ 1TK8A 4ZVGA 3N4WA 4NCAA 1K9MT 1S49A 4B3SF 2HS4A 2DEIA 3NRBA 4DR6J 3TX0A 3QAUA 5BXIA 2Z56B 3POTB 4LVNP 2VQEJ 3KMSA 2Q6BA 3MD1A 3FKBA 4EEYA 2V8PA 2VA2A 2EFQA 2IJFA 3DGPB 2Z2ZA 1SCJB 3PRVA 3NGRA 4CT8A 4MT1A 1JLAA 1Q81T 1NNDA 2HVDA 3HD1A 1XMQJ 3DXSX 2NZ4A 3W2VA 4NRTA 1JJ2R 4CLWA 2U2FA 2B9XA 4K5SA 3UN3A 3BSNA 1H0HB 4CO3A 2BR0A 1PBUA 1BY9A 4KGVB 3K89A 2W9BA 4UOGA 2EXUA 4X4OA 2RJZA 3ETMA 4F36A 1L3UA 2MGZA 1FDAA 1PAUB 3AB2B 1B70B 2HHTA 2HHSA 4FXDA 1SV5A 4ZA1A 2JHEA 1RWUA 3GIJA 4ZVSB 1FXRA 1ULRA 4IDKB 4EO8A 3A4TA 3VV2B 3AXMA 1FNMA 3CCZA 3V81A 2BV3A 1PKUA 3PJ9A 4IRDA 2R7VA 2J9CA 1FNOA 1FA0A 1S6PB 4DR4F 5I42A 2IIHA 2XMVA 1LK5A 2PMWA 2DGWA 1H98A 3TZZA 4C0BA 1TVRB 4WP9A 4NWBA 4ECSA 2DGTA 3FCVA 1S5ZA 1RHRB 4DPTA 1IXKA 2BKOA 1D9DA 5CZVA 1TMJA 2DNOA 3BGOP 1WI6A 1FE0A 2QEXS 3N28A 1KR4A 3BKUA 3HKWA 2D41A 4QQBA 4E8UA 2YWWA 2C2KB 1TAUA 2V67A 1OY6A 3Q8VA 2G2ZA 1KQFB 2RHQB 2DXEA 1K8AT 2VFVA 1TUGB 2VHGA 4LF9J 1RWOB 2J9DE 2YWGA 3CDBA 1JB0C 1TP7A 1KFSA 3G71S 3OHBA 1T9XA 5B0BA 2GQCA 2XM3A 1WWHA 1L3SA 1IR2A 4P71A 3I96A 4LVOP 1KTVA 2HLUA 4RW8B 1VQ4S 1R0AB 1DARA 1ZS6A 1URNA 3PEJA 3NBPB 3GCXP 3J7ZT 2E1AA 4EK2A 1RI7A 2KFNA 1CJUA 2YKOA 4RWWA 2DHXA 2H54B 3W62A 5DGBA 1EQMA 3CC4S 2MKCA 3L7PA 4M5IA 2HK3A 1QE1B 1VBZA 3W60A 3MDFA 1TL1B 3UE2A 1ELOA 4ZKAA 2JZ5A 2UUBF 5D0RA 1JJHA 3HVTB 4IOCQ 4QYRA 3CD5A 2P8IA 2WBRA 3HFVA 2AIRB 2J0SD 2BE9B 4MAKA 3AA8A 3WX4A 2Y0BB 4KHRA 1RDRA 2WRMA 3M2RA 3I5CA 2YH1A 3M8SA 2ROEA 1NK4A 3DOKB 2AYBA 3O1LA 1CQMA 4X4VA 5F8MA 3AOCA 3HJVA 1DURA 2G9OA 1S6QA 5F8LA 4JI6J 3HXMA 1VQ7S 1EAYC 4UOFA 1HNVB 4NI2A 2VPZB 3JSRA 4N77A 2UUCJ 2P5VA 1WOPA 5E2QA 5GAGI 2YBVA 4XDCA 1XR6A 4ECZA 2QL7B 5DQIA 4JOUA 3CNQP 1OSDA 4OHXA 2XMKA 3DLEA 5THWA 2XO7A 5IM0A 1XERA 2AZ1A 4Z2XA 3P96A 2HQGA 3QIPA 3FMWA 1YJWS 4L72B 5KFBA 1YZ7A 3MOJB 2B9WA 2YPYA 2ZKUA 1P1LA 2QN6B 1Y10A 5AJ3J 1LFWA 3WDOA 1NPKA 2VG7A 4PWDA 2W2MP 4LFAF 1S0OA 1H7WA 2VDIA 4QWCA 3GZ7A 3DXBA 1VBXA 1WF2A 2N82B 1YJVA 5EX3A 2L41A 3MM8A 1HWKA 3PZPA 3HJFA 2DNPA 4O3OA 4V19J 2PA8D 2AEJA 3TZYA 5GAEU 2QC3A 2IAJB 3GPAA 3BGRA 2BOPA 1UW4A 3VGSA 1UA1A 4PEOA 3PEHA 1REVA 1I3OB 3KLFB 1VMBA 2PT0A 2B43A 1KLMB 1X31C 1A9NB 3H5UA 4X4UA 4DF4A 2CPJA 3DRYA 4ZPWR 3Q89A 3K58A 1I94J 1UL3A 2RDIA 4TU8A 1HW9A 4IG0B 2HHHJ 3HHLA 2L08A 1IKWB 5KFCA 3AT1B 3IA0A 3K5PA 5LMNF 1V5VA 2KO1A 3J80Y 1GMVA 3M6WA 1UETA 2H5EA 4UQGA 2FDNA 3D7SB 5B0CA 1LNQA 3FZBA 1B0VA 4WKYA 3PVXA 4WF9Q 1WSVA 1WC5A 1FKPB 1D9FA 2F65A 3GTYX 3MCMA 1WKKA 3IFEA 1UVMA 2LU2A 2ZM6F 3BSAA 1TV6B 4K2JA 3M9NB 1JX4A 3K8WA 2QL9B 2HNYA 2OPPB 1P6TA 3MZIA 5CABA 3TUIC 1FEEA 4AE5A 2V94A 3HO1A 3C15B 2YY3A 1X4EA 2R8GA 4FPRA 5J1EB 3ONQA 1TL3A 4DSKA 2ZZTA 1RTHB 5B0EA 1EZZB 1GX6A 4CWBA 4LF5J 5FIIA 4Y28C 3MECB 4ETZA 4HH0A 4N41A 4ZVOB 2CPIA 3RW6A 3GG1A 3T1YF 5BYSA 5KFGA 4K8RA 4WE1B 5FLXY 3GIKA 2FJEB 5IQQA 5K8MA 2FLNA 1EKSA 5ADZA 2VUGA 2QSWA 1T03B 2GX8A 5H1SV 2WOMA 4IFVB 1RHJB 2HVZA 2V0NA 1S10A 1X8DA 1PCAA 3CC7S 1RB0A 5JVGQ 2FPHX 1Q8KA 4DN0A 2K3IA 3KLIA 2J7WA 2CQ1A 4ZVHA 3WZ0A 1Q4RA 4KIAA 1Q8IA 3KXDA 2ZZMA 3K2YA 1AT1B 4B9SA 4DV1F 2VPXB 3AODA 4IFYA 5LOQA 4ZCIA 3TUZC 2AX0A 1PJ7A 3ENAA 2NXCA 3PKMA 4ES1A 1IM4A 1FO1A 1ZM9A 3BN7A 3H2UB 2JEIA 4CQ1A 1UFLA 4U8VA 3BR9A 4YS2A 4RW6A 2W2PP 5GAEI 1WELA 3CGIA 5L38A 1WDDA 3P3DA 3HFKA 1N36F 4G1PA 2B5JB 2LQBA 3CC2S 4O4RA 2HWTA 3OXFA 4LBPA 3FEZA 3FQKA 3J7AN 3MFIA 2V8GA 3T5LA 3BQ0A 2Q6CA 3LP2A 3RR8A 3DRPB 2FGCA 2A10A 4DR7J 3DFEA 3W5ZA 3QT7A 4NZ0A 1QTMA 4HHHA 4HTJA 1FTCA 1PIEA 3H2LA 3C16A 1H3DA 1T3NA 1AUDA 2HMIB 4DWIA 2CPEA 2QGFB 2E7WA 1M0SA 4IOBA 2W9CB 3TAMB 2UVWA 1DQ9A 2ASDA 2CXEA 4RUBA 2FJAB 2FJXA 2UXCJ 5E41A 1V5IB 2EFVA 3KLHA 2PDAA 1GQEA 3HT3A 4ZP7A 2LEBA 3T6BA 4P10A 5A8KB 4P75A 3FRZA 3FNNA 3HFZB 1XIQA 1BQMA 3GIRA 3G8QA 4KJIA 2RHSB 3CCWA 1TKZB 1F1BB 3HHNB 3FBCA 2COLA 4NLSA 3LANA 1RACB 1C1CB 3G87A 3R5GA 3RR7A 3ZZYA 3O2IA 1NHVA 4K4ZA 1S97A 1RT7A 2IY5B 2BUNA 4FF1A 1CPZA 1CJKA 3GB0A 3V2UC 1YQHA 2XGQA 1T94A 2BW7A 1SVDA 2UVRA 4M94A 1NJIT 3TZXA 1I1GA 4DV4J 4ZLJA 1S0NA 4I2QA 2CQ4A 4XAKA 2ZC3A 7FD1A 1KSPA 1QAJA 2IJNA 1J5OA 3SV4A 1RAJA 1JJ4A 2C28A 1S1UA 5CYMB 4HI1A 2B8PA 4R25A 3OTOF 1KD1T 3TZWA 1IBMF 3N79A 1BQNA 3UFCX 2PN6A 1RAOA 2W25A 4PUOB 3SEOA 4AXIA 3JSMA 2PSZA 2OPRB 4F4ZA 2FTRA 1RT5A 3KFWX 4K0KF 3QO9B 4ZPAA 2RIJA 2W2NP 4J9NA 4IQXA 4WZQA 1LFPA 1S9EB 2DBBA 3UD5A 4UZBA 1AROP 3SDEB 5C24A 2LXIA 3B78A 4N7TA 1GTEA 1J5EJ 4LF4J 2X3GA 4DI6A 5SZTA 1WC6A 1V6HA 2I1RA 3VF0B 1DRZA 1LOUA 4PXCA 4OJHA 4MFBB 3P4UB 4KSEB 3POTA 3O8WA 3S7RA 3TP2A 4B9NA 3NWGA 4QCLA 2VH7A 4Q44A 4QR1A 5EUHA 4P7TA 1NRKA 3MOZA 1H72C 4J9QA 2RRBA 1VIXA 1UJ6A 3DGPA 1HNXJ 4U67Q 3K5LA 5L8RC 4B3TJ 4U7UK 1FEHA 3K8VA 3RAMA 3H25A 1MMNA 1H2UX 2YNHB 2J6TA 3SQOP 1KLNA 4NXMF 4RU9A 1WJ9A 4OZLA 2AU0A 4ECVA 3CCES 1U48A 4FYDA 2YNIA 4CO5A 1HNWF 1IUJA 1GAOA 3AHPA 4MIAA 5K8OA 5EN1A 4O4GB 4DR3J 3RBZA 2VF3A 3TW0A 1U1QA 3U27A 4ED3A 2JC1A 2JWNA 2VDHA 4NA3A 2NUUG 5LSOA 1SH2A 2CPYA 2QA4G 1YJRA 4KV8B 1OS5A 3HF5A 1KQSR 3MCOA 2XCPA 3OFFA 3DRSB 4YY3J 3BQ2A 1VLYA 1Q5VA 3ILJA 1FF2A 3UR3C 2G1DA 2GMJA 2MKIA 4KT0C 4OYZA 1DJ0A 2MSSA 2GJFA 4Y34A 4WTOB 5D3GA 5ETMA 3KNAA 1HWJA 4ZVEA 4LF8F 1RA6A 1S6PA 3VZIA 3VQTA 3GJQB 5T14A 2HK2A 4J37A 3R6LB 2FVQA 1WD6A 3MWBA 1HKAA 3L95X 1TVRA 4CNZA 1EIYB 4OI0A 1OPIA 3DLBA 3UDVA 2J6SA 2DH8A 5D4OA 3NS7B 3IP0A 4DL0C 3PV8A 1CJVA 1XBWA 2FC9A 4C11B 2UXBJ 5D4LA 1JLQB 3G82B 4DUYJ 1MWYA 1SL2A 1FX4A 2IFXA 3VAFA 2BQ3A 4V1Ak 1U1RA 2J6UA 4KQZA 2OSQA 5A0YB 2B9YA 3MMBB 1LW0B 3PDNA 4MYUA 1NJZA 2ZH5A 3MEGB 3WHIA 2FIUA 1HHQA 2AQ4A 4OHZA 3MXHP 1SJRA 4J9RA 2IBKA 3VALA 1VYAA 3QZ7A 4F50A 1FJGJ 2WW8A 2B0GA 4J9PA 4NLTA 3OQ2A 2EVZA 3O5TB 1DFDA 2CIMA 4B9LA 1Y5LB 4RW8A 3ZZUA 2WW4A 2MY8A 4DJBA 3NBPA 3V4IB 1UZDA 4RW7B 1FJ7A 1RTZA 1VIOA 3ELHA 2HFOA 1IR0A 3MUMP 3C6TA 1N48A 5M2PA 2ZOMA 2XLIA 1RBOB 5DO2A 2MZ1A 4LFCJ 1K44A 3DLKB 2JC0A 3IC1A 3D6TB 2ROPA 3CJ0A 1FRHA 2O3DA 3UCZP 1SQFA 4JI1F 3V6KA 2MZRA 4TLQA 2WSFC 1NHKL 1VFJA 4NYPA 2HHVA 1SB6A 1WKLA 2R8IA 2MQ8A 4XTTA 2R2TA 4DQQA 1X4BA 4ZP9A 2PMHA 4I4BA 3BB5A 3PYFA 1T9UA 2MKSA 3DOKA 5LMUJ 3BEGB 2OIHA 1FTRA 4C8OA 1TTHB 3JSBA 1R89A 4KHPJ 2FUG9 5D77A 3W5XA 3KJVB 1L3VA 1NO8A 4KH1B 4LRFA 2NREA 4DUZF 5LSLA 5A76A 3WIUA 1X9WA 5JXSA 1HNVA 2DR5A 3ENQA 3BGFA 4DR6F 2NPFA 1DLOB 1NB7A 1RT4A 1NK9A 3E01B 3MR5A 2V68A 2WAQD 4DS4A 4OYBA 1SI9A 2VQEF 2QLBB 2AJ1A 1FDBA 3HDSA 4M5DB 2DNHA 3IWXA 4C7QA 2N4CA 3DOLA 5HANA 2FY1A 4N8OA 2ZH1A 4K4UA 2GO9A 4IG3B 1EQ0A 2BQRA 2CZ9A 1BC6A 3OVAA 4L76A 4DPYA 3SV3A 4TYBA 1XTZA 1YI2S 2JH3A 2QIFA 3PIPQ 2FGOA 3QSYB 1GXUA 1HIYA 1H2TZ 3D1OA 3OTDA 2RS8A 1XMQF 3NWRA 4USVA 4DPXA 2DGVA 1X9MA 3QGPA 4OLOA 2PFDA 2FVPA 2BJ8A 3MPYA 7AT1B 5LSRA 3QT5A 5DGAA 2DGOA 4PXEA 2IAJA 3LOUA 5KT2A 3PXGa 4KGKA 4Y0FA 2MQMA 4RNFA 4X65J 4WU3A 3KLFA 2JOQA 3UDLA 1KLMA 3JYTA 4BBYA 2DGSA 3I9ZA 1UEKA 2D3O1 1RUSA 4B3SJ 2EI5A 5KFFA 4UF4A 4ED5A 4YB6A 4H4OA 1GFWB 7FDRA 4GKKJ 2D74B 1JQGA 1IKXB 1WF0A 4ATNA 5E5NA 1NKBA 4B3MF 5IXUA 1OJ4A 4JUZA 1M1GA 3D66A 2JFDA 4NMXA 2F8HA 1F9FA 3UI3A 2EFNA 5ETTA 1VRUB 4PYDA 4HT5A 2LXUA 3MM7A 4MJKA 3ISZA 2LQ9A 5H9EK 1NEEA 2MYFA 5KFLA 4F04B 2E1CA 3DMJB 1FKPA 2VC0A 4DN9A 1SKWA 1WOOA 3G86A 2V8HA 4CI0B 5KFHA 4HKQA 1FRLA 1U1NA 3FCWA 1YGYA 1SQEA 4OHVA 4IRCA 3B6BA 4ECTA 1TV6A 3AB4B 3GE9A 2ATLA 4LMZA 3OFGA 2OPPA 3BYPA 3W66A 2ZH4A 1QAXA 3C15A 1YG0A 5CHCB 3BO3A 5J1EA 4LF9F 2XBPA 2N4DA 3M8PB 3MECA 2EKNA 1ZPVA 5EDWA 1N0UA 3M32A 2XNRA 2OKQA 5KG3A 3KK3A 4ED7A 4WE1A 4QIWD 4P9SA 4DFKA 5A2QY 4RO0A 2ASJA 3NXZA 3MPDA 1ZOTA 2QTWA 3W2WB 3HM9A 1T03A 4JI3J 2MDAA 4CIOA 2AGOA 4A8YA 4IFVA 4DR4J 1UEVA 5C25B 3M30A 1FT8A 1OY8A 1VI7A 3M2UB 4KGZB 3I4HX 4K4VA 2W7OA 2ZNZA 3QYYA 5DRKA 1SJFA 5HQLA 3DI6B 4L3NA 3CTRA 3V6DB 3RGIA 4EZ9A 4HDGA 5F0WA 2WONA 1F3FA 4Y2KA 4FS1A 2H1YA 2QLJB 3FSXA 4FPIA 5D0GA 2HURA 1UVLA 1F6TA 3R6GB 3DRRB 2VQFF 3SFUA 2M88A 1D1UA 2DB1A 1U24A 2XS5A 3BH6B 2BM1A 2DHAA 3LAKA 1TK0A 1VR6A 2FVRA 1Y3JA 2ZH7A 3LAMA 4KH0B 3ULHA 3LTOA 3CJKA 5DDOC 2QMUB 2VU5A 3CCVS 5FLXU 2RDJA 4RNNA 1EJ7L 3GYGA 1RSCA 4N47A 4ES3A 1RWPB 2ZBQA 1SL0A 1F3VA 3WC0A 5IT9Y 4JI6F 5HBMB 2B5JA 4U6PA 4P2MA 3EXCX 2NZCA 4QOTA 3PYEA 2BE7D 4RBVA 4KPYA 3RB3A 2V8VA 4F25A 3UVJB 1EKRA 1KHVA 1NLKL 2CPDA 2R2UA 4AL6A 4DZ6A 4NASA 2D69A 1D0EA 3FFIA 1T8EA 2PGCA 2BJ7A 3H4BA 2WSEC 3DRPA 1YRUA 3KWMA 4ZCKA 5KFQA 1ZM3A 4ANCA 1UFKA 1UJ4A 2Y1RI 3GCWP 5ETNA 3EPGA 2OO4A 4Y2AA 1Y3KA 3MAHA 5AJ3F 2YNGA 4URQU 2HMIA 3M8WA 2N7CA 3C46A 1ZETA 4OJ1A 3TR5A 2W9CA 3TAMA 2C2EA 3KG1A 1S6UA 4K7QA 4RNMA 3EDQB 2CPFA 5CD4A 3LPYA 2ZBPA 1QUPA 4UT4A 2A18A 3DHWC 4H4KA 2D3UA 2CZVC 2QFJA 2KJWA 2V34A 3QAEA 1KP6A 1PGZA 2IC3B 3N5BA 3T41A 2DD8S 1EETB 1C1CA 5ETKA 4LFBJ 3DLGA 4LIWA 2KB2A 5IV4A 5KOXA 3CMAS 3QRPA 4JYAJ 1OWXA 3OR1B 1VHFA 1RTIB 4H4MB 5A8RB 1NPPA 2IRUA 4DV0F 4WJBA 3UD3P 2ZKTA 1SL1A 5CA5A 2AMCB 2OFHX 2M7SA 4LF7F 2QRRA 8ATCB 5LXRA 1VOMA 3ZNUA 2BANB 5JJBA 1C0TB 1U09A 4ILRA 5AT1B 4LF1A 2GVDB 3R5CA 4YHHJ 1APSA 1VQPS 2HGNA 5C2CA 1RWXB 4I68A 3AAWB 2GQ2A 1CS4A 4OL8A 5DQGA 1YWXA 1X4DA 3HZGA 4LQ9A 2C22A 4XDDA 4LFAJ 3U02A 1NMEB 5CYMA 3A12A 4O23A 2FHJA 1SH3A 2J9DA 1Y5NB 3MTKA 1UA0A 4I1TA 4DR5F 3I0RA 3R8YA 2OPRA 3W9IA 3JB9k 2C2MB 1S4FA 4W98A 4B9TA 3QO9A 1KC8T 1U45A 2ALYB 4NLRA 4GC6A 2A0FB 1SC4B 2OPSB 1NJXA 2AW0A 4LF5F 2AP6A 3MM6B 1S9EA 5G4DA 3HSZA 3SDEA 2V63A 4RNHA 3VVTA 4DFPA 4EZ6A 2VBYA 2HFVA 1UVNA 4LSLB 2LQ5A 2XYGB 4TVAB 2V2VA 4DU8A 3G6VA 1L5UA 5IZHA 1S9FA 4MFBA 2EBGA 2OD4A 1JKHB 4ZPBA 2MB0B 1REGX 5B08A 1D9AA 2WB1D 5LMNJ 3MAAB 4E2FB 3M9OB 2FHMA 5DZ6A 3FCHA 2F5GA 2BVZA 2DR9A 1PC5A 2GW8A 2RVJA 4J9UE 1WHWA 2NPIA 3DCAA 2LU1A 5E3QA 3J81Y 4UUXA 2DVIA 4ES2A 1K47A 2F8MA 1HL6A 1CC8A 3IBCB 5HSPA 4G6VB 4WYWA 5DM6Q 2ZM6J 2DY1A 3DU5A 1R6VA 4LR8A 3MR2A 4DV3J 2VONA 3U1MA 2XO6A 3C8YA 4FYWB 5LJ5Y 1MWZA 1KWMA 4O4GA 3BO4A 2RRNA 1VQKS 3I5AA 2HNZA 1DHMA 2J5AA 2HHWA 1HI1A 1TL4A 2FJDB 3SQGA 4ZCLA 4FYXB 3QWPA 1ZAWA 3T1YJ 2VD3A 1NZAA 4OJ3A 3DRSA 1ZAXA 2H65B 3AA9A 1DTTB 4YMEA 4IR1A 3RB4A 3TA1A 4MK9A 3L4BC 3A1YG 4NYOA 2HQFA 3M4XA 1KONA 3F73A 2RILA 5ETPA 2MQPA 4ZMMA 3LQVA 2XLKA 2LMIA 3HT0A 4ZOSA 4IH7A 3A8JA 2I0XA 1PJ6A 3GJRB 1TUWA 2QE5A 2IBOA 4LRCA 4JI0F 2B8QA 3J7A1 2CQBA 4DV1J 3S6EA 2VFUA 3TWZA 3KTQA 4DSFA 3K57A 4MK7A 1TFWA 3SSSA 3T9NA 3D0HE 3H40A 1S9GB 1QAIA 4ANDA 4CLFA 1Y4ZB 4TU9A 2R7XA 2V2KA 1JLQA 3G82A 1AYEA 4Q5VA 2YVSA 1OO0B 1KBRA 3Q8RB 3PW4A 1N36J 5A0YA 1G2EA 4Y65A 4JV1A 1GXLA 1LW0A 3VGUA 2P9CA 2RAQA 3MEGA 3TJ8A 3HI9A 1UVJA 4I6YA 3EE3A 1XEZA 4KE5A 3SXLA 3Q8YA 2CFXA 3OXGA 3MTJA 3RBDA 1NDPA 2EBEA 4ID5A 4F3MA 1Y7PA 2K7KA 3DOMA 2HHPA 4WIQA 3MM9B 2B6AB 5I3PA 1FK9A 3KLEB 1Y5IB 2HHXA 3JQJA 2HW3A 4PG5A 2YWHA 2NQPA 3V4IA 2J8SA 4EFAC 4RW7A 1YJUA 1B0PA 4NLWA 1FKAF 2R7SA 4J5OA 1R8CA 2KG1A 4JI7J 4UOCA 4P52A 2K3KA 5B0DA 5IC6B 2V2QA 1IKYB 3RZAA 1I51B 1TK5A 2KKHA 1G3OA 1FERA 2OLWA 1B7YB 2FVSA 3UPFA 3TI0A 2R8HA 2C42A 1VQ5S 2XMUA 1S1TA 2G13A 3OD2A 3M6XA 3PY8A 1E6VB 4TY9A 3CJRA 5U47A 2UXDJ 2VA3A 4PPZA 2BE2A 4JV0A 1B64A 3G4SS 3TQ1A 4O3QA 3JSYA 1RT6A 1R43A 4F0HA 3OLAA 3KJVA 2E5GA 1T0TV 4LF4F 4XO0A 5KT7A 2ZE2B 1Q0NA 2JRSA 5EX0A 1LWCB 1VC6A 2HNDA 4EWTA 3G6ES 1DLOA 4KPCA 3E01A 2D3OR 1Q1KA 1N52B 3CULA 3RRHA 3EJMA 4M5DA 1XJWB 1C0UB 2EFOA 3TJ9A 5L9NA 1O6XA 4X66J 4QPXA 4ZPTR 4QR0A 2AF6A 1YJ7A 1XK8A 2BBEA 4WK3A 2B4UA 2EFGA 4QJVA 2HVHA 1YX2A 2R4FA 4NRUA 1JXLA 2GMLA 4DSJA 2PE8A 3FSIA 3M7VA 1N6QB 1PG5B 2GAGC 4NLUA 3QGHA 1VDHA 4KFBA 3BS9A 3OV7A 1DBDA 2YX7A 2ZHAA 3R27A 4Y6IA 2LVWA 4ED4A 1SJQA 3OTOJ 2HQDA 1IBMJ 1HWUA 2RQ4A 3ZZPA 2YWEA 1WNEA 5K5MA 5F9LA 2FZCB 1NDCA 1YJTA 1SXLA 1BWVA 3T9ZA 3ADAC 4DR3F 4CLTA 3OL9A 3A3OB 3RTVA 5KG4A 2EKYA 1UCNA 3U1NA 5KFKA 2E9ZA 5KFEA 1RCOB 4CZCA 1PYTA 3PYGA 2M70A 5HK4A 1TU0B 2JEGA 5KFXA 1AXQA 2W24A 4R0JA 2WK4A 4ER8A 4Q2MA 3OLBA 1VBKA 4RWXA 3PX6A 3DM2B 2E44A 3R3TA 1CLFA 1IKXA 3CJQA 1W7WA 3NEKA 5K20B 4AQYJ 3VTIA 2W2QP 5F8NA 1CJTB 4KKOB 3KDNA 2Z4PA 3CD6S 4DUTA 3BREA 1KVJA 2FJVA 4LUBA 2NCKL 2XMAA 4NLYA 1W26A 1VRUA 2OEKA 4N56A 3TOQA 1VISA 4HACB 4NYZA 3AQOA 3HHEA 1VQ8S 4USMA 3UDEA 1FWKA 4OX8A 4ZJLA 5C42B 3O44A 4NXMJ 1GMWD 3DMJA 1KRPA 4NEZA 1VQOS 4I6WA 6FDRA 4Q0BB 4JI5F 2UXBF 4MK8A 1HYSB 4YB1P 3KJNB 4NCGA 1WC1A 2D7SA 4IOAQ 1S12A 4ZDNA 3C3LA 3H2VE 1HBUB 4DFJA 2M5YA 3MR6A 2DTJA 4O3NA 1G4CA 5EWGA 1M1KT 5HP1B 5J1NA 5F0UA 4RW4B 4PQUB 1RKJA 1FJGF 5DM7Q 2HZCA 5CYJA 2BJ1A 3DYAA 1NJWA 3CPWR 3NKYA 4MKVA 1UMJA 2VPWB 4QPTA 2JVRA 4IRKA 3W2WA 3IXQA 2C2DA 4LF8J 1NZ8A 4ELUA 4M8LA 4ECUA 3RW7A 4NEYA 5C25A 1BXNA 5KG7A 2X1BA 3M2UA 2DGUA 2ZOGA 4CLKA 1X60A 4IH5A 3BBBA 4K4SA 4LFCF 4FF2A 3M8RA 2J0QD 1W2IA 3DI6A 3LF0A 3QLHB 4A8KA 3V6DA 4FKYA 2HQ3A 2KT2A 1PYOB 2BKPA 4ID8A 2W7PA 3V6JA 1E6YB 4ELVA 4NE9C 2LQ8A 3DRRA 4G1QA 3ZZZA 3KYLA 4ZVQB 5ITHA 4KRWA 3W1YC 1T05B 2YH0A 3H5XA 2R42A 2DRDA 2YKPA 2RDDA 4KHPF 3Q23A 4ICLA 1R8PA 1FWPA 3FC9A 2K8GA 1LEOA 4X4TA 3G8TA 1R0BG 5M2RA 2XSJB 1YTYA 4ZPDA 4CTAA 4D3GA 1RQ0A 4HHUA 5HMWA 4DV7F 3OL8A 3W61A 5ETOA 3UVJA 4ECRA 4FVCA 4CLZA 4ZJQA 1HI8A 2CVIA 4DF8A 2RMLA 5J2QB 1R3NA 4X62F 3UR0A 2IRXA 4KR0B 1U0HB 1VRTB 3D3BJ 3OPKA 1D8ZA 3TVKA 3CDWA 2L3MA 2VFTA 3CCJS 3BKTA 2J0WA 4TY8B 2PD1A 5J2PB 2D3ZA 1U1KA 4QU6A 2EG2A 5AXLA 3KG0A 4UOHA 3IR5B 5IT9U 4R5PB 4JI1J 3HHDA 4QYZJ 2ATCB 3QFHA 2P2CB 2AEFA 3NGTA 3TUJC 1ZPWX 1X0FA 1X4HA 3I0SB 5IT0A 3KK1B 3KLGB 4C3KA 2XC9A 3M8QB 2F1FA 4TQRA 2FLLA 1VLOA 2CQ0A 3RYLA 4BWMA 3CDUA 3PW5A 4X65F 1HNZF 1YKWA 1EETA 5D8HB 4DUZJ 5T41A 1UTAA 4LF2A 2U1AA 1JLFB 1BHNA 4FVMA 1R8HA 2ROGA 3CXCR 4GKKF 1NK7A 3AFGA 2DK2A 3OR1A 4OI1A 1S1VB 1RTIA 4DV2J 1X4CA 1QSSA 3LO3A 1WOSA 1U1LA 5D4PA 5KOWA 2BANA 5F8HA 6AT1B 3MPWA 4DPUA 2GVDA 4AL7A 5ETVA 3UQSA 3CJ8A 1XMOF 1ZZNA 3BM7A 3D1QA 4QZVB 5L9XA 4U7CA 4RLEA 5F3TA 2FYXA 1RHMB 4JV5J 4O3SA 2YKMA 3PYDA 3V4MA 3CDEA 4GMKA 4HYKA 4F02A 2JSXA 3R5DA 2AKWB 5J1PA 2ACYA 4OMFG 3LWLA 4OFZA 4J91A 2E66A 1Q5YA 1FFWB 4O44A 3QT8A 1WHVA 1RLDA 4DLEA 1SH0A 1K0VA 5KFOA 2Z58B 1TELA 2FQQB 2OPSA 2MLYA 3BH7B 5CCMA 3GIIA 1N33F 2Z2LA 2V5HG 1YSJA 1JIHA 2CQDA 3NY0A 1H2VZ 3NNAA 1OYDA 2VOPA 4LSLA 3ZZOA 1RISA 5GAGU 5F8JA 3Q8UA 1M1HA 3PCOB 1ITPA 4ZLLA 1M5PC 5H9FK 2AHOB 4JI3F 3FRYA 4URSA 4B3MJ 2HS0A 5C7PA 1Y9OA 4Y2CA 4DEZA 2H3EB 1DY3A 3MAAA 2XYPB 4OYIA 4PCQA 1X5PA 4KGXB 3X1LB 1VS3A 1IWGA 4FP9A 1U8WA 1KQKA 1GMUA 3EWGA 1JLAB 2GNKA 3VQSA 3VVUA 4X4SA 2EFPA 3P8BB 1RTDA 1N5VA 3VR1A 2M4MA 3Q2TC 3CF5Q 1WEXA 4HHJA 3UNGC 4C4WA 3QFWA 2CJYB 1RAFB 2VKZG 4KO0B 3CDAA 1OMSA 3D6HB 3DLJA 4M63A 2MTLA 4A8SA 2CWXA 1N5SA 4RUCA 2PFFB 4X64J 4PG6A 2MGZB 2W1BA 3GIMA 4NLGA 3NAHA 4OZ2A 1T9VA 3HHLD 2O67A 2CDRB 1SV5B 2C2NA 2AGPA 1EP4A 4DDFA 2L48A 4DL6A 3OW2R 3I6PA 3EGWB 2GC8A 5L1IA 4A48A 1G7CB 2KYZA 3R7NB 2PO4A 1LQ9A 3ISND 4F4YA 2Q1LA 3J81U 4CH7A 3TA2A 3OJUA 4PR6A 3NGKA 4O3RA 1D3WA 1HPZA 4ZVUB 2QMWA 3H0PA 2E5JA 2LCWA 5FDLB 4C8ZA 4CLYA 3RRGA 2Z0GA 3CMQA 3IG1B 3N5FA 3C6UB 1RLCL 3PFOA 4HLBA 3G8SA 3FEYB 4RUHA 3CJ5A 3GFXA 2E5LF 1FXLA 4WWSA 1VK8A 2IM2A 3CCQS 2MKHA 2YQ0A 4OYWA 4ALZA 2VQFJ 2ZH6A 3LW5C 3W3SA 2UVVA 1K0TA 2EC0A 3UDCA 3SIPB 3M1VB 1S9GA 2RRAA 2NXJA 5JVHQ 3EX7B 2DO0A 3EZUA 4NCBA 1JLEB 2MQQA 2ILYA 3TNVA 4IR9A 4DOZA 3BV8A 3QRRA 2HRTA 1X7VA 1O51A 1YRXA 1S99A 3TA0A 3GYNA 3L9ZA 4LFBF 3ZC4A 2HG4A 2UV8G 3AOBA 2EK1A 2GJIA 1UJ5A 1MNEA 4EGLA 5KAKA 4JYAF 2C3MA 3ILOA 4B3RF 3N0VA 1U6BA 9RUBA 1X4AA 4DV5F 4DL4A 3WQPA 3ET6B 5B09A 1YBTA 2E9RX 5DQHA 3MF5A 2JEJA 3FZ2A 2UZAA 3Q24A 2RNEA 4FXVA 3M6UA 2KZZA 2ZUAA 4WFAQ 3KLEA 4MH8A 2E1PA 3DDKA 1CJUB 2M9KA 4YHHF 3RRKA 1Z2ZA 4HL9A 4NZ6A 3H5SA 1VQNS 1FRIA 2V8DA 1LXNA 4XK8C 1NH8A 1RHUB 4F8RA 4A8OA 5E3PA 1FFSB 3N6NA 1U2CA 3HX9A 2MHNA 2Z30B 2E7VA 1IKYA 1TKTB 3VCDA 4NLDA 1ZZFA 3A8IA 3IR7B 4HT7A 2MKKA 1RWNB 5J2MB 2X3DA 2BDPA 2HQCA 1RT2B 2CNNB 1E6VA 3BN4A 3IM9A 4EBDA 2V4QA 3OTBA 2KG0A 2CDQA 1YJ9S 1M5OC 3C19A 3MR7A 1XC9A 2CVEA 4DQIA 2C2RA 4QBUA 1RBAA 3M8YA 4RR5A 3R2CJ 4FXWA 4CYUA 1Q7YT 2DGXA 2ZE2A 1GX5A 4C98A 1S1WA 4AT1B 1J27A 3IBFB 1LWCA 4A8WA 1RWKB 2CQPA 1YZ6A 2H4WB 1WKJA 1IKVB 4DV0J 4ENOA 2DNYA 1MROB 2DKOB 1RU1A 4LF7J 3QJLA 3L7UA 2W4PA 2JVOA 1M5VC 3DDNA 1C0UA 3LP0A 2DGQA 5IM0B 5GMDA 2UUAJ 3QIPB 1V3SA 1N4LA 4GO7X 1NSKL 5AXNA 2VJUA 4E98A 3W5YA 5ETQA 4CO0A 3CCLS 1ZA2B 2BKNA 2WZ1A 1YK9A 4TQSA 2VG7B 1RAEB 4LR9A 4DPOA 2OH2A 2V69A 2HLTA 3QGGA 1FXDA 2C1EB 2V4RA 1S77D 4USTA 1OSCA 4B3OB 3MMAA 3R9LA 1FKOA 2IVMA 5J2NA 2LLZA 3JTOA 4DV3F 4DR5J 4CNYA 4K4YA 3EZ5A 4CLLA 4HI2A 2JJ4D 4F3QA 1REVB 4USWA 4ZHRA 3Q0AA 4WPAA 5KFMA 4F2SA 1Q16B 3HHLB 1S57A 1NB2A 4UY8T 4DV6J 1S0VA 3DM2A 1U49A 2UVUA 2ZBCA 3M05A 2MHEA 2N3OA 4YUDA 1I5OB 2DNQA 1F5BA 4I56A 1CULB 2QLFB 4OJGA 1MW7A 4F4KA 4HACA 2LYVA 4EYHB 1MWQA 2NXNA 1HHTP 3LGHA 1F2GA 3UW1A 1RT1A 5C42A 4RU2A 1WEYA 4BC9A 2YXLA 3P5BP 5KFRA 2ASLA 4YP3A 1N54B 5CZXA 2GFFA 2DNKA 3HLUA 5LXYA 2OELA 4U8YA 4Q8FA 5A8WA 1HR0F 4MKAA 4ZP8A 4FNIA 1XMBA 3GV8B 3JQMA 2A6OA 1HBUA 1EHWA 1RP5A 1QUVA 5D15A 4C8KA 4C8LA 3H98A 3F0NA 2IM0A 5GADU 3NAIA 1RHQB 3ZZTA 2RS2A 1FE4A 4RW4A 5KFNA 4PQUA 2MQNA 3PM9A 4J9SA 3FGVA 1HQEB 3GG0A 2WTFA 4UTGA 4F4XA 2AYGA 4E0DA 3KDOA 1L3KA 3KUEA 4F3OA 3N01A 4OYAA 3OBIA 4RUAA 4Q8EA 1UP1A 5KFAA 1SJ1A 2HGMA 4N76A 1RKIA 4JI7F 4FYYB 2OEJA 1AZSB 2Y8WA 2F63A 5BR8J 4JI0J 2ZH3A 4F4AA 2KFZA 4IFYB 2HHUA 1RTJB 1U6FA 1WSRA 4LR7A 2OPQB 2KFYA 3VAJA 2OEMA 2A3JA 4RW6B 5M2UA 1VCTA 2NXEA 4WP8A 4ZVFA 4CO4A 2UXDF 4TKTA 1T05A 2XMMA 4DFMA 2DHGA 2LQJA 1TAQA 4B9VA 1WACA 3AOAA 3JAMY 2AJ0A 1Q53A 2Q43A 5B0FA 3W8GA 2VFSA 1ZH5A 4LSNA 2M8HA 3CIZA 1WI8A 2ABYA 2Z2MA 3BO2A 4DG1B 3UCUP 3EGNA 1S79A 2LECA 3D54A 3K59A 4X66F 2BJDA 5J2QA 2F7VA 3G2XA 1CSJA 1XNRF 1YBUA 2KXNB 3JTPA 1VBYA 1BUXA 1HFEL 1ZM2A 3C16B 1U0HA 1UFWA 2OGUA 4Y2MA 3PNIA 4EBCA 3P49B 3TVZA 2XHCA 4U95A 2HEKA 3GLJA 1U7LA 2VBZA 3IGVA 2BJ9A 4TY8A 1N5YA 5J2PA 1IBLJ 3KLHB 3KLVA 2CG8A 4PXBA 5KFUA 1RYRA 3N6MA 3PHEA 2OAUA 5K8PA 4X4PA 3I0SA 4S0MA 2VG5A 3US5A 3KK1A 4M5JA 2DNLA 1UVIA 3KLGA 1CEZA 1X4FA 1MN9A 3HSJA 4KC5A 3M8QA 4QWEA 1V3RA 1Z2LA 4DQRA 2B4OA 2XMJA 1NK6A 4L3KA 4J9MA 4RW9B 4C6AA 1O5JA 3V6HA 5GADI 4DL2A 4LSZB 3AD8C 3BQ1A 2IYIA 3W9HA 2IMWP 1T9TA 4FBTA 1JLFA 1RT7B 3NCQA 2KH9A 1RT3B 2IPOB 1YITS 1NSQA 1CJKB 2HS3A 1HLWA 4LT6A 4AQYF 3PRDA 1H74A 1Q7LB 2D9OA 3PKYA 3G6YA 4CLPA 4L74A 3GFHA 3HULA 3LP1B 3A3NB 2OP5A 1RJJA 3Q2SC 4I2QB 1RWMB 1J5OB 4OZ1A 3SSRA 5KFWA 1HW8A 4W90B 3T1HF 3B82A 1YLXA 1HBNB 3CJTA 5B7WA 4J9KA 4JV2A 2FLOA 2Y3YA 4FN5A 3MCNA 2VB6A 5HJYA 1VRQC 1SC1B 4DR1F 5KG5A 1HHSA 3NCPA 3OSNA 2AYEA 3G96A 2KRBA 2DIVA 1CBKA 3F41A 3S8SA 2QL5B 4YDXA 3D68A 2RKIB 3N9UC 4ZS6A 2CNOB 3D0GE 3VAGA 1R31A 2E5HA 3CSKA 4CLSA 4ZN3A 2F8EX 4DHVA 5IWAJ 4IDKA 5EWFA 4AD6A 2KVQE 2I38A 3D6FB 2XZDB 2UUWA 1V9OA 3R2DJ 1KS2A 1ICEB 2E1RA 3MCSA 2DR7A 4LQ3A 4BC7A 3DNCA 4QIEA 4LBIA 2XNQA 4DBQA 1KOHA 1IJEB 2QG9B 1EX8A 3IGNA 5KFZA 2UU9F 4WK1A 5AE1A 2R7RA 3OR2B 2MZSA 4JI5J 1AFIA 4KO0A 3P6YC 2YNIB 2KXHA 2J76E 5KG2A 4ZVRB 1WUUA 1B0TA 1OY9A 3DC2A 5K14B 4CH0S 2DRAA 2H5IB 2RU3A 3I4PA 5I3UB 2YX4A 1M5SA 2XMWA 1Z4UA 4NXNJ 3TAQA 3ZTQA 4M95A 3NOCA 2BACA 1RAHB 4FYVB 2OUGA 5HLFB 5L1JA 1XN9A 2WCXA 1C1BB 1HI0P 5DLFA 2HZVA 1R0AA 2EPIA 4I0WA 5D3GB 3IWLA 3KHGA 3K7RA 4NLPA 4TYAA 2POKA 2RB7A 4FF3A 3T19A 1S76D 3IN5A 3HSGA 5KTQA 1JXEA 1P27B 5FDLA 1RE1B 4TLRA 3R5JB 4F0MA 3IG1A 1NDKA 1VC5A 1T9YA 2ZBIA 3KUHA 2XZWA 3C6UA 1SQGA 5AE2A 1LWXA 1QE1A 1RAIB 3K5OA 2O66A 2LDIA 4WYLA 1TL1A 2DCLA 1UAWA 4IH6A 1NM2A 2J9EA 1F5CA 2Y8YA 4CO1A 3NCRA 3HVTA 5EHHA 1CJVB 3PJXA 3SMZA 1X5SA 2MKYA 2PEHA 2PMZD 1IBKF 1UEUA 3M1VA 1U2RA 1HBMB 1KOOA 4JI2F 1JLEA 2DH7A 5D78A 3O6QA 3S01A 5MLCV 4ILMA 4M5MA 1RAGB 4DQSA 4DV7J 1PO6A 1T9WA 2V4JB 3EGVA 3ET6A 2KU7A 4DV2F 4WFXA 3BZQA 4FF4A 3PW7A 3HP6A 4X62J 3GR1A 1NU4A 4USUA 4CM2A 1ZAVA 4WFYA 3ZTRA 4B02A 3QPIA 3C6TB 3P45B 3FJ2A 1LV5A 3ILLA 2EEYA 3FBEA 4XPEA 2H4YB 2IMOA 4HVZA 1YVFA 5HVGA 3ZO7A 3MPUB 1R8BA 2ZWOA 4JV5F 2O5DA 4DU7A 3IRWP 4WKRA 3MEDB 1X4GA 2L9WA 4B17A 5B0GA 1CVJA 2QSFA 5HMXA 2LEAA 4X84A 1TKTA 3QQCD 3ZZRA 1N34J 3CCMS 4USHA 3R5AA 4IYQA 2BOAA 3ZTPA 2VOOA 2DISA 3NOGA 4GKJF 1WTFA 3SCKE 2F3JA 2DXFA 2DO4A 4URGA 2KHCA 5J2MA 3QIDA 1RT2A 1LWFB 5L1LA 2HBYB 1O0PA 1HNZJ 1RADB 3WC2A 4ZK7M 5L1KA 1ZTTA 2A2DA 2AYMA 2B9EA 2DEJA 2ZH8A 3U1LA 1RT4B 4DSLA 5GVQA 2C2ZB 4D3HA 4IG0A 2F4VJ 3AXKA 3QGIA 4M1KA 1S59A 4XPCA 1IKWA 2QX0A 2IA6A 4K5RA 1IKVA 2R7QA 1MROA 5CQGA 3DOLB 2ZFHA 3ICLA 1HMVB 4ZPVR 2KTQA 4GVBB 2P6SA 1FCAA 2XS2A 2KT5A 2MY7A 5KT4A 3SI8A 3WIVA 4J9VA 2QO3A 3MM5B 3C66A 3HMJG 4DXLA 4NA2A 3I9V9 3QRQA 1NKEA 1F9HA 4KB7A 3CEDA 4P2SA 1XMOJ 2QYCA 4BCAA 3EM1A 2F9DA 1DAXA 4ED2A 1JNRB 2G0CA 2DYAA 2HKEA 5H9EJ 2BW2A 3QJJA 4B3OA 1QTNB 2FY8A 4YOEA 3D3CJ 2E7XA 1SKSA 3NG8A 3BYRA 1H38A 3GQCA 2AX1A 5E3RA 3MAQA 4X64F 1B99A 5KFYA 3HSDA 2RUGA 4PG4A 4DLGA 2CQ3A 3ZXWA 5JMNA 2X1GA 2AT1B 1PILA 3A13A 3D0IE 2V2ZA 2Q79A 1RTHA 4WP3A 3JYTB 5IOLA 2HPUA 2XI2A 3SCIE 1N33J 4N8NA 2QA2A 1TKXB 3J80U 4KGMA 1VGYA 2C3OA 4DSIA 4H4OB 3PW0A 3H90A 2G2YA 3NGSA 4OX9J 3M2VB 2ZUGA 3IS9B 3BGLA 3PRBA 4EYIB 2VIHA 2QLWA 1P1TA 5DETA 1HBOB 1VJQA 2K1RB 2GO8A 2FHJD 1SKUB 4NLXA 4JI8F 1CULA 4MYTA 3T5KA 3MM7B 5L46A 4LRAA 3EVMA 2XWXA 4O3PA 2MQOA 3N6LA 3KJFB 5K9FA 2ALZA 5HL7Q 2HQIA 4U9RA 5C5JA 3NMRA 2XYHB 1QM9A 2XGPA 3K5MA 5SUHA 4OI3A 3MUVP 2I2YA 1UVKA 3F56A 5A6WA 4UW2A 3NL0A 4ZN1A 2RSQA 4RZRA 5CD4H 2HVIA 1XR7A 1U1PA 1QY7A 4NZ7A 3LALA 3T3FA 4I2PB 4YR2A 1UWBB 1IQZA 1LW2B 3M32B 3RBEA 1GNKA 3KK3B 2BMBA 1JXVA 2VBXA 2QV6A 1HQEA 5LJ3Y 2RQCA 3J7YU 4OHWA 5JUMA 3EZOA 4YQWA 1KHWA 2QJ3A 1HNIB 2QMXA 5G0RB 3CIMA 3M30B 3OTEA 3NNHA 1FJEB 2WVEA 2I5JB 3BSCA 4AYBD 2NLWA 4XIUA 1AZSA 5F3ZA 2KJVA 2DY9A 1BD6A 2WONB 3CT9A 4F2RA 2YPZA 2P9EA 3CD7A 2E5LJ 2XMTA 4AFFA 4ZP6A 1XWLA 1S72S 1RTJA 2R2RA 3BKFA 4Y2IA 3CE8A 4X4RA 2OPQA 4ITSA 3PFEA 4ANEA 2CJXB 2G1HA 1X0PA 1VK3A 1IBCB 3CMES 5A8KA 1QVFR 2M2BA 3Q8PB 2YKNB 3CJKB 1A7GE 2NSCA 5KG6A 4X2BA 1TKZA 3H59A 4DX5A 3DLHA 4K50A 1TUVA 2HIQA 3ITHB 5KT5A 5DG8A 3CCTA 3GFYA 2HZAA 3H42A 4O0IA 3FBFA 1NBEB 5HROB 3IBWA 4AUKA 1SKRA 1XNQF 2VL1A 4B3RJ 2ZEJA 3RUBL 1QAYA 4JI4J 3A8EA 4DV5J 1MU2B 2KVIA 3FFIB 4DG1A 2ERRA 3MPVA 5CAAA 4M5HA 3NLCA 4USKA 5DG7A 2DNNA 2UUAF 2H5JB 3KMQA 1WF1A 2ZWPA 5ETLA 3MFHA 1ZM4A 1AW0A 2HAIA 4NMLA 2HBQB 4DR2F 2XCAA 3QSIA 1M5HA 4YR3A 2YNGB 3C2PA 2ZJQQ 2UUTA 3G6XA 4QWBA 2YNFB 3TEHB 2ZVSA 2O01C 2YQ3A 3SCJE 2MEWA 1C4AA 2PC6A 3IAS9 4RNOA 2K7JA 2J7KA 1OQ3A 3JAMU 2ZD1B 4PUOA 1C4CA 4ED6A 4ZIVA 3EGZA 3EDRB 4LREA 1HQUB 4Y3CA 3FMBA 2CPHA 1UWAA 2N3LA 2QA1A 2NR0A 2JNJA 4BDPA 3TUPA 1SJ3P 4RBTA 1N56A 2EW9A 3BPSP 2MZJA 5CYQB 2QYGA 5A6PA 3DLGB 4RW9A 3VGTA 5IV3A 2DNRA 2KYXA 4YEAA 3I87A 4OQJA 4K4WA 3PW2A 3QJPA 4R8UB 2KM8C 3J7YI 4DV6F 1IR1A 1RT3A 4I69A 3R97A 1VHIA 5GAHU 1FDNA 3KNGA 3OSPA 3X3UA 5HJXA 1J2VA 2RQKA 2V50A 3LP1A 2WSCC 4Q2LA 2IJRA 3R1LA 2ZOFA 1CS4B 3OT9A 4EMDA 3SZ2A 3QATA 4OI6A 2NUHA 3HZEA 2PEBA 2RQMA 2YNHA 3O3LA 5F9NA 3NGUA 1HBNA 4PG8A 1ZBTA 1YHQS 4IO9Q 3K5NA 2YKQA 1LWEB 2GHWA 4A47A 2DNZA 1ROFA 2NS1B 2PIIA 3I0RB 2CKWA 1TQLA 2Y1IA 3MR3A 2GHVC 4TNOA 2BABA 4QWAA 4M5KA 2R7TA 3A3PB 2GIQA 2Q66A 3D67A 3RBXA 3KKFA 4ECQA 1JNZB 2CQHA 2RKIA 3I56S 3NMAA 4KV8A 1SUQB 3C14B 3T1AA 2QT7A 1RWVB 1Q82T 1DQAA 4DCPB 5GMKa 2GIRA 1S48A 2FZGB 2CADA 3QZ8A 2CPXA 5B0AA 4C3MA 4PXDA 2IHR1 4K4XA 2B56A 2HBZB 3JTNA 3MMCB 1MN7A 3Q22A 2CJKA 3OL6A 5I3QA 4YFUA 4R0EA 1S6OA 1FRJA 2V9KA 3NNCA 5BR8F 4M5NA 4ZVTB 4ED8A 4J7CA 1RU2A 4AXJA 4HEA9 3QT6A 4LJMA 5FJ4A 1Y0HA 3T6JA 3OR2A 5F8GA 4P73A 1TR0A 4C11A 3ENWA 1Q78A 1WEZA 5DDRC 3TX8A 1BE4A 1C2PA 3UD4P 4NLQA 1HR0J 3TANA 3ZFVA 5K14A 4G1IA 3MMBA 3RJMB 3KHHA 5T7LB 2CYYA 2HNZB 3OXLA 1U2FA 2XSFA 5AXMA 5I3UA 2AGQA 4C8YA 2KXFA 4HR2A 5KFIA 3SQGB 5DDPC 4OZJA 1JMTA 2VZ9A 3DKDA 1TFYA 2V6AA 3PX0A 3LGNA 3HHKA 5HAOA 4ELTA 3LPEA 1IJFB 1IQTA 3UN5A 3AD9C 5HLFA 5BYRA 4PABA 5IQ6A 1C1BA 1AB8A 5K8NA 1IM6A 5GAHI 3TEGA 1JWWA 3T5HA 4C8NA 3IRXB 2FC8A 2WVBA 2NSBA 3GJSB 3BSOA 2DNMA 4G65A 1T95A 1H6KX 2J7UA 3QMQA 3S1TA 3TJAA 4B9UA 2JLGA 3TVYA 3PJWA 2XI3A 2ZH9A 4FDFA 3DLKA 3D1HA 1ZA1B 2RT3A 2WVDA 4FBUA 3GP9A 1IBLF 4DX7A 2ZVIA 2AEMA 1WHXA 2WB4A 1FRMA 1H7XA 2MSTA 3P5TL 2XY6A 3D5MA 4OHYA 2J8AA 4LF6J 1WG1A 2DPIA 4V19X 2HGLA 5IC4B 4ETXA 2VKRA 3BBCA 5LL6d 1HBMA 1U1MA 2ZNYA 4DMZA 3GU0A 2GVZB 4A8FA 4AL5A 4QU7A 3ZZ0A 3H5YA 1FHTA 1T02A 4J9OA 4P6QA 4LRBA 1W25A 2BJ3A 1QVGR 4RJVA 3UCGA 2YKAA 3GFZA 3CJ2A 3G9CA 3LUYA 5E33A 3MEEB 2E29A 2GGPB 5LM7E 3Q8QB 3CO9A 2F9JA 4ID5B 2V4JA 1HA1A 2QA4S 1AA1B 3DOMB 5BYQA 2BJEA 4NPOA 4F4WA 2Z2YB 1HD0A 1N88A 1VQYA 1FK9B 2AV5A 5KT3A 1XNRJ 3AQPA 2VG6B 1S7IA 4IG3A 5E3CA 2OMOA 3D28A 4Q45A 3RAXA 3CD0A 3L3CA 1Y11A 4ZPCA 4OZ3A 3CUNA 1EARA 4C48A 2IA0A 1RGVA 2HIYA 4OYPA 3PTWA 3MEDA 4A46A 3MEKA 3EMTA 5IS2A 5KFSA 2CJAA 2V9WA 1R6YA 2LFVA 1S1TB 2JL9A 4EBEA 3U7JA 2GQQA 3BBFA 2BE2B 4OYXA 3IWNC 3BGUA 3HVWA 2YTCA 2ZJRQ 2Y1JA 2JDJA 5HVFA 3HKZD 3W65A 1LWFA 5KT6A 2GV1A 4DS5A 1QSYA 3FEXB 4FKXA 2B3TB 1RT6B 2UP1A 2XB2D 1AFJA 4OZ5A 3RB0A 2C3YA 5IWAF 3J81j 3I5BA 2DITA 4YR0A 2HNDB 5C2GA 2XTJP 1YDLA 2ZZNA 1WC4A 4K59A 3HHLC 3AJDA 3QWUA 2HAFA 4NLVA 3PG9A 4P2XA 2W7AA 1YIJS 4BHQA 3B4MA 1VC0A 4HH1A 1DQ8A 1V3ZA 1BMQB 1HMVA 3FVYA 4GVBA 3GSIA 3UWTA 2ZC4A 1BQXA 2R7OA 4PRFA 1TZ0A 5D4NA 2DRBA 3MM5A 1Q8BA 2AZ3A 4KFBB 1GK8A 1XR5A 3ENVA 1NXIA 2AJ4A 3ISNC 3CCSS 3T1HJ 2XS7A 2A6MA 3MURP 1QDUB 1WDTA 2VJVA 4G3IA 2AJFE 4C3LA 2G0JA 4UZCA 2OSRA 4DR1J 2CNLB 3KG4A 3OFHA 3DRXA 2HRYA 1RCXB 3AY0A 1LXJA 1RYSA 2DH9A 1GTHA 2M0GB 3PO5A 2JLEA 4KTQA 1L3TA 4M5LA 4NXNF 1N32J 2RE1A 2JEFA 3HVAA 3PIOQ 2MZQA 1I6JA 2XG8A 2X1AA 1SIZA 2IRYA 2D1CA 2B51A 3M8PA 3H7HB 2ZHBA 2EC2A 3E3XA 3SFGA 2DPJA 1TKXA 1FVSA 4ZCMA 2A2CA 2GCFA 2W8KA 2DNGA 1NHUA 2OMLA 1JLBB 3M6VA 2BA9A 4F7VA 5EWEA 3ZTSA 1OIAA 3M2VA 4ECYA 4MIWA 2E9TA 3IS9A 3R5BA 4PAAA 4Q43A 2EK6A 1JLGB 1BGXT 3AD7C 1HBOA 4C0HA 4L75A 4OLPA 2K1RA 2MLZA 2LXFA 3I32A 1TL7B 2DHSA 1KNZA 2NXUA 1S4EA 4PPDA 5KG1A 2UU9J 3AJ2A 3DU6A 4MTPA 1NKCA 3HD2A 5DG9A 1BLUA 3KUGA 4EUVA 2PI4A 4NCGB 2I9SA 3MMJA 3OVBA 1DZ5A 4J90A 3OFEA 4UQTA 1SC3B 2HWHA 4RL1A 2M8DB 5A2QU 4L73A 1MLAA 3PX4A 4QIVA 2W4CA 3W63A 4Q7AA 1MSWD 5HBMA 5IT4A 3ETOA 4N5SA 3THTA 4C8MA 1S1XB 3FK4A 3BDPA 4A8MP 1T7PA 4I2PA 2W8LA 2ZHOA 3ZTOA 1UWBA 4C0OC 1LW2A 3DYAB 4I7FB 1P9YA 2FZKB 2HHQA 3IO1A 3Q86A 3OTCA 1NAQA 4F0KA 2KN4A 2ADCA 1XQIA 4ZLPA 1U02A 2X51A 1HNIA 5G0RA 2YX1A 3E51A 2E5IA 5RUBA 3QNWB 2J0XA 1FDDA 2Z57B 2G2OA 1NH7A 5E3AA 2OD6A 3PACA 2I5JA 2GJ2A 4HDHA 1FI4A 1K1QA 4WCEQ 4QIGA 4PZVA 1LKZA 3GMGA 4GVLA 4OX7A 2IVYA 4DPWA 2LA4A 2CWKA 3CVKA 4G1QB 1N34F 1CC7A 1HWIA 3I55S 2RF2B 1IBKJ 1FFGB 3JS9A 4MIBA 2C3PA 3D6MB 4IQMA 1KEKA 2YKNA 3FDSA 4JI2J 2LP4A 2BQUA 4QW8A 4KHMA 4P74A 2MMYA 4ICLB 2IC3A 5D6GA 2HBRB 4OI2A 1VQMS 2HVEA 1NSPA 3ITHA 3NGDA 2PI5A 3CO0P 4OZ0A 2APOA 4CTAB 5HROA 2XZTB 2UUCF 5D0EA 2F4VF 2LEPA 4H4MA 5A8RA 4WZMA 1QJHA 3KJQB 4EU0A 2ILZA 1MU2A 5LT5A 2DR6A 4JP8A 4OX6A 3R7BB 3JXOA 2MZTA 2P6TA 3DHXA 2GS8A 2CJQA 3UNYA 4NL5A 4X4NA 3Q83A 1C0TA 2C3UA 2UV8A 3D4JA 3EICA 6FD1A 2HFSA 2SXLA 3TRGA 1BWEA 1JLCB 1WORA 2JFKA 3IM8A 2BXJA 1F5AA 4M5GA 4IKAA 4LRDA 4MKYA 5CH7B 2WHOA 2YNFA 3PR4A 3T5JA 2XHWA 1R8AA 2UUBJ 1HWLA 3MUTP 3THPA 3CCUS 4LIRA 3EUNA 4C9DA 2ZD1A 4GKJJ 1DTQB 2FB0A 3KK2B 3OUYB 4GO5X 1HQUA 3MI7X 4FNHA 2W9AA 3RB6A 2CJBA 2MLXA 2M52A 2W2OP 3MM6A 3KHRA 1U0SA 1A0OB 5CYQA 2CQGA 2AJ2A 2HWIA 2XWYA 3UO0A 2KM8B 1I94F 3SYZA 5HVHA 3CWJA 3GSDA 2HHHF 1HQ2A 1UPMB 4A8XA 4R8UA 3TAPA 4OX9F 4YDDB 1TL5A 3A8KA 4QR2A 5D0HA 1FVQA 1JKHA 1PJ5A 1GEHA 2BEFA 3MD3A 4GC7A 2R8JA 2DXDA 2ASYA 5H9FJ 3VZHA 2DJWA 1U47A 1F60B 3BJYA 2KDOA 3K17A 3GWCA 3W2VB 2YKMB 1U6ZA 1D8YA 2BRLA 1U4BA 5BJRA 2CUYA 1ZYQA 2EG1A 2MJUA 4MMOA 1LK7A 5ETRA 2HRUA 2ZJPQ 5FD1A 3TO8A 4I6AA 2W9BB 3THVA 1LWEA 4EO6A 2GIFA 8RUCA 1ZTWA 4QW9A 4ECXA 2L9DA 4O44B 2BM0A 2HFUA 2Z8QA 2C2OB 4DCJB 4WBFA 4JBCA 2Y1LB 4DX8H 1JJCB 1IWAA 2XULA 4Z7CA 2PA3A 4CH1A 4WIIA 5GMEA 5CCLA 1SUQA 3C14A 1Q86T 2B4PA 3B54A 3V81B 1URRA 1DTTA 4CLUA 2EWHA 1IN0A 3GR0A 5E7OB 3HVRA 3LWMA 1HARA 3GYXB 1N5QA 4LBHA 2ZDOA 5I42B 4KYZA 5DLGA 3MMCA 2NYHA 2VFRA 4JI8J 5KFVA 2DR8A 3DGVA 4USJC 3E2EA 2XEXA 2XLJA 1PYSB 3LGMA 1UKUA 3VGVA 4OI4A 1RTDB 4TN2A 2GAHC 3K0JA 4P7VA 4ZJOA 5L39A 8AT1B 1SBRA 2XQCA 4J9LA 4PWWA 4A4JA 3OVSA 1SPBP 3WX8A 4KY3A 5I4MA 1W2BR 3MGJA 1WG4A 1PSDA 3WBZA 3VAHA 2AD9A 2GHPA 4TU7A 3F44A 1TMMA 4EI2A 2FHKA 1QLNA 1P8GA 2K2PA 4CDIA 3BDEA 1N0VC 5T7LA 2FJBB 1RABB 4UUWA 4RX6A 2RUSA 1HD1A 1EP4B 3CJ3A 1N8RT 2M3DA 4JI4F 2QLXA 2CQIA 5MAOA 2KL8A 2IVFB 2FJWA 4MKBA 3MM9A 4JB8B 2B6AA 2RD5C 1N5TA 1HPZB 2LDYA 2GZOA 3GILA 4DR7F 1FD8A 3IRXA 4B08A 2HFNA 2MQLA 2WBMA 5HATA 2Y9HA 1RK8A 3RAQA 3OL7A 1S0MA 1RWWB 5HI7A 2BRKA 3L7OA 4O0NA 2CZ4A 2ZH2A 4WFZA 1NK5A 2WVCA 3W64A 4NX9A 1NDLA 2UXCF 1VQLS 1F2HA 3M2RB 1NPRA 5AE3A 4RKUC 4OV6A 4TXSA 4B9MA 1FRKA 5EGYA 5KFJA 4DL7A 1NJYA 1Z1ZA 2D9PA 5KFPA 1VQ6S 2VICA 1MMLA 3FUYA 1S6QB 2GVZA 1QSLA 3HK2A 4DZDA 4NI2B 4WTYA 2VC1A 3R1HA 2CG4A 1M5KC 3TQEA 2I8EA 4OYOA 1U25A 2OTJS 3GV5B 1XNQJ 5HMYA 2CJ9A 3MEEA 3UN2A 2B4VA 2GMHA 3CJ4A 2GGPA 3D9BA 2G0IA 3B4DA 4BS2A 2R9LA 4FZVA 2W01A 2CQCA 2KZMA 2R7WA 5HN0A 1WG5A 4A8QA 2DT9A 3DLEB 2W4DA 1PC4A 1PAEX 3RG6A 4C97A 2R2SA 4P2FA 3KOAA 4WFNQ 4ECWA 1K73T 3OJSA 3BR8A 2VG6A 5KFDA 4DR2J 4DV4F 1N6QA 2VODA 4DSEA 2KI2A 5DS7A 2Y0SD 4PWDB 1RBLA 1OPZA 3ILIA 1OYEA 2ADBA 1G6BA 1EB0A 2KHDA 5CXTA 4FS2A 3MM8B 3NP5A 1CQNA 2HFZA 4KAIA 2VPYB 1ACMB 4ZLNA 3BGRB 4KBIA 1U8SA 2O1PA 4PQAA 4I67A 4U96A 2A1BA 1MMDA 3BF4A 1T11A 3VHQA 3J7Z5 1UPPA 2B7CB 2H9ZA 2JLFA 1F0XA 2AJQA 1KKHA 4CYUB 1J5EF 1UZHA 1S1WB 1RHKB 3LA0A 5DDQC 4L6V3 1FD2A 2QZ8A 4W92B 1WHYA 3TARA 2IM3A 4BLGA 4ED1A 4DL3A 1CJTA 3LP0B 4KKOA 5DZ7A 3PO4A 4CO2A 4DQPA 2ZDPA 1UW9A 1HNXF 1FESA 3GONA 4ZIWA 2N7YA 4HTIA 2G4BA 3IR6B 3M8ZA 4B3TF 4CCHA 3BPDA 3PHTA 4Z7YA 4USIA 1KQGB 4ERDA 2IDEA 2FVCA 1VQ9S 3MHYA 3MMAB 3OHAA 4W4MA 4CP5A 2F40A 1R0CB 1FKOB 4Q0BA 1YRTA 5J2NB 1HYSA 4X4QA 2XY5A 1VJWA 2HNYB 5IFMA 3FBBA 1FNXH 2CNKB 2MJNA 4BWJA 5F8IA 5F41A 4K0KJ 2X7IA 1FJCA 1TL3B 2I6WA 2RU9A 2FHOB 2L9NA 4NLOA 1KFDA 2H48B 1X5OA 1MG7A 2H51B 4ZHRB 2HSEB 5HO4A 1YBAA 5HP1A 2ZBRA 2HYIB 3VAMA 4PG7A 4K2XA 5E0OA 1M90T 4QIFA 4YY3F 3EXYA 4DCOB 1U26A 1NK0A 3CCRS 1SJ4P 2VV5A 1JLBA 2BYCA 2WOMB 3DLLQ 2CPZA 1A6LA 2MPUA 1G1XA 4ILLA 2IM1A 2QFIA 5DJBA 4ZITA 1GXTA 2GA7A 5AXKA 1JLGA 3H20A 2YWFA 3KLIB 4YB7A 3SCLE 2VBWA 2Q3PA 1P9QC 1TL7A 2F4FA 4QWDA 4U7UD 4RPFA 4K4TA 1NSAA 1NK8A 4DL5A 3QLHA 1RT1B 3H8YA 1PBAA 3HCXA 3L09A 1WC3A 1E6YA 4LF6F 3EYZA 3AJ1A 3W8PA 3W9JA 5HMZA 3QBCA 1JK9B 4DUYF 2B7BB 1HNWJ 4NA1A 5A8WB 3LH2S 4YB5A 1AUSL 5HQMA 2FD2A 2IDLA 5ETSA 3GJTB 2K06A 4C2MA 4OZNA 2NYIA 3R7SB 3I31A 2E1MC 3DDIA 2XY7A 2R7UA 1SC6A 3CB4A 4H54A 4YN3B
chains in the Genus database with same CATH topology
3KNGA 5LSRA 1R27B 4RUHA 4K4VA 1VQSA 2XSJA 3CJ5A 3GFXA 1S1XA 5KFTA 2E5LF 5DGAA 3OSPA 1FXLA 3V5RA 3X3UA 3FQLA 3E8OA 1VK8A 2IYGA 2DGOA 2IM2A 4PXEA 1Q8LA 2IAJA 3CCQS 1J2VA 3LOUA 4WXOA 2MKHA 5KT2A 2RQKA 3PXGa 4KGKA 3LP2B 4ALZA 4Y0FA 2MQMA 4I7FA 2ZH6A 3LP1A 3LW5C 4RNFA 1KN6A 3W3SA 2WSCC 4Q2LA 2UVVA 1K0TA 4WU3A 2EC0A 3KLFA 3R1LA 1Q79A 2JOQA 2ZOFA 3UDCA 3UDLA 3H4DA 2X1FA 1KLMA 3M1VB 3JYTA 1S9GA 2RRAA 4BBYA 3SZ2A 2DIUA 5JVHQ 3EX7B 2DGSA 2DO0A 3I9ZA 4Z37A 4OI6A 3EZUA 4NCBA 2NUHA 1JLEB 3HZEA 2EI5A 5KFFA 2ILYA 2MQQA 3TNVA 2RQMA 2YNHA 3O3LA 5F9NA 4IR9A 3D2WA 3TYTA 4ED5A 1HBNA 4YB6A 4H4OA 4DOZA 7FDRA 2D74B 4PG8A 1ZBTA 1YHQS 1X7VA 1O51A 1YRXA 1IKXB 4IO9Q 3K5NA 1S99A 3TA0A 2YKQA 1VRTA 3GYNA 1LWEB 2GHWA 4I64A 4A47A 2DNZA 3ZC4A 4ED0A 4F26A 4LFBF 1ROFA 2HG4A 1GT8A 1WF0A 2NS1B 2UV8G 5E5NA 1T3OA 2PIIA 4ATNA 1NKBA 4B3MF 2EK1A 3I0RB 2P9GA 2CKWA 2GJIA 1UJ5A 5IXUA 2CQ2A 1YJNS 4JUZA 1TQLA 1MNEA 4EGLA 5KAKA 4JYAF 2Y1IA 2C3MA 2CRLA 4B3RF 2JFDA 3N0VA 2YWKA 2ZITA 1U6BA 4Y00A 3MR3A 2GHVC 2F8HA 1F9FA 1X4AA 4WU2A 2EFNA 2LA6A 4TNOA 3UI3A 4DV5F 4DL4A 2R8KA 5B09A 2BABA 2E9RX 1WTBA 4NOHA 4QWAA 1VRUB 3SSQA 3KHLA 2R7TA 5DQHA 3MF5A 2GIQA 2JEJA 3FZ2A 2Q66A 4R5PA 3NS5A 4HT5A 2LXUA 2UZAA 1KTQA 3MM7A 3Q24A 2RNEA 3KKFA 4MJKA 4ECQA 1JNZB 3ISZA 2LQ9A 4FXVA 1NEEA 1BQMB 3I82A 3M6UA 5KG0A 1OQ6A 2CQHA 2RKIA 3I56S 2RF2A 5HQ8A 2KZZA 3NMAA 2MYFA 4OIXA 4WFAQ 5KFLA 1S7HA 4KV8A 1SUQB 3KLEA 4H4KC 2E1CA 3NS6A 4MH8A 3T1AA 2QT7A 3DDKA 3DMJB 1FKPA 2VC0A 5LMUF 1Q82T 1DQAA 2VASA 4PKDB 2DCUB 5GMKa 2M9KA 2GIRA 4DN9A 4YHHF 1R7IA 4UY85 3RRKA 1S48A 1SKWA 1Z2ZA 4HL9A 4NZ6A 3H5SA 1VQNS 1FRIA 3G86A 2V8HA 2V8DA 4CI0B 5KFHA 3QZ8A 4HKQA 1X9SA 2CPXA 1LXNA 4XK8C 1FRLA 1U1NA 1YGYA 1SQEA 5B0AA 4OHVA 4C3MA 4PXDA 4IRCA 4RBUA 1NH8A 4ECTA 1TV6A 3AB4B 3GE9A 4F8RA 4A8OA 5E3PA 2IHR1 4K4XA 2ATLA 4LMZA 3N6NA 3OFGA 2B56A 4LSNB 2OPPA 3JTNA 3MMCB 4IO1A 3HX9A 2MHNA 4OV1A 1X5TA 2ZH4A 3Q22A 1B7FA 3AH6A 1QAXA 2CJKA 2MKJA 3OL6A 2OJ3A 1IKYA 5I3QA 1TKTB 3VCDA 4YFUA 4R0EA 1YG0A 4F67A 5CHCB 1S6OA 3HPOA 1S1VA 1ZZFA 4NLDA 3BO3A 5J1EA 4LF9F 1GH8A 1FRJA 3IR7B 2V9KA 4HT7A 3NNCA 2XBPA 3Q8SB 5BR8F 2MKKA 2N4DA 3M8PB 4ED8A 5J2MB 4AXJA 3MECA 4HEA9 1ZPVA 3M9MB 2BDPA 5EDWA 1N0UA 1RT2B 3M32A 2JX2A 1E6VA 2OKQA 3BN4A 5KG3A 4LJMA 2XNRA 5FJ4A 4EBDA 3KK3A 1Y0HA 2V4QA 4ED7A 3T6JA 3OTBA 4WE1A 4QIWD 4PWUA 1TKDA 3OR2A 5F8GA 2AWZA 4DFKA 5A2QY 3RU0A 2KG0A 2CDQA 2MXYA 2ASJA 1TR0A 1SIWB 1YJ9S 1M5OC 4C11A 2KRRA 3ENWA 2BZ2A 1JLCA 3IAM9 1Q78A 1WEZA 5DDRC 3TX8A 1ZOTA 1XC9A 2CVEA 3W2WB 4DQIA 2C2RA 4QBUA 1KVIA 2KT3A 1S1UB 1C2PA 3HM9A 4NLQA 1O8BA 3UD4P 1T03A 2MDAA 4CIOA 1FRXA 2AGOA 4FXWA 3TANA 4A8YA 1Q7YT 4IFVA 2DGXA 1BQNB 3ZFVA 1UEVA 2ZE2A 1GX5A 4C98A 1S1WA 5K14A 5C25B 4G1IA 3PR5B 3M30A 3EPIA 1FT8A 1N5YB 2RH3A 1Y00A 3MMBA 1VI7A 3M2UB 1LWCA 4A8WA 3KHHA 3GV7B 5T7LB 4CT9A 2CYYA 3I4HX 4WXWA 2HNZB 3VAIA 2CQPA 3OXLA 2W7OA 2OFGX 1U2FA 2XSFA 1U1OA 5AXMA 1IKVB 5I3UA 2ZNZA 3QYYA 5DRKA 3W7BA 1RA7A 2AGQA 1SJFA 4C8YA 2DNYA 1K1SA 1MROB 2KXFA 3JSMB 5KFIA 3QJLA 3SQGB 2W4PA 5DDPC 4OZJA 1JMTA 3DI6B 4L3NA 2JVOA 1RT5B 3CTRA 2VZ9A 3VAKA 1M5VC 3V6DB 3DDNA 4IUFA 1C0UA 2VG5B 3LP0A 2DGQA 4HDGA 4EZ9A 1TFYA 5IM0B 3PX0A 2FLPA 5F0WA 2WONA 3B8HA 4Y2KA 3LGNA 1DTQA 4FS1A 3VWSA 3HHKA 3FSXA 1V3SA 3QIPB 1N4LA 3FSYA 3KK2A 4ELTA 1N32F 3OUYA 1UVLA 4GO7X 3DN9A 1IJFB 1IQTA 3DRRB 5AXNA 2VQFF 4E98A 5HLFA 5BYRA 4CO0A 2LKZA 3SFUA 2M88A 5IQ6A 3CCLS 1C1BA 1D1UA 2DB1A 1U24A 2XS5A 5C24B 5K8NA 5GAHI 2OTLS 1CG2A 4WFBQ 1JWWA 2BM1A 4TQSA 2DHAA 1TK8A 2VG7B 3LAKA 1TK0A 4ZVGA 4DPOA 2FVRA 3T5HA 4C8NA 1Y3JA 2OH2A 2HLTA 3N4WA 3QGGA 1FXDA 3IRXB 3LAMA 2ZH7A 3ULHA 1K9MT 1S49A 4NCAA 2FC8A 3CJKA 2V4RA 4B3SF 2NSBA 5DDOC 1S77D 2HS4A 3CCVS 3BSOA 2DNMA 1OSCA 1T95A 3NRBA 2RDJA 4RNNA 1H6KX 2J7UA 3QMQA 4B3OB 4ES3A 4N47A 3MMAA 3QAUA 1SL0A 3S1TA 3POTB 4LVNP 1FKOA 2IVMA 3WC0A 2JLGA 4B9UA 5IT9Y 4JI6F 3TVYA 5J2NA 5HBMB 2LLZA 3PJWA 2B5JA 4U6PA 2XI3A 3JTOA 3EXCX 3KMSA 4DV3F 4QOTA 4RBVA 2ZH9A 4KPYA 2Q6BA 3MD1A 3DLKA 3D1HA 4CNYA 4EEYA 4K4YA 3RB3A 2VA2A 2EFQA 3EZ5A 2V8VA 4F25A 2RT3A 2IJFA 4HI2A 4FBUA 1IBLF 2JJ4D 1KHVA 1WHXA 4F3QA 2CPDA 2WB4A 1REVB 2R2UA 1FRMA 4AL6A 1H7XA 2MSTA 3P5TL 2XY6A 3D5MA 4OHYA 4CT8A 2J8AA 1WG1A 2DPIA 1JLAA 1D0EA 4ZHRA 3FFIA 4V19X 2HGLA 1T8EA 2PGCA 1Q81T 3Q0AA 3H4BA 1NNDA 5KFMA 2WSEC 4ETXA 4F2SA 3DRPA 1YRUA 2VKRA 3KWMA 4ZCKA 5KFQA 3DXSX 5LL6d 1Q16B 2NZ4A 3W2VA 1HBMA 4NRTA 1U1MA 1ZM3A 2ZNYA 1UJ4A 2Y1RI 3HHLB 1JJ2R 4DMZA 2U2FA 2B9XA 3EPGA 4A8FA 4K5SA 4AL5A 4UY8T 4QU7A 3ZZ0A 3H5YA 1FHTA 2OO4A 1T02A 4Y2AA 4J9OA 4P6QA 1S0VA 3BSNA 1Y3KA 1H0HB 3MAHA 5AJ3F 4CO3A 2BR0A 3DM2A 2YNGA 1U49A 4URQU 1BY9A 1W25A 2UVUA 2HMIA 1QVGR 3UCGA 2YKAA 2W9BA 3GFZA 2ZBCA 3M05A 3CJ2A 2N7CA 2MHEA 2N3OA 4X4OA 1ZETA 3C46A 4OJ1A 4YUDA 3G9CA 3TR5A 2RJZA 3LUYA 3MEEB 5E33A 2DNQA 1F5BA 2E29A 2W9CA 3TAMA 2C2EA 1L3UA 2GGPB 3KG1A 4I56A 3Q8QB 2MGZA 3CO9A 2F9JA 1FDAA 4ID5B 1S6UA 3AB2B 2V4JA 4RNMA 2CPFA 1HA1A 4OJGA 2QA4S 1MW7A 2HHTA 2HHSA 4F4KA 3LPYA 4FXDA 5BYQA 1SV5A 1QUPA 2BJEA 4NPOA 4F4WA 1HD0A 1N88A 2A18A 1VQYA 3DHWC 1FK9B 2LYVA 4EYHB 4H4KA 2AV5A 2JHEA 4ZA1A 2D3UA 1HHTP 1RWUA 2CZVC 1F2GA 5KT3A 3UW1A 2QFJA 2KJWA 3GIJA 3AQPA 1FXRA 1ULRA 2VG6B 1RT1A 4IDKB 4IG3A 5C42A 3QAEA 5E3CA 4RU2A 4EO8A 1FNMA 3CCZA 2OMOA 1PGZA 1WEYA 2IC3B 3N5BA 4BC9A 2DD8S 5KFRA 3D28A 4Q45A 2ASLA 3RAXA 3V81A 2BV3A 3CD0A 3L3CA 1EETB 4YP3A 4IRDA 2R7VA 1N54B 5CZXA 1C1CA 2J9CA 4ZPCA 2GFFA 2DNKA 3CUNA 3HLUA 3DLGA 1FNOA 5LXYA 2IA0A 4Q8FA 1FA0A 1S6PB 5A8WA 4LIWA 1HR0F 2KB2A 4MKAA 4DR4F 5I42A 4ZP8A 5KOXA 1RGVA 4FNIA 3CMAS 1XMBA 3GV8B 3MEDA 1HBUA 1OWXA 3OR1B 4A46A 2XMVA 1LK5A 1VHFA 1RTIB 1RP5A 2DGWA 3MEKA 4H4MB 1QUVA 5A8RB 1H98A 5IS2A 4C8KA 2IRUA 5KFSA 4DV0F 4WJBA 4C8LA 2CJAA 3UD3P 4C0BA 1TVRB 2ZKTA 3H98A 2V9WA 4NWBA 1SL1A 5CA5A 2OFHX 2M7SA 1R6YA 4LF7F 2QRRA 2IM0A 4ECSA 5GADU 3NAIA 1S1TB 2DGTA 3ZZTA 2JL9A 2RS2A 1FE4A 4RW4A 5KFNA 4PQUA 5LXRA 4EBEA 1VOMA 3U7JA 2MQNA 2BANB 3PM9A 4J9SA 3FGVA 2GQQA 5JJBA 1C0TB 1U09A 4ILRA 2BE2B 3IWNC 3BGUA 1IXKA 3HVWA 2YTCA 1HQEB 3R5CA 2ZJRQ 2Y1JA 2JDJA 1APSA 3GG0A 3HKZD 1D9DA 1LWFA 5CZVA 5KT6A 2GV1A 1VQPS 2HGNA 4DS5A 1QSYA 2DNOA 3FEXB 2WTFA 2B3TB 1RT6B 4I68A 3AAWB 4F4XA 2AYGA 2UP1A 2XB2D 2GQ2A 4E0DA 1L3KA 1AFJA 4OZ5A 1WI6A 3RB0A 1FE0A 4OL8A 5DQGA 4F3OA 1YWXA 2QEXS 1X4DA 2C3YA 3N01A 3HZGA 3N28A 3OBIA 1KR4A 4LQ9A 3HKWA 5IWAF 2D41A 4QQBA 2C22A 3I5BA 2DITA 4XDDA 4E8UA 4YR0A 4RUAA 2HNDB 3U02A 4Q8EA 5CYMA 1TAUA 4O23A 2FHJA 1UP1A 1SH3A 2ZZNA 4K59A 2J9DA 1KQFB 1Y5NB 5KFAA 1SJ1A 3HHLC 2HGMA 1K8AT 2VFVA 4N76A 3QWUA 1RKIA 3MTKA 4JI7F 1UA0A 4NLVA 2J9DE 2YWGA 4I1TA 2W7AA 1YIJS 3CDBA 4DR5F 1JB0C 1TP7A 4BHQA 3I0RA 1KFSA 2ZH3A 3B4MA 3G71S 1VC0A 2KFZA 2OPRA 4HH1A 4IFYB 1DQ8A 3OHBA 1V3ZA 2HHUA 1RTJB 1U6FA 1HMVA 3FVYA 5B0BA 2GQCA 3JB9k 3UWTA 2ZC4A 1BQXA 1S4FA 1WWHA 1L3SA 4B9TA 3QO9A 1KC8T 1U45A 2R7OA 4PRFA 4NLRA 1TZ0A 2OPQB 4GC6A 5D4NA 2KFYA 3I96A 4LVOP 3VAJA 2OPSB 1NJXA 1KTVA 2DRBA 2AW0A 2HLUA 4RW8B 4LF5F 3MM5A 1Q8BA 1VQ4S 4KFBB 2AP6A 3MM6B 1S9EA 1DARA 1R0AB 5G4DA 1XR5A 3ENVA 1URNA 2A3JA 4RW6B 3PEJA 2AJ4A 5M2UA 3NBPB 3ISNC 3SDEA 4ZVFA