2OPCA

Structure of melampsora lini avirulence protein, avrl567-a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
115
structure length
115
Chain Sequence
EGYTRFYRSPTASVILSGLVKVKWDNEQMTMPLFKWIGGEQAEELHFCVHIAHSSGPKLNRARSLGTVNSNMDQHWAQAQRNSGATRRTIEGFHLFENDIPNFPDYIKIKLVPKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The use of Co2+ for crystallization and structure determination, using a conventional monochromatic X-ray source, of flax rust avirulence protein.
pubmed doi rcsb
source organism Melampsora lini
molecule tags Protein binding, metal binding protein
molecule keywords AvrL567-A
total genus 18
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2007-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11529 AvrL567-A Melampsora lini avirulence protein AvrL567-A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2510 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2opcA00
2OPCA 2QVTA
chains in the Genus database with same CATH superfamily
2VDRB 1PG7W 4FFVD 4WI4A 5E2UL 3KPQB 3WJLC 1CE6A 3JWNC 3JT2A 3LQZB 2CCLA 1A6PA 2VISB 2XCMC 3W82A 3INOA 3MRJA 4JFFE 3MLZL 3MRMA 1GW6A 3PWPD 3ILPB 4JKMA 4ELMF 3O4OC 3SY6A 1WBXB 1H8NA 4GBXB 2XKNB 3CHSA 3VFNA 4KKPA 5CGTA 3FUFA 4NUGL 4A04A 4GRLC 3QQ3B 4JPWH 1F4XL 1BVNP 3DK2A 2VXQL 1WA0X 1KTDB 5I1AB 5EUKA 5CKAA 1EFXA 3UYPA 3BGFB 3ZKMD 4UILL 2X1XR 3GMOA 4GO6B 3TVMD 4F58H 2A1WL 4WFED 2W38A 2GFBB 4F15B 2Z31D 4AW7A 4XR8C 2AI0H 2VXUL 4J1UB 5DS8A 3OF6A 3RWHA 1HJCA 3KLHC 4JDEA 4L5FE 3R4RA 4UAOC 1DSYA 1M71A 1X6NA 4LF3B 4Q6KA 5D1ZC 1CLOH 2Z1PA 5JQIB 4G1EB 3GJFA 1S7QB 4FD0A 1GY1A 5AZEL 3ZE1E 4XN8A 5IW3A 3LB6C 2BWQA 4ORZC 3VQMA 4BCYA 3L5XL 1UZ6E 1K8DA 4QKXB 5IOPA 5BRZA 4IRZL 4ZSOA 1BXAA 4LLAA 4AIZA 2O5YL 5FYKH 1F4WH 2G2PA 3B4NA 3E6HB 3HHMA 3OWRA 5ABAA 1MWAH 3IB4A 1U8IA 5IMLA 3V6BR 3ARBB 1NFKA 4U7KA 4UOW1 2VQTA 2J57A 1QZ1A 1WQVT 4NKIH 4U4IA 3WNIA 2KH2B 1A6WH 5HYSB 3KWWA 2D9QB 5FS5A 1TF4A 4JM4L 3QDMD 4OIBA 3EFOB 1JWSB 1FV1A 4XP4L 1BREA 5I1DB 2Y6SD 4MJ5B 1MFDH 4YMPA 5IM7B 4C47A 1E67A 3U30B 1LDPL 4L1DA 2BXYA 1F56A 4HPYH 3UBHA 4MNGE 1MIEL 1PDKB 5C97A 5CMAB 1A4CA 1MCOL 5B1JA 3FO9B 4K5PA 4P2OD 3HFMH 4AGQA 1E9OB 1E7VA 4I3RH 1MW1A 4LLMB 1NGPL 5DK0B 3N2JA 2X3AA 1JGUH 2Q0ZX 4NGHL 2CIKA 4I2XB 2WQ8A 3ZE0B 2VRQA 1ZSHA 5ID0B 3PFQA 4MRCA 2DYPD 1S7UB 3QFDB 4FP8H 2X9ZA 1F2XK 1M3IA 4LLWA 4RX4A 4BGDA 4PJIA 3JTBA 1RURH 1COBA 1WS8A 2H7WA 2X4SA 1NC2D 2HA1A 3SZKC 5GRVL 3T08A 1YG9A 3VE0B 5FWQA 4HUNB 2HP4A 4HS6A 4PJFA 4BQ8A 1QWUA 1TSRA 3E9TA 5CILH 4ZPTB 5JXAL 3QI9A 5IFHH 1WHPA 4PRAB 4YXHL 1B88A 2HVKA 2IQ9L 4IK6A 2X88A 1XGRB 4N2HA 2QZQA 1D2OA 1RK1A 2WLJA 1YMHB 4FG2A 4NOBA 1TFHA 1GJIA 2IG2L 3I3DA 4HWEL 1RIUL 5D8JH 4TNWK 4HEME 4B9CA 4H0GA 3X12A 3KS0J 5FA3B 3D39D 3IFNH 1JYWA 5AZUA 3U0WL 2PO6A 4Q8BA 4KY2A 3X11B 4EKXA 1QKZH 5K9OB 3MOAL 4I48B 3GHEL 1TOXA 1WEJH 3DHUA 1I8LA 3FQUA 3P2TA 2D4DA 4QRQA 3CZFB 4B6ZA 1HHHA 1NH6A 3S4SG 1GCYA 3QUYD 1L9MA 2GBTA 3SCMD 4NO2B 5F3BB 3O6KH 2WBXA 3UZVB 1UA6L 2VXVH 2BIQA 3H3KA 4NKMA 5I1JH 1EHNA 4OUUB 4H7VA 1KTCA 2WSKA 3DUHA 3CGTA 5KVFE 2X38A 3P3YA 3X14A 4O5LH 4WHYH 3QS3A 2K0RA 3PL6D 2VLJE 2WO4A 1TU2B 1IKFH 3FQTA 3JXAA 1IKNC 4PLKD 3ZYZA 3BOVA 3BFWA 4X6BB 4DO6A 1CF8H 2NX5A 4DETA 1UEYA 3GXUB 4X6FB 3SBPA 5FPIA 3UZVA 2VDQL 4F7PB 1T1XB 4PW9A 4QD2E 4AYBA 4X2UA 3T9WA 3BP5B 1I31A 2Z64C 4OZFB 2DH3A 3HCVA 3BZDA 1ROCA 4OVVA 4ZFZB 1LMIA 4DFIA 4PBDA 1NAMA 4P2OA 1MAJA 3QARA 4F2MB 4MJID 3O3EB 1O9ZA 1PCSA 1C12A 3B2VL 2CLRA 3DJTA 3T77B 3CSYB 3HRZC 4E9WA 4V2BA 1T0NA 3EJSA 1KFGA 4UV4L 1G7JB 4BXSV 4I77L 3PWJA 3HE6B 5EO0A 3VD3A 1FL6A 1DVFC 1RZKH 5G5DA 3R7RA 4PJ7F 3FN0H 1UWYA 5E94B 3X1FA 4S2SB 1UASA 2XFXB 2DIAA 2IAAC 2VLRD 3QCTL 4HWEH 4J4PD 5C0IB 4H20H 4AMWA 3AXLA 3HBGA 5E95B 2VC2L 3ZDZE 4NQCD 5JXED 4ZUTB 3RAJL 3K74B 4JO4H 3W37A 3L4ZA 4NQTA 4RGND 4YS4A 5KVDH 4OW6A 5MHSE 3MV7D 5FYLE 5TH2A 5ITFA 43CAB 1G7JA 1ZTXL 4NKOA 4WWOA 1RZGB 1D6VH 4L3EA 4YAQA 4MS8D 2I9TB 2PXYB 4XPTL 2CBOA 4H2CA 1LO5A 1CF8L 1CDYA 1H0DA 5FW7A 4YDNA 4EZLA 4K7PH 1LD9A 5TDNA 4WUUB 4X6CA 1FNAA 1AKJA 1HK6A 2RD0A 5J13B 3CIQA 4HIXH 2CKBL 4FI7A 2QKIB 4G9DA 4HCFA 4L1SA 4NUGH 1ZVNA 5EZLB 1J05B 2Y25A 2NW2B 4W9EC 4R7VA 5AALA 4ODHL 1GYAA 5GGUA 4HDIB 2ZCZA 2CJ3A 5HXMA 3F7VA 4G42B 2B2XH 1F4AA 1GVIA 1PL3A 4XCYA 5I1HL 5B1AB 1A25A 3ZHKA 1EZLA 3KR3H 3MVSA 1TCMA 4LEXL 4MBRA 3T4AB 3DOHA 3FN0L 3I6GA 1QI4A 4O2FB 1TEGA 5IW1B 5KBKA 4YIQA 1ID5I 1Q0YH 2F8VA 2WLMA 4B3VA 4OI7A 2WVUA 3EF4A 3HC0A 3BZFB 2FR4A 4F9PC 4HH8A 3K4AA 2VL5B 2D4FA 4FQXC 2O6FA 3RPKA 3B2VH 4RQQA 4Z5RB 1PKOA 4LSSH 5T5FA 1XCTA 3BESR 4WO4B 5BJTA 1MFEL 2E75C 4IBVA 1GZHC 2RA1A 2QEJA 1X5MA 5ESVA 3LZQA 4U05A 1S9YB 1W0VB 4HUMB 1LE5A 2YKLL 2CK0H 1DUZA 1T22B 2K78A 3H53A 1GAFH 1YY8A 4WY7H 2MTAA 3FJTA 4M7ZC 2P5WB 1O6SB 2A7BA 1BD2B 2R8SH 3CDFA 4NOFA 5KVMC 3VXUB 4XBMA 4R7DB 1DQLH 4XMPL 4C4KT 3B3IA 2DYRB 4QOKA 1KCSH 2WN2A 4WNQB 2OSYA 1CFBA 3G5VB 3Q48A 1TSHA 4N0CD 1A6TA 4KPHL 4Q9CA 3F62A 4N86A 2VXQA 3KG5A 3NIGF 4YE4L 1CFVL 4GXVL 1E4XI 2DEYX 3OKNB 1OSYA 3L5WA 1A1OA 2R69L 5I76B 1FSKB 2V2WA 3IE4A 3MV7A 2WGNB 4JRXB 4YHYC 3I9PA 3EDEA 1SHSA 1YEHL 4I0PC 2IAMD 1MHPL 4M29A 4P04A 1ZHKB 2IAND 2PWEA 2WINA 1X5JA 2QVTA 3WN5C 2LOEA 2WN3A 2YXWA 3ARGD 2YGVA 5ETUB 1FBIH 5DK2B 4YVNA 1GKOA 3RUGA 4ZD3L 4QT5A 4C56B 4JRYD 4E42B 3ABLB 2FJGB 1JTTA 1FDLH 3MRQB 2Z93B 4X7FC 5KYNA 3QCVL 3FCTB 3OKEA 1RJYA 5C0BE 4HS3A 4U6XA 1N0XL 4ELME 3SGEH 4EZJA 3DTUB 1AIFA 2JB6B 4MCYA 2H4EA 3PWPA 5KVDL 1WAPA 4XCYB 3QR1A 5GS1A 1DDHB 5E08H 3D85B 5LQBL 1AZNA 5L2JA 2JMRA 2IQ9H 3GZOA 4NCDA 5E00B 1PLCA 4JO8A 2L7EA 3M17B 4NPKA 4KHXL 2VXTH 4TPRL 5DS1A 4MZ2A 2DQGH 3N42F 3IJ8A 4HUKB 4AXWA 1OSZB 2CALA 3CK0L 2QQLL 2OLDA 1U41A 4Y4HD 2X89A 2N0MA 2Q3AA 5IQ7H 4HGMA 4R4ND 4KRPC 3GUFA 2RFXB 1CR9H 1SF5A 1WISA 4FF9A 4XBEL 4L8CA 2F8XC 3HG3A 1RHFA 4GT7A 3WI9A 2FO4B 3ZTJG 1TT6A 4X0NA 4N2FA 3NIFE 5LAXA 3RTQA 2WVSA 2HFTA 1W0VA 2NY6D 4G43A 4A2GA 2XN9D 4RFEA 1IUZA 4RFNC 1I9EA 5EO1A 5EZIH 3TV3H 1KZQA 1YPZF 3E0GA 3D3VB 4JFYA 4F8QA 5KBLA 3CTTA 1T21B 5LDUA 2IQAA 2ZYIA 3QB7C 4U1LA 2X4OB 2JCWA 3BP7A 1OGAD 4HPYL 1Q90A 4ZPVB 4POUB 4Z0BL 5AAWA 4N2MA 3DGCR 1AGCA 1BZ7B 4IRJA 2JI1A 4MDJA 3VXRD 1FFQA 3SHSA 2X6VA 3WLBA 4I87A 2EIKB 2M1KA 4PJGF 4AZ8B 1E5AA 1QMUA 4K7PY 5JHDA 1PZCA 4ADJA 1ZVHA 3A4AA 2B59A 3OLDA 4YZFF 3IGKA 1IKFL 1E5UI 1XF5B 1TEFA 4L4TD 1A9EB 1KG0B 1YJDH 3QDGD 1A7RH 4KOBA 5IMOA 4ODWA 3C08H 4K3JH 1N6VA 4ANVA 1NFDA 3PLYA 1JZ2A 3TVMB 1D7DA 3BP7B 3ML9A 3D2UB 3CLWA 4F7EA 4J23A 4P23C 4HCGA 1JCVA 2VKXA 1W8OA 1ZT7B 3O4LB 5DS8B 1EAQA 1BD2D 6CGTA 4FQIL 4GLRI 4OCSL 2HT4C 5L8LB 2GSIB 3A6BH 4WWKB 4OFDA 5HHMD 1OM3L 1MCJA 1D2PA 2WQWA 3DX4A 2P24A 4IS6B 1T1WB 4G5ZH 4HK0B 4L5FH 4PP1C 5F7MC 4NO0A 4BFJA 1DL7L 2I07B 4WF7A 1OTTD 5E8PA 1BXXA 5ES4B 4RWHA 3B2MA 3F6JA 2CHDA 1GYVA 4LLQA 2VR3A 1TKWA 5E00A 1ZANL 3KGUA 1CI5A 2N4IA 4IGBC 5JW5A 4ZTOH 4YWGH 4LRNH 1F1AA 4LCWE 4PB9L 5AOIA 3EBIA 4JFDD 3G9VA 5DC9B 2Z9TA 5ANHA 3BQUB 4PS4H 1JPGB 3O4LD 1RUMH 5A2AA 1YY9C 4WGKA 3MXWH 1Q1JL 1BW8A 3G6AA 3OGOE 2ICEA 4TSBL 2J8HA 1QWNA 3I2CL 1WCBA 3V52H 1KPVA 3MREB 4KZEL 5F7AA 3CPLA 5I0VA 3EJZC 3Q5YA 3HS8A 5IBLD 1JZJA 2D8KA 1JRHH 3RJDA 4X7EC 2A6DA 2VSDA 3QEHA 4KXBA 2VLLA 2X4SB 1G7LA 2FLRT 2ZOLB 2BOBB 2OBGA 4XP9L 1FGVH 5I74B 3SDYL 2WAQA 2VDPH 2UYLA 4AZ8A 1KMGA 1HCZA 2YGQA 3Q1SL 3ROLA 5E6IA 4FFYL 3K6IA 2WP3O 3ZHDA 5KG9B 2HJKA 1NBZB 5GSVA 1QTPA 2ED6A 2GSGB 4LEOA 3VI4A 3GSWA 4CN1A 5L2KD 3MJGX 2ZOOA 4UOW0 4XODA 1F58H 1RUAH 3N04A 1SN2A 4FG0A 4IU2A 5EF3A 1SF3A 1XGYH 1J5OL 1RUML 3W5MA 2R0WL 1RUPL 3WFDH 5DJCB 5IVXB 5MP6H 1LVEA 5FK9A 1BVLA 3D39E 1Z2KA 4OGXH 3C2AH 3QGVA 4H8WL 3V4PH 2HJFB 4I8DA 3I50L 3HAEG 3TA4D 1BDYA 4ILDA 1JF6A 2VLKD 2CO7B 3TPUB 1I1AA 1GZPB 3RVUC 1QYGL 5HPOA 1SDDA 1GMIA 1YPZE 4HK3J 1QLEB 3WNJA 2BSBA 3UJTL 1FAIH 1T7ZA 3P2DA 5GS0D 3BUIA 3L3IA 2CQVA 4QRBA 4I2XE 3FU6A 3MCG1 5C0FA 1OY3B 2PABA 3GFUA 4X5WA 3E6FA 1MPAH 2WKOF 3JWNE 1LYQA 3U7YH 5MEQB 3EKCA 5L2KB 1A1MA 1BVLB 2WBKA 1IBGL 4JFXA 3F5WB 1LK2A 1CURA 2YSSB 3TT3H 1KPRA 3LD8C 1HI6A 3ECQA 4G6FB 1DJWA 2B08A 4MXVF 5AYQA 1QSEB 2WCSA 1C1EL 1T0MA 4YQXL 3T1WA 3ZIYA 5B21A 3TYGH 5C0RL 3WFEL 2WZPD 3BC9A 4UOQA 3SDDB 1UKQA 3B2UC 4Y9BA 1VADB 2Q2EB 5LAPA 3ZHNA 1J9RA 4GH7B 1RK1B 4YSRA 1NBYA 1ZS8B 2NY5C 3UZEA 1CQKA 2GBUA 3LS4L 4NRYA 5EIIA 4GKSB 2G2NA 3G04A 4Z7NE 5HHPB 3US9A 4WCYL 5C0AB 4YSEA 3RNKA 3UBXB 3GLDA 3TA3B 1SM3H 1XX9C 4Q9BA 2AS5M 1Z9LA 3BHBB 4GAGH 3L5HA 1KULA 3HE6A 3Q13A 4FKKA 5DJ0A 4B9JA 5IQNA 3V4PA 2R1XA 1A47A 2WW8A 3ATFA 3HLKA 1S5HA 2EIJB 3AY2A 4RFNB 4M5ZL 5FHAL 4P46A 4JGMA 4WWKC 1R3HB 3O41A 4QRUB 1LL1A 1U2HA 3UTQA 1TQTA 5LN4A 3CBRA 35C8L 4D8PA 2HTLD 1MAKA 3CLEH 4I3SH 2XVGA 2O4EA 3H54A 4BE6A 2JKLA 1JHKL 4P06A 5E4AA 5TDOA 3ZYIA 5EBLB 2AGJL 3E2HC 3H1ZA 2AV1B 3FTZA 3MCLH 4BFNA 5F8QC 2X9XA 4JPVH 1KEML 2X4PA 1MRCL 2V2TB 4MNQE 3L3IB 2BOCA 3FSAA 2BHYA 1KB5A 1TJMA 2C1PA 2JLLA 4D9RE 4YK4B 3E6FB 4Z7OE 4HWZA 1CFSB 3ARSA 2ED8A 3ZTNL 3E6HA 2Y06H 4LDEB 4XVTH 5GRUH 1GC1C 3V4VA 3ZSTA 4P2OB 5HI4D 1AO7D 1X9QA 3H9SD 3VWKB 1TTCA 5AWNH 2YAOA 2DLFH 2Q3ZA 4ACTA 1Y1DA 1HAUA 3NOIA 3WEBA 1ZTXE 3U36A 4JBSA 4FQXD 1EMTH 2V7HA 2ICWB 3W2DH 5BW7A 4NENA 3EFDH 1OP5H 4WK4B 3TIDA 1JZ5A 1YNTB 4RISH 3CAFA 1OM9A 1OB1B 4YL4A 5C0CB 4PJIE 4XNYH 1NAKL 3PP3H 4EDWL 4ENZA 1URLA 2D7PA 4LXFA 5CMAA 1I9RH 4M4RA 5IBTL 2O93L 4UIKH 5KWYC 2F58H 4FQ2H 3RB5A 3ZN6A 5ESQA 1AI1L 5CCJA 1MHEA 3G04B 3TT1H 4RQQB 5CNHA 2Q8AL 2A6IA 2EEBA 1SM3L 4JQVA 2XV6B 5CBAB 2D7OA 3HMXA 2GYSA 5I6XB 2YPKB 5ICUA 1ZT1B 1M1XA 3OAWA 5EN2B 5MEPB 3TO2A 4LF3A 3WXVH 1NFIB 1IBHA 3QIWB 3C6LB 2HZHA 5IB3B 2HFEA 2QHRL 5DEZA 3B83A 4ZODA 1RUQL 1XEUA 5DVPA 3VD0A 3NCCB 4LSVH 2B9AA 4QNPF 4AQ1C 3HR5A 4N85A 4TOYH 4G70B 1BOGA 3B6SA 4OCNC 1UD5A 2MHAA 3VM7A 2W0KA 3P77A 1MDAA 4D94A 2MPVA 4YGVA 4ZS7H 5J8OA 4L4VD 3AWGA 3DOSB 4Z7QE 5CBAA 1EDYA 5I9QC 3ZY7A 1GZHA 3VFWB 4LKXA 3QAQA 2BNRD 2NXYD 3T4AC 1TETL 4JDTL 1NEZG 2WO2B 3IMVA 4MA1B 1HYSD 3ZUNC 1GGBL 4PJHA 1UACH 2PR9A 2XTJB 1WTLA 3DIVA 4LOUC 2CLVA 2DEWX 2W9DL 4HJTA 1ZXKA 3H3BC 3K71B 1EJ8A 1SJEB 4XE0A 3LIZH 1SBBA 3P3RA 4C56D 5LHDA 2HLAA 3C60B 1B4TA 4WTZG 2Y2WA 4EDXA 1SXCA 5D7SL 4GSDH 3IWUA 3EH2A 5KN5B 1WAEA 5EORH 1DE4B 1DFXA 2DQCH 3EYSH 4JY6B 3U48A 1ECZA 2G0KA 1NAML 2Z7WA 2R0WH 2L3BA 2OW6A 3EJYC 3D9AH 3FCBA 4AG4H 1H3TA 1DHKA 4YFEA 1D5BB 5L2JB 1OARH 1FL5B 1T1YB 4AWJC 2QADC 5EU3A 2V33A 2DM7A 1F8TH 2P43B 3QQDA 4GQ9H 2AABH 4JN2B 4AH2A 3OC5A 2YD3A 1Q9KA 1T1ZB 2E59A 4M6NH 5HHOB 1JTPA 1YYLL 5BRZE 4NQCB 2I7SA 1URZA 2YPLE 3OKOB 4Z7UB 3B3IB 3TZVA 2HVJB 4PS8A 3J27A 3FU9A 1UFGA 3QDMA 2J7LA 2NNRA 2APWA 3KYKH 3QXUA 2ZAGA 2ITFA 3ZIMA 1ETJA 1DQQA 1JS4A 3BWUC 1L7TL 5HJDA 3U4AA 1XD0A 3JWOH 3CXDL 4J3WA 2VWEC 5F1NB 3I6LD 5GRYA 2HYMA 4MJ4A 4ODSL 2YBRA 2WXJA 1AGFA 1DQKA 4Q2ZA 1JGEB 3N3EA 2VZOA 4CU7A 5EO1B 1KENH 1F90H 2XA8H 3DX6A 4KJQC 3VX1A 2ZJSL 3I6SA 4P46C 5G5DB 4A6YH 3ABKB 3CH8A 1KIQB 3DDFA 2HRHA 3GBNH 3KGSA 2WC7A 1G4MA 4QF1B 1HHIA 5EWIH 1IM3D 3VG9B 4NKIL 2XLLA 4FDWA 1A7OL 3QZLA 3A23A 2L7UA 4XCEB 4LCIL 4UOZA 4CL7A 3Q43A 2EEXA 4NZTH 3DX0A 3EGXA 3FQ4A 4ZS6D 1EDHA 2X4RB 1JFQL 2Q2LA 5F71A 2BSED 2EEAA 2H32B 3S4SA 5I18L 4HSAC 5DHDA 5LKNA 4PG9B 3OKDB 4XOEA 5I66B 3FFDA 4AL8C 5B8CB 2D7TH 4MD5A 2OV0A 4L4VA 5EU5A 5IBUB 5KS9B 3US1A 1QFUH 3WV0A 4ZX4A 1UM6H 1AJ7L 5LGJA 4V1DA 3AS1A 4FMFA 4F7MA 3DRQA 1IEBB 5CWSB 3VXRA 2XETA 1PTZA 4TNWF 3REVB 3CG8A 4MMXC 1EHAA 1ZA6A 1ITBB 1E3FA 4XNDA 3KWVA 3MLUH 1M56B 2DBLL 4MA8H 3NFSL 3VRIA 5JQ6H 3FHQA 5FFOA 1H6EA 2Z8SA 5SWQB 2WLKA 3IBOA 2VDPB 2AEPH 3F7KA 4G6JH 1PYWB 1KCLA 1SLVA 3BO8A 4RH4A 1YEDB 3TP4A 4HYTB 5E1GA 1J5CA 1HX0A 1FFOB 5D1QB 4ACPA 1NUFA 1WK0A 1G0XA 3HBQA 1PLAA 2VW7A 4KAQL 4UM8B 2L0DA 4P4KC 3UDWA 3DURB 4BKLB 3DECA 5DT1L 3EOAA 2N1KA 4K3JL 1RD6A 2WGXA 3MO1B 3QNFA 1U8HA 4IHBA 2UX6A 4HKZB 1HXMB 4JFYB 4KVCH 4M7LT 5CJBA 4CSZA 4D9QD 5K1JA 4PY7A 4G6KH 4LPXA 4BFEA 4MKTA 5IROC 2Y22A 5F6IC 2EKSA 2X87A 3BQUA 4IOIB 3C6LC 3W0WE 2DWEA 3QEGL 1KCWA 3QFJB 5DRZA 3UO1H 1IM9B 1EAJA 4KDTC 4M5YH 1GS7A 2JJWA 2UWEB 3FKUS 2Y6TE 4PJIF 5E8DH 1EGJH 5DYOA 2ATKA 1JHTA 2L7QA 3DI2B 3WGUB 2D7TL 2E47A 5EIIG 4JY5H 3QVAA 4L8BA 4NCC2 4YQXH 3BPLB 2ENJA 3DTXA 2J6EL 1S9XA 2AQQA 3QXAB 3PHSA 2IH8A 1TZIA 3K91A 2XZQH 4M1CC 4GO8A 1BWMA 5GGQL 2WKGA 3ARFA 1SJMA 3PWNA 1P1VA 2NY7L 5DLLA 4PJBE 1G6RL 3W11D 2VTFA 3P1VA 4QOKB 5D1ZD 5I8KL 3RGBA 4DUVA 3QQ4A 5C09D 3FSZA 2EVFA 2MCPL 4FHBD 2B1HH 4JFOA 5EZOH 3D51A 4I9WE 1Q1JH 3U4KA 1RSFA 3KL5A 2CHZA 4PJGB 1U8OB 4I3SL 3VFPB 3GUTB 2X6UA 4OLYH 4RGNC 3NFPA 1IM9D 3GXMA 4OUOA 5KUKA 3CXDH 4R7NB 3UYRH 1TEYA 1HL9A 3IU4H 4HF5L 1UH3A 2V9RA 1A7NH 3IF1A 3QIBD 4GAYB 2E4FA 3ZR6A 3KH3A 4RNRB 5DI8B 1IEAB 1VACB 4OM1L 4YBQD 2DBJA 4Y5YC 3OR7A 4ETQB 4PJ8D 4XWOC 1A6UH 3D85D 1BXUA 1LWRA 5L9DL 2Y1ZA 2DM4A 4YXKL 4YX2H 5I82A 3SO3B 1UJ3B 3BDYL 3EJPA 4RSYA 1B0RB 4I85A 1ZLVH 3VGFA 1IL1A 1HE7A 1KIPA 1IC5L 3DARA 2FBRA 1KELL 5K33A 5I8EA 1WO2A 2DJSA 1AGEB 2JFCA 5CIPH 4OLUL 4DPCX 1OP5K 1XXDC 4TVSa 4W9IC 1JZGA 3VB9A 1KJVB 2KZ1B 4KKBC 3GT6A 4XZ4A 2IDQA 2ZUVA 3UG5A 2IAMC 5H8DA 1ZVSB 2C3VB 4NC0B 3BISA 2HT4D 5DK3A 4L8SA 3N85L 1MJ7H 2E0PA 4LIQE 3FS9A 3T0WA 1N8OE 2KPWA 5FV2A 1AD0B 1D5RA 4FN0A 3L4WA 2OSLB 5E8DL 4NM4H 4HZLB 3KPNB 1UKTA 4GMTL 4M62H 2FAUA 4PR5A 1H6UA 2FO8A 3GXTA 3EH3B 2F61A 3PL6C 4ZO8A 3F00A 4U1GB 1CFNA 3GZQA 3VJ6B 2F54B 3AB0C 4BA8A 3QJVB 4UT7H 1WZLA 3GSWB 3BZ4B 1FRGH 4HLEA 3O6FC 1KJMA 2YD1A 4LCWB 2O5ZL 4K0OA 5TPWH 2ENQA 5AYTA 1P7QD 1QD0A 2DTSA 3OQRA 2IF7A 5BUGA 4Q7DA 3EBHA 2ZP0T 3EO1A 2DKMA 2R4SH 3PGCB 4DN4H 1U8MB 5SWZE 5BV7C 3I02A 1RZKC 4OD3H 1I1RA 3MCYA 1S7VB 4LBEA 3CDZA 1MY7A 3NGBB 4G6AD 4LDLB 4QXTB 3AT0A 1CFMA 4X7CC 5J0BA 1FNGB 5IHWA 2XDHA 5AVTB 1IEHA 2HLFC 4I1RA 4BK4A 3QDGE 5GZOD 1YY9D 1OK8A 2YSTA 2FZ3B 5CLYA 5CGYD 3KWTA 2PXYC 2OSXA 1E27B 1G7MB 1FVDB 1KJMB 4LCWA 5IMKB 3KPSE 4DPBX 3DYMA 3OXSA 2BCKB 5HJ3A 4O58H 1U93B 4M6OH 1FVEB 3D34A 4XPBH 3LV3A 1FORH 3FN9A 1HN1A 2W91A 3QUZA 5E08L 1F3JA 1M42A 1Z9NA 3CFBB 4ONHB 5D6DA 4CNIA 5BVPH 1HSAA 5A6LA 5L0QC 3UXFA 5KYXA 4Y9GA 4OF8A 1U8QB 5BS0B 2NDFA 3N85H 2XXCB 3BKCL 1GOFA 4WI5A 4Q97A 3CZFA 4W1TA 2D73A 3P0YL 2F08A 1JGDB 1IGMH 2PYFB 1Q4NX 5L7XH 2H45A 1U3JA 4GRLD 4N2DA 2G9HB 4FTVE 4OZGE 1E2WA 2EXTA 2BVTA 4XP5L 5C1MB 1DN0B 2COVD 1YMMD 4YHOL 3B1UA 5IMKA 2GITA 4BFBD 3VXQA 5AL0A 1PY0A 5LVEA 3QZMA 4ZTEA 1FUNA 1N7ML 4EI5D 1ZCRA 3N40P 2BSRA 1J11A 3Q2CA 1WAAF 1QEWA 1GGCH 1ZDSA 3OHMB 1A7BA 1NUGA 1X7QA 4N87A 4R8WH 2QLYA 4ODSH 1KIRB 3L3OA 1ZY9A 3FO1B 4U33A 4WWPA 1NJ9B 1E42A 1P7KB 2EIZA 4KH9A 3DX3A 4PR5B 1YRKA 3IWVA 1Z3GL 3ARVA 4O02A 1H3PH 2P48B 2HVKB 5DMIH 4TS6A 2VDRH 3RY6A 1CO1A 3GRBA 5E2TL 5CCKH 4E9RA 4OTXH 4XMPH 5DDHB 4Z23A 1FNSL 5DHMC 1P7HL 1ONQA 3O3EA 2P8MB 2A9BA 4XBPA 1HDMB 3LQZA 4QEGA 1LEKA 4S0HA 3P2BA 2IDTA 5DWPA 2A6DB 1N5YL 1OD9A 5AW6B 1EVUA 4J6RH 3K6SA 3ZZLA 1ADQH 1S7SB 1AFVL 1U4EA 4ODXA 3OKLB 2J72A 3ECBB 3SDYH 3FBKA 5C2BH 3L4YA 3WOVA 3G6DL 3Q6GL 4GXUN 4M8VA 4Y4HB 1BQ5A 3G3LA 3OJVC 4XNUH 4A38A 1BVOA 4FCHA 4IBSA 4RWYH 2YKKA 3U1SH 4UDUB 2I07A 1WT5A 4YSOA 4HUVA 1K8IA 1KEGL 1ZRUA 1E9OA 4BE5A 2KZKA 2EH8H 3VAEA 3BP6B 1B6UA 3LKSB 1U58A 2WVVA 4DO5A 1DYZA 4NQDD 4JPIA 4BZ1A 1T2XA 3NP3A 2CO4A 2UXTA 3O8XB 4AE1A 4DP9X 3D52A 4NRZA 4O5LL 1CD1B 4XP6H 5T8IA 1BJMA 3D09A 5DHYA 2WBWB 3HNTL 2JELL 4IOSD 3LMJH 4Y19B 2N7SA 2UVFA 1RIVL 2EE6A 1BAFH 5C86A 3OLEA 2WHVA 5I24A 2CXGA 2VSKB 2GW5A 3MZTA 4UQ2A 4CJ0A 1UYWL 4GRLA 4X4ZA 2QVMA 4MJIA 4PRIA 4KXDA 3KM1A 4KJYB 4HIJB 4O00A 1U91B 5DFWH 2KERA 3VXPA 4AEIL 4BSWA 3ARBA 1OLLA 3P02A 3RWIA 3U7YL 3CN3A 4EI5C 3AQYA 2X6BA 4XBEH 1KPRB 2VJ0A 2R8SL 4W9DC 4QTIL 2J1YA 1TJGH 5I0WA 2OJ1A 4K23H 1HHGB 4GXFA 3NMEA 1S4IA 2JCCA 3S0PA 1MFCH 4XNMA 1KGXA 2KQNA 5EU6D 4P5TC 5MI0C 2ZCKL 3IDGB 4MNHB 1I1CA 3OG4B 1IZJA 3MKKA 4XMWA 3OJDA 2XTLA 4Q74A 1JV5B 2XICA 3OGCA 3H4FA 5E24E 5INCB 2MQ0A 1HAWA 1RZJL 2PCFA 2FVNA 1JF1B 3V4UH 4I9XA 4LLVA 4W9HC 1TJHH 5IT2H 2XQ0A 3RL1A 2MIZA 1AXSA 1TQWA 1YC8A 2GJPA 2PKDA 3EGDB 5CEZL 4Z77B 4XGZB 3HLAB 2W9EL 3RWEB 4JHWH 5C0EB 1HHGA 4LNVA 3BAIA 2IGFH 1DBAL 4ONFH 3HG1A 1ZV9A 1TZGL 2PW1A 3C75A 1Q9WA 3K7UA 3KYOA 1ZE3H 3OF6D 1IC5H 3JUYA 5AOKA 4WI8A 1LXMA 5TDPB 3UPRA 1EJOH 4DQOH 2DH2A 1A2YB 1HHIB 1TYEB 3ZHFA 5DSCA 4KUZL 5FO9B 5DJ8A 1KCUL 1BZ9A 2WLNA 5C6TL 1RMFL 2BFVH 5FAAA 4R90L 3IJEA 4JUTA 3NQKA 1CT8B 1W8EA 5CLZA 5SX4I 3FFCA 1B4LA 1HXYA 3H6JA 5CD3A 3FSVA 3HHSB 3MRCA 1YN7B 5EN3A 3VDBA 5FECA 4DN3H 3OWEA 4GG6A 5KYUA 3WEOA 3U6RB 1HL8A 1G9NH 5IQ7L 3BI9X 1QABA 2CE6A 4XN4A 1S7RB 3X13B 1GHFH 1EANA 3VCLA 3TL5A 3ZDYB 5DC2A 5EUOE 4H8HA 2RCSH 4HAFA 4OGAC 5CFHA 5HYQB 2JIXD 5GS1C 2X4TB 1V3MA 1U8KA 5C0JA 1D5IH 3MJ8B 2DIEA 2X4QB 1R33A 3NEXA 1KGJA 2NXYC 4Y16A 4S1RH 4XO9A 1I4FB 2QT6A 2X1OA 4G3YL 1ZLWK 3JWNH 3O2DL 1IBFA 1PLBA 3ZE1B 1E8YA 1SJXA 2DQIL 4CVXA 5C0AA 5KSAC 2HCZX 2VABA 1AGFB 3GGWA 3PIQB 5BZWA 4IRZA 4QAMB 5GISH 4WW2B 1JGLH 2G9KA 3LPFA 1B0GA 3K2IA 2HKFH 3VFOA 1DZBA 1VB9A 5SX5H 4F15C 1XBRA 4ATTA 2BVYA 2X53A 1VCAA 1OAQL 5F88A 2VNCA 2PXYA 3OJDB 1WBZB 3ZO9A 4PY7B 5AB9A 1FJ1B 3WO4B 5ERWA 3BH9A 4EOWH 1NOAA 4K5OA 4TRPL 1G1CA 4KHTL 3HI1B 2PWGA 3WE6B 4I13B 4KK6D 1SEQL 3QFJD 3L45A 3VU2A 4BINA 4FEIA 4FHKA 4DEPB 2ZCLH 3NIDE 1CGXA 4WV1A 2MPAH 2J8UF 1NGWB 3M6DA 1P1ZB 3CSYA 4LRIC 4UIMB 2ATPB 2LHAA 3D1MC 5HHXL 3HZKB 1SXAA 4OJFL 1QRNE 4LSVL 4HDIA 5D5ME 2V2WB 4JRXA 2A0LC 2G5BB 2IANA 2BPBA 4Y2LA 5T3ZD 4U1SB 2FWOB 2IO5A 3MBEA 4S2SA 3MCKB 2CXKA 1A7PL 2IDUA 5AVSB 2X05A 1X5HA 2W07B 3CXFA 1L0QA 2MTPA 2DYSB 5EIQA 2BRRH 3P30H 5FO9A 2Z7YA 4Y5XB 3V9CA 4N9OB 3OZ9H 2ERJB 1R3JA 4KVNL 3AGVA 4XT1C 3VRIB 4IBQA 1X5GA 1UM5H 1E8WA 4P07A 3RFZB 4ZO7A 4D0DB 3DUSA 4GIOA 2PYEB 4UF7C 4UTBA 5J11B 5ISZD 3B5TA 4P2RB 3VDCA 4YHIB 5E7BA 3V7AE 4DCQB 1RY7B 3FT2B 1AZUA 1J7VR 3HRZA 1EBPA 4OBSA 3IFLL 3WKML 5HGHB 2H0EA 2EIBA 1WV7T 5IVXF 5HHQB 3LRMA 4H2AA 5E0QA 5LBVA 3WNLA 1LEIB 1ZT4A 1U3HC 1CJYA 4PJHB 4ESKA 5ICXB 4BEIA 1ZVYA 2OTWA 43C9B 5SWSA 5IQMA 1OGAE 5LXVA 2X6MA 1RZJC 2Q7YB 1JOIA 4F92B 4UYQA 3AU1A 4Y1SA 2KLSA 3QJHA 4HJEA 2D03H 2QDWA 1DLFH 1J05A 3CN1A 2R2EA 2ISDA 3RFZA 3CNKA 3DYPA 3MLWL 1FYTD 4XPGL 1O5DT 4ZYKA 4GRWE 4X6DE 2HMID 2Q6WB 3EDJA 4MXVE 3RVXD 4LHUA 1A66A 1CTOA 4FFZH 1IFGA 4QJ4B 4IKIA 1R6VA 4P5TA 3ZK0A 2DYPB 3NDZE 2IALB 2R0LH 3RE0A 3BPCA 1H5BB 3WS3B 2ZG2A 4YLCA 1KB5L 4FZEL 1VA9A 4K2UL 4CDGC 2WWMD 3QIWA 2OR7A 3NIFB 3MV11 5IB3A 2K8MA 3K81A 4W6WB 4AH2B 4WHTA 2WNWA 2WP3T 5LDSA 4L05A 3QDAA 3V6OC 1ZPLA 2QDVA 3HC0B 4OQTL 4X5QA 3FQ1A 3WJJA 3TBTB 5IMMB 1ZLUH 5FUCE 5HGBB 4HETA 1Z9MA 3MN8A 4KDWA 1TR7A 2F19L 4PJHF 1G0DA 3AS3A 1ERNA 4P59L 5E5RB 3TA3C 2Z3FA 4MJIE 1XWVA 1EDQA 3KWUA 3IMBA 1HWWA 4EUPG 1GKEA 3D9AL 3RVVD 2SEBA 5IFJB 3HJEA 4KKLC 1SZNA 4OZGF 1FNEA 4DT2A 2G5BA 2XN0A 2DQDL 3VWJA 4YWGL 4ZTOL 1SVBA 5K59F 3T1FA 4BWUA 4Y2DC 2GK0A 5FYKD 3FFCD 4EAEA 4UBDC 5JOFA 1NIAA 4LT7A 5CJXA 3HB3D 5TE4L 1KC5H 1QQDA 3H42L 3U46B 3MRRA 4IU3A 3FQYA 4OIIH 1ZK9A 4WU7B 4BDVB 1DL7H 1MDTA 3HTLX 1Y0LA 2PYEA 1PKQB 3ESUF 1UWEL 2V3FA 2YKLH 4Z7VF 5D7JB 5D8JL 3H8NA 4DEUA 2R56H 2IAMB 4YO0A 3BCDA 3QPXH 3EGSB 2I24N 1G9NC 1MF2H 2I60H 7FABH 2XWJB 4ZTPL 2V37A 2O5ZH 1BZDA 2HJLA 3TWCL 2XNAB 4QHMA 2XTJE 3WFBH 1ZHBA 3CN4A 2WNKA 2LU5A 4X4KA 1MWAA 2H8PA 5JORB 4WW2C 3AXIA 3X1EA 1MHCB 3C08L 1DANU 2DKSA 1INEL 3CPUA 2UX7A 3VFUB 4XPAL 1G9NL 4HMEA 1WZ1H 2JKXA 3LB6D 5FDYA 4RZCA 4WSKA 4X9BA 4YSCA 5DHEA 3S34L 2IWKA 3FF7A 1ZK5A 4BKTC 4G6KL 3TX4A 5IKCB 4HUXA 1AANA 4U3CA 3WAKA 5IBTH 1M7DA 4CDHA 4GG8A 3T6QC 3VXUE 1REIA 3MBWA 2CR0A 3QJUB 3OX8A 4CMHC 3S3PA 5SWZB 2NXYB 1ZLDA 1G6RB 4KNTA 4QF1A 3FHEA 3UIZA 3TN0B 3MFFA 5J57B 2F19H 3IGFA 3THML 3P4OA 3E3QE 1CFTA 4ONFL 3ROLB 2JB5H 3I85A 2CDEA 1P2CB 1F4HA 1IBDA 5H4YA 2OPCA 3T6VA 5ABDE 5C3TA 1NBYB 2DMKA 1RUKH 4LPYA 4XWGH 5B4MC 2YA0A 1S9XB 4JO4L 3GDCA 4QNPE 2Z35B 4IRSB 2RR3A 4YPGB 2VN5A 3BHBA 2E27L 1Z0NA 1I7UA 5DVMA 3HBPA 1JF5A 4U1IB 4MAYD 3QRLA 4XMKH 3UGEA 3WLWC 1S7QA 2V8MA 3BMWA 3AY4C 4K71B 3R0MA 3KZ8A 3QCVH 2EXWD 3TEWA 1CDGA 1RZKL 2GBAA 3HAEA 4U7MA 4R0LA 1L5GA 3T4YA 5GJSH 2OMTB 2EE9A 2QMJA 4K4KA 1TG8A 2FECI 3SOBL 3ZU8A 4RGMB 5D1XD 1A6ZB 1BQHB 3HNSH 5J6HA 4OI8A 1UXSB 2YUZA 4OQ1A 3RYMA 3VXMB 4DVRH 2Z35A 2XWCA 4XPHL 4FL4C 2WANA 2GIXA 1ZWIA 1YEHH 2ESVE 5I71C 5HHMB 2H41A 2CBPA 5F9DC 3GC3A 3T8VA 4BUGA 3L9EA 4MFHA 3UH8A 1UGNA 4ANUA 5KZCB 4WV1C 2H6UA 1TQVA 2JKIS 4Y1AD 4C4KO 4JM4H 5HY9A 1INDL 1VGEH 3L9RA 2BRRL 5IV2A 1C16B 4G7RB 5BZZA 2Y07H 5DZPA 2FYVA 3CFNA 4OY9A 5GGTL 2WXKA 4HKJA 2YPVH 3EBAA 2PO6D 1MJJA 4N2AA 2XG4B 4FJYA 2EINB 3S8GB 1BSIA 2A6KB 5LAXB 4PJEB 1M7DB 2JE8A 5FYKL 1C9SA 1F6AA 3TBWA 1JGVH 5F6HI 1MCLA 3WMSA 4WCYH 3SE9L 4I7ZC 5SWZA 4YPJA 2OR8A 2F53A 1UUSA 3BE1H 3A6BL 3KPOB 4P23A 3MLPA 4A7GA 1ETA1 4R96A 2QTEA 3VXMD 3M7OA 5JZ7D 3STLA 3K6SB 1F4YL 1UD2A 5BZXA 1P7QB 2RJMA 3GDBA 5EA0L 5JHDB 2W65A 3A0OA 2XWBB 3MUJA 4F2ME 4Z1PA 4F37F 5IFAL 2VITB 1CFNB 4J6RL 5DUMH 5J5EA 5JPNB 1RZFH 4G80B 1A0QL 3FQNB 1Z9SA 3VYNA 1DVZA 1DVFD 5IUSA 3TFKC 4ZMWA 2GKIA 1Q0YL 4M8QA 3ARGA 3BQUD 2GI7A 4JFUA 2G2RB 3JWDL 2ESVD 2F53B 4ORGA 4AQEA 3BT2L 4FXGC 3VTTA 1ACYL 5EPMA 4JFHE 4C83B 3MAWA 3HC2A 2ZOLA 1PU0A 5ENWA 3NIGE 3UADA 3T0VA 1U8MA 4KRPD 4JCWA 2EZ0D 4MYWB 1Q9WB 1SY6A 3KYOB 2QQNL 3P3TA 1QLFA 2NY4C 5CS7A 5HHNA 3ZDZB 6FABL 1U2YA 2GCYA 4KRMB 5I0DA 1N6UA 2ZYRA 1IQWL 3ARFD 8FABB 2YAHA 3KPSD 1BYNA 4MDIA 3QPQD 1AQ8A 3HI5L 3GSNA 4OKVA 2F0CA 1DBKL 4PJ5E 1GXEA 2YD7A 2ZD0A 4N0UA 1KENL 3IVKA 2PLTA 5GHWL 2VR7A 2XVLA 3HZMB 4XP5H 3HFML 4HQQH 2J5WA 2VERA 1KSRA 2JKWA 2QR0A 3FTSA 3IN2A 4FEMA 2AVFA 3DJZA 1W72L 5IV2B 1RKRA 3BSZH 1LNUA 3MODL 3P4MB 4QRPE 4UIKL 5T1LB 2EDYA 2ICWJ 2CSPA 4HLZG 2J1KA 2E86A 4KU1A 1KNOA 1ILSA 4AYFB 1I9RL 3TTSA 2DS4A 4OCYL 4PIBA 3DHJA 4HH9B 3UTQB 4NQEA 2W9EH 1CE6B 2QSCL 3DX8B 3ZRFC 3RLSA 5L6YH 1QSED 1HIML 2VW4A 1MFBL 4ZW5A 2FX7H 1K6QL 4UV4H 5FM5O 3EH4B 2AV1A 4F8OA 3MLSL 4DGVH 2Y06L 4PCKA 4GBXA 1IMHC 4K3DH 3MRHA 4LL9A 3V0EA 2VLJA 2XFXA 1D5ZB 3WIFA 5MERA 1MIML 4TV3A 5DD0H 3ZKXC 2Z92A 4ZMLA 1A6VH 3W11C 3MR9A 4WHDA 1N7MH 4JM2D 4AQZA 2XWZA 1DQJA 2CDGA 3OR6A 1VPOH 1C8QA 4HFUL 1RXLA 3OAZK 4ERSH 4OLZH 5LLIC 4X7DC 5GS0C 3ZDYE 5HDBB 3ARDA 5DJ0B 5B39B 4TMPA 3OKLA 4LARL 4XOBA 5AZ2H 5DZLA 5I75C 4JY5L 4IGBB 1DSFL 4ZDHA 3TLRA 3NFNA 1QBBA 2C9AA 4UCFA 2KL6A 5L2KE 4MDIB 1RLBA 4M5YL 1KGCE 4R6UA 5H37G 5CFAA 4AYEC 3D8MA 3EJUA 3CZJA 3II1A 4JFDA 5I74C 1B0IA 2NNFA 3LPGA 4EN3A 3MNWB 1HFUA 3R06A 4YFDB 3MLVL 5A1AA 5KN5A 1CMOA 5F97E 2UXFA 5GIRA 2O6PA 1SXNA 3FUEA 3GM8A 4JFPB 4OD1H 3ETTA 5T5FL 3HI6H 4JJOA 4J2QA 5CP7B 3JTSA 1RUPH 3TBSA 3WFDL 5TE4H 1JGLL 4F7MB 25C8L 2B14A 4KQ0A 1KIRA 2RALA 3TH3T 4Z3JA 2K3TA 4XNUL 4QYAA 2DWXA 3FAXA 4IMLB 2YWYA 4J3XA 5D72H 5C0BB 2ZXAA 5F7LB 4C55A 3DRTB 3V7AG 3DV4A 3R06B 4ODHH 3EXJA 1PJ9A 3F64A 1XSOA 1GSMA 4WV1B 4KTEH 3NJJA 3R19A 4Y4HC 5HHOE 3OKMB 5EZIL 3TV3L 1EO7A 4PBXA 3NZ8A 2Y3NA 1PS3A 3HC3L 2C9XA 1TIUA 2IOOA 43CAA 4QJ5B 1X44A 3EOTH 5CEZD 2X2HA 2APVA 4LE8A 1OGTB 4NDMA 5KVFH 4H8QA 4NM4L 4BA0A 4MCZB 5DO2D 1N8ZB 3AB0B 1O6SA 2N7AA 3MRHB 4B0MM 1UVQA 2GJJA 4JMXA 5DFVD 1MN4A 3LCYA 3RVTC 1U6AH 4FNTA 3S48A 3BFOA 1XH2A 2CLVB 5D5MF 2R23B 3EIFA 1UOWA 5LG6A 2RAMA 2OMBA 1TZOA 4HBCL 3FH5A 3ZZSA 1DQJB 4I1NB 1D9KC 2WWKO 4KQ4H 2CIIB 4A7TA 1MZZA 2GC4C 5F89B 3HLAA 5FA4A 2BCMA 3UP1A 5E99H 3AG1B 3NGBC 2X7LA 3MRLB 4S1DC 1CDUA 1J9QA 5E6UB 1Y18A 3QIWD 3SKOB 5HGHA 1BPVA 2IGFL 2EC8A 4I0PD 1SMDA 3L81A 3BVTA 3S2AA 2WINB 5JHLL 1HH6A 4XCCL 2BWIA 3P0YH 3GMPB 4QRFA 4GRWB 3GBLA 4HMDA 3WKMH 5IW1A 5C0AE 4N26A 3RTQC 4Z9KB 3UTSD 4FMVA 5HHOA 5TJWK 3X3FH 3DSNA 3UG3A 1MEXL 2NR6D 3IMWA 3BEWB 2R39A 5IROA 2ZUXA 5HHVH 1O5PA 1NIBA 3RWCA 4UWQB 5IWLA 2H2SD 1UCBL 3CFCL 4RIRA 1MCFA 3U2JA 2ZXGA 4KJQD 1K4DB 1IGTB 2UWEF 2AC0A 1CDHA 3C6SB 1MCHA 2QGBA 3N41F 4CSSA 1UH2A 4POYA 5D7EA 2FIKA 4MXWL 4GMSL 1H5BA 4LSDA 3WS3A 4TQHA 3VW3H 1JGVL 2NW3A 1RZIA 4F58L 2GVYA 1GTFA 3SKMB 5EF1A 1E43A 2NSMA 4ZJ9A 3I2CH 2PCFB 3UABA 3B2PA 2EIEA 4Y16B 4BWTA 5A2CA 1MCRA 2UZXB 5C0RH 5IR1B 2BS8A 2Y24A 4M3HA 4W9GC 4DP2X 1CBJA 1JAEA 1R4XA 5EBWB 3N1MC 1AGEA 5GRJH 4BQBA 4P5SA 1GPOH 5C8JB 1KT2A 3U4BL 1MF2L 1P6FA 2I60L 1EO8L 3TC9A 4YDKH 7FABL 4KHTH 3KLKA 5BZWB 3QDJA 4NWUL 4MX7A 1MI5B 1OD7A 3GM0A 1UWXK 1JZ4A 5L8KB 1VESA 2EILB 1KYAA 1ADWA 3JSSA 3S8FB 4Y19D 1AGCB 5LNDA 3ATDA 3UTSE 1BIIB 3MNZB 4J8QA 1O0VA 2DDQH 4UQCA 5D9SB 5A2LH 3WE6A 1GH7A 3NSYA 5KW9H 2FR4B 1W2KT 1AQKL 1A0QH 1YEIL 2CH8A 2YXVA 3TO4D 5DT1H 1YO4A 4ZUTA 2D7NA 3O2DH 2QQLH 3U1SL 2ZOWA 1HHJB 4ZAKB 1HINL 4AGOA 5B1BB 2C9SA 3EOYG 5C0ND 4JDVB 3KPRD 3IRPX 2G4EA 1QO3A 3N43B 4GAJL 4N5ED 5I23A 2XIBA 3S37H 2F5AH 2FWOA 2JCCE 3VWKC 5AENA 4PJ8A 4QCIB 5D1ZI 1DQVA 5HI3C 1S7TA 3W9DA 4JLRA 3IETB 4WI0A 1BIIA 3MNZA 1N0XH 3FDWA 3KGTA 5F6IB 3ZTEA 2OMZA 3K6DA 4UQAA 3K6NA 5EC1A 5KJ7E 2QGDA 4G1MB 5L9DH 1XR8A 3NCMA 4KI5E 4UT6A 5KVEH 4RMTA 3CHRA 3WKQA 1KIPB 2VC2H 3PFUA 4NQUA 5EMYA 4AY0A 3DXAB 4A7GF 4RIRB 2A9AA 3HG1E 5T5NF 4JE0A 2C4FU 5EU7E 4PRNA 5HVFB 1UXLA 2FHCA 2HT3C 3BT0A 1JFQH 5EU7C 3QPQC 4JHUA 4ZFGH 4KNUA 1EMTL 1ZPUA 5CZVH 4I0PB 1NCIA 4UTAH 5DJAA 3E3QC 2DLFL 4BCZA 2Y36H 1XHHA 2DRUA 4LESA 2MOGA 4KI5C 3X1BA 3S3DB 2IOMA 3WFCH 2AV7A 3MXWL 4XHQA 4JFQA 1ET7A 2AITA 4HS3B 4U6XB 4PV9A 1H19A 4HLZH 1CZ8H 1M7IB 1BP3B 3V2AR 1K4CB 4IBUA 1TJHL 3K1DA 2MRYA 1NSNL 3VXQB 1CXEA 4FNQA 4HV8A 3WIHH 3DIDA 4U6HA 1ZANH 4OZHB 3ZSSA 3HVDA 3VI4E 3TU6A 5JW4R 4B53A 3TFKD 2BSRB 5BVPL 3PE9A 4A55A 4AM0B 4YDJB 4JO3L 1OP3H 5HI4C 3KPOA 1E8ZA 4M7LH 1EXHA 5E6RB 2NZ1A 1TO5A 4AMKH 1FO0H 4P2QA 4CJ1A 3FOMA 1CTMA 4WSJA 4WUUA 3IT8D 1RFDL 4PS3A 5FGBA 1F8TL 4KK5D 5GZND 4Z8FL 3ZQXA 3I02B 2AV7B 2FEJA 1P69B 2RQEA 2ZSWB 2XTJC 2DWDB 4WQOA 4TULH 1I7RA 1N64L 4XCFH 3CDYA 4PJXB 4WFGD 2LU4A 3BIAX 4E9YA 4WFHD 4NSKA 3EBGA 4DP5X 4FQIH 4GS7C 4OCSH 3VXOB 5HYSG 1FL3B 3CQFA 3O6KL 1E27A 1G7MA 2F7QA 4OZHA 1EFXB 1AZVA 1K2DB 2PW2A 3L2MA 4BFGA 4ZW3A 1R1CA 2ESVB 2F53D 3ZYJA 5I2IA 1XF3B 2GY5A 1KJVA 5DEFA 3VXSA 4U1NB 3SGDH 3QIUA 5JPNC 3MLZH 4JO1L 2HJFA 3QEUA 4FG6D 2RIKA 3OB0H 3NFSH 2HUHA 3HUJB 5JQ6L 3N1PC 3ZTJH 4OAWA 3MUZ1 3K4ZA 4TVPE 3VI3F 2NY2D 5FC9A 3VQLA 2FJGA 5DRWA 1S3KH 2XZCH 1SGKA 2XUWA 1Y6MR 2J20A 3BW9B 3DO4A 4U1MB 1OCZB 4DHLA 4KOCA 1HZHL 3LEVH 1NM9A 2CRIA 3MOAH 4JG0L 3ZL4L 2XQYA 4NO3B 2OJZL 3A3YB 4ZS7L 3C60D 3IF1B 3SPGA 3U0WH 3BH8A 1KBPA 5PCYA 4OBRA 1EAPA 3D06A 3F5WA 4N0UE 4ZTPH 3QH3B 1QEWB 3HBZA 4PGBA 4RA0C 4WWKA 3IDYC 3MTRA 3SE8H 2APBA 3U9PL 1UJ3A 3SGDI 3HIZA 1JL8A 3OZLA 4WFGE 4X6EB 2HLFD 4N2BA 2H1PH 1YYML 1LNUB 1A6TB 2E8YA 3QJTB 4A37A 3KPPB 3WJMB 3FSOA 2CA4A 4HJJH 3PY9A 2SEBB 4W93A 4FADA 1TKWB 3DTXB 2CR6A 2VRKA 3ZDXB 4R2GB 1UTDA 4LP5A 3V5HB 1LEKB 3D69A 3EYQD 3HZYA 4G6ML 5GZOC 2J1ZA 4C83A 3BUYA 3ULUF 3LV3B 4YDLB 1M6UA 5A43C 1A5FH 1A6WL 1NIEA 2JTYA 3AXHA 4NQXB 1MLCA 2AQPA 4PLKC 4HQQL 1HQRA 1X3DA 1IAKA 4HHAB 4NSKB 3KM2A 4IJTA 4Y1TA 1FYTB 1CL7L 1NCCH 4OB5L 5DTFB 1T83C 4AG4L 4ZNEA 3AUWB 4Y4FB 1FHGA 5E99L 3ERXA 4XMXA 3X12B 1KN4L 3GNML 5MEQA 3LIUA 3O3DA 1OGPA 4FOMA 1W6LA 2L04A 2CKNA 2NY1D 3J2PA 1DBBH 3W0WB 1FFNB 3SCMA 2K9UA 2XNAA 3NABH 4X7TA 3QUGA 1KCVH 1LP9B 1ODUA 3BAEH 4DZ8A 4AXWB 2DWTA 2QELA 1DSFH 1OSZA 3BKML 4HHGA 4KXAA 2BIPA 2KS0A 4QHPA 3IN0A 2CHXA 4H4NA 3W3BA 4WI9A 2CBQA 4HCRL 1J86A 3S5YA 5D7KD 1EEQA 4HVBA 2HRLA 4R83A 3MYZA 1L9SA 1SEQH 4RZCB 5EOQH 4U49A 3PL6A 5D70H 1XGTA 3S97C 5IKCA 3ALWA 4OFKA 2BS71 1FA4A 1T80A 5I75B 2D0HA 2HKFL 1GTNA 35C8H 1LLAA 3KHQA 3O3UN 2OR9L 1QNZL 4OJDH 1MQKL 3VXRE 5INDB 4F57H 3JTSB 4KBPA 2M83A 2P46B 3TH4T 5E9AA 3T0EC 1AD0A 2JSFA 1RK0B 3K5SA 4HJIA 2CLZB 4M61A 4WJ5B 3TBVB 2W94A 4LVOC 1JNNL 1KBKA 3GJFB 4PJ5B 3GMLB 5EDSA 3CSTA 4E41B 4G5ZL 3CJJA 1J0ZA 4LVNC 3P54A 2GJZB 1AOHA 5E4IA 3PJSB 3FU7B 4P8QA 1H15A 3TASA 2XI9A 3C09C 4WW2F 5EH1A 3BD3A 2D0GA 3D2UA 4Y9CA 1WWCA 4CC1A 1R46A 4E9QA 3FTGB 3E1ZA 4HWBH 3MGAA 1QG3A 3ZE1F 5C3IA 2YPVA 3MNVB 2OX5B 2NY0C 2YUVA 3AMKA 4FQLL 1WFJA 4MLIA 3WTSA 3L3OB 4H5SA 4ZXBA 5F88B 4ELKB 5MEOB 2HUEA 1HQRB 4W9LC 1T0PB 4A6YA 2ZSVA 1BLNB 3MSPA 2WUCH 3CFDB 5I18H 4M8RA 4L1TA 3LRHA 4PRDA 3LRLA 5I1EL 2F68X 3IJEB 3PJSA 3S3JA 3ORJA 1L9QA 2F15A 1BHGA 3A47A 2PETA 2AEOA 1I3VA 5GGVH 1H6TA 3EO0B 4F20A 4PI2A 3RGVA 1RU9H 1KXVC 2PTVA 1A1NB 2AK1H 1RVFH 3I84A 4HT1L 3HNVL 5GS2H 4PSRA 1ED3B 1TXKA 2VDRL 3AG3B 3QORD 1ANUA 1OW0A 4A2FA 3QUKB 3Q5TA 4IBLT 4QPEA 3U9UB 1MCCA 3ABZA 4FABL 1HYRC 1SBSH 4F7PA 3EG9A 4FA6A 3C8DA 4F5CE 1C5DB 3FW6A 5J3HC 1D5IL 4OJEH 3PV6A 4AIZB 3ZDXF 4X5XA 1NEZA 2WQUA 2Z4QA 1CN4A 4DOHE 3ES6B 3SDXA 4DP1X 4N2NA 5DJ6B 5CINH 1P5UB 1WF5A 2VM4A 2HFFB 1AIZA 5T3XD 3QDME 1U8JA 2VR4A 3H3PH 4YC2B 4XNBA 1JPTH 1NCNA 4FNSA 3LQAL 5FWRA 5I6PA 3QZNA 5D1XA 1YN6B 2Y7NA 5TQ2H 1AR1B 3T2NH 3KJ4C 4JJHA 1MFMA 1FGVL 3D5OF 3SKMA 1LQBC 1S5IH 1IKOP 1RJZB 3ZMNA 1EXUB 5D1QE 1UZ8A 2Q3XA 4RETB 3WXWL 1FDLL 2VMJA 4NQCA 5JXEA 1FVCA 1F3DJ 3Q3GA 1F45A 4GAGL 5GS2D 3SE3C 1IFHH 4W81A 1RIVH 3T6ZA 1CUOA 1CU4L 5H37H 5HI3D 4HWBL 3TBCA 5FUOL 3UIYA 3L7EA 1A3RH 1F6LL 3AU0A 4JE4B 1NGQH 1P4LA 3P9LA 4PRBA 3S5LG 4P5MA 2NCMA 4LVEA 4MNQD 4U1GC 1HU8A 4ZZKA 3N9GL 2JK5B 2BNUA 1GZPA 4TM9A 2FX8L 3DMMA 3V95A 3P73B 4LSUH 4F5CA 2ZYHA 1U95A 5MERB 3CN2A 2WLLB 4X9YA 3WFEH 1LD9B 4LRNL 4PB0H 4RDQG 1UM4H 1JNNH 1WH0A 5AAWC 1JI2A 2JQZA 2YAQA 3Q9QA 1NM4A 3NCEB 2UY7A 2B9BA 5CJXC 1JHLH 3T2NL 1A3QA 1NAMB 1TTFA 2Q76A 4BK8A 5IQ9B 3STZA 2XWXA 2YLHA 4OD2B 1J1OH 1Q9LB 3IS1X 4WK2B 3ETBF 3MLYH 1TVDA 1K4DA 3ME0A 3FCGA 4GMSH 2IXQB 4JVPA 3P73A 1AVAA 1RHHA 3QZWG 5F9JB 2GJ6B 2VYRE 1IQDB 1OOWA 2YAMA 4Y4FC 3WTVA 1XIWA 3EUDA 4RGMC 1MIMH 1T4KA 4FTDA 3T4AA 4P4KD 4EZKA 4Z7NF 1KBWA 1TZAA 2EDNA 1U8LA 2WAHA 1ET8A 1FGNL 3EO9H 3I9GL 5I73C 4E42A 3F12A 4JM2C 2AEQH 2QMKA 3TIEB 3RVWC 3ZKNC 4C57C 1LEGB 1OGSA 2N01B 1NAKH 3CHXA 3E7JA 3ILEA 4PJCA 1XGYL 2VGLM 5DGRA 5E6YA 2LU7A 1QFWL 2FD6L 3MHZA 1RP9A 3U6RA 1KN4H 3PQYE 2DYPA 4CC4C 1BF8A 1JGEA 4EMZA 4X80H 3L1OL 1F13A 2H0JA 3W2DL 4DVBB 1OAYL 2K6WA 2Y36L 3U1PA 2HN7A 5T1DL 4J6IA 5AW9B 4GW1A 3A4FA 3F7RA 4LOEA 3DBXB 3JWNG 1LO5B 3N42B 4FI8A 3UC0L 1OTSC 1MCIA 4V1DE 4UQDA 3DO7A 1G7PB 3BZEB 4FQQA 3HA0A 3CSFA 1NCTA 1U3ZA 4JJ5B 4XP9H 4EBQL 2VDOL 5CEZH 1B2WH 1V05A 2HTLC 2P7TA 1ZGLB 2XQYK 1NMBH 1JRHL 2B1OA 2WZPA 2XY2A 4IBTA 3QZWA 4G8GA 3VQ2C 3V6ZA 3TEYA 5AKVA 3WO3B 1BJ1H 1QO3B 2UY6B 2ZPKL 3HRZB 2CJSA 1UXMA 3HI5H 4XN5A 1DFBH 1MNUH 3TO2B 3P3UA 2R59A 1KPUB 4NUPA 5I5IA 3UPRB 1IGFL 4KNQA 1PLGH 3FUNA 3QWRA 2V5TA 2FE0A 1E28B 2YXFA 5IEKA 4NO2A 3NQIA 4TPRH 1Z32X 4HEPG 5G4NA 4YC2C 4XAWH 2EDQA 1KYUA 5DZOA 3AITA 1P4UA 1P53A 3AREB 4FQXB 4POZD 4X8CA 3DXAE 5DFVC 5HYEA 2EXWC 2YQGA 4Y9EA 4FXKA 5KSBF 3FRPG 4WO4C 1T7VA 3BZFA 4Z76A 2WZ0A 3MRQA 2VDKH 3V6ZB 4BSVA 1U8PA 1W8NA 3SJVA 4KKZA 5I6KA 4NFBA 3SPHA 4OFQA 2LABA 3CBKB 2XA3A 4UTCA 3KW8A 5JTWA 3NJKA 6FABH 5L4MA 3UTSB 5F70A 5T1KB 1KIQA 4AIEA 4TYUA 5FFLA 5E5UB 2JJTC 3SQRA 2YWZA 2FEEI 3LS5H 5AVUB 1AGDA 1U8HB 2E7DA 2JELH 5AOLA 5DJAB 4YZWA 3O6ML 1ACYH 3DHMA 5L4IA 5IJVA 2YD2A 1AQDB 2J5LB 3BP5A 1ND0A 4U1HB 3KJ4B 3KL3A 2OMVA 1R3IH 3VFTB 2J1XA 5DRWB 1ZSDA 5BVJB 5ISZB 1JK9A 4BSVB 5CSBA 3WYRA 4M1DL 2PTTB 5IIEA 4G8EB 3GS4A 3RVVC 3MV8E 2K4WA 2BDNH 3H9HA 4KK9D 2A6IB 1KEGH 3L4XA 4F3FA 4YHYB 4U0RB 1Z5LA 3BAEL 3BIBX 5B8CC 1X4ZA 5EOTB 3UEQA 2VIRB 3BH8B 2P45B 5CUSL 4XMVA 2CO6A 1ZA6B 3U7WL 3FZUD 4TRPH 2IH3B 1QASA 2Z34A 4WI2A 5IJVB 1C7TA 1AH1A 4LEEA 1BBDL 3NJNA 5CXPA 1FIEA 1OF2A 4LCWD 2F5BH 4QXUL 4G72B 2BY1A 2G75A 1ZSDB 3AQXA 5F7UA 5KSAA 3I75A 4UU9A 2ORBL 1U8NB 5EU6B 4NERA 3BLBA 4OFYD 3WJLA 2DLEA 2ITDB 4Q6YA 4F3FB 4Y7OC 3TO4B 5ITFB 4O9HL 3CVHA 2K6ZA 3FCTA 3HZKA 3OKEB 4TNEA 3DMMC 3IKCA 4DVRL 3DI3B 4G8FB 3RIFK 1CD8A 1AOZA 3KXFD 3I3BA 4PEEA 5CR8A 2XXFA 2GT9A 4HISA 4RNRA 1D7FA 4XAWL 1P4IH 4PVNA 1A4JB 1DR9A 1R17A 2YMTA 3RBGA 1J0YA 1I7UB 1BAGA 3U6XA 5IF0B 4C8XA 2AK1L 3M1OA 2W65B 3APNA 3N1GC 4LCIH 1OZUA 4NO0D 2EYRB 3KBFA 5CBEB 3FH8A 4ZNCD 5IJDC 4G80A 4KMLB 1IKNA 2AJSH 1W72A 2RFXA 5CEXA 4G8FA 3QYCA 3OG6B 4OV5A 2OJEA 4IU2B 1AACA 1IFHL 3APCA 4H25B 4EI6B 4HC1A 3GSOB 1U92B 1Z9OA 5H94B 2IBGA 2ZWSA 3INUH 2Z0BA 2CJTA 2PWFA 3CZEA 5EU3B 3CBJB 3FU5A 1KIUA 1Y7VA 4JG0H 3ZL4H 1RH8A 2EADA 3B9VA 3UAFA 5D4QA 3MFFB 4WU7A 3D25A 4FKHA 3DK0A 3KBEA 3SE6A 4AEFA 3UPAA 5E1IA 2C9UA 3OLGA 2CNZA 2DJMA 5HHME 2Y2YA 2DLTA 5CLWA 1I3UA 4BRJA 4DP7X 2NQ3A 3COOA 1HH9A 4GAFB 3DX9A 2GITB 1Z5LB 1X7TA 2DM2A 4PS4L 3LZFL 3L5IA 1G7IA 4A2LA 3ZL1A 2ENSA 2D31B 2QL1A 4P5KA 5KSBE 1NFDB 2AEQL 4G6MH 5D96B 5D72L 1PVHA 3CHOA 4I5BB 5AAPA 4FABH 1AHKA 5ITBH 3ZO0A 3H6AA 3L3DB 2AHIA 1X7QB 1CIDA 1XD1A 1FG9C 1IGYB 2PYEE 3IDJA 3K6OA 3ZE2E 2BOBA 5D9SA 3GMRB 3W81A 2I7OA 1Z5HA 3RVUD 4RESB 4NQED 1FYTE 4W9FC 4MQXC 4WNJA 1J48A 3UOAB 5AB2A 1QPPA 4I4WB 3TNNA 1VZHA 3ZR5A 5LBSL 1K5NA 2C3WA 5AEAA 4CKQA 2HAZA 3F05A 3MLYL 4QTIH 3FB5A 4LEOB 2FX9H 2P8LB 4AT6B 1JHTB 2YQ3A 3LQAC 3IDIB 1G6RH 1LK3H 4HH9A 3GQFA 4NQVA 5ANMA 1KBVA 2COQA 1CTNA 2R56L 2XV0A 4L3AA 4MQXD 4AQ1B 2ZAHA 1TZIB 1YHPA 1OTUC 1JXJA 2Z91A 3W39B 2P8PA 2TSAA 5E8NA 1IV8A 1CE1H 1D9KD 3SQBB 4XMTA 3V9FA 4ONHA 4KX7A 4UUJA 5G4OA 4JAMA 4OIIL 1XGQB 2CO7A 1DBJH 1E5BA 1L4IA 2D3VA 4PY8J 2FSDA 1CZ8L 1YQVL 3APFA 4PH8A 5GGSY 1JGDA 1GIGL 4W9CC 2VXQH 4WHCA 1JK8B 3CFKA 2ZKHL 3QK0A 1JG9A 3VXOA 1TZHB 3CQQA 3P69A 4GFXA 3F7PC 2N3JA 3UROR 1P9MC 3WAJA 3GSNB 5BO1H 1VEMA 3B9KC 4MAZA 1F18A 3B8YA 3B9AA 3BYTA 4KGLA 1OIOA 4HUCA 2FCBA 4DFHA 3D48R 4JFXB 2J8OA 5LB1A 3B9KD 3DJ9A 5HHVL 4KUZH 4TNFA 1SFDA 4MAYB 3MRJB 3OHXC 3VDAA 4LASH 2HG0A 3EFOA 4PJ7A 3P40A 5CEYB 3FQXA 5IHHA 1EJFA 2VT0A 2Y7SA 3HN5A 3LKNA 4R4FL 32C2A 1QNZH 1PDKA 3ISYA 5KYWA 2VITA 1C5DA 1HL5A 2QADB 4ZUUB 2DLHA 3CDGB 5EEVA 2O5YH 4NKDA 3FPXA 3ECUA 5CINL 3DMMD 4L48A 2EAEA 2WVTA 4A66A 2QHLA 3QISA 4U1JA 1F3JB 2IQAB 3CFBA 1YYMH 2BJML 3IGLA 4UOJA 1NINA 4LK4A 1WGVA 4GUOA 2NZ9D 3EJTA 3R4DA 4L37A 3WLBB 5GS0L 3MNVA 3V0GA 4JHAL 4D9LH 1PZSA 5D1XB 4DUWA 4HBCH 4APQA 1JPST 3H9SB 3QCTH 2OSLA 2CHNA 2OZNA 5HTSA 5GGRY 2CDEB 1MZYA 4KKCC 3MRKA 1WCBB 3D2TA 5GHWH 5L88H 1JZDC 1RZ7L 3I6KB 5J1TC 4GKOA 5C6PB 3C2SA 4UMSA 1GYUA 4X9IA 4XPGH 2HMIC 3MXVH 1ID2A 4HAKA 4M4PA 4Y1AB 5C08B 4OZFH 1OE1A 4CBPA 3GBNL 2NY4D 2QADD 3V55A 3WHE0 5I0YA 1NGPH 1MHHA 4RAUA 2APFA 1BGXH 2X2JA 1CYGA 1JBJA 1AMYA 3VXNB 1KDJA 3G5XB 5I0ZA 1UD8A 4FZ8H 5B39A 2F7RA 1KCRL 5AOZA 1A8ZA 1T03L 3L4TA 5E23A 4S1SH 1ED3A 4P3CH 3SDDC 5GZNC 1T0MB 3OZ9L 1IVTA 2FEDD 1W16A 2A4EA 4PCSA 3EF7A 3BVVA 2W60B 4R0LB 1DCLA 4TL4A 5J12C 5JQHC 1KTBA 2QVFB 1WS7A 4H26A 1TQBB 4Q6IA 4TNVF 1KB5B 2BVPA 1XEDA 4NT6B 1D6EB 3U2SB 1D7BA 5JDSA 4P4RB 3MROA 3MV9D 1S9WA 2BVOB 2JVUA 2X89D 3HG4A 3PWLB 2R0ZL 4PJBF 3T71A 5DJXB 2WXLA 2AEPL 3QPKA 5IT2L 3K2KA 2XSKA 3MRCB 4J3VA 2P5EE 4MA8L 2YD8A 2FQEA 1KN2H 3IPFA 1J0HA 1HWGB 5CEZE 2B8OT 3FT4B 2GJ6A 1OAZH 4N0YH 1ACZA 2NT0A 1WG3A 3HKFA 1KTLA 1AMXA 3VXSD 4ONOA 3KPNA 5BS0E 5I8OL 2DI9A 5DU7A 1YLBB 5C0BA 2PPAA 1SJEA 2AI0L 2VXUH 5C0GA 4FXLA 3S88L 1EXUA 1T3FB 1BZEA 3OQ3B 3QYMA 3UBGA 2GY7B 2O30A 1KCRH 4K94H 4PQXA 1XV8A 2VXSL 4PJ9D 4WO4D 5DQDH 5IK3B 5J6SA 3BN3B 4QTHA 3KYNA 1MSPA 3WIIH 3HE7C 3NTCH 4PGEB 5GRZA 5DXWA 1E6OH 1TENA 3QIUC 5INDA 4ZO6A 4PYHA 5DO8A 2YK1L 4Y88A 3CFTA 3MOQA 2OM5A 5SWZD 2HH0L 2H2PD 2VQ1A 1EZSA 4MJ5A 2J2ZA 3UACA 2J56A 3ZTNH 5I8CB 3OJ2C 3ULSA 1H6FA 3QJFA 5ACZB 3C6LA 1ZLSH 2X6CA 1SOQA 4E9VA 4U0QB 4ZQTA 1J9CT 1NANH 4QGTA 2A73A 3HR5B 4XNZB 1RJLB 1U4FA 5FV1L 1IBZA 3ALXA 2QKSA 3ARGB 1J0KA 3RUGE 1E30A 2FGWH 3P77B 4NC1C 1YUKB 2R2HB 5CJQL 5GPRA 4HKBB 2HB0A 2V4LA 1A3LL 2B7DT 5ALCH 5JYMA 3CFIC 4Y4KD 4RBPH 4X7TB 4K3GA 5FB8B 1WBYB 4MX7B 2KPNA 1HL4A 1IGFH 3RWGB 2R29L 2D9CA 4GQ9L 2WXQA 4HSQA 1BQLH 1BAWA 3LZOA 1I3RA 3H2WA 3OGCB 3BKCH 1J1PL 3II2A 5FKAB 4F27A 3CLFL 3DNKA 2DJUA 1DCEA 5EOCH 1PSKH 4Z3FA 2NR6A 4LLUA 4JM2B 3U2SA 1PX3A 3JV6A 2ROYA 5CHNA 2FO1A 1LO0H 2JH2A 4H20L 2DMGA 4PJDF 3PHOB 5D55A 1VZGA 4CGUB 3BJ91 4LCVA 2AF2A 1C12B 1P0SE 3I3EA 4KUCD 4HOMA 4K71C 5GZOA 1RLWA 3T0BA 4QRPB 4AYDC 2YD5A 4Z7QF 2R4RH 3N40F 4M9OA 1IT9L 2MCPH 2X70B 5EBMA 3RVXC 3VI3B 2VJ8A 3ILPA 4RRPM 3LVEA 5I8KH 1N59B 5LCVH 3PAVA 2GTZB 3GJEB 1G5AA 5CJOH 5E4OA 5T1LA 2FWSA 1KLGB 3OKYA 5C0IA 2WZ5A 1OT4A 1GYCA 4JJ5A 5JMRA 2XN9B 5JR1L 1CFVH 4A7QA 2X1WL 3WTYA 3LIZA 1U9KA 2VZ3A 3QUXB 4NYLB 3BFQG 3OAZH 1TJGL 4TUJB 4X6CE 4WO4A 5FECB 2FK9A 1SDAB 3BKYH 2GIYA 5GXBB 2OTUA 5DJDA 5FHBH 2E8ZA 2ZP9A 4OLZL 5GGRA 1EERB 4NZRL 1VZIA 1W80A 1YCSA 5DLML 3RJQB 2B1AL 2I9TA 1PZDA 3LHPH 4JPSA 1WUNT 1NZRA 1QSFE 4QRAA 5EO9B 3KLAB 4ZOEA 4KRNA 3KGRA 2B4CL 2EDRA 4G8IA 3HR6A 3GMPA 1N2RA 4LCCC 2OKMA 4DNLA 3QUXA 4DGWC 4ZMTA 2ZTBA 2YPLD 3EDKA 3O6FA 4XO3A 3TJEH 4HK3N 1YMMB 4P2CG 2OZ4H 2YUWA 5F9OL 3GGWB 3PIQA 2ZF8A 3RWJA 3JZ7A 1FZOB 5KS9A 3HC4H 2CM6A 1QHQA 2PW1B 5F44A 3SDXF 5KSBA 5L6YL 1WAAA 1HC1A 2BP8B 5D2LE 2Z7ZA 4AM0A 2HFEB 4PLJD 4XP6L 4EE2A 1MVFA 3KLAA 3PWNB 2DZEA 2V3EA 1FF5A 5SWSB 3K0WA 1TUPA 3VGEA 3LRKA 5KTEH 4MZIA 2DWDA 1CU4H 1N0LA 1V3LA 4L4VE 2WWOA 4Z7UA 2K70A 1U91A 5TPWL 4MSWA 1D5MA 4HX1B 5E9DB 3KDPB 2YA2A 1FN4A 3HN3A 1I9IL 4L23A 5MENE 1NPNA 3HVNA 1PIGA 1KDIA 4ZMOA 4M8UA 5ID0A 3ULVE 3CN0A 3CFUA 5C09B 4LVNB 4PGJA 2WBJA 4GG6B 2WLYA 1QFOA 4U1SA 1KXTB 5J12B 1FNSH 3KPMA 4KWUA 4LSTL 2B15A 4Z7WB 2NX5B 1OB1A 5C0CA 5C9KA 2XZZA 3GK8L 2EC9U 4MDRA 4OF0A 5B38G 3MJ8A 3RGVD 4G9DB 1VIWA 4OH2A 1WDAA 2HLAB 3C60A 4EDXB 3CK0H 4EO5A 3SGJA 3VD4A 3QDHA 1R3LB 4HX1A 4FQPA 2YQBA 4R90H 4QMEA 1FYHB 3RPBA 3QCUL 1GRWA 1H3XA 2OL3A 4PFEA 4RAVA 3RGVC 2GHWB 2Y23A 3WY3A 3FFDB 2BJMH 3I9AA 5D2NE 5D4HA 4H8WH 1KLUA 4TLKA 3UO1L 4BZ2A 1EAPB 1DVXA 3W1ZA 3GSNH 3MU3A 5KVEL 4IOFC 1INQA 2WKOA 4X80L 2OP4H 3KLHD 1FJ1A 2ZOKB 1OZTG 3MLXH 4XXDA 1JZHA 4OJCA 2E9BA 5CGBA 4NRXA 4U6YB 4ZX5A 3UG4A 5F7EL 1RZFL 1BOGB 3B6SB 3NAAL 3RI5K 4IYKA 2QQKH 4IKNA 3WDJA 2OL3B 2OZ4L 4QGYA 1I8KB 4NPJA 2W9LA 3BYYA 1S78C 4YSDA 1O6VA 5DHXB 4YLQT 3LN4A 3W9EB 1KLUB 4PW4A 3WENA 1SNRA 3VFWA 5I1LB 3GXNA 4P57B 3LKRA 1IIKA 2BP8A 5DO2C 4UYPA 1J8HB 5DEFB 1YNKH 4NNYB 5EZOL 3RA7H 3D85A 4IDLA 3V10A 4U6VH 2HPTA 1RIHH 1A3LH 1JPSH 1PFCA 4HJ0C 1QP1A 5ALCL 4ANWA 1JXFA 1SEBA 5CZXC 2ADIB 2CKBB 4QTFA 3L4UA 2VZSA 1OT2A 1IC0A 2EH7H 4PUBH 4OLXH 2YUXA 1FN4B 4JFQB 3VXTB 4HUWB 3QIBC 3NA9L 3GIZH 4PRIE 1DVUA 3DX9B 2EUVA 4FZ8L 4U7SA 1OWRM 1TQCB 2LLLA 2WZAA 2M2DA 3IFOB 1BAFL 3SDCA 4AEHL 2EJ1A 2Z31B 3ULUC 4ODVL 1FL6B 4AJWA 5FGRA 2F8OA 1OHQA 2PPFA 5CKGA 2PPDA 1AC6A 1G7HB 2J8UE 4TTDD 4ZI8A 1QQDB 3GINA 4L3CA 4CW1B 3IU3B 3BH9B 4PAZA 4D0BA 2VC2B 1A6AB 4JGJA 3SDDD 2EVHA 25C8H 1BVNT 5JHLA 1Y0LB 4JQVC 1NBCA 2V0AA 3WD5H 6TAAA 2EDOA 4M7JH 4JB9L 4ZZFA 1MAML 2CM5A 3ELQA 3MX0A 3V5DA 2D3JA 1M05B 1OPGL 4HALA 4YHZH 2DQEH 5DEJA 1CLVA 2VL4A 1NC4A 4JZJC 5GSRA 1FO0A 5IJKA 3FO2A 3M07A 3BKMH 1XIWC 2WNGA 1HKFA 2C3HA 3BUBA 1D5XA 1DQDH 1DEEB 1A6AA 3BEVA 1JV2A 3FB7B 3HEIB 3O4LA 4HKXB 3HJ0A 3GMQB 4Q4IA 2VKWA 3MLUL 3EDFA 5KAQG 4MQSB 1S7VA 3OB8A 3AREA 3QUMA 3O3AB 3FOLA 2XXMB 4EUPH 1XCQB 3T04D 3ARXA 4KRPB 1R5IA 3UBFA 1U8PB 1ROWA 3SJVB 2P42B 4NN7C 4URKA 4G43B 1R19A 3QXWA 5AWNL 3PGDA 1AHWA 2X0WA 3UGXA 3ZKMC 2BIMA 2BVUA 5C08A 2BFVL 2YZ8A 1ES0B 2IPUG 5D7SH 3DUUB 4U1LB 4ZPVA 4QCIA 4FFVC 1XB3A 3JYCA 5DMKB 1E8XA 1ZHKA 2DAVA 3AWEA 4JFEA 3BEVB 3FB7A 3NZSA 2VN7A 1GGCL 2WB7A 2MCG1 4L8SB 2AKRB 2R2BA 1AG0A 1T20A 2G3MA 1MVYA 5F6HJ 5KYYB 4KKAC 4ELKA 1TETH 4JDTH 2BVQB 3PHQB 4FYRA 3WO4C 5C0CD 4FLRA 3FT0A 4K73A 4HCRA 3KPRE 1WICA 5L88L 3WJMA 3QUYB 1A9BB 1OW0C 4ONGL 1E4XL 3O0RH 4DGYH 2H9GA 4HOZA 2BZ7A 2CPCA 2VSCA 4NAJA 4RFOL 2YRBA 5KSUB 1XVSA 2EEFA 4XMZA 4W68A 5DA0B 4ZFOB 3ZT6A 4FQHA 1ZT7A 2IDSA 4H1LA 1DP0A 1LK2B 1A1NA 2NY7H 2P5WA 1MREH 3RFRA 3VGBA 5DMGD 1MHCA 1W72H 2EDWA 3HE7D 2Y1VA 3H9YA 1LMKA 1NFAA 1X7SA 2K6YA 4B9GA 3QXTA 4NUQA 3SDDA 4OSUL 2WIIA 4YBLB 4ZUWA 1VF5C 3PWVA 4HOWA 1DBKH 5FYLH 3OKNA 4ISVB 4P9MH 4HIIA 3T65B 2F2HA 4ZFOA 5FLVA 3WL9A 2Q20A 4GSDL 3V0HA 3FFCE 4Y16C 2YN3A 1L0PA 3OAYH 5IVXA 5IZ7A 1E50A 2B3RA 1E6JL 3VMOA 2ED7A 4GO9A 5B38A 4S1SL 1UURA 5DUJA 1F97A 2ZCLL 4PJFB 3DGGA 4H5SB 4L0YA 1XSKA 5I1KH 1CFQA 3V4PB 3FOLB 1C1EH 5J9PA 2B59B 1NEUA 4XPHH 5CIPA 5ABZA 3L2NA 3V5KB 3LXCA 4FHJA 1VAHA 2W60A 4L9DA 3O6MH 3T0XA 3LHAA 5T1KD 1QLEH 2VLRB 4MVBD 4YHNA 2IPTL 4N3TA 4MD4A 5GISL 2E7BA 4JRXE 1XO8A 4XPTH 2P5EB 3GXIA 4D8PB 3HE6C 2XRAL 1YQ2A 2FT8A 5HGDB 3QEHB 4K07A 2VLLB 2VR8A 2EIMB 1MJ7L 4RMSA 3HE6D 2CK0L 3C60C 2BIIA 2IC2A 4OFPA 1KIUB 3DOIA 4K8RL 5F21B 3V4VH 2BNUB 1CVSC 4IK7A 3LNGA 2HT3D 2CRZA 4ZAKD 4JPVL 4JHVA 1IL1B 4PGCB 4WFHE 5I26A 4F91B 3CZKA 4JANB 4ONGH 4NUJA 3JVGC 2OXGB 4KMTL 3S35H 4HG4K 4W9ZA 1T3FA 3ARBD 1BFTA 4E5XA 3VFVB 4LMQE 1OAXH 2VRAA 1CBVL 1AD9B 4NZTL 1U33A 4UZUA 3ULUE 1UQSA 5FKPA 5IB4B 4MMZC 1UT9A 1BD2E 3SD2A 2CMRL 4AGLA 1KYOJ 5DRXA 2DQDH 2NLJB 5ICYB 5KS9E 3HRPA 1KJ3H 1ZS2A 4MDJB 4PD4K 4QXGL 5CZVL 2XX1A 3ZDZF 4YR6A 4N20A 1A4AA 1XIWB 2R29A 2ZWKA 3CLFH 5TD4A 2H3NA 2E7HA 1CXHA 4CUCA 5EEWA 3RPIA 5TF1L 5IW6B 2R69H 4KROB 1ET5A 1BLNA 1M2VA 3PHAA 5TE7H 1FVCB 1WC7A 5BO1L 3O41B 1U8CA 3MV01 2BXZA 4PJ8C 3BZ4A 3TIEA 5I5JA 4C4UA 4PG2C 2HLEB 1JGIA 1I8IA 2ZWZA 5FM4A 1PQZB 3BVDB 3DWTA 3OSVA 4J3OG 4XTRC 5D7IB 3O8XC 4YL9A 2HRPH 5H35B 3NJLA 4GSXA 2Q8BL 3F04A 1NGXB 1OAUH 1NQBA 2WNXA 5GGVY 3MRIA 1NDMB 1CD1A 3IMTA 3KJ6L 4NI6A 4WI7A 3DHPA 3C5XA 1UB6B 4XBGB 4DSYA 1FNGA 5AW3B 5D7LA 2VXVL 3QUKA 4IKJA 3CFKB 3CFQA 4F7TA 3APMA 4QHUA 3B56A 1ZS8A 4Z7NB 4Y2DB 4Y4FA 3ZOAA 4S1QH 4DPAX 5D7IA 4L9LC 5D4JA 5HJ3B 2OI9B 1BYOA 3GBML 4N68A 1IZKA 1P4IL 1L7IL 2MKLC 4B41A 1KGWA 1MVUB 4O2EB 2X41A 3BXNA 3FO0L 5EZJB 4PIRF 3NK3A 5B3JE 1ASOA 2X4UB 4GPVA 2VUYA 1OP4A 3PQYD 3FB8A 1NCAH 3BAKA 2DJ4A 1MFUA 2FJHB 5D7JC 5T3ZE 3WEMA 1Y1UA 3BPOB 1WIPA 1WWWX 5HJBA 4A6YB 1NCGA 3D0AA 3LKNB 3L16A 1DN0A 3QORC