2OPCA

Structure of melampsora lini avirulence protein, avrl567-a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
115
structure length
115
Chain Sequence
b'EGYTRFYRSPTASVILSGLVKVKWDNEQMTMPLFKWIGGEQAEELHFCVHIAHSSGPKLNRARSLGTVNSNMDQHWAQAQRNSGATRRTIEGFHLFENDIPNFPDYIKIKLVPKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AvrL567-A
publication title The use of Co2+ for crystallization and structure determination, using a conventional monochromatic X-ray source, of flax rust avirulence protein.
pubmed doi rcsb
source organism Melampsora lini
molecule tags Protein binding, metal binding protein
total genus 18
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2007-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11529 AvrL567-A Melampsora lini avirulence protein AvrL567-A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2510 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2opcA00
2QVTA 2OPCA
chains in the Genus database with same CATH superfamily
1QHOA 3HI5L 4MCMA 1HH6B 4B50A 5JXEC 3IGLA 1QBAA 4PJGB 2D7OA 4L37A 5T8IA 2Z93B 1YEHH 4XVTH 2X9ZA 3FT3A 3DA0A 5CWSA 2R23B 4I0PB 2YMTA 1J0KA 4KJYA 2A9CA 3ROOA 3WIFB 3V7AE 3ZDYE 1MZZA 4XN9A 4JG1H 3DTXA 5T3ZL 1KDJA 4Q4IA 2UUDK 4JFQB 3L3HB 1QSEB 4EO5A 1A7NH 3BIBX 5HP5A 4L8CB 2BVQB 2QQKL 4KUCF 1RZIB 2AQ2A 4Y4KD 3UC2A 3GZKA 5DZAA 4N5EC 4XNUH 1VACA 4O58H 2A83A 4Y19B 3WTXA 4HX1A 3A6BL 1BVNT 4JVUA 4YPGB 2CHXA 5E5MB 4RQQB 4NNYB 3HMXH 2FB4H 1LO0L 3LKRA 3WUWA 4GRMB 3T08A 4OGZA 1N2RB 3NJXA 4KZ0A 2Z35B 3WTSA 3BT0A 2YKLL 1NUFA 3KJ4B 4F92B 4ZBJA 3RYMA 3ZRSA 4Z7UF 4D0DA 1HILA 2RFXB 4OGYH 2YGPA 5AWNH 5ECGA 2XETA 3OPZL 3QISA 4FC3E 4X83A 3CVHL 1ZD6A 3C60C 4M61A 4WJG3 3U82B 4QHKJ 1EJFA 4ADJA 4PUBL 5CJOL 4L1BA 4BH7A 5LVEA 4MJ6B 4G7SB 1B3JA 1F1DA 4B5ZA 1BDYA 1LK3H 4JZNA 2QV4A 1IBDA 5HHOE 4ZZKA 4HETA 2GUOB 5IVXE 3BEVA 3NCWA 1QFHA 2BSSB 2Q76B 1INDH 5F0MB 3D33A 4LHUA 1PKQA 3PWJA 2XA8L 4LLWA 3ZJAA 1CBJA 2YWYA 4KJQD 3VSVA 3PP3K 4F8LA 1AY1L 4ALAH 2W0FA 5E8PB 1WCBB 3GJFB 1FGVL 5EZIH 4H7VA 5IQ7L 5T1LD 3U25A 2QEJA 4E5XB 4KKBD 1QVOA 4NQCE 2HJFB 5ITFA 2XWTA 2M2DA 1QLEB 4QRRE 1IM3D 5CLXA 4DHLA 3FSZA 3NP4A 3P9MA 4CADA 5CGMA 5KYWA 3MLTA 1U8HB 1OTSC 4XP9L 4IRSC 1AZBA 2HVKA 2ZCLL 5C0CE 3H7LA 2J21A 4GW5A 4P3DA 5D7LE 3CQPA 4DO4A 4APQC 3CXDH 4JZOA 3HKZA 2DH3A 3BKCH 2K3HA 5BXFA 3EFOB 4MCYA 3DGDA 1I8LA 5E6IA 3DX9A 15C8H 1U3NA 3H0TB 1XGQA 3EDKA 1U3YA 2MHAB 3SCMC 4KNSA 4N28A 2X1PA 4P5RA 4BK4A 2BXYA 4G80B 3WJJA 2PCFA 2FK9A 3QZNA 1LDSA 4KROD 1HYSC 1D6VL 4UIKH 1DVTA 3ULUD 1QYGH 5EIIA 1MG2C 3HB3C 4I3SH 5F7EL 4TQEL 1U36A 1NLBL 4GJTB 3H9SD 3MUHL 3VH8B 3DPBB 1ACYL 1E6OL 4I4WA 1I9EA 5FLVA 5AL0A 3MTXA 2DWEB 3BPLB 4X80H 4F7CB 3WO4C 4PRPE 5IMKA 2GBAA 4I2XB 3UTQB 4ZX4A 1Q9LB 4MNQB 4DIXA 3WTYA 1AQKL 2BIPA 4HPOL 4YBHA 1QRND 5C6TH 1PZAA 3D52A 3FB8A 1SY6L 4QD2E 2KLSA 2AABL 3QDHA 4NKOA 1J8HB 4JMNA 4NOFA 1PDKB 3MCG1 3N91A 5L6YH 1CGSH 1MFUA 1PZDA 5C9JA 1L5GA 2XQBH 4JY5H 1GAFH 3RVWD 2EAEA 2WQRA 4LAJH 5DMGC 3GC3A 1MNUH 4YFLF 3IGKA 1RUKH 1AGFA 3OLEA 4HWNA 1YZZA 1I82A 1WZ1L 1GGCH 2H2SC 3D39D 4J2QA 1FF5A 5FM5M 2Y7QA 1NBYB 1VGEL 1N19A 4FTVB 5FA4A 3O41A 3ZL4L 4BZ2L 5EEVA 4KTGA 3TFKD 4EUPH 1ZGLP 1WAPA 3GNML 1IC4H 4PCKA 1I8MB 2HTLD 4QYOA 3KNBB 4PQXA 3VCLA 3NIDF 4H8QA 4NKIL 4HOWA 1A6AB 1S7QA 5CILL 5D7IF 1B0GB 4NQCA 3MNVA 3PDOA 4WV1A 3PY9A 4QRRA 4XT1C 1FO0H 4UOZA 1S7XA 3VRIA 3BD4A 1FFNB 2ZPKL 3M86A 4OLUH 5F1IB 3K6DA 5DJZA 3EOAB 4XE0A 3U4BL 3CFKA 5HYJE 4ZO7A 5I8OL 5I1DA 4MRCA 2KT6A 4Q52A 2ZCKL 1RUMH 4MDIA 5AAWC 1K2DB 1AP2A 1RJCA 1UM4H 1LEKB 3MJ9L 3WJLC 5K9QG 1Z0MA 4HEME 3PFQA 1UD4A 2MSPA 3VFMB 3VXRA 3L3JA 4MD5B 4EIGB 2QQNL 2GT9A 5K9JH 4BQ6A 3M17A 1I8AA 1UJTA 4GW1B 4YUEL 4PGJA 1A3RL 2E59A 1C5BH 3PYCA 3RUGB 2R1WB 1XF2A 2D2OA 3GSNH 3MV7D 4Y5VA 2WQWA 1BBJB 5DZOA 2X4UA 3QQXA 2C3WA 3V8OA 4WJKB 5JQHC 3RA7L 3T6QC 5CJQL 1LNUB 5IBTL 4XRCB 1AO7E 1MRFH 1JV5B 2VDPB 3MNZB 1IBGH 4JFYA 1OL0A 4YLQT 3U0TB 5L88L 1ZT7A 1OWRM 1MW2A 1QWHA 4ZOAA 3MOAH 1ZANH 3ML8A 3QR0A 4JM2B 4PRPA 1LP9E 1T83C 5AW3B 4DAGH 4DP4X 3TN0C 3CPLB 4Z7NF 5DYOB 1XGRA 1A7RL 4WWID 5JLZB 1PAMA 5EZJA 3T65B 2WKOF 3LKQA 1X5MA 4JHVA 4UQAA 2H7WA 1U91B 2DRUA 4N5ED 4K8RD 1KTBA 5EC1B 3UL4A 1AGEB 1GGIH 4YFEA 4KV5F 3RGBA 5SWZE 1NLDL 3FN0H 3VXSD 1WGOA 5EOCL 1EFXA 3FCSA 5EOQH 2NNAB 3B3IB 4PR5B 1TPXB 5E94A 1V7ML 4PTTA 2YD0A 5E1HB 3O81A 1DQTA 1Q0YH 1ZRUA 5F0PB 4RDQG 1MCIA 1SMOA 5D5ME 3VB8A 4ZW3A 3KPPB 3RZCC 4NJ9L 4QI3A 2EIKB 3RY6C 4B0MB 2NY0B 4AITA 4QR7A 2NY2C 2TRHA 3T8XA 3C60D 3QXUA 1PYWB 4ZT1A 3OKDB 1E43A 2WPGA 1X5LA 4LLDA 4PLJC 4B3EA 3WELA 4B0MM 5L8LB 1HXYA 1RUPL 1TZGL 4HAKA 4U7KA 3V55A 1BQ5A 1BF5A 2IOOA 3ORJA 4MAYB 1DJGA 3W0WD 1BLIA 2R56H 5JA9A 2E9JA 5KYXA 1CU4L 2OMZA 4XC3L 2ED7A 2AEQL 1F4XH 4X7SH 1VZGA 1E5YA 5AWNL 5ID1B 4ZFFB 3BFQG 1WZLA 3OR7B 3LIZL 3X13B 2J25A 4CN4A 5GZNC 1ERNA 4KQ3L 3UYRL 4YFDB 5FWQA 3US9A 5LBGA 3HMWH 3QWRA 4NN6C 2CBPA 5IV2B 3BAJA 1ET8A 1M3IA 1ML0A 5BRZB 4M7KL 1NUNB 4CJ1A 5GIRB 5CZXD 5IHZA 1F11A 1OAUL 3RILA 1JGVH 1OTSD 2K6YA 1MFBH 1ZVYA 3LNGA 3QRFM 1BZ7B 5DI8B 1YHPA 3HZMB 1EXUB 2QVFB 2IAMD 4GXVL 4APQD 5BRQA 1LO2H 5KSAA 3HG2A 4U6VH 1AGCB 3J8F7 4M7LT 4HKZA 3IMWA 4NYLA 5CU5A 1Z3GL 4HT1L 5E2VH 5F9AC 2ZONA 5C09A 2M83A 3SPHA 1JL8A 3R8QA 4KAQH 4OM1H 4LIQE 3BPNB 1GIGL 3DMMB 4P2RD 4AGNA 5EEZA 1UG9A 2CO6A 5I1IH 1KXVA 5C0BB 1P4BH 3I9GL 2Z9TA 1YEKH 3BLKA 1HYSD 1ZS8A 2EJ1A 2WUCL 4NNXA 2P48B 5F93C 2XFXA 3CTTA 4P5TC 1JZGA 4GI9A 1OW0A 3WKQA 3HB3D 3UEQA 4IRZL 3MV9B 3PPEA 4NUGL 4V2BA 5FYKH 1CWVA 4OZHA 3MRCB 1E2VA 4ZOBA 1KEML 1EO8L 3KPTA 3STZA 3DO3A 1XGPA 2AJSL 1OTTC 4PTUB 4YL4A 5F96L 5GHWH 3ZPDA 4V1DD 4HHAA 2EEDA 4ZOCA 5EA0H 3F7LA 3RFRA 4Q2ZA 1O7SA 2WN3A 4UDTB 4MYPA 3IT8D 5EORL 1T5KA 4U1JB 4GSDL 1G9EA 3CX2A 5PAZA 3MRMA 4OVVA 3S3DB 3MCYA 3DOSA 3BWUF 4JANA 3KW7A 3SEPA 5DGRA 3GEWB 4OM0L 1J5DA 1JS4A 4F33A 5ENWA 5AAMC 1DN0B 3M1BB 3QAZB 1AI1L 1EUUA 4K07A 5DLML 2OYPA 3RHWK 2ZP0T 4KNTA 3CFBB 4RGNC 5JXAL 3ULVL 1U58A 4ZS7L 3GJEB 4XNQA 5AKVA 4F7PA 3LEVH 2V3DA 5DRXB 2V7HA 4JG5A 4OQTH 4UINH 1BECA 4KY1H 4NN7C 1IGCH 1NFDB 1OQXA 2H2SD 3LKNA 4IJ3C 4TKWA 2JIXD 1QABA 1D5BA 1OAKH 2OTUB 2R1YB 4ZTOL 1FIEA 3L08A 1K85A 3C5JA 4KKNA 4FOMA 5FYLH 1G7LA 4JO1L 3S37X 4U0RB 4CMMA 1V7NH 4O02B 2WBJC 4OGQC 2MCMA 2FX9L 2KZWA 1INEH 4K3EH 1WD8A 2R2EA 1WBXB 3F00A 3J27A 3JYBA 2OQJA 3MBEC 3RFZA 1FL3B 4BK5C 2E6JA 5KYYA 3MROA 5AVTB 2PP7A 1BVOA 3RTQC 5HVWA 4WKXA 4QXUH 1NCIA 1QFWL 2DQ6A 4NT6B 4HCGA 4XPAH 3SE4C 2AEIT 5IHLB 2OR8A 1SFHA 2V8LA 5IFHH 4I18C 5CGBA 2X88A 4DKEH 2OL3L 4P5MA 3L7EA 4JFDE 4FFYH 1U8MB 1U9KA 4MXVF 3S3JA 3VFTA 1R24A 2FO1A 2GIYA 1YMMB 3LEXA 4ZTPH 1E50A 3UZQB 3FK3A 4QTHB 4F24A 4WEEA 2GEQA 3PABB 2IWKA 1QX1A 4YXKL 2HUEA 3CFEB 4BINA 3V6ZA 3IDGA 2WINB 2VLME 2J8UF 3FQ2A 5E95B 2VZTA 1AQDB 4UDUB 1R5WA 1SNRA 1YAIA 4WTZA 2Z31A 3FN3A 5D7HA 1FPTL 1DSWA 4ORGA 4HZAA 1KCBA 1Z5YD 4QO1A 4YLBA 3BLBA 3HPJB 4JFFE 2J2ZB 3BZDA 3O0RL 1T0MB 5E9NA 1YECL 4ONGL 4AEHH 2MRYA 4X8GA 1Q0XL 3ZR6A 4ODXA 3UEZA 3KYMB 4YQXH 3ES6B 3QEGH 1MRFL 5CIPA 2Z8SA 2W0KA 2V2TA 4OVUA 1YN6A 2UWEF 4PJCB 2C34A 2GSIA 2QSTA 2YD8A 5A16B 3MUGA 3V8CA 1YUKB 3QJTB 2CDGB 2VMCA 3LHPL 3O2DA 2VDNL 3X1GA 3HRPA 2VM3A 4P2CG 5LDUA 1MCWM 2YK1H 1VFUA 2X1QA 1JWUB 2WZ5A 5DMJB 1XEDA 1MPAL 2CMRL 3GBLA 1IBBA 2FIRT 2J4WL 3K2UH 4JKMA 4OZIE 5IGXL 4H26B 1T21A 5CP7A 1P7HL 3DGCR 4GSUA 2X40A 3LKPB 3S5LB 5I1HL 3SJVB 1YQ2A 5JOFB 5FFOA 4B9IA 4HKJB 5EO0B 3CH1B 3RZCD 2FATL 5FKAA 1B0IA 2F54A 2Y2WA 2NY2D 3QUML 3SKNA 3SQOH 1SXNA 3P0VH 4YHIA 1HIMH 3K7UA 4PLJD 4EIZC 3CXFA 3S88L 5I1CH 5EOQL 2IH1A 4TVSa 2NW3A 4NQEB 2AJZB 2GIMA 3DVIA 3MRRA 1IBFA 5HVHB 2CKNA 3FJTA 4R7NB 2ZKHH 4PS4H 3ARGA 2FHFA 5DHVH 1EK3A 2AF2A 5HGDA 2E76C 3UZEC 3HZVA 1NAML 4G70B 4HV8A 4HS8H 2IFFL 3QJQB 3P9LB 3QUGA 4YHYC 1HSBA 2VLKD 5TH2B 3PQYA 3FSAA 2D7NA 2CKBL 4YGVA 1NIBA 3GSRA 1SEBA 4P4KB 1PG7X 4MJIA 3H9ZA 3O8XC 3HN3A 1ZT4A 1DVSA 4XBPB 4GT0A 4RMQA 4HIXH 5KOMC 4AMKL 1U8IA 2CM6A 2O5XH 2RTTA 4Q6IB 4WKZA 1O7VA 2CCWA 4Y2NA 5IT2L 3OV6A 4X98A 5BJTA 5E9DB 1GC1H 3FUHA 3BZEB 1XGTA 3LEYL 3TA3A 3ZDZF 1BQLH 5F6HI 4ZMYA 1M71B 2XXCB 2YPVA 5EU5B 5EEYA 3VE0B 1G87A 2ZWNA 5EF1A 2XTJB 3T3PB 4N8UA 1FE8L 1L9QA 2MKLC 4P5TD 2CXKA 1H6UA 5IROC 1FP5A 3JUYA 1NFIB 3RGHA 2WQXA 1DQQB 3V0DA 1F6AA 2J1YA 2R0ZL 2F1AA 5BOJA 1NJ9A 4Z18A 4OD2A 5D70L 3HS0A 3H55A 3QJVB 4L3FA 4OM1L 2W07B 4OCRL 3HBZA 4LSVL 1C08B 1P1ZB 1FAKT 3IE4A 3MREA 4G7VL 3G5YB 4UM8B 4UM9A 2ORBL 4OZIA 4D9RE 3DSNB 1DR9A 2ESVB 4Y4HA 1NIDA 5CEZL 2XHNA 4JEGB 5A2BA 5D7KE 2GITA 4UNTA 3U79A 4PIBA 2QMKA 5FDWA 4K94H 5GS0L 2IANE 3H4HA 3AXLA 1ILSA 1H19A 1QLFB 4I9XA 4Z7NB 4ZAKC 3D85B 5B1JC 4PS8A 1I1CA 5C8JB 1OK0A 2XPGB 5BQ7A 4PJDB 2CO2A 4M00A 3WFHB 1FYTD 2KKQA 3P2TA 3WEMA 4EBQH 2D0GA 4LRIA 1RU9H 4LFHD 5DJ8A 3KPOB 4WK2B 3IF1B 3TT1H 2XX0A 2HG0A 3FSWA 5E08H 1KCSH 1OZUA 3CUPB 3TESA 5J4MA 1G7IA 2J6WA 5J6GB 2P1YA 3TYGL 3DX2A 5EBWB 1SM3H 5BO1H 4LLMB 2FBOJ 5D6CB 4DPAX 2XACC 3GBEA 2VSMB 1J1XH 4M6NH 2BP8B 3T0EE 4JLRB 5B38B 3DX7A 4GG8A 3C9NB 4WUUB 1LO4L 4G42B 5F3FA 5DK3A 5C0AD 4G5ZH 2B39A 4UU9B 1IQDB 4L8DB 5HYQB 3QG7H 1NCWL 3W82A 3SBPA 4I48B 4L8SA 3CZLA 1H3GA 3BUPA 3MBED 1DTUA 3OMZA 3KWUA 3RTQD 3IDJB 1IAIH 2KMWA 1M2OA 1ZIBA 5D7JA 1TQCB 2J88L 2DH2A 4P2QE 1UVQA 3MLWH 4YDVA 2BK8A 3EH2A 1P4LB 1V7NL 1WTGT 2F53D 3GKZA 3U9PH 5AYTA 2YOAA 3VXTB 2CJTA 5BZWA 3FQYA 5EEUA 4AI7A 3THMH 1WBZA 2P8MA 1JFQH 1MFDL 4KI5E 3ARXA 2EDJA 3F7YB 5EOTA 3M1CA 1BQKA 1JYVA 3IFPB 1FGNL 3TLRA 1SBBA 4PN6A 1JE6A 5F0LB 2LABA 2PWFA 2JELL 5GGUA 2BVOB 3VH8G 2H3XC 2AXFA 2WMPA 1YYLL 2AJVL 4YX2H 4GKZB 3D3VD 3RVUC 3U46B 1NCBH 2DD8H 2CHNA 2UZPA 2IH9A 3UADA 1ZSHA 1EWHA 2YLKA 5T1JA 4MB3A 3F6LA 5GGQL 3MYJA 1FLTX 2CUMA 2HYMA 3C6EA 4IRJA 5KSBE 2PWGA 5FPIA 3MV11 4JO2L 3UJTL 4OBRA 1JPTH 4Q14A 2H9GB 4HJEA 5I8CA 3TM6A 3RPIB 3I6GA 5E6IC 1JDAA 5L2KB 2D7QA 3EFDH 4YHNB 1OB1A 5F72S 4F2MB 3R18A 5CBAA 3TH4T 4EN3B 2IANA 1LE9A 4FKEA 3K71A 4NDMA 4G8FB 1DBML 1U3HB 3DJZA 3GUFA 3ZKQD 3RWIA 2EXYC 1CR9H 1S7RA 1CE1H 1HHKA 1D5RA 4PLKC 4WU7B 1A7PH 2DWTA 4GXFA 3RIKA 2XVGA 2F7IA 2EECA 2KERA 1DSFH 1XO8A 2Y22A 5HGHA 3SDXE 3IRZA 5IK3A 2X9YA 2XU9A 4M6AA 3RJDA 2WGXA 1J5OL 5BZXA 5C92A 1B4JH 2BVYA 1IBHA 1NCAL 2G0LA 4CJ0A 3FQTB 3T0EA 3UTSB 4QHNB 5CCHE 1MWAA 2YK1L 5F1OB 3MX0A 4TSAH 1F1AA 5D4QA 4ES8A 1MN4A 3A6CH 4KY2A 1KJMB 5B3NA 1QW9A 2CR0A 2CDEA 3IFOA 3VXUE 1FIGL 1QEXA 3KE0A 3VWKB 3VD4A 3LPWA 4FKHA 3DUUA 4XXCA 2B3IA 3F7VA 4AXWB 2EDMA 2ZX5A 4L4VA 4M5YL 4EDWH 1I7UA 2UVEA 4FQ1H 3L5WA 4OGXH 5FGCB 3UXFA 1IL1A 4GS7B 1SVBA 1RSFA 2J1XA 2D7TL 2DDQH 2VUYA 3N85L 1MVUB 3P0VL 5DD6A 2VLLB 3TBWB 2P5EA 2P8LB 1MREH 2GBVA 1NC4D 1PQZB 1U30A 2ZSWA 1RZFL 1UB5A 4PJ8D 2HXAA 1S5HB 2P80A 4MA3B 3EHBC 4ZMNA 4CDHA 4RGOH 4TL4A 5F7LB 3VXNA 2OX5B 4X8JA 2DQFA 1T1ZA 1NCGA 4XP1L 1T0NA 3RL1B 3D18B 3UBXB 2CGRL 2QKIB 5LO7A 2XZQH 2VZUA 1TQVA 3LN9A 1ZMYA 1D7BA 1DVXA 1WC7A 5HHQB 1I4FB 2H2PC 3LHAA 2ZXAA 2PO6A 3AXIA 2EEBA 1HHHB 3MN8A 4Z1PA 5GS1C 3HNTL 4HLZH 1A22B 2Y5TB 4LLUB 1CF8H 3EO0B 3CBKB 1NBZA 4ZXBC 1QFPA 4YSTA 5CJ5A 3NEEA 4ZX5A 2VR8A 3NAAH 3B6SA 1SLVA 4XB7A 4HYTB 4D0BB 5IROD 4NQVB 1MCPH 4NQXA 2CIIA 3GKWL 1BXAA 1X5IA 3H42H 2NR6A 2WLYA 3JWNC 4GAGH 4POYA 2HT3D 1NC2B 3QCTH 5TJWK 2YRPA 3TBYA 1HXMB 4KO5A 2O5ZH 5HYIA 2BX5A 4OF5A 2JJSC 4JHBA 3Q1SH 4Z7VE 4G5AA 1R0AH 4A04A 1A1NB 2XIDA 5A6MA 2Q20A 1DQJB 3DIFB 2PPEA 1FJ1B 3U9WA 5IEHA 1M7DA 2AQTA 2GTQA 4OF8A 2FL5A 5D4IA 1I53A 4G9FA 2BSDA 4X5WA 1W6LA 3FOMB 3P2BA 1A8JH 1HHIB 3DX6B 1KBBA 3O6LL 4P3WA 1OSPH 1BZQK 1IGML 4NO3A 4LPTA 4FI8A 3WFEH 4ZAKD 4PJHF 4XPHL 1HCFX 5LGJB 3R06B 35C8L 3LXUX 4ZD3L 5MEPA 5CR8A 1TEFA 2YAQA 2ED8A 4FLHA 3VXUA 3FTXA 1NBVH 2UZIL 3C5ZA 4OV5B 4K94L 1CZ8H 4JFWA 3MDJA 3LJ3A 2VDOL 3CLFH 3ULUF 5TDPA 4HS3B 4ZSOE 2BZ7A 3VXMA 1UGKA 3STLA 4N1HB 3P40A 1XB3A 5ICXB 1ICTA 3RGVA 3O4LE 5ICZA 2DQMA 3REVA 5IKCA 3TT1L 1UWGH 5C70A 3K3QA 3SD5A 3TV3H 5T1MA 2GHZA 3TGXA 4PLNC 4YHPA 4HA1A 2QTEA 3M88A 4QRFA 4XWOC 3CZKA 4RGNE 5BV7C 4U49A 4G6KL 4G5ZL 1KYUA 2WTRA 2HLEB 2WLKA 1FZMA 1AVAA 4N2EA 3RU8L 4X6CF 3FO2B 4NUPA 4X7CC 5IVZA 5T5FA 3DGGB 3T3MF 5J13C 3QYMA 3BRFA 2Z7YA 4FAAB 4LHUD 4PWFA 3MLSH 1BZ9A 4HLEA 1JYNA 5H35B 3UAJC 5BZDA 5AYUL 3PE9A 1F56A 4ZFGL 4B9ZA 1XXFC 1NUGA 5B8CC 3NCBB 4N20A 1AKJA 3BZFB 1NM4A 3FU5A 3U9PL 1OGAE 4LMQE 3UGEA 1XF5B 2IBGA 3RVUD 3HRZA 1AMXA 3EXLA 2WLLA 1A4BA 3GSVA 1JGUH 4QWWC 4L1LA 4R96A 5I17A 1DYZA 5JTWA 2AGJL 1T22A 5SWSE 5AW7B 5I8KL 3QARA 1KCUH 1YVLA 3ESUF 3RE0A 2A6DA 3G7TA 4Z7VA 5AENA 3DX8B 4PRHA 2WCPA 4ZI8A 4G8EB 4Z77A 2OI9B 4W9KC 1QASA 3TZVB 4DKTA 3A4FA 3UTTE 2MQ0A 4M8VA 3QJXA 1SJVA 2J71A 2LFEA 3AWFA 3QCUL 4LGRB 5CFAA 5E6ID 1W8NA 2FJHB 1XFPA 5CN2A 3FSOA 5E23A 5DEGA 5KSVB 2CRZA 3QJFB 4W9LC 5DRZA 5AVUB 4NQSA 2O1AA 4JJ5A 1WH0A 2EXYD 3OPUA 5AB9A 5KVDL 4DCQA 5HDQL 1RZKL 3QEHA 3NJMA 3TT3H 1OW0C 5JYMA 2XBZA 3OMNB 3GMQB 2DI9A 1MFCH 4KNUA 1ET5A 1I7RA 2AERT 4C56B 4D8PB 4QRUB 4X50A 3Q3GA 1YEIL 1IC7L 4X4YB 5GSVB 1Y18A 2FQGA 3B9EA 3FQXA 2IVFC 5I73C 1HFUA 1B4LA 1QFOA 3TVMA 3P69A 2X2UA 4TUOA 3UBFA 5EU3A 2DJUA 2HKHH 5JHDE 4PP1D 1PLAA 2YAHA 4LARL 4BFJA 2ADFH 1UH4A 4Z3EA 2BNRB 4LIQH 1IILE 3QIWA 4R4FL 2VLRA 1KWGA 4D9QE 4OIBA 5DR5H 2PUQT 3BPOB 4X7DC 5JO5B 3ARUA 1B9ZA 2OJZL 1PD6A 1IARB 3DUSA 2FEEL 5I75B 3JWDH 4WJ5A 4MCZA 9CGTA 2AQNA 1X9RA 5K1JA 4WY7H 5DXWA 1CD9B 2CXGA 5IIEA 4KUZL 1JGEB 5DRWB 2FGWH 3HUJB 4LPXA 4LLYB 1FG9C 4Y1AB 4RGMB 3EHBD 4MX7A 1A6TB 3GMLA 5IQLA 3VGHA 2E5EA 4FQ1L 4LCWB 1ZEAL 4L5FL 4X6EA 3VFPB 5M94B 2YPLA 1IKNA 3PHOA 1OGAA 3P4OA 3WTTA 4XBMA 1GGBH 2NXZB 3QFGA 1S2EA 2NY5L 4HBCL 2H2PD 4L8BB 3RKPA 3VQMA 5TK2A 1NA8A 2ADJB 4MJ5A 3TURA 4D9LL 4S11A 3O2DH 3HNVH 1T2QH 1CI3M 5ACZB 4XNMB 2IBZX 5I28A 2EDEA 5B1BB 5E2TH 3ARDC 1FRGL 3BH9A 5F21B 3HC3L 4PJ6A 4M62L 2DJ4A 1N12A 1OV8A 1HOCA 2J6EH 2OKMA 2WZ0A 3MV8D 1WA0X 4K23L 4QKXB 4FQIL 3VXRD 4AYSA 5GGSB 3FQ1A 1ORQA 3DRQA 1BYOA 3IXTB 1WHOA 3ZKMC 2W65A 3FBQA 4F9PA 1I1YB 2NYKA 1T5WB 4ETQA 43C9A 2OXHB 3B2XA 3U7WL 3GLAA 2A9ML 3FU9A 3S5LG 4BSWA 2UYLB 1TTFA 5FR3A 2OLDA 2FNBA 2X4PB 2Z31C 1XHHA 4GAGL 4JPWL 1R47A 2R39A 1N6VA 4JDZB 3BE1H 1MHCB 1OAZL 2CLRB 4LF3A 5D1QC 5LJYH 3PUCA 4M6ML 3SE9L 3MRQB 3NA9H 3RWEA 2XN9A 2C9UA 5JHDA 1IFHH 1RK7A 4ZPTA 3FONA 1OANA 3MLUL 3N50A 5FECB 2ZAIA 1LJMA 3QUKB 3C6LB 4L3AA 1D9KB 1XR9A 3LS5L 3KYOA 1Y1DA 3SIKA 2JCCF 3RI5K 3EOTL 3VVWA 4TVPD 5EO9B 4JHWL 2JKRM 3BN3B 4POZD 2Y69B 1DBBL 2LR4A 3Q6GH 4AV5A 1EFXD 2XKUA 2CGYA 4NRXA 1UEMA 1RIVH 1TU2B 5IY5B 3FU0A 3L7FA 1XIWB 2WNKA 4GSRA 2TSBA 4JN1L 1NGZB 2KZBA 5FGBA 2YPVH 2EYSB 4AYFA 5CZVL 2FECL 2ZOTA 3ENEA 5I74B 1JN6A 1S3RA 2B1HH 3GSWA 3OZ9H 1LQSR 2FCBA 2X70B 4BDVB 2OMWB 3OLGA 3ZW3A 1JNJA 1HH6A 3Q9QA 1W80A 4J6RH 4PJGA 1XSOA 4XWOD 4YSQA 1BX2B 2APBA 4R4BB 3TP4A 3QUYC 2Z93A 5EWIH 1IIKA 2R23A 4I0PA 3WIFA 2A77H 2VSDA 2RMNA 3FRUB 2EYTB 3MJGX 3QWOB 4IIQC 4PJ7E 4XCYB 3IS1X 5DD1H 2E7HA 4R84A 3G6DL 1OPGH 4JFQA 1CXKA 4ELKB 3L3HA 5E7BA 1QSEA 4AX3A 1HCYA 4FQLH 4AUJA 3GI8L 3UAJD 4L8CA 4G6ML 2BVQA 5KYNA 1GZHA 1RZIA 1UWFA 2P45B 3EJTA 3QWRD 2CR3A 3HC4L 5DHDA 1L6ZA 2F7QA 4WFFE 4Y19A 3UBHA 3WDHA 1GTFA 4PG2A 4OI8A 4YPGA 1JXJA 2XQYG 5E5MA 5INDB 2EH8L 4RQQA 3L4VA 4NNYA 4XP5H 5IFJB 4HIHB 2JE8A 4GRMA 1N2RA 4MXWH 3RWCB 2Z35A 3O6FC 5KSAD 4RZKA 4OB5H 3MLVL 4NQUA 4QJ4B 3N1PC 4OFYA 5C09D 2P43B 2RFXA 3BVNB 4PLOB 3VD3A 4IBYA 4ZMTA 2WXOA 3OJVC 4YSPA 1ZLVH 3KHOA 5AFAA 3S3CB 2I24N 3NTCL 3VVVA 1PX4A 4R5VA 1TSRA 5IVOA 4MJ6A 2YGOA 3RB5A 2TSAA 4QXGL 3ILEA 1I3RB 5TFSH 4EVNB 1UJ3B 3LH2H 5F1KC 3ATEA 1U95B 2GUOA 2Z6FA 2Q76A 2BSSA 5D96C 2RACA 1D2PA 3VFSB 1EO5A 4EZMA 4WWPA 3QCVH 4ESKA 1PVHA 1BMZA 5E8PA 1WCBA 3GJFA 5FYKU 5IJKA 3B43A 5TQ2H 4E5XA 3F83A 5EU6E 2HJFA 4P5KB 5A2IH 5B38G 3ATFA 4ONOA 5G4OA 3UBXI 4A7TA 4JO4H 4EDXB 3QQ4B 3NABH 1U8HA 2IBZY 4M7ZC 1BFVH 1NICA 4W6XB 3WKML 4J3OH 4IBUA 1K6QL 1TYRA 5AZ2L 3CVHB 5T33H 2R4SH 3BUTA 1CFTB 2HWZL 3DWTA 3QH3B 5F6IC 4DVBB 2XZZA 3EFOA 2J1WA 2W9LA 3UOAB 1BD2B 3VGAB 2PR9A 3H0TA 3PJSB 4I1NB 2EDBA 2MHAA 4H2AA 3SKJH 5C0RL 2WLNA 2JKXA 4G80A 1JCVA 4KVNL 4LIQL 4A2EA 2ZYIA 3ILQD 3KJ6L 3NCXA 3QUZB 4YSRA 1Z2KA 1G7JB 1KV3A 4ZOEA 2Y6SD 4M7LL 4PGEB 3BAEH 1MQ8A 1NEUA 4MZ2A 5MI0B 3LZFL 3VH8A 4G7YL 3DPBA 1NTDA 3Q5YA 4I1RA 4NM4H 1I1FB 1K4DB 1C7TA 5HHME 3KM1A 1HDMB 4OJFL 2P44B 2DWEA 4JM4L 4F7CA 3UTQA 4I2XA 1HI6B 1Q38A 4FQJL 3KDMB 1Q9LA 3GHEH 4GSXA 4K3DH 2UUDH 4MNQA 2DJSA 4WW2C 2ARJB 2YMXH 1A66A 4XZUB 4FG0A 3ARDD 4OY9A 3DHMA 4AQ8C 3KXFB 4QAWA 3HE6B 1J8HA 2QPEB 1HJBC 1PDKA 3BVTA 1CYXA 4K3HA 5ABDE 1XEUA 3QDAA 4NZJA 3DXAB 5GRZA 2ICCA 3GSOB 5CJBA 1CICB 5ID0B 3CQFA 1V3MA 4JO3L 3HZKB 1MWAH 3ZKMD 4XCFL 2RHEA 1DQVA 3FMGL 1DANT 1NBYA 3BLPX 3HTLX 4FTVA 1PG7W 4CVXB 1GYCA 4RISL 5D2LB 1GKOA 1EHAA 3GMMB 3N6YA 4FNLH 5D8JH 2Z31D 1I8MA 3KNBA 1ACXA 4KJWD 4N22A 1A6AA 1OVZA 1B0GA 4WEBL 5KTEL 1H6TA 1E4HA 1ASOA 3QEQE 5D1QD 4FQQB 4YSCA 3IDMB 4A2DA 3NOIA 3LMJL 3ZE0E 4F58H 3TEZA 3LVTA 5KVMC 1FFNA 3HIZA 3MC0A 3NN8B 5F1IA 5KS9F 1SBSL 1GXEA 1YEWA 4E42B 3EOAA 1D5MB 1L6XA 2BC4B 2YQ2A 3S7GA 4PJEB 1NWPA 3U6XA 3ZX1A 2XSKA 1RFDH 4KZDH 3PUUA 5EEWA 1K2DA 4L3CB 1LEKA 5IW1B 3WFDL 2WKGA 4PB9L 4N0CD 5DURD 1C5CL 3ETTA 1CXLA 5DVPA 2WLMA 3VFMA 3ZDXF 3Q44A 4MD5A 3IM1A 4L3EE 3R8BB 4FFZA 3CZEA 5FW7A 4LESA 1FZJB 3C09C 4NAJA 3X11B 4GW1A 2YO3A 5HDRA 4D0CB 4YSUA 4TTGA 1TZHB 4PRAB 1AS8A 2FDBP 2C3GA 3D2TA 5F6HJ 1TNNA 1UKQA 2R1WA 2EEAA 1IGYB 1KLUB 4GAFB 4NCC1 3W2DH 3T71A 1BBJA 4F1SA 5JORB 2F54D 3IMVA 2VZVA 2BPBA 1RZJL 3V0WH 1LNUA 4FHKA 5LWYH 4F8QA 1P84K 4XRCA 1JV5A 2HRPH 3ESMA 3MNZA 3U0TA 1N4XH 3VYPA 1EBPA 3QUYD 4GP8B 2DS4A 3SPIA 5AYQA 4N25A 4C83B 1PBYA 1I31A 4E41B 4DEPC 1J0HA 5KAQG 3EJYC 3GDBA 3MNWB 1KYDA 3NZHL 1B9KA 3WAJA 5BOZG 5C0BE 4JM2A 1CD8A 5FK9B 2DPKA 1Z9MA 2YUVA 3CPLA 4IOSD 4JAMB 2XWZA 1OE3A 3NH7L 1FNEB 1EZSA 4KRMB 2HA1A 3E6FB 3T65A 5JLZA 4LDLB 5ESVB 2ZXCA 2N0KA 4FNRA 4CVWA 2PXYB 3LRGA 4K5MA 2J12B 1U91A 1C8QA 4N1CA 2HX9A 5HDBF 1KYOJ 1Y07A 5EC1A 1AGEA 1DUZA 4NAMA 3PQYD 5I6XB 4M43H 2QVTA 5GJTL 3UAAA 3E8UH 1RPUA 5LBSL 2PWHA 3SBWC 2NNAA 1BOGB 2W38A 3HR5B 2Y7NA 3B3IA 3GMPB 4MJID 1OPGL 3PV7A 4PR5A 4ZUUB 5L0QB 3GRGA 3O6FD 1ZXQA 1J0JA 1TO5A 4PW3A 2M8XA 3S37H 1VB9A 4FYSA 3FT1A 3KPPA 2CK2A 3TA3D 4TOYL 2Q3ZA 3LXCA 3MOBL 1PYWA 2WJ5A 1E9OB 4ENZA 3OKDA 4P23C 2IGFH 1Z5HA 4OCLC 1A6UL 1FUNA 5IOKA 1IKFH 2GEEA 3EH3B 3FOLB 3HPLB 3HVNA 1YRKA 3S3BB 4MAYA 1I8KB 3CWGA 4FQCH 3GMNB 4PFEA 4XVJH 2WAHA 4ORZC 1A65A 5DJXB 3BC9A 1OCWL 4K9EC 1G7PB 3CDZB 2W80C 5ID1A 4ZFFA 3OR7A 1JPST 3QHTC 4XHQA 3R0NA 3X13A 4XP4L 4YE4H 1BVKB 1HC1A 3MRPB 4CU6A 4HWZB 1ETZB 4JJHA 4PBXA 4FG6C 5IV2A 1Z9NA 1UD3A 2VR5A 3BGFB 5BRZA 3T2NH 5TFSL 1AHMA 4YHOL 5GIRA 1BF2A 2FHCA 2ZUQB 1A9BB 4IGBB 1UYWL 1KY6A 2CRYA 2FWSA 1BZ7A 5T5FH 5DI8A 3HZMA 2B3RA 1EXUA 5T5NF 2Z4QB 4ODWB 1P69B 3MRIB 5I0DA 1K5WA 1AGCA 4AIOA 2CSPA 1CL7L 1MHEB 3OXSB 1THCA 3BFWA 3UO1L 1FAIH 1BJ1H 1IFRA 2BSTB 4MB4A 3W11D 4B9PA 2FSEB 1RZQA 2JTYA 5DJ6B 1LXMA 4NHCH 3BJLA 3DMMA 5AW2B 2BDNH 3VXQB 4Z7OB 1HHJB 2EKJA 2B1OA 5C0BA 4QRPE 3SN6N 4JL1A 4FXKC 3BKJL 2H0EA 2MEJB 1ZHNB 1KGJA 2ERJC 5I71B 3ARYA 4XGZB 5J0BA 1UZ6E 5ANHA 3K6OA 1UM5H 1TJHH 3MV9A 4PREB 4M48L 3IFLL 4H20H 3MRCA 1A7OH 2WZPA 1CTNA 1UOKA 2CHDA 5DT1L 4PTUA 2X1XR 5FV2A 1X5FA 4OJDH 3KWWB 4UDTA 1MUJB 4U1JA 4OLZH 4XN2A 5FYJE 4YK4B 2GPZA 3GI9L 3MU3A 4PJ9B 4EMZA 5LBVA 1BLNB 3ZMEA 2ENSA 1IJNA 3NT0A 2VQUA 4JR9L 5CBEB 2PLTA 3JWOH 3O3AB 5FW6A 3BAEL 3EADA 3ARBB 1KN2L 2Z7UA 1DN0A 1RSYA 2G5BB 3M1BA 3QXWA 1R1CA 4YPJA 1XTMA 1CF1A 4PJ5E 3CFBA 5ITBH 4ECNA 4C4BA 1CN4A 3UZVB 3GJEA 3UJJH 3GHEL 5DRXA 3VRJA 5KG9B 2C9PA 2IDTA 1NFDA 3OGCB 4GQRA 1DBAH 4EXPX 1W15A 2JJVA 2HKFH 2DQGL 4JDEB 4I3GA 1J7VR 4QIRA 3SJVE 3V5HB 3L3KB 3FRPB 1ASQA 2OTUA 2R1YA 3HRZC 3AREC 2IPUG 2PWDA 1CK0H 2OP4L 5C86A 5IFAL 1PMYA 2YXWA 4GFTB 3GT6A 1ZDSA 5IB5B 4NO0B 4O02A 4IRJD 5A3IC 1YQVH 1GS8A 1SDYA 2DQCL 4NQEE 1WBXA 1I3VA 3LS4H 2Z34A 5ISZE 3S36X 1FL3A 1L7TL 4E9TA 1X5GA 2WQVA 3BO8B 3EYOB 4R7VA 4FNLL 1GJWA 2WWMC 4NT6A 4RMTA 1N64H 1FI8C 3ISYA 3VFRB 4P3CL 2WUBL 5TF0A 1MKFA 1K72A 1CLZH 1UCTA 3GHBL 2WXPA 1U8MA 7FABL 1YMMA 2IH3B 2X12A 4HZ1A 3X3GL 3UZQA 4A68A 2PYEB 4G1MB 4QTHA 4N0YH 4NEHB 1GSMA 1EMTH 1UHVA 1WYJA 2D3NA 3BH4A 3OG4B 2VXQA 3PABA 3AM8C 4X6FB 1ZV5A 5HHVH 4LASH 3TBTB 3O3BB 2CUHA 3CFEA 5EB9A 5TF1H 2BHFA 4Z7QB 3ZZ1A 1S6NA 1CFVH 4XMZA 1KB5L 2RCSL 2WINA 3O3UN 1UD5A 4OKVB 2ZCZA 4U1IB 4DVRH 1AQDA 1WD9A 4UDUA 4C57C 2OYLA 2Q6WB 4YHLL 2PNDA 4OLEA 4JFEE 4WI7A 1MI5D 4HU2A 1G7HB 1RK0B 1YYCA 3OKEB 1KNOB 3HPJA 4BQ9A 4FMFA 3RPKA 3QIWC 2J2ZA 1T0MA 2YD2A 4L4VD 2XTJE 1GGUA 3OZLA 4H1LB 1RH8A 2W81C 3QULB 2OR9L 2V0AA 4UT9A 3CK0L 4IK7A 1XMEB 2F8IA 1RQ5A 2RH0A 4IMKC 4XCEB 1QFWM 2OL3B 1EVTC 3ES6A 3A22A 4KTYA 4LXFA 3P30L 2P5ED 4K5OA 4PJCA 3FQNB 3PU7A 2I25N 4IIZA 5DVNA 5A16A 1UT2A 4ZMZA 2JJTA 2CDGA 2BP3A 4N8CH 5JUEH 2B14A 1JWUA 1JNLH 4GRLB 4FNTA 4URKA 3OKKB 4J8RA 5MP6H 1VA9A 2D8KA 3F58H 4RMRA 4CDGC 3ZK0A 2CQVA 3VXOB 4PJAE 5CEYB 4H26A 3L9RB 4KGLA 1CVRA 3S5LA 4BKLB 4ANVA 4DKDC 1F4YL 1URIA 3DIVA 3QDGD 3RVXC 2CO4A 4E9LA 3SJVA 4YGAB 4LL9A 4KTEH 4ZW6A 5JOFA 2OZ4A 5I30H 4HKJA 4NP9A 5EO0A 1SEQL 3CH1A 5L7XL 2DYSB 2IDUA 2PO6D 3DLQR 5HY9B 4NERA 3VX1A 1MDAA 3EJZD 5EULV 4I88A 4NQEA 2ZYSA 4Y5YC 5CF3A 1PZ3A 2AJZA 5C6PB 1ZLSL 2YD4A 1BXVA 5B7MA 1MHPH 1DQLH 4R7NA 3AC0A 1JZFA 2NR6D 2ZX6A 5L9DL 3CX5J 3IJSB 5E8EB 2OCFD 4NPJA 3PHSA 4XPFL 5ALBH 5GRUH 3SO3C 4ZO6A 2EDKA 4XBEL 2VDNB 3PLYA 1TQTA 1AHWC 1EXHA 1KBWA 1WICA 1JHKH 1P4IH 2YJQA 4FG6D 1BQUA 4PVBA 3P9LA 1A9VA 4PV1C 5TH2A 3SBRA 1AOZA 4NC0B 5CU9A 4CW1B 1DQML 1XTLA 2FQFA 4LVEA 4N26A 4P4KA 4YL9A 3KPSE 3UDWA 4G9FD 4LSSL 3SGJA 3VTTA 4PRIB 4XBPA 3MLXL 3QUMB 4AY0A 2VT0A 3WY2A 3ARVA 4XN4A 5F3BB 4JN2B 4Q6IA 3OSVA 4BV1A 3QUXB 5KWYC 3F6IA 5E9DA 3CLEH 3HI6L 3BZEA 4OTXH 4ZJ9A 2XIIA 4AM0B 2FD6H 1A14L 4Y88A 1M71A 2BHZA 5AVXB 5EU5A 1XGYL 3A3YB 4J1UB 2K3TA 3SY0B 3UABA 3V4UH 3C5ZD 3VE0A 1AAJA 1OIOA 3C8DA 5JQ6L 1QBBA 5JPNC 2ICEB 3WXVL 1D5IH 2LE9A 5TE4H 1FLRL 3P4LA 4NPKA 1NFIA 1NAMB 1DQQA 3VXMD 1SHXA 3MVSA 4JVWA 4GI8A 3ZDXB 3H8NA 1G84A 2F68X 1YG9A 4TYUA 4A63A 3KL5A 5KBKA 1WIOA 4PD4J 2W07A 5K9OB 2VSCA 2CKBB 1F90L 1C08A 2FIKB 1P1ZA 3FCTB 3N1GC 1SZNA 4XODA 5E4OA 4ZFQA 4BKSC 1V10A 1UWXK 2VXVH 1FZKB 4OD3L 3G5YA 2MTAA 4QYAA 4UM8A 3B9AA 3I9AA 4Z8FH 5LQBL 4XX1G 3DSNA 1NPNA 2ESVA 4XNBA 3C5SB 1OAXL 2CUIA 2DI8A 4NLHA 1G0DA 3Q13A 4F2ME 1MQKH 1H5BB 5F7HA 3I50H 2J56A 3KW8A 4NO2B 4K5LA 2ZCHL 1M7XA 1YA5A 1QLFA 4UIMB 5DK2B 3GJFH 3SDAB 4XMTA 3D85A 5C8JA 2XPGA 4PJDA 3WFHA 5DWPA 2WKOA 3JZYA 5AAPA 1QLEH 2YGVA 3L4YA 1KSRA 5DVOA 5I5JA 4YDIL 5AVWB 3KPOA 3IF1A 3ZKSD 5HDBB 3WIHA 3CUPA 3K2KA 1AKJD 1HHGB 3BUQA 1TQBC 2I60L 3QZMA 5ILTH 5J6GA 3TNNB 5EBWA 4Y2OB 1MF2H 1MW0A 4M6OL 3SGDI 4LLMA 2P49B 4TSBL 5IUSA 5D6CA 3KLAB 2DQUL 4F91B 3PCYA 4OCXH 5B38A 1XMWA 2BP8A 4JLRA 4J7RA 3C9NA 1K3IA 4G42A 4WUUA 3O6KH 2O6EA 4GO9A 1QTPA 5A3ID 2FX8L 4UU9A 4L8DA 4PRHD 5FF6B 2BERA 3V95A 3KJ4C 5HYQA 1YN7B 5IHHA 1BGXH 4KK6C 3SPJA 4I48A 1G9MH 1RK1B 2WYTA 4QLWA 2COQA 5JOPE 2ZKWA 2X3AA 4WFEE 1N5YL 4KRPC 1HWGB 1EJ6A 3IDJA 3L4XA 3SB3A 3BSZL 2WWMD 4UMGA 1HOEA 4P59L 4ZFOL 3OC8A 1P4LA 4UAOB 5J5EA 1HL5A 4WENB 1JBJA 1H3XA 3F7KA 1NSNH 2XKNB 1PG7L 2YN3A 1NGQH 4R8WL 2WVUA 3VXTA 4DO5A 4YSOA 2B4CH 1ZVSB 2A9NH 3NJIA 1ZPUA 1N18A 5CMAB 4GUPB 3UACA 3H7BB 5CEXB 3WKYA 3F7YA 4GP5B 4HC1L 5DC2A 1OHZA 1N0LB 4PJIB 5F3HB 3TBSB 3FQWB 3IFPA 4FYTA 4ONHB 1KEGH 1A9EB 3QA3A 1E4XI 2BVOA 1VZIA 1MWOA 1RZ8B 2VN3A 2FH8A 2AV7B 2HTKC 3QQDB 2A74B 4RMSA 4ZO8A 4GKZA 7PAZA 1GCYA 4Q9RH 3U46A 1EJOL 3CXHK 3QS2A 1DSYA 2NZ1A 4ZNEA 2VQ4A 1SXAA 4FNSA 3F12B 1ZAGA 3QI9B 3AGWA 4W9GC 4RMBA 4UQBA 3QIWD 2AK4B 2VLRD 2NX5D 2WNXA 4Y5XB 4F3FB 4FE9A 2H9GA 3RPIA 4U1SB 1IEBB 4UT7H 5L2KA 1XBRA 4YHNA 3TPUB 4DUWA 5C07B 1H6EA 4F2MA 3G5XB 1IQWH 2A9AA 3EBGA 4HSQA 4EN3A 2OCJA 5L8KB 3K6NA 1EZLA 1TMCB 2XIBA 3EZJB 4G8FA 4MB1A 5HJ3B 1U3HA 4L2LA 5HHXH 3ZO9A 2VLJE 2Z1PA 5JDJA 2XV0A 3DJSA 2AP2A 1KENL 3EXJA 2Z64C 3EUDA 4WU7A 3BW9B 4UYPA 4DKFL 1N3NB 2IDFA 2IBBA 4H0IA 3UROR 2R29H 4KOCA 1MCOH 4JZJC 3S8GB 3WTWA 2WBXA 4BH8B 2YPLD 5GISL 3WL9B 4AEIH 2Y1VA 12E8H 3RWJB 4I77L 4U6TA 3QNYB 3NZSA 4LSTL 1CLOH 2WOYA 3FQTA 3BPLC 2DLFL 4OZGB 3UTSA 4QHNA 3S8WA 3NJGA 4JG0H 4L0YA 2JSFA 4PCYA 1BAFH 4PGZA 2XN2A 4WUKL 1KJMA 1ANUA 4Y4FB 3VWKA 4KDTA 1MJ7L 4AXWA 2ENPA 1F2XK 1HZHH 5T3XE 1TFHA 5KJRH 2D3LA 1ZVHA 4ZQKA 1JXDA 1TCMA 1UOVA 2BS8A 1NIAA 4N87A 3T8MA 1RL1A 1E6JL 5IJVB 1MVUA 3S4SB 3VD1A 2VLLA 2HP4A 5CUSL 3TBWA 4WU5B 3V52H 2P8LA 2VDPH 1WFOA 5EMYA 1PD1A 1PQZA 5J12B 3DSFH 1KACB 3TIDB 4YHML 1S5HA 4MA3A 3RNQB 5GGSY 4MNGB 2IPTH 4XWGL 2OX5A 1I9RL 4U1NB 5C3IA 4X0NA 5I1KL 3UBXA 3RL1A 3BN9C 2AXWA 1R75A 3D18A 4IKJA 4LPWA 2DEXX 2QKIA 4M8RA 3WN5B 3GMOB 1Z7JA 2X7LB 1HQRB 3MHZA 3WCYA 2XN9D 2G5RA 1I4FA 5HHQA 5IHUH 1U8JB 3HG1B 5IQMA 1RZGB 1FBIL 3IGUA 4JRWA 3NIFF 4KITB 5MHSD 1OOAA 2NCEA 2MPAH 1BBDH 5LG6A 2Y5TA 4LLUA 2HPTA 3EO0A 1ZHBB 1QTSA 4GT7A 3MRBB 1LP9F 3UTPD 4D0BA 4NQVA 1VZHA 5EC2B 5K5YA 1YJDH 4AGPA 4YWGL 3SPCA 1EGJL 3BSHA 5KVFE 3TASA 3B2DC 2BRRL 1B2YA 3CFUA 4TNWF 3P0GB 1BVLB 1NC2A 3QIBB 4OF0A 5BVJB 1HXMA 2XUWA 1FYHB 3VMNA 4XNXH 4WCYL 4HXBH 4L1TA 4R0LB 3OGOE 4XI5C 1YYMH 4N1EA 5JMRA 3QVAA 2V5YA 3AU0A 3VXPB 1A1NA 4AKQA 1DQJA 3DIFA 1X9LA 1FJ1A 3HNSH 3M1OA 1WDAA 4LSQL 3AS2A 3CZGA 4DJMA 3I3DA 2I9TB 1SFDA 1EHKB 3FOMA 3Q2VA 1HHIA 3DX6A 3WFBL 3U1SH 3BKMH 3WFCL 4I0PD 4I9WE 1P9MC 4TRPL 3X3FL 2FE0A 5HPOA 2HFTA 4U1GB 3SPVB 5LGJA 4KFMA 3R06A 3BZ5A 4UOQA 4FZEH 4KK9C 1KFAH 4UQ9A 5FS5A 1MIEL 1JNNH 1QSED 1M7UA 3U2JA 1ZTXE 2YHGA 3OAYK 1NAKL 4C56E 2NY7L 4HJJL 3RTLA 4AL8H 2B7DT 1CIDA 1S9WB 4FFWC 4OV5A 4G9DB 1N8ZB 2WVTA 4HK3N 1MCEA 2IFGA 4U0QB 1NCUA 4Y19D 3LZNA 1W91A 2UVFA 4HS3A 1MFEL 1NINA 3QDJE 3OKYA 4Q7DA 3BP7B 1T7VA 3MODH 4EZKA 1MCLA 5ICXA 1TPXC 4JGNA 1N68A 2ZAHA 4Y16B 1OTUC 1F4AA 4AUUA 4UNVA 2BNRE 4N2MA 4ZMVA 1E2ZA 4KK6D 3DX4A 3WNMA 5JW4R 2NXYC 4HWEL 4OFYD 1ZDQA 1VCAA 2DQDH 3OTTA 4LCIL 4KRPD 4DN3L 4RIRB 1P2CB 5EO1B 3WIIL 4LCUB 3S0PA 3OAUH 4JQXC 3LSOB 1EV2E 4PJXB 2H47C 1QFWI 3MRNA 1A25A 1QWNA 2D4DA 1FDLH 3APMA 1KTKE 3FO2A 2NDGA 3DGGA 4R90H 4C54A 2XJKA 4FZ8H 3AADB 3LV3B 5H35A 2VDOB 3VGEA 4GQ9H 4LCWE 5GGTH 3U7AA 4FULA 3P11L 1E8ZA 1X5XA 5TPWL 4F9LC 1J9SA 3LQAC 3BZFA 1KB9K 2HTKD 4GOSA 3I02B 1NBCA 4QTIL 4F5CE 1XF5A 1R46A 1NL0H 3AUVA 3P2DA 1NSNL 2R0LH 4KKZA 2GI0A 1ET7A 2X4SB 2J1ZA 3P3YA 4JDTH 5BS0D 3KPRE 2F15A 3JV6B 3DX8A 3AVEA 2H0PA 4MA1B 5BPPA 4G8EA 3Q2WA 3TF7C 4CC0A 1FV1A 3TZVA 3F05A 4FGMA 4JQVC 4KVCL 4LVHB 2F1BA 3N42F 2FJHA 3PDGA 5KSVA 5FUOL 3QJFA 1S7WB 5E51A 3NMEA 3BWAB 4B6ZA 1JF6A 3FFCD 4XMKL 4DO6A 3ECVA 3B7TA 1U8NB 4NJAL 3AG3B 2OYKA 1MH5B 3ZDYB 4JUSA 3R19A 4JPVL 4P2OC 4O02H 2IQAB 2IOIA 2ZUXA 4E9QA 4ANXA 2CK0L 1IVTA 2A6JB 3GMQA 3JTSB 5TDNB 3QQ9D 4FQXB 4D8PA 4JFZH 4C56A 4QRUA 1TTAA 4FXLA 4UTBA 5GJSL 2EDQA 3CX5K 4KMQA 4X4YA 3FRPG 1CCZA 1IQWL 4B60A 1AG6A 3DARA 1PJWA 1L9PA 5JPMB 4WHDA 2J8OA 5KUMA 4QXTB 1E4KA 1IC1A 1A1MB 2C4FU 2F19L 4MNQD 2VAJA 4Y7OC 5J6SA 3BCFA 1RP8A 2BNRA 4M1GL 1EZUA 4Y8AA 4DP9X 1MCOL 3RAJH 4ONFL 2B2XH 2MQGA 3FHEA 1KN4L 1EHLL 1J8HD 2VXQH 4KHXL 1KPVB 3CV5A 2VQ1B 3MLRH 4GRWB 5JO5A 3K8MA 3OJ2C 1D5XB 2BCMA 1U8LB 2EVHA 4MFHA 4HUVB 2NY4B 1E5AA 4Y1SA 4MQTB 4KX8A 4HCRA 5HHOB 4FTVD 1JGEA 5DRWA 1OAQH 5IZ7A 3HUJA 5IVXB 5I1GH 3DYMA 4LLYA 1ODUA 4Y1AA 4QGYA 3CMOH 1A6TA 4YDKL 3HC2A 3PWVB 4LCWA 2AFNA 3BN9D 1MY5A 3INUL 4UT9H 4WFGD 2BJMH 3I6KB 3TWCH 3VFPA 4F93B 2UX7A 1BM3H 3S96B 2ED9A 4FRWA 3U1PA 3GO1L 4LSUL 4XNDA 3BDXA 3TJHC 4L8BA 1BYPA 1JP5A 2QBWA 3IAGC 5KVGE 2P42B 2ADJA 4KFZC 2GYSA 3RDTB 5C0CB 3NJKA 5D7LB 4EUPG 1KPRB 5ACZA 1R5VB 4XNMA 2D0FA 2XFGB 1HKFA 1YAZA 2IQ9H 1M56B 3ESPA 5D2NC 2KHAA 2IDCA 3AAZB 5G4MA 3RWGB 5DWUH 1V5JA 3AFLA 5A6LA 1QI5A 2OZ4H 4OD1H 3RX9A 3FHAA 2FLRT 2GBUA 3ME0B 5GGSA 3VA2C 1FORL 3IXTA 4TUUA 1DBJH 2G5UA 2WW8A 4ZMLA 1I1YA 2F5AH 1T5WA 2VGLM 1SJMA 4X8XA 4BUGA 2OXHA 3QO1B 2CBMA 2UYLA 2Y36L 3LNEA 2XPYA 1P53A 4OZIF 2X4PA 4ZUSB 1A6VH 3HFFA 1BJ8A 1YEDB 1TF4A 4JDZA 5C7ZA 1MHCA 3DVNB 3F04A 1CGUA 2CLRA 1CFSB 3U7YL 4Q9QL 4OI9A 2B15A 3L1OH 5AOLA 1JRHH 1ECZA 3MRQA 4JM2D 2HT4C 2ZAGA 1TTBA 1PU0A 3UJIH 2OS7A 3WE6B 3U30B 4KK9D 2B5IB 3CPUA 3ABKB 1BFTA 3ZKNC 5FECA 4A55A 1CLYL 2ZOUA 3VB9A 3QUKA 3C6LA 1D9KA 1XF3B 3GBDA 2P24B 5EZPA 1K8DB 4B95C 1L0QA 1K4CB 2RAMA 3HE7C 1KT2B 2XQYK 5EO9A 4LOUD 4NZFA 2WCGA 4TUKH 4ZW8A 3SDDB 3T0DA 4FXGB 1AANA 2DMKA 1TU2A 4BHUI 4J4PA 1JNNL 4QHPA 1XIWA 4O2EB 5DU7A 1OY3B 4Z0BL 1OTUD 3IJ7A 5E70A 5ELIA 4YEEA 1PCXA 1NGZA 1VEOA 1CBVL 2NXYD 2EYSA 1TQSA 3EIFA 4XE5B 5FUCE 3N1MC 3VYOA 5J1TC 5FFLA 4U31A 2X70A 4BDVA 2OMWA 3WEOA 4KK8D 2PKDA 4HUXB 1BD2E 1CTOA 1BX2A 3H3PL 4R4BA 5I15H 1UD2A 3VDCA 4UQEA 1JIBA 2V17L 3QR1A 4AV0A 3QWOA 3FRUA 4XCYA 2EYTA 4Z3JA 3FUMA 1BQSA 4A2GA 3VFOB 4OAWB 1VFOA 4YIQB 4J3OF 4AH2B 4ELKA 5HYJB 2JF1A 1XH1A 5JIPA 4L9DA 3VGGA 2OMXB 4E2OA 1O5PA 1PGRB 5DS2A 2APWA 2BO0A 2JWYA 1UXMA 5IR1B 4LCCB 4N90D 4TVPL 4BJLA 3O2VL 3ZHNA 1KGYE 1Q72L 2HFFB 5BRZD 1FNGB 4DGVH 5INDA 8CGTA 5IFJA 4HIHA 1I9IL 2A6KB 1N8OE 4D94A 1JGIA 5AOKA 3UP1A 1TMQA 4IS6B 3RWCA 3SGJC 1HKLH 4D3CH 4UYQA 3L5XH 4X9BA 4L48A 4FLRA 2XBTA 1ES0B 1NGYB 2Q2LA 2DWDB 3KXFE 1PEWA 2W9DH 3QGVA 1YEGH 3BVNA 3LD8B 1AO7B 5BV7L 1EBAA 3HHSB 4HWBH 4H0LC 4U6YA 4MVBC 3DXAE 4Q0XL 3WGUB 3DMMD 1JTTA 3A4EA 1QNZH 4LVOB 3OKOB 3MLZH 2R0KH 3QC6X 1A64A 1LP9B 2J8HA 1I3RA 2AEOA 4EVNA 1UJ3A 4CVZB 3Q43A 4BFNA 1WFNA 1U95A 2GY5A 3CSBA 1MRCH 3ZTNH 4LCVA 5DEJA 3CVIL 2HX7A 2CR6A 3FPYA 3MV9D 1KLGB 3QJRB 4YNYB 2Q87A 2IDSA 3P9WB 3VFSA 5D2LE 5EF0A 2YBRB 1UH2A 2WZPD 5JDSB 3WBDA 3I6LE 5DD0H 2DBJA 5FCUL 1AFVH 3PXHA 1CD0A 4J12A 4P5KA 3KEDA 3QW9A 5SWZB 4OZFB 3Q8AA 2K8MA 1L7IL 2AJXH 2LU5A 1YEEL 4GXUM 4LRNL 4EDXA 2V6HA 1CFMA 3QQ4A 1NMBL 3PGFH 4X0KB 3ZMRA 4KKAC 5I18H 1C5DB 2GJRA 3ECWA 1P6FA 3IDYB 3IPFA 2OK0H 2H3NB 2ZKXA 3S8FB 4WHTB 4PJEE 5A7EA 1JPSL 5D5MB 3CVHA 1T20B 4PB0H 1CFTA 3EKCA 4TNEA 3QH3A 4DVBA 1P5UB 2L7UA 1E5CA 1NMAH 4KX9A 3QFJE 1BD2A 1DE4B 5E2WL 3T2QA 3B2MA 1W72L 3PJSA 2F58L 2EKSB 3L17A 2OAAA 5FO8B 1SF3A 3E38A 2BMKB 1WFMA 2B2XL 3QUZA 2AKRB 3HFMH 4JL2A 4UTAH 2EDLA 1OM3H 1G7JA 4R7LA 4EOWL 4YEFA 5ADOL 3SE8H 4PGEA 4O4YH 4LT7A 2QGCA 2OSLB 2F18A 1QPXA 4R2GC 2GBTA 4L4TE 4XXDA 4GMSH 5D7SH 2GC4C 1I1FA 1K4DA 4OUOA 3TJHD 4E41E 1HDMA 2AK1L 5T5NG 1R9FA 5F1NB 3IN0A 4I0CC 1HI6A 3KDMA 4RDBA 2CG9X 2ARJA 3MBWB 5LNEA 5FYJL 4XZUA 2HT2C 5LXGH 3CIQA 1OT4A 2WO2B 3KXFA 2B16A 3QWNA 3TO2B 3HE6A 2BWDA 1R4XA 4KRNA 2V5MA 4JREB 1RUQL 3N06B 3S5YA 1A6WL 3KYKH 5DUMH 1YMMD 3DXAA 3V10A 2C26A 5AZEH 2XBDA 3GSOA 3V9FA 1CICA 3I3BA 3ZHLA 1YLBB 5ID0A 1RLWA 4NZRH 3G5VB 3HZKA 4N8VB 3FB6B 4TSCH 3M8OH 2RQEA 4DTGL 4IBZA 1ND0B 4W1TA 3DBXB 4PV8B 1E5UI 3OJDB 4KX7A 4CVXA 2Y0SA 3DHUA 5D2LA 1AACA 1O0VA 3GMMA 1PTZA 3L1FA 1IM3B 3HAEB 3IXAB 4W9JC 4EXKA 5DWUL 5A40E 1GTNA 2DN7A 2EO7A 3PWPE 3LNFA 2K0RA 3P4NB 5EUOB 1NKGA 5AZUA 4FQQA 2DQTH 4NKQB 3IDMA 4XNYL 4UOW1 3QEUB 3BVXA 2AMUA 5K9QI 1SY6A 3NN8A 4AM0Q 2G9KA 4XOAA 3ZE2E 3ZKND 1MCBA 4E42A 4L18A 1D5MA 2BC4A 4PJEA 4YDLB 4NIYE 2UXFA 1C7SA 2WBWB 1W0WB 1OAJA 4L3CA 5IW1A 4KROB 4DK5A 4LLVB 4OBSA 3S4SG 1JRHL 2BOBB 2BLFA 2YXVA 2AS5M 3SDYL 4L29B 4OIIH 3OD3A 1LEGB 1SLXA 2B0SL 4YN3A 3UO8B 3E9TA 5DO8A 4BZ2A 3KLDA 1FZJA 5FM5O 3X11A 1EH9A 4D0CA 1A7BA 4JHAH 4PRAA 1HT6A 1KCVH 2RA1A 5KYUB 1VFBB 2A4EA 2E27H 4Y2DB 1FNFA 1IGYA 1KLUA 5JIIA 2J73A 2K70A 1KELL 3ARZA 1IEAB 2X6MA 3MJ7B 5JORA 5L4JA 3DX1A 3ZE1F 2ITCB 2WXHA 3IFNH 4J27A 3APDA 2X4NB 1KCRL 2DM7A 3GBNH 3BWUC 2CU9A 3WNLA 3PRZA 4C83A 4Q8BA 4UV7H 4ZS6D 4WTQA 1X4XA 4E41A 4KDTC 3MNWA 2DWYA 1FNHA 4W6WB 5FK9A 4JAMA 2Z0UA 4N8PA 1FNEA 1HL9A 3E6FA 5ESVA 1UFUA 5F88B 2PXYA 3MJ9A 4MJHA 4XP6L 4YZFE 1IAII 3ZLQC 2BIMA 2E0PA 4H13C 3NJJA 2OMTB 1JGLL 4JFDB 3B7YA 5LB1A 4X5PA 2QSVA 2H6OA 2EC8A 4HCIA 1PPIA 4JFUA 1A7QL 1V3LA 4H5SB 4NZUL 3U4AA 4BZ1L 4O51B 1BOGA 3HR5A 3LAFA 3N44B 3GMPA 3QZWG 1FFTB 2JQMA 4M5ZH 4ZUUA 3ZXAC 1DJIA 2QKIC 1JI2A 4N2CA 4Z7VF 2V2WB 4AENB 4N0UB 3AT8A 1ZGLB 1DN2A 3M46A 5E9DD 5T3XH 4AYDC 3N9GH 1XH3B 1MCCA 5TQ0H 2ADGB 4MVBD 1E9OA 1KTJA 1QSZA 3MA9L 4CBZA 5C7XH 1ZGLM 2KI6A 3GZPA 3S36H 4JFFB 6PAZA 5KZCB 3NSCA 3HPLA 3FOLA 4RFNC 4IHOB 1I8KA 5F9WB 3BCDA 3GMNA 5I82A 4KGJA 2GVYA 2XYCA 5DJXA 2I7OA 2B77A 3ULAB 1G7PA 4Z3IA 3CDZA 1A0QH 1BA9A 5DA0B 4KI1A 1PLCA 3D34A 2WO3B 4YMPA 2WQSA 1B4TA 1R6VA 1BVKA 3MRPA 4HWZA 1ETZA 3T2OA 1WAAA 1SQMA 3WUWG 4ZUVB 1NH6A 2A73B 2QPFA 3O9WC 3PGCB 3QORB 4B96A 4S1DC 3WLWC 1FC1A 3FU3A 3GSQB 3KGTA 1A9BA 2ESVD 4IGBA 2QR0B 4KKAD 3M07A 2CA4A 5IW6B 2Z4QA 4ODWA 2Q5BA 3MRIA 3N41B 5HDOA 3OQRA 1JF1B 4JPKH 4W9IC 1MHEA 3OXSA 2X0UA 5DD0L 3D85D 2BSTA 3JSSA 3KGRA 4NFDA 5DQDH 1MFAH 1S3KH 1OAYH 5ESAB 5E1GA 2FSEA 3GS4A 4KQ4L 5DJ6A 5KVFH 5KJ4A 5B3SB 2AJXL 2FEEI 2PYEE 4CSTA 2GJ6D 1PIGA 3VXQA 2E56A 5IQ9B 2XNAB 4BA8A 1HHJA 3Q5OA 3D9AH 2W91A 5DUJA 5JOEA 1X3DA 4LHUG 3ZGIA 3KPLB 3LIZA 2CJUL 1WT5A 1ZHNA 2H0JA 4XGZA 2HFEB 2IPUK 2KPWA 1WEJL 4PREA 5D93B 1E9QB 3EJCA 4R2GD 4C58B 4HQQL 4WUUD 5DD5L 3M7OA 1IM9D 1IU1A 1L3NA 4HFUL 3CFCH 4P9HC 4G82A 2AEWA 3BP4B 4JFSA 4HDIB 4F1ZA 3KWWA 3TX4A 5IBLC 3L6FB 1MUJA 3DTUB 3ECBB 2N7SA 1PNCA 2Q8BL 2F5BH 4PJ9A 4UTAL 4Z95L 1BLNA 5FOBB 5DS8B 4DZ8B 1H3PL 3SE8L 5CBEA 1AXSB 2HT2D 1INQB 3MCLL 3O3AA 1ZTXH 4FF9A 4YXLL 3ARBA 5CR1A 5IWLA 3W9DB 2CUAA 2ZX7A 2G5BA 4KKQA 2O5YL 3F6JA 1IGTB 1YNKL 2HKAA 2V5TA 3W0WB 3L3OC 1I3UA 3C8KB 4DQOL 4S2SB 5CCKL 4WSJA 4ODHL 3VU1A 3V7AG 3UZVA 3QZPA 4NS0A 4OT1H 3T8VA 3SDCB 4PMEA 5EIIG 5KG9A 3DVFA 4CL7A 4IRZA 3OGCA 4R97B 3QJSB 4HF5H 4NWTL 1HYRC 1TYEB 2X3BA 1CE6B 4JDEA 3V5HA 3L3KA 3FRPA 4DP6X 4HOMA 2EH7H 4JKKA 5IREA 3BQUC 3ZBMA 3QQ3B 4OLYL 1CDBA 2VN5A 3EO9H 4IRSB 5IB5A 1BQHG 4S1SH 4OLWL 4NO0A 5E2UH 5FFGA 3A5VA 1XR8B 3UG5A 1X5ZA 4XO3A 4KPHL 2NOYA 1RIUL 5DHMC 1OO2A 1LWRA 2BY3A 3GM8A 4BFRA 5L2KD 1XD0A 2GI7A 2DMHA 3BO8A 4UB0H 4AV4A 3EYOA 5E2JA 2HN7B 3SCMB 1WK0A 1FFPB 4P2RB 3APCA 3STBA 1KLFB 3VFRA 4N9GB 3DYOA 2YAMA 3B9KB 2R9HC 1JK9B 3AY4A 3MAWA 4J3BA 3T4AC 2ATAA 1UQSB 2R8SH 2IH3A 1JV2B 4ELMB 2PYEA 3HB3B 2NUPB 4G1MA 4HUMB 3RVTD 3TJPA 4B3VA 2OMNA 1PY0A 4X6FA 3KCWA 4XMPH 3TBTA 1TXKA 3G6JB 3O3BA 4O2FB 3LQZB 3W1ZA 1KJVB 3GK8H 4U1KB 4OKVA 4V1DB 2FECI 5DFTA 3V4VL 3MACH 3UTSD 2AQSA 3HG5A 4U1IA 3TEYA 1MOEA 5JR1H 2Q6WA 1AE6L 4QUOA 3IGAB 4HPYL 2XWBB 4PJGF 4DOHB 4HIIB 1G7HA 1RK0A 3OKEA 1KNOA 3FUDA 3VWKD 3ZN6A 1A4AA 1Z9SB 3GZOA 4DUXA 2XZAL 3MRJB 4PJBE 3SKMB 2FWLB 2WXLA 3OKNB 3BQVA 3BPOC 3P54A 1S78C 4H1LA 4N85A 3RX5A 5LGHH 3CIAA 1JERA 3F5WB 4P2QB 4XCEA 1L6PA 2LU4A 4I3RH 2OL3A 4K4KA 3US0A 1XH2A 3V6OA 1FVCB 4OCYH 4GG6B 3GBMH 4X6BB 3FQNA 1YDPB 3NCYS 2CDFB 4G7QB 4I85A 3C2AH 4GRLA 2JIXB 3OKKA 3PV6B 3FUIA 5KW9H 4LPYA 4BELD 2JKNA 5ESQB 3VXOA 1KB5B 5HJDA 5CEYA 3L9RA 4BKLA 3IDUA 1CFBA 5I26A 2X38A 4J3VA 3OAZK 1FWXA 2EIDA 1ID2A 2EE9A 2NW2B 5GGVL 4E36A 4PWJA 1G9NC 3VI3B 1N0XH 5HY9A 3D51A 3OJMB 4X5XB 3BSGA 1MVFA 1RZ7H 4GUQA 2XOTA 3I75B 1E8YA 1ZTMA 4XO4A 4FHJA 5KSBB 2VC2L 2DY2A 1UATA 3FW6A 1T04B 2NTFB 3GQFA 1JHLL 3NJFA 2IGTA 4WGVB 4MTMA 2CNZA 2JXMB 3QDME 3LOWA 1N9PA 4G3YH 5E7FA 1OGSA 3IJSA 5E8EA 5CLWA 3OMAB 2B20A 3RDJA 4PBVC 4XCCH 3UPRB 2YGQA 4KK5D 1WHPA 4HLZG 1FFRA 2KDYA 1ZLUK 5D7IE 2DYPD 4LNRB 3O9WD 4S1DD 2WOBA 3WLWD 5CEZE 1NCCL 4HZLB 4CW1A 2ZYRA 2B08A 1O9VA 1W0YT 3UBGA 3SDXB 2AEPH 1MELA 1WP6A 4PRIA 2BNQE 3KLHC 5FHBH 1R17A 3QUMA 1ZV9A 4NQDE 4JN2A 5AG8A 5F3BA 5IUCA 1KC5L 2DQHH 3BAIA 3QUXA 4K3JH 2ZTBA 2HMID 1QMUA 2PABA 2PW2B 4H8WH 5E4IA 4CA4A 2ILLA 3CHQA 4LOEA 3TN0B 1FG2B 2KPNA 4AM0A 3IB4A 5IMLB 3KYNB 1SPDA 1HZKA 1VAHA 4J1UA 3SY0A 1H8SA 4PJIE 5FKPB 2RQ8A 3KH4A 4K9EL 5F89B 5KVEL 2ICEA 3CN1A 1USQA 1F4WH 1LDPL 4NI6A 4NZ8A 1J8SA 5CCGE 2D03L 4KZEL 2JQZA 1HSAB 3HI5H 1NAMA 1QRKA 2A6IB 2G75B 2Q7NA 2J5LC 5HPMB 3OKMB 4WFHD 3L3IB 4ZYKB 1F3DH 2X9WA 3CAFA 5DO2C 5DUBB 1CDYA 1H8OA 6PCYA 3BYYA 3EF7A 3CFQA 5K9OA 1SN2A 3VW3L 2CKBA 3EJSA 2FIKA 3C87A 4FTDA 2DF3A 3LNHA 3OHXC 3PNWB 1FZKA 4JQIL 5T3ZH 2OR7A 1KJ2L 2I32A 1BVNP 3IKCB 1K8IB 1VFAB 4BA0A 2ZIDA 4U05A 2NY2B 3C5SA 2QQKH 5TE7L 3SHSA 5E1AB 5DEZA 4BWUA 5C07E 2YRLA 2JKSA 5INCA 1H5BA 4NO2A 1TCRB 3A6BH 3CHOA 1AJ7L 5DK2A 4UIMA 1E27B 2JMRA 3SDAA 4JRFA 1UURA 4P57B 1Q4NX 2P8PB 3E3QC 3IJHB 1JXKA 1LO0H 2OMUB 3BAXA 1KDIA 1KULA 2X28A 4KV5E 3QC5X 1FH2A 3U6XS 2YKLH 3IDXL 3R7QA 3JTTB 4AVHA 2WNWA 4Y4KC 5ERWB 1HHGA 1TVHB 5F97E 1WFIA 3FT2B 3H9YA 2YN5A 3TNNA 4HU8A 3OPZH 4Y2OA 1WWBX 3CVHH 4PWHA 2LT9A 1MJUL 2WO4A 3KLAA 2GABA 3BQUD 4U3SB 3GB7B 4JFTA 4IBWA 4PUBH 5CJOH 5E56A 1HS6A 1NUDA 1UZ8B 5FF6A 4AQ1C 1YN7A 3QRGL 4NC1C 2ZUYA 1ZE3C 4AOFA 3TZVD 1RK1A 1KCWA 2F0CA 2G3XA 1BPLB 3ARTA 3GHPA 1WA1X 3LX9A 2XA8H 1AY1H 5HGGS 3IMRA 5CINL 3T2LA 1FGVH 5FX3A 5IQ7H 1YNLL 4P99A 2E7DA 2FWOB 2B9BA 3FFOA 2AZAA 5EZOL 1YPZE 4S1SL 3L4ZA 4IU2B 2XKNA 1CG9B 3QJHB 4FJ6A 3BGMB 5HYFA 3TU6A 4TLSA 3FC8A 1ZVSA 4XP9H 5JHLL 1AXTL 3B34A 1Y7VA 4GUPA 5CMAA 3H7BA 4CU7A 5CEXA 4MZ3A 2IV8A 2WVSA 1N0LA 4KJQC 4PJIA 5F3HA 4QOKA 3TBSA 5AD0B 3AT9A 3X17A 3CU7A 3FQWA 5C0FB 1TUPA 4ONHA 2EILB 1A9EA 1S5IL 2IO5A 4BHUA 3RUGF 3QQDA 4AYMC 1RZ8A 1RJLB 2AV7A 4ZSOB 3S3PA 4BRJA 2A74A 3AW5A 1IT9L 3DI3B 1F8TL 2WQUA 3E8VA 4OQTA 1FA4A 4IK6A 5KANI 1N7ML 3O4LB 3QI9A 2Z7WA 3GPSA 1NEZB 1D6VH 1M7IB 3D1MC 2NQCA 1CXHA 2AK4A 3VG9C 3WNNA 5H37G 2WAQA 2ZE0A 4NGHL 2ZXEB 4Y5XA 5DHEA 1S78D 2C7FA 2HH0L 4JM2F 4QEGA 5F7EH 4TQEH 4F3FA 3LKOB 1JVKA 4U1SA 1IEBA 1NLBH 4YBLC 4ZFOB 4F80A 5JIQA 3TPUA 4RZCB 4V2CB 4RGNB 1ACYH 5C07A 4F8TA 1BHGA 3G5XA 1E6OH 1FYTB 4FCHA 3FO9B 2EINB 1S9XB 2EE0A 2CCVA 4JPQA 5HJ3A 1RCYA 4MHHI 3MZTA 5HI5D 2FZ3B 4NN7B 2IWEA 5D6DC 4Z7AA 5IJDC 4UV4L 2H8PB 3ULUC 1UWXH 3BW9A 4Y1AD 3CZFB 5IESL 1N3NA 1AQKH 4HPOH 1S46A 4M1DL 3WNJA 2G2RB 5MI0C 1SY6H 4NC2B 4BH8A 1JZ7A 2AABH 2Z92B 3GGWB 3RQ3A 3WL9A 5C0AB 4AMXA 4FFYA 3F84A 4FYQA 4S0TD 3RWJA 1QG3A 3KBHE 2A4ZA 1A5FL 2WBJB 2Q7YB 4TLTA 1DBKL 3F8UB 1AIZA 3FN9A 3ROLB 2BP0B 1KMGA 4OZGA 3BD3A 5KEZA 2P5WE 1L9NA 4PWEA 1COBA 5SWSB 5CO1A 2FTAA 1WZ1H 3IRCA 1T1WB 4Y4FA 1VGEH 2PN5A 3UTTB 3SGDH 3ZL4H 4BZ2H 1TJIL 5HDLA 2Y7MA 4W6YB 3UTZB 2E74C 4I18B 2IF7A 1F97A 3GNMH 4FQHB 5D71L 1CQKA 2OZNA 2G9HB 3RIFF 4NKIH 5CILH 1TETL 3U2SB 4GFXA 2GFBB 5IJVA 3S4SA 1RZ7L 1NCHA 3SGKC 2YXMA 3JVFC 1KBKA 5AOJA 1R3HB 2YARA 2V3EA 4HGWB 1A1OB 2ZPKH 4I89A 3TIDA 1L0YA 2A38A 2K78A 3RNQA 4PP2B 2W59A 4HGKC 3U4BH 3FKUS 4MNGA 2G3ZA 5I9QC 4U1NA 5I8OH 3FAWA 4NRYB 3AS1A 2WLHA 4A7SA 2ZCKH 2UXVA 2ZUWA 4A67A 1PX8A 3WN5A 1O7DE 3GMOA 3MJ9H 2X7LA 4KDWA 1HQRA 3TOPA 1UD8A 3MJ6A 1U3ZA 1U8JA 2A5UA 3HG1A 1DLFL 4DGUA 2XN0A 4IHBA 1RZGA 3WXWL 3FUEA 4HK3J 2QQNH 4FDWA 3BHBB 4MXVE 5KVGL 3C6LD 1D9KD 4YUEH 3ESVF 1A3RH 3H6AA 1YEFL 1ZHBA 3V0AC 1MNNA 5IF0B 3MRBA 2MNWA 5EC2A 5CJQH 3S3SA 2DQHL 2H6UA 3CSYB 5IBTH 5CM1A 1EA9C 4K3JL 1G0YR 5JIKA 1BVLA 2WB1A 2XG5B 3G5WA 3QIBA 3QNZB 2X0VA 5DO2D 1KGUA 3T6XA 5BVJA 4QKTA 5L88H 4BWTA 2JNZA 4R0LA 4TTDD 3PWUB 4MQ7B 1A7RH 3FQRB 3VXPA 2AJUH 1ACCA 1BZ8A 3QHZL 2EICA 1VF5C 4WNQB 5EDXA 5DJ2A 3NCJL 3LKSB 4NM8L 4BFIB 1QTYT 4W68A 2I9TA 3DURB 3FU6A 5TK4A 2F61A 2YPKB 4Q58C 5KOVC 1DVUA 2WYZA 5C08D 2Y3NA 4EAEA 1NLDH 3VD9A 2BRQA 3EDFA 4LBEB 2WV3A 4MMZC 3SPVA 5EOCH 3E1ZA 2VDQL 1CTMA 5D1XE 3OL2A 3SQBB 4WO4C 1V7MH 4G8GE 1AKPA 2DKUA 2PXYC 4KHTL 2D3VA 4CN1A 2EVJA 4P46B 5CXPA 1S9WA 3Q1EA 1FH5L 4LKCB 4LP8A 1NFDF 3MUJA 4G9DA 1N8ZA 2A1WL 4K8RC 3QNXB 4NJ9H 4M4PA 4F8PA 4QF1B 4WWNA 4JRXD 3VG0L 2LLNA 3BP7A 3TH2T 5C3LD 1RUPH 1TZGH 2ZWLT 3QNFA 2VM9A 4Y16A 2ZNXA 4MLIA 3ALXA 1CDGA 3O8XB 1GGYA 2YJLA 1ZLWK 3A4DA 1CU4H 3H3BC 1PW3A 4XC3H 3B1TA 1FFQA 2AEQH 3OHMB 5A6IA 4PPTA 3ARSA 4WQOA 3KG5A 3KPQB 3LIZH 4FLQA 4GRWE 4IKKA 4RIRA 1FSKB 1P2CA 3OG6B 5EO1A 1KTLB 4LCUA 4K7PL 1HNYA 4KQ3H 3UYRH 2R2HB 5KVDE 3LSOA 3U9UB 4PJXA 3TJEL 4O5LL 5T3ZD 2MJWA 2YUXA 1MG3C 1TTRA 2K9FB 2VTFA 2XX1A 2Y5QA 2Z8RA 3SODB 4M7KH 1P5VA 3PXJA 5FWRA 4GEIA 1WZKA 4HXAL 1OAUH 2FQEA 2K7QA 1UGNA 4DPRA 5DC0A 3DV4B 1E3XA 1SHWA 4GXVH 3LV3A 4BM7A 4XOBA 3ULSB 4Y9EA 1N26A 3MKKA 1Z3GH 5F7FA 4HT1H 2DEWX 3REWB 1NKOA 1GJUA 3I02A 3M7FB 2ZD0A 3E80A 2UZYB 4W9ZA 5TDOB 5CZXC 1GIGH 5E8DL 2X4SA 3CHRA 2CLVB 2PP8A 4FEIA 3ZDZE 5C71A 3I9GH 1HH9B 1KG0B 4UILL 2WUCH 2IAMC 3JV6A 4W4OC 3U36B 5LCVL 1OP3H 4AIZB 4OFQA 3KL0A 4IRZH 4DESA 2EVIA 4NUGH 4ZAKB 2LU7A 3MRKB 3Q6FB 2YAEA 3DYPA 2HVJB 1KEMH 1EO8H 1S7WA 4EJ1C 4LDOB 3ZR5A 2AJSH 1NIEA 3BWAA 2AVGA 2BSCA 5F96H 1DJHA 4PVNA 4J3OG 3FBKA 3QHFL 1SQ2N 1U8NA 2X42A 2BINA 2WWOA 3C08L 4PJ7B 1MH5A 4PJCF 5ANME 4GSDH 5EORH 4TVUA 1E28B 3B8SA 4ZK8A 4DETA 2IQAA 2A83B 3CU1A 1YC7A 4L5FE 1SDDB 2A6JA 3JTSA 1BXXA 3NJHA 5TDNA 4FQXA 3IBEA 4OM0H 2CO7B 2V8MA 1G94A 2NNXA 1AI1H 4N2OA 5DLMH 5AW1B 1ILUA 5JPMA 2VERN 4Y8DC 1A6ZB 5JXAH 3TBBA 3ULVH 4QXTA 1BQHA 4AGOA 3AQZA 4OJAA 4YK4C 4ZS7H 4JNXA 4L1HA 2PCXA 1A1MA 3HG4A 4PJ9C 4ALAC 5A2AA 3NCCB 4JY4B 4MQXC 3QG6B 4JRYD 3VFWB 4XVSL 3EGDB 3HE6D 4G71B 4KDVA 1KPVA 4S1RH 4ZTOH 2VQ1A 4PYGA 1D5XA 1WV7T 2B1AL 2XTSA 4JO1H 1U8LA 4GNKB 2NLJB 4HUVA 4O9HL 1EEUA 4WLCA 2VXTL 4PW9A 2OYMA 3D08A 4JFHE 4FCAA 1RUAL 1ZHKB 3BUIA 2FX9H 3EH1A 4Q9BA 2NY6B 5HHOA 4XNAA 3MR9B 5K33A 4M93B 5IVXA 1QEWB 5D1ZB 5BOPA 3CDYA 7CGTA 3WNIA 3DV6B 3V0JA 3TH3T 3PWVA 4H1LH 2EO9A 2N1TE 1QFWH 3E7JA 4MYWB 4UAHA 3I6KA 5EU6B 2KLTA 2HG5B 3S96A 3L4TA 2OL3H 5F9JB 1T03L 25C8L 3LB6C 1VKXB 4W4NA 1UWEL 2HFGL 3PFUA 4TNFA 3RDTA 5C0CA 2QLVB 3MUUA 5HGBB 5D7LA 5HI3D 1KPRA 1DZBA 3ZU8A 4YXKH 1R5VA 2KQNA 2XV2A 3D4ZA 1SLWA 4OIAA 4N2AA 4L0ZA 2FR4B 1P6WA 4C4UA 3GUTB 2NY1B 3T3PF 5LAXB 5EH1A 3APFA 3AAZA 4KTDL 5TGBB 2WTOA 3RWGA 2C9XA 1FPTH 1WZAA 5CD5D 4DT2A 1GYAA 3T2PA 4J2XA 3ME0A 2D4FA 3A0OA 4MDRA 3P0YL 3F7QA 3O0RH