2OPFA

Crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli (r252a) in complex with ap-site containing dna substrate
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
262
structure length
256
Chain Sequence
b'PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGQVDALFRFKVFHRDGEPCERCGSIIEKTTLSSAPFYWCPGCQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*GP*CP*TP*TP*CP*AP*TP*CP*CP*TP*G)-3'
molecule tags Hydrolase/dna
source organism Escherichia coli
publication title Active site plasticity of endonuclease VIII: Conformational changes compensating for different substrates and mutations of critical residues
rcsb
total genus 83
structure length 256
sequence length 262
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2007-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2opfA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 2opfA01
2UXBM 1N32M 3T1HM 1Z5BA 1XMQM 3GQ4A 4LFCM 3GQ5A 2F5QA 3GPPA 4YY3M 2E5LM 4JI3M 2VQFM 4LFBM 2F5PA 1Z59A 4LF7M 1HNWM 4DR4M 4MB7A 4NRVA 5ITTA 2F5NA 3OTOM 4DV1M 3U6OA 4CISA 4JYAM 3J80S 3JR5A 1J5EM 2UUBM 4LF5M 3U6MA 1TDZA 1N34M 2OPFA 1Z5AA 4DR1M 3J7AS 1Q3BA 3U6LA 1K3WA 4JI0M 1L2BA 1I94M 3SASA 4DV3M 3SAUA 4B3RM 4DV6M 3SAWA 4JI2M 5ITQA 3T1YM 4B3SM 3SAVA 1Z5CA 1XNQM 1HNXM 3U6DA 1KFVA 4PDIA 4AQYM 4G4QA 2XZFA 4G4OA 4JI5M 3U6SA 1TDHA 2VQEM 1FJGM 1L2CA 4JI1M 2UUCM 2ZBKB 2F4VM 5LMNM 4DR5M 4LF6M 4YHHM 4B3MM 5LMUM 4PDGA 2UUAM 3W0FA 3J81S 2XZUA 1HR0M 3SARA 2F5OA 3VK7A 4DV4M 5IT9S 3TWLA 4JI6M 1EE8A 4JI7M 1PJIA 1L2DA 3C58A 4JV5M 5ITYA 1NNJA 3A42A 3VK8A 4G4NA 4LF4M 5FLXS 4DR3M 1L1TA 2HHHM 5IWAM 3GP1A 3A45A 1Q39A 2ZM6M 5BR8M 3U6CA 3U6PA 4LF8M 4NRWA 5ITRA 2EA0A 2Q2EB 2OQ4A 4PD2A 1R2ZA 4PCZA 1Q3CA 4ITQA 3GPUA 4LFAM 5ITXA 4KHPM 4X66M 3GQ3A 1XC8A 1IBMM 1XNRM 1IBLM 1XMOM 3TWKA 4DUZM 2HKJA 2UU9M 4DV0M 4K0KM 4B3TM 1K3XA 1MU5A 3SBJA 2UXDM 4X64M 4LF9M 2UXCM 4GKKM 4DV7M 2F5SA 3JAMS 1L1ZA 1HNZM 3JR4A 4OX9M 3GO8A 4G4RA 4DR7M 4GKJM 4DR6M 1PM5A 4NXMM 3U6EA 3TWMA 4DR2M 3U6QA 1PJJA 4JI4M 4DUYM 4JI8M 5A2QS 4DV2M 1MX0A 4X62M 1N36M 1IBKM 3GPYA 1N33M 1R2YA 5ITUA 3GPXA 1K82A 3DOAA 4X65M 3SATA 4NXNM 5ITXE 4DV5M 3A46A
chains in the Genus database with same CATH superfamily
3B7QA 3SMSA 2CE7A 1TH3A 2O01F 3GLHA 4Z6YA 3GRVA 1N32M 3K2LA 2DENA 1XMQM 1NNUC 2G3QA 2XFTA 2DAKA 2ZTDA 3UMMA 3GQ5A 1N77A 2J5YA 2F5QA 2XLJA 2E5LM 2LVOC 3AFHA 4AI6A 2I7NA 1SG9A 3EIHA 3FKEA 1OTRA 1Z59A 1HNWM 3TE6A 4MB7A 4NC6A 5ITTA 4CISA 1IXSB 2EJSA 4AZFA 2XEPA 1HT1E 4M0WA 4REZA 4I5SA 3JR5A 3QYBA 1PGYA 3U6MA 1N34M 2R65A 2L6OA 1Q3BA 5DYGA 3KSXA 2JP7A 3VKHA 2LVAA 1VG5A 3LCVB 1QZMA 2RKOA 3SAUA 1SXJE 1V92A 2DZLA 2KNAA 2WSFF 3AOEA 3ZC7B 1H6UA 4ANRA 4LGYA 3SAVA 3TPZA 1HNXM 1OIZA 3B7ZA 4Q7JA 3QAUA 2XSZA 4PDIA 3C3DA 1DV0A 5KPTA 1OAIA 2Z8YM 1TDHA 3K1JA 1NVMA 2RRUA 2R4JA 2R0IA 4NSRA 4DR5M 4KO8A 4B7FA 2CHGA 1ZMWA 3PVSA 3C9PA 4LF6M 3H4MA 4NOOB 4YHHM 1IFYA 1QQWA 5LMUM 3I4VA 2C5RA 5JI3E 4L6V6 2UUAM 2LH0A 4FCWA 2R18A 3IECA 3W0FA 3ZCBB 3J81S 1E9SA 1EIJA 3PNYA 1TTEA 3SARA 1DGHA 1L8QA 4F2LA 2DWLA 4FWHA 1X37A 1HQCA 1JB0F 4LY6A 1PJIA 2Y21A 1L2DA 4RKUF 5ITYA 2GQFA 1QAQA 2I7PA 3GLFA 2CV0A 2L2DA 1ZMUA 5FLXS 1N78A 4DR3M 1SXJB 1DGGA 1TGUA 4WW0A 2HL7A 5EQTA 5IWAM 1Q39A 3LCUA 3GLHB 5BR8M 3IHPA 3U6PA 2EA0A 1QUSA 3TQSA 2CHQA 5JI2E 1QAOA 3BBZA 2JXNA 1GJTA 1D0MA 3R9XB 4KHPM 3Q8XA 4X66M 3E46A 2L09A 3F92A 3W68A 1IY1A 4FCVA 4QNRA 4PT5A 1XMOM 3TWKA 4W5WA 3AL0C 2HKJA 5FTLA 3T6PA 5KQ8A 2RGHA 4B3TM 1WJ7A 2DHYA 3WHLA 4GHAA 1QANA 1OFIA 1GJSA 1HJPA 2LHCA 2Y0QA 4G3OA 4M9ZA 4XK8F 1HNZM 4OVZA 3HJSA 1PM5A 3U6EA 4HEOA 3KS8A 1PJJA 3AOEC 4LZJA 3BXWA 3ILKA 4FW9A 1N36M 1WGNA 2Z4SA 1N33M 3SHGB 5ITUA 4IBCA 2DAGA 3RFWA 2VDBB 2H1RA 3A98B 3DOAA 1MN3A 3HWSA 1QUTA 3AOGA 1R4GA 3U61B 2DXIA 3SATA 5ITXE 4XBOA 2CV2A 1AUAA 3A46A 2MGWA 1JR3D 5EXSA 2CFOA 1QDRA 8CATA 4LZZA 2LWXA 1NSFA 3GQ4A 2WZJA 3GPPA 2QP9X 3W67A 1KYIA 4M0DA 4F1IA 3AKZA 3W0LB 4AG6A 1LV7A 4LFBM 3GLFB 2CUZA 2DWMA 3B74A 2KZSA 2F5PA 4LF7M 4DR4M 1XHBA 4NRVA 4D82A 4DV1M 1GL7A 2V6ZM 2R62A 1UFZA 1J5EM 2UUBM 4GEWA 1Z6TA 2JY6B 3FTDA 1KSFX 1IN8A 2J7OA 3THGA 1VDDA 3UZUA 3QYEA 4DR1M 1GLNA 1JQJC 2MR9A 2YFQA 4LJ9A 2WSCF 4JI0M 5FSWA 1L2BA 3SASA 4OW0A 4A3VB 4B3RM 3UGJA 2L4FA 1NY5A 2LVPC 2GNOA 3GLGE 3T1YM 1AIPC 4B3SM 1Z5CA 3IG8A 1GO5A 3U6DA 2LNHC 1WHCA 4G4QA 2XZFA 1NHGC 2XGNA 4JI5M 1FJGM 4MGZE 2KA6B 3L2AA 2UUCM 2F4VM 2B3TA 3V76A 1P3QQ 1IN5A 2CV1A 1DGFA 2ZAOA 3E4RA 3SFZA 1QVRA 3I04M 5EP3A 1R6BX 3VK7A 2XSZD 2CHVA 4GITA 3TWLA 4JI6M 2WSEF 1J7KA 2OOAA 1VEJA 1GABA 3C58A 4QOSA 4JV5M 1ZMVA 2KNVA 2Z4RA 3ZH9B 1XXHA 2BWBA 4G4NA 2DWZB 3U61A 1G4AE 4KLNA 2JZ1A 1JR3A 2VF7A 4B7HA 1L1TA 2FOIC 2DAMA 2HHHM 3A45A 2FH0A 4JN6A 1XXHB 3U5ZB 4L8RC 4NRWA 5ITRA 2OO9A 1ZAEA 2R44A 4LGMA 2K47A 4II7A 4PCZA 4ZPXA 4BB9A 3CGWA 3VFDA 3GPUA 4LCBA 2MJ5B 1YE9A 3KVWA 2K9DA 4R7GA 3GQ3A 2DNAA 1XC8A 2X49A 2Z3XA 1G59A 1VEGA 4L15A 4CGYB 2CP8A 2ZAMA 2UU9M 2KHHA 3RGSA 1S3SA 1W5TA 3NBXX 1K3XA 1MU5A 5H37D 2UXDM 3I51A 2EO2A 3FUVA 4G6ZA 2QSFX 4LF9M 1GKIA 3HJ8A 4DV7M 3JAMS 4LG2A 1G8PA 3KSJA 2DAIA 3VLFB 4D81A 2P5TA 4MGYE 4NXMM 1DO0A 4QHSA 2YR0A 2KRUA 4JI8M 2YNMD 5A2QS 2CWBA 2HWJA 1D2NA 2LHGA 5IZ7D 4DV2M 4TUWA 5C1BA 1MX0A 5BPVA 4IBEA 3HHZA 2JZ0A 3GPYA 4FWGA 4IBGA 1R2YA 4GC9A 1IBKM 1TH4A 3GRRA 3FD9A 2FFJA 1VQ1A 4LJ4A 4QOZC 2FE8A 4X65M 2KW0A 3FRHA 4LF8M 4I8OA 2XFSA 4P16A 4B08A 3U5ZA 3K9PA 1ORYB 2QBYB 3ZQJA 3MK6A 2D7HA 3T1HM 1Z5BA 2DI0A 4XGIA 4AW4A 1OIPA 3I01M 2VQFM 1IM2A 3KS4A 1XWIA 2KXEA 3I4YA 2F5NA 3U6OA 2C9CA 2JNHA 1IN4A 2R4EA 2Y0TA 1IY0A 2EKFA 1WGLA 3KW6A 4GIPA 1IN7A 1T3TA 3FUUA 2QZ4A 1PJTA 4LF5M 1DGBA 1QDTA 2JUJA 2LBCA 4QNMA 1K3WA 2FS1A 3KP0E 3KOYE 2DAEA 2LTUA 4IBJA 4R71A 4DV3M 4IBBA 3SAWA 3PXGA 5DNYA 3KDSE 3NBIA 3PNVA 4IIWA 2M5ZA 3GLIE 4LJ7A 1GVNA 1FNNA 1PJSA 3DZDA 1YUBA 3FUWA 1TH2A 1L2CA 4JI1M 5KPZA 3U60B 1PRBA 2JY8A 3B7NA 2HAKA 4GMQA 3RGPA 3VKGA 1IXZA 2D7EA 5L8RF 3FYCA 4R3DA 1N75A 2D7GA 3HU2A 3KOZE 5EJCA 1TF0B 5EXPA 3FYDA 3HKPA 4DV4M 5IT9S 1XB2B 2C98A 3VDUA 4OU7A 4EIWA 3B89A 4LJAA 3WHKA 4MGKE 2L4EA 1OQYA 3SMPA 4LF4M 3HZJA 1OJLA 3HU1A 3FRIA 4IBIA 3GP1A 2KNZA 4AG5A 2VF8A 1VDLA 3H4JA 2ZM6M 3U6CA 3KP1E 3TL4X 2HCBA 2JA2A 5F3WA 1QZEA 3HJQA 2X8AA 3MHVC 5E26A 4ITQA 1D0LA 3L27A 1G41A 2MROB 1C7YA 3UK6A 1C1KA 1IXSA 4M9SA 4NSOB 2LXEA 3GLHE 1CUKA 1XNRM 1IBLM 3D8LA 2C99A 3L26A 1VEKA 3FTFA 3DFZA 4IBKA 4K0KM 2VIIA 4M9XA 4OVZB 1BVSA 1A5TA 2BJVA 1YLAA 4X64M 4AKHA 3LQRA 2QPAA 1F4IA 2FNAA 2K6BA 2UXCM 1IN6A 2YQZA 4GKKM 2O25A 3FUXA 4KT0F 4RF0A 3JR4A 1ZQ9A 3SHFA 1YSYA 7CATA 3GLFE 3HX3A 4G4RA 4OX9M 4DR7M 4GKJM 3R8FA 2C96A 5DYIA 4BBAA 4DR2M 3U6QA 4JI4M 1HT2E 2KEBA 3LW5F 1R5LA 2QENA 4Y28F 4X62M 1DO2A 4IBFA 3LVVA 3FTEA 2Y20A 2A5YB 3CF2A 3PFIA 4HLQA 5E6JA 3SYKA 3GPXA 1EFUB 1SXJA 1IY2A 3LQQA 2R46A 3SC3A 3VDPA 3KOXE 4GHLA 2K0BX 3HU3A 2DWNA 4IJEA 2C9OA 3LMMA 1WIVA 2Z7JA 3J7BA 4IBDA 2UXBM 1DGHB 2KDLA 3CF6E 3AJIB 3DA1A 3E9SA 4LFCM 1NV9A 2BNKA 1OFHA 4YY3M 2ZTCA 4JI3M 3J27B 1T43A 2G8LA 3EIEA 3M0EA 2DHRA 3T15A 1HQYE 3FE3A 3IG5A 5EXXA 3UJNA 3OTOM 3GLIB 4JYAM 2M60A 1WXQA 1NJFA 5EP4A 3J80S 3SYLA 1GL6A 3BOSA 1W5SA 5KPRA 3K8ZA 5FTJA 5GKNA 1PJQA 1TDZA 2OPFA 1Z5AA 3J7AS 3MJ5A 2QCUA 2ERCA 3U6LA 1IXRC 1LTMA 1XXHE 2JY7A 1I94M 1I4WA 2XF3A 3NWLA 1D0KA 4D80A 3GLIA 4CHTB 2KZUA 2BJWA 3L28A 4LJ5A 4WP2A 4WURA 3MMPA 4L4UA 4HL4A 4LJ6A 5ITQA 2AHMA 1XNQM 4MGIE 1T6OA 4RF1A 1TR8A 1KFVA 4AQYM 2J7NA 4G4OA 3U6SA 4Z8XA 1NJGA 2VQEM 3KXEC 5KO3A 2KRKA 2ZBKB 3K9OA 1OAOC 5LMNM 3HHWA 2G5GX 2XH9A 1V33A 4JXJA 3QWLA 3Q8GA 4DBGB 2LVQD 2DZOB 1NY6A 2X4AA 3GRUA 4B3MM 3B9PA 2OOBA 4PDGA 2XZUA 3LVWA 5EP2A 2DVWB 3FUTA 3CF0A 2JWSA 1HR0M 2V1UA 3HGIA 1Y8GA 2F5OA 2BWEA 4I4LA 4IJFA 2QBYA 2W82A 1E94E 3M7GA 4GC5A 4P17A 1EE8A 3KOWE 5EXTA 4JI7M 4FVMA 1J09A 1E32A 4AKIA 3E21A 1R7RA 3A42A 1RU3A 5C18A 1NNJA 3VK8A 2DKLA 3CTWB 4QHTA 2NQ8C 2O5RA 5EP1A 1SXJC 4LRTA 4L16A 2L7HA 4CIZA 1E9RA 1NO1A 1WR1B 2N35A 5FTNA 5IREB 4GH9A 2Q2EB 2R6FA 2OQ4A 3M6AA 4FD2A 4PD2A 1R2ZA 3L25A 1Q3CA 4NL4H 4RNAA 5DFLA 4CJ6A 4JI2M 3KFUG 4LFAM 5ITXA 2CRUA 1QAMA 5FTKA 2MH8A 1G71A 2LVNC 3T38A 2EKKA 4KODA 1V34A 1IBMM 3K92A 4FWDA 3L29A 4MGHA 4DUZM 1IQPA 3D8BA 4AKGA 4MM3B 4DV0M 4GRIA 1QYRA 2V1CA 1ZV1A 3FTCA 3HHXA 3SBJA 2EUCA 4L78A 1G3IA 4FCTA 2QQ8A 3GRYA 3HHYA 3U60A 2DZNB 1OKSA 4UN2B 3RE8A 3HY5A 1L1ZA 2JY5A 2F5SA 1UM8A 4LJ8A 3GO8A 2L7IA 4DR6M 2RGOA 3C3EA 3TWMA 4BLCA 1JR3E 4DUYM 1SXJD 1NV8A 3GLGB 2CEAA 1MJGM 4B7GA 1NHWC 2ZANA 1Q02A 4DV6M 2QHOB 4S12A 5FTMA 3J2PB 4LRSA 1K82A 2QNJA 2APLA 5KQDA 3GLGA 2H5XA 3AV0A 4I81A 4NXNM 4DV5M 4MH0E 2R45A
chains in the Genus database with same CATH topology
3SMSA 2CE7A 1TH3A 3GLHA 4Z6YA 3GRVA 1N32M 3K2LA 1XMQM 1NNUC 2XFTA 3UMMA 3GQ5A 1N77A 2F5QA 2XLJA 2E5LM 3AFHA 4AI6A 2I7NA 3EIHA 3FKEA 1Z59A 1HNWM 3TE6A 4MB7A 4CISA 5ITTA 1IXSB 4AZFA 2XEPA 1HT1E 4M0WA 4REZA 4I5SA 3JR5A 3U6MA 1N34M 2R65A 2L6OA 1Q3BA 5DYGA 3KSXA 3VKHA 1QZMA 2RKOA 3SAUA 1SXJE 3ZC7B 3AOEA 1H6UA 3SAVA 4LGYA 3TPZA 1HNXM 3QAUA 2XSZA 4PDIA 5KPTA 1TDHA 3K1JA 1NVMA 2R4JA 4DR5M 4NSRA 4KO8A 4B7FA 2CHGA 3PVSA 4LF6M 3H4MA 4NOOB 4YHHM 1QQWA 5LMUM 3I4VA 2C5RA 5JI3E 2UUAM 2LH0A 4FCWA 2R18A 3W0FA 3ZCBB 3J81S 1E9SA 3PNYA 3SARA 1DGHA 1L8QA 2DWLA 4FWHA 1X37A 1HQCA 4LY6A 1PJIA 2Y21A 1L2DA 5ITYA 3GLFA 1QAQA 2I7PA 2CV0A 5FLXS 1N78A 4DR3M 1SXJB 1DGGA 1TGUA 4WW0A 2HL7A 5EQTA 5IWAM 1Q39A 3GLHB 5BR8M 3U6PA 2EA0A 3TQSA 2CHQA 5JI2E 1QAOA 3R9XB 4KHPM 3Q8XA 4X66M 2L09A 1IY1A 4FCVA 4QNRA 4PT5A 1XMOM 3TWKA 4W5WA 3AL0C 2HKJA 5FTLA 5KQ8A 2RGHA 4B3TM 3WHLA 4GHAA 1QANA 1OFIA 2Y0QA 4M9ZA 1HNZM 4OVZA 3HJSA 1PM5A 3U6EA 3KS8A 1PJJA 3AOEC 4LZJA 3ILKA 4FW9A 1N36M 2Z4SA 1N33M 3SHGB 5ITUA 4IBCA 3RFWA 2H1RA 3A98B 3DOAA 3HWSA 3AOGA 3U61B 2DXIA 3SATA 5ITXE 4XBOA 2CV2A 3A46A 1JR3D 5EXSA 2CFOA 8CATA 4LZZA 2LWXA 1NSFA 3GQ4A 3GPPA 2QP9X 1KYIA 4M0DA 3AKZA 3W0LB 4AG6A 1LV7A 4LFBM 3GLFB 2CUZA 2DWMA 2KZSA 2F5PA 4LF7M 4DR4M 1XHBA 4NRVA 4D82A 4DV1M 1GL7A 2V6ZM 2R62A 1J5EM 2UUBM 1Z6TA 3FTDA 1KSFX 1IN8A 2J7OA 3THGA 1VDDA 3UZUA 4DR1M 1GLNA 1JQJC 2YFQA 4LJ9A 4JI0M 1L2BA 5FSWA 3SASA 4OW0A 4A3VB 4B3RM 3UGJA 1NY5A 3T1YM 4B3SM 1Z5CA 3IG8A 3U6DA 2LNHC 4G4QA 2XZFA 1NHGC 2XGNA 4JI5M 1FJGM 4MGZE 2KA6B 3L2AA 2UUCM 2F4VM 1IN5A 2CV1A 1DGFA 2ZAOA 3E4RA 3SFZA 1QVRA 5EP3A 1R6BX 3VK7A 2XSZD 2CHVA 4GITA 3TWLA 4JI6M 1J7KA 3C58A 4QOSA 4JV5M 2Z4RA 3ZH9B 1XXHA 4G4NA 2DWZB 3U61A 1G4AE 4KLNA 1JR3A 4B7HA 1L1TA 2FOIC 2HHHM 3A45A 4JN6A 1XXHB 3U5ZB 4L8RC 4NRWA 5ITRA 1ZAEA 4LGMA 4PCZA 2K47A 4II7A 4ZPXA 4BB9A 3GPUA 3VFDA 4LCBA 1YE9A 3KVWA 4R7GA 3GQ3A 1XC8A 2X49A 2Z3XA 1G59A 4L15A 4CGYB 2ZAMA 2UU9M 3RGSA 1S3SA 1W5TA 1K3XA 1MU5A 5H37D 2UXDM 3I51A 2EO2A 3FUVA 4G6ZA 4LF9M 1GKIA 3HJ8A 4DV7M 3JAMS 4LG2A 1G8PA 3KSJA 4D81A 3VLFB 2P5TA 4MGYE 4NXMM 1DO0A 4QHSA 2YR0A 2KRUA 4JI8M 2YNMD 5A2QS 5IZ7D 1D2NA 4DV2M 4TUWA 5C1BA 1MX0A 5BPVA 4IBEA 3HHZA 3GPYA 1IBKM 4FWGA 4IBGA 1R2YA 4GC9A 1TH4A 3GRRA 3FD9A 2FFJA 4LJ4A 4QOZC 2FE8A 4X65M 2KW0A 4LF8M 4I8OA 2XFSA 4P16A 4B08A 3U5ZA 1ORYB 2QBYB 3MK6A 2D7HA 3T1HM 1Z5BA 4XGIA 4AW4A 2VQFM 1IM2A 3KS4A 1XWIA 2KXEA 3I4YA 2F5NA 3U6OA 2C9CA 1IN4A 2R4EA 2Y0TA 1IY0A 3KW6A 4GIPA 1IN7A 1T3TA 3FUUA 2QZ4A 4LF5M 1DGBA 4QNMA 1K3WA 3KP0E 3KOYE 4IBJA 4DV3M 4IBBA 3SAWA 3PXGA 5DNYA 3KDSE 3NBIA 3PNVA 4IIWA 2M5ZA 4LJ7A 1GVNA 1FNNA 3DZDA 1YUBA 3FUWA 1TH2A 1L2CA 4JI1M 5KPZA 3U60B 3RGPA 3VKGA 4GMQA 1IXZA 2D7EA 3FYCA 4R3DA 1N75A 2D7GA 3HU2A 3KOZE 5EJCA 5EXPA 3FYDA 3HKPA 4DV4M 5IT9S 3VDUA 2C98A 4OU7A 4EIWA 4LJAA 3WHKA 4MGKE 3SMPA 4LF4M 1OJLA 3HU1A 4IBIA 3GP1A 4AG5A 2ZM6M 3U6CA 3KP1E 3TL4X 2HCBA 2JA2A 5F3WA 3HJQA 5E26A 2X8AA 3MHVC 4ITQA 3L27A 1G41A 3UK6A 1C1KA 4M9SA 4NSOB 2LXEA 1XNRM 1IBLM 3D8LA 2C99A 3L26A 3FTFA 3DFZA 4IBKA 4K0KM 2VIIA 4M9XA 4OVZB 2BJVA 4X64M 4AKHA 3LQRA 2QPAA 2FNAA 2UXCM 1IN6A 2YQZA 4GKKM 3FUXA 4RF0A 3JR4A 1ZQ9A 3SHFA 1YSYA 7CATA 4G4RA 4OX9M 4DR7M 4GKJM 3R8FA 2C96A 5DYIA 4BBAA 4DR2M 3U6QA 4JI4M 1HT2E 2KEBA 4X62M 2QENA 1DO2A 4IBFA 3LVVA 3FTEA 2Y20A 2A5YB 3CF2A 3PFIA 4HLQA 5E6JA 3SYKA 3GPXA 1SXJA 1IY2A 3LQQA 2R46A 3SC3A 3VDPA 3KOXE 4GHLA 3HU3A 2DWNA 4IJEA 2C9OA 3LMMA 2Z7JA 3J7BA 4IBDA 2UXBM 1DGHB 3DA1A 3CF6E 3AJIB 3E9SA 4LFCM 2BNKA 1OFHA 4YY3M 4JI3M 3J27B 2G8LA 3EIEA 3M0EA 2DHRA 3T15A 1HQYE 3IG5A 5EXXA 3UJNA 3OTOM 3GLIB 4JYAM 2M60A 1WXQA 1NJFA 5EP4A 3J80S 3SYLA 1GL6A 3BOSA 1W5SA 5KPRA 3K8ZA 5FTJA 5GKNA 1TDZA 2OPFA 1Z5AA 3J7AS 3MJ5A 2ERCA 2QCUA 3U6LA 1IXRC 1I94M 1I4WA 2XF3A 3NWLA 4D80A 3GLIA 4CHTB 2KZUA 2BJWA 3L28A 4LJ5A 4WURA 5ITQA 4DV6M 4L4UA 4HL4A 4LJ6A 4JI2M 2AHMA 1XNQM 4MGIE 4RF1A 1KFVA 4AQYM 2J7NA 4G4OA 3U6SA 4Z8XA 1NJGA 2VQEM 3KXEC 5KO3A 2KRKA 2ZBKB 5LMNM 3HHWA 2G5GX 2XH9A 4JXJA 3QWLA 4B3MM 2DZOB 1NY6A 2X4AA 3GRUA 3B9PA 4PDGA 2XZUA 3LVWA 5EP2A 2DVWB 3FUTA 3CF0A 1HR0M 2V1UA 3HGIA 2F5OA 2QBYA 4I4LA 4IJFA 4GC5A 2W82A 1E94E 3M7GA 1EE8A 3KOWE 5EXTA 4JI7M 4FVMA 1J09A 1E32A 4AKIA 1R7RA 3A42A 5C18A 1NNJA 3VK8A 3CTWB 4QHTA 2NQ8C 2O5RA 5EP1A 1SXJC 4LRTA 4L16A 2L7HA 1E9RA 5FTNA 5IREB 4GH9A 2Q2EB 2OQ4A 3M6AA 4FD2A 4PD2A 1R2ZA 3L25A 1Q3CA 4NL4H 4RNAA 3KFUG 4LFAM 5ITXA 1QAMA 5FTKA 3T38A 4KODA 1IBMM 3K92A 4FWDA 3L29A 4MGHA 4DUZM 1IQPA 3D8BA 4AKGA 4MM3B 4DV0M 4GRIA 1QYRA 2V1CA 3HHXA 3FTCA 3SBJA 2EUCA 4L78A 4FCTA 1G3IA 3GRYA 3HHYA 3U60A 2DZNB 3RE8A 1L1ZA 2F5SA 1UM8A 4LJ8A 3GO8A 2L7IA 4DR6M 2RGOA 3TWMA 4BLCA 4DUYM 1SXJD 3GLGB 2CEAA 4B7GA 1NHWC 2ZANA 4S12A 5FTMA 3J2PB 4LRSA 1K82A 5KQDA 3GLGA 3AV0A 4I81A 4NXNM 4DV5M 4MH0E 2R45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXB M;  1N32 M;  3T1H M;  1Z5B A;  1XMQ M;  3GQ4 A;  4LFC M;  3GQ5 A;  2F5Q A;  3GPP A;  4YY3 M;  2E5L M;  4JI3 M;  2VQF M;  4LFB M;  2F5P A;  1Z59 A;  4LF7 M;  1HNW M;  4DR4 M;  4MB7 A;  4NRV A;  5ITT A;  2F5N A;  3OTO M;  4DV1 M;  3U6O A;  4CIS A;  4JYA M;  3J80 S;  3JR5 A;  1J5E M;  2UUB M;  4LF5 M;  3U6M A;  1TDZ A;  1N34 M;  2OPF A;  1Z5A A;  4DR1 M;  3J7A S;  1Q3B A;  3U6L A;  1K3W A;  4JI0 M;  1L2B A;  1I94 M;  3SAS A;  4DV3 M;  3SAU A;  4B3R M;  4DV6 M;  3SAW A;  4JI2 M;  5ITQ A;  3T1Y M;  4B3S M;  3SAV A;  1Z5C A;  1XNQ M;  1HNX M;  3U6D A;  1KFV A;  4PDI A;  4AQY M;  4G4Q A;  2XZF A;  4G4O A;  4JI5 M;  3U6S A;  1TDH A;  2VQE M;  1FJG M;  1L2C A;  4JI1 M;  2UUC M;  2ZBK B;  2F4V M;  5LMN M;  4DR5 M;  4LF6 M;  4YHH M;  4B3M M;  5LMU M;  4PDG A;  2UUA M;  3W0F A;  3J81 S;  2XZU A;  1HR0 M;  3SAR A;  2F5O A;  3VK7 A;  4DV4 M;  5IT9 S;  3TWL A;  4JI6 M;  1EE8 A;  4JI7 M;  1PJI A;  1L2D A;  3C58 A;  4JV5 M;  5ITY A;  1NNJ A;  3A42 A;  3VK8 A;  4G4N A;  4LF4 M;  5FLX S;  4DR3 M;  1L1T A;  2HHH M;  5IWA M;  3GP1 A;  3A45 A;  1Q39 A;  2ZM6 M;  5BR8 M;  3U6C A;  3U6P A;  4LF8 M;  4NRW A;  5ITR A;  2EA0 A;  2Q2E B;  2OQ4 A;  4PD2 A;  1R2Z A;  4PCZ A;  1Q3C A;  4ITQ A;  3GPU A;  4LFA M;  5ITX A;  4KHP M;  4X66 M;  3GQ3 A;  1XC8 A;  1IBM M;  1XNR M;  1IBL M;  1XMO M;  3TWK A;  4DUZ M;  2HKJ A;  2UU9 M;  4DV0 M;  4K0K M;  4B3T M;  1K3X A;  1MU5 A;  3SBJ A;  2UXD M;  4X64 M;  4LF9 M;  2UXC M;  4GKK M;  4DV7 M;  2F5S A;  3JAM S;  1L1Z A;  1HNZ M;  3JR4 A;  4OX9 M;  3GO8 A;  4G4R A;  4DR7 M;  4GKJ M;  4DR6 M;  1PM5 A;  4NXM M;  3U6E A;  3TWM A;  4DR2 M;  3U6Q A;  1PJJ A;  4JI4 M;  4DUY M;  4JI8 M;  5A2Q S;  4DV2 M;  1MX0 A;  4X62 M;  1N36 M;  1IBK M;  3GPY A;  1N33 M;  1R2Y A;  5ITU A;  3GPX A;  1K82 A;  3DOA A;  4X65 M;  3SAT A;  4NXN M;  5ITX E;  4DV5 M;  3A46 A; 
#chains in the Genus database with same CATH topology
 3B7Q A;  3SMS A;  2CE7 A;  1TH3 A;  2O01 F;  3GLH A;  4Z6Y A;  3GRV A;  1N32 M;  3K2L A;  2DEN A;  1XMQ M;  1NNU C;  2G3Q A;  2XFT A;  2DAK A;  2ZTD A;  3UMM A;  3GQ5 A;  1N77 A;  2J5Y A;  2F5Q A;  2XLJ A;  2E5L M;  2LVO C;  3AFH A;  4AI6 A;  2I7N A;  1SG9 A;  3EIH A;  3FKE A;  1OTR A;  1Z59 A;  1HNW M;  3TE6 A;  4MB7 A;  4NC6 A;  5ITT A;  4CIS A;  1IXS B;  2EJS A;  4AZF A;  2XEP A;  1HT1 E;  4M0W A;  4REZ A;  4I5S A;  3JR5 A;  3QYB A;  1PGY A;  3U6M A;  1N34 M;  2R65 A;  2L6O A;  1Q3B A;  5DYG A;  3KSX A;  2JP7 A;  3VKH A;  2LVA A;  1VG5 A;  3LCV B;  1QZM A;  2RKO A;  3SAU A;  1SXJ E;  1V92 A;  2DZL A;  2KNA A;  2WSF F;  3AOE A;  3ZC7 B;  1H6U A;  4ANR A;  4LGY A;  3SAV A;  3TPZ A;  1HNX M;  1OIZ A;  3B7Z A;  4Q7J A;  3QAU A;  2XSZ A;  4PDI A;  3C3D A;  1DV0 A;  5KPT A;  1OAI A;  2Z8Y M;  1TDH A;  3K1J A;  1NVM A;  2RRU A;  2R4J A;  2R0I A;  4NSR A;  4DR5 M;  4KO8 A;  4B7F A;  2CHG A;  1ZMW A;  3PVS A;  3C9P A;  4LF6 M;  3H4M A;  4NOO B;  4YHH M;  1IFY A;  1QQW A;  5LMU M;  3I4V A;  2C5R A;  5JI3 E;  4L6V 6;  2UUA M;  2LH0 A;  4FCW A;  2R18 A;  3IEC A;  3W0F A;  3ZCB B;  3J81 S;  1E9S A;  1EIJ A;  3PNY A;  1TTE A;  3SAR A;  1DGH A;  1L8Q A;  4F2L A;  2DWL A;  4FWH A;  1X37 A;  1HQC A;  1JB0 F;  4LY6 A;  1PJI A;  2Y21 A;  1L2D A;  4RKU F;  5ITY A;  2GQF A;  1QAQ A;  2I7P A;  3GLF A;  2CV0 A;  2L2D A;  1ZMU A;  5FLX S;  1N78 A;  4DR3 M;  1SXJ B;  1DGG A;  1TGU A;  4WW0 A;  2HL7 A;  5EQT A;  5IWA M;  1Q39 A;  3LCU A;  3GLH B;  5BR8 M;  3IHP A;  3U6P A;  2EA0 A;  1QUS A;  3TQS A;  2CHQ A;  5JI2 E;  1QAO A;  3BBZ A;  2JXN A;  1GJT A;  1D0M A;  3R9X B;  4KHP M;  3Q8X A;  4X66 M;  3E46 A;  2L09 A;  3F92 A;  3W68 A;  1IY1 A;  4FCV A;  4QNR A;  4PT5 A;  1XMO M;  3TWK A;  4W5W A;  3AL0 C;  2HKJ A;  5FTL A;  3T6P A;  5KQ8 A;  2RGH A;  4B3T M;  1WJ7 A;  2DHY A;  3WHL A;  4GHA A;  1QAN A;  1OFI A;  1GJS A;  1HJP A;  2LHC A;  2Y0Q A;  4G3O A;  4M9Z A;  4XK8 F;  1HNZ M;  4OVZ A;  3HJS A;  1PM5 A;  3U6E A;  4HEO A;  3KS8 A;  1PJJ A;  3AOE C;  4LZJ A;  3BXW A;  3ILK A;  4FW9 A;  1N36 M;  1WGN A;  2Z4S A;  1N33 M;  3SHG B;  5ITU A;  4IBC A;  2DAG A;  3RFW A;  2VDB B;  2H1R A;  3A98 B;  3DOA A;  1MN3 A;  3HWS A;  1QUT A;  3AOG A;  1R4G A;  3U61 B;  2DXI A;  3SAT A;  5ITX E;  4XBO A;  2CV2 A;  1AUA A;  3A46 A;  2MGW A;  1JR3 D;  5EXS A;  2CFO A;  1QDR A;  8CAT A;  4LZZ A;  2LWX A;  1NSF A;  3GQ4 A;  2WZJ A;  3GPP A;  2QP9 X;  3W67 A;  1KYI A;  4M0D A;  4F1I A;  3AKZ A;  3W0L B;  4AG6 A;  1LV7 A;  4LFB M;  3GLF B;  2CUZ A;  2DWM A;  3B74 A;  2KZS A;  2F5P A;  4LF7 M;  4DR4 M;  1XHB A;  4NRV A;  4D82 A;  4DV1 M;  1GL7 A;  2V6Z M;  2R62 A;  1UFZ A;  1J5E M;  2UUB M;  4GEW A;  1Z6T A;  2JY6 B;  3FTD A;  1KSF X;  1IN8 A;  2J7O A;  3THG A;  1VDD A;  3UZU A;  3QYE A;  4DR1 M;  1GLN A;  1JQJ C;  2MR9 A;  2YFQ A;  4LJ9 A;  2WSC F;  4JI0 M;  5FSW A;  1L2B A;  3SAS A;  4OW0 A;  4A3V B;  4B3R M;  3UGJ A;  2L4F A;  1NY5 A;  2LVP C;  2GNO A;  3GLG E;  3T1Y M;  1AIP C;  4B3S M;  1Z5C A;  3IG8 A;  1GO5 A;  3U6D A;  2LNH C;  1WHC A;  4G4Q A;  2XZF A;  1NHG C;  2XGN A;  4JI5 M;  1FJG M;  4MGZ E;  2KA6 B;  3L2A A;  2UUC M;  2F4V M;  2B3T A;  3V76 A;  1P3Q Q;  1IN5 A;  2CV1 A;  1DGF A;  2ZAO A;  3E4R A;  3SFZ A;  1QVR A;  3I04 M;  5EP3 A;  1R6B X;  3VK7 A;  2XSZ D;  2CHV A;  4GIT A;  3TWL A;  4JI6 M;  2WSE F;  1J7K A;  2OOA A;  1VEJ A;  1GAB A;  3C58 A;  4QOS A;  4JV5 M;  1ZMV A;  2KNV A;  2Z4R A;  3ZH9 B;  1XXH A;  2BWB A;  4G4N A;  2DWZ B;  3U61 A;  1G4A E;  4KLN A;  2JZ1 A;  1JR3 A;  2VF7 A;  4B7H A;  1L1T A;  2FOI C;  2DAM A;  2HHH M;  3A45 A;  2FH0 A;  4JN6 A;  1XXH B;  3U5Z B;  4L8R C;  4NRW A;  5ITR A;  2OO9 A;  1ZAE A;  2R44 A;  4LGM A;  2K47 A;  4II7 A;  4PCZ A;  4ZPX A;  4BB9 A;  3CGW A;  3VFD A;  3GPU A;  4LCB A;  2MJ5 B;  1YE9 A;  3KVW A;  2K9D A;  4R7G A;  3GQ3 A;  2DNA A;  1XC8 A;  2X49 A;  2Z3X A;  1G59 A;  1VEG A;  4L15 A;  4CGY B;  2CP8 A;  2ZAM A;  2UU9 M;  2KHH A;  3RGS A;  1S3S A;  1W5T A;  3NBX X;  1K3X A;  1MU5 A;  5H37 D;  2UXD M;  3I51 A;  2EO2 A;  3FUV A;  4G6Z A;  2QSF X;  4LF9 M;  1GKI A;  3HJ8 A;  4DV7 M;  3JAM S;  4LG2 A;  1G8P A;  3KSJ A;  2DAI A;  3VLF B;  4D81 A;  2P5T A;  4MGY E;  4NXM M;  1DO0 A;  4QHS A;  2YR0 A;  2KRU A;  4JI8 M;  2YNM D;  5A2Q S;  2CWB A;  2HWJ A;  1D2N A;  2LHG A;  5IZ7 D;  4DV2 M;  4TUW A;  5C1B A;  1MX0 A;  5BPV A;  4IBE A;  3HHZ A;  2JZ0 A;  3GPY A;  4FWG A;  4IBG A;  1R2Y A;  4GC9 A;  1IBK M;  1TH4 A;  3GRR A;  3FD9 A;  2FFJ A;  1VQ1 A;  4LJ4 A;  4QOZ C;  2FE8 A;  4X65 M;  2KW0 A;  3FRH A;  4LF8 M;  4I8O A;  2XFS A;  4P16 A;  4B08 A;  3U5Z A;  3K9P A;  1ORY B;  2QBY B;  3ZQJ A;  3MK6 A;  2D7H A;  3T1H M;  1Z5B A;  2DI0 A;  4XGI A;  4AW4 A;  1OIP A;  3I01 M;  2VQF M;  1IM2 A;  3KS4 A;  1XWI A;  2KXE A;  3I4Y A;  2F5N A;  3U6O A;  2C9C A;  2JNH A;  1IN4 A;  2R4E A;  2Y0T A;  1IY0 A;  2EKF A;  1WGL A;  3KW6 A;  4GIP A;  1IN7 A;  1T3T A;  3FUU A;  2QZ4 A;  1PJT A;  4LF5 M;  1DGB A;  1QDT A;  2JUJ A;  2LBC A;  4QNM A;  1K3W A;  2FS1 A;  3KP0 E;  3KOY E;  2DAE A;  2LTU A;  4IBJ A;  4R71 A;  4DV3 M;  4IBB A;  3SAW A;  3PXG A;  5DNY A;  3KDS E;  3NBI A;  3PNV A;  4IIW A;  2M5Z A;  3GLI E;  4LJ7 A;  1GVN A;  1FNN A;  1PJS A;  3DZD A;  1YUB A;  3FUW A;  1TH2 A;  1L2C A;  4JI1 M;  5KPZ A;  3U60 B;  1PRB A;  2JY8 A;  3B7N A;  2HAK A;  4GMQ A;  3RGP A;  3VKG A;  1IXZ A;  2D7E A;  5L8R F;  3FYC A;  4R3D A;  1N75 A;  2D7G A;  3HU2 A;  3KOZ E;  5EJC A;  1TF0 B;  5EXP A;  3FYD A;  3HKP A;  4DV4 M;  5IT9 S;  1XB2 B;  2C98 A;  3VDU A;  4OU7 A;  4EIW A;  3B89 A;  4LJA A;  3WHK A;  4MGK E;  2L4E A;  1OQY A;  3SMP A;  4LF4 M;  3HZJ A;  1OJL A;  3HU1 A;  3FRI A;  4IBI A;  3GP1 A;  2KNZ A;  4AG5 A;  2VF8 A;  1VDL A;  3H4J A;  2ZM6 M;  3U6C A;  3KP1 E;  3TL4 X;  2HCB A;  2JA2 A;  5F3W A;  1QZE A;  3HJQ A;  2X8A A;  3MHV C;  5E26 A;  4ITQ A;  1D0L A;  3L27 A;  1G41 A;  2MRO B;  1C7Y A;  3UK6 A;  1C1K A;  1IXS A;  4M9S A;  4NSO B;  2LXE A;  3GLH E;  1CUK A;  1XNR M;  1IBL M;  3D8L A;  2C99 A;  3L26 A;  1VEK A;  3FTF A;  3DFZ A;  4IBK A;  4K0K M;  2VII A;  4M9X A;  4OVZ B;  1BVS A;  1A5T A;  2BJV A;  1YLA A;  4X64 M;  4AKH A;  3LQR A;  2QPA A;  1F4I A;  2FNA A;  2K6B A;  2UXC M;  1IN6 A;  2YQZ A;  4GKK M;  2O25 A;  3FUX A;  4KT0 F;  4RF0 A;  3JR4 A;  1ZQ9 A;  3SHF A;  1YSY A;  7CAT A;  3GLF E;  3HX3 A;  4G4R A;  4OX9 M;  4DR7 M;  4GKJ M;  3R8F A;  2C96 A;  5DYI A;  4BBA A;  4DR2 M;  3U6Q A;  4JI4 M;  1HT2 E;  2KEB A;  3LW5 F;  1R5L A;  2QEN A;  4Y28 F;  4X62 M;  1DO2 A;  4IBF A;  3LVV A;  3FTE A;  2Y20 A;  2A5Y B;  3CF2 A;  3PFI A;  4HLQ A;  5E6J A;  3SYK A;  3GPX A;  1EFU B;  1SXJ A;  1IY2 A;  3LQQ A;  2R46 A;  3SC3 A;  3VDP A;  3KOX E;  4GHL A;  2K0B X;  3HU3 A;  2DWN A;  4IJE A;  2C9O A;  3LMM A;  1WIV A;  2Z7J A;  3J7B A;  4IBD A;  2UXB M;  1DGH B;  2KDL A;  3CF6 E;  3AJI B;  3DA1 A;  3E9S A;  4LFC M;  1NV9 A;  2BNK A;  1OFH A;  4YY3 M;  2ZTC A;  4JI3 M;  3J27 B;  1T43 A;  2G8L A;  3EIE A;  3M0E A;  2DHR A;  3T15 A;  1HQY E;  3FE3 A;  3IG5 A;  5EXX A;  3UJN A;  3OTO M;  3GLI B;  4JYA M;  2M60 A;  1WXQ A;  1NJF A;  5EP4 A;  3J80 S;  3SYL A;  1GL6 A;  3BOS A;  1W5S A;  5KPR A;  3K8Z A;  5FTJ A;  5GKN A;  1PJQ A;  1TDZ A;  2OPF A;  1Z5A A;  3J7A S;  3MJ5 A;  2QCU A;  2ERC A;  3U6L A;  1IXR C;  1LTM A;  1XXH E;  2JY7 A;  1I94 M;  1I4W A;  2XF3 A;  3NWL A;  1D0K A;  4D80 A;  3GLI A;  4CHT B;  2KZU A;  2BJW A;  3L28 A;  4LJ5 A;  4WP2 A;  4WUR A;  3MMP A;  4L4U A;  4HL4 A;  4LJ6 A;  5ITQ A;  2AHM A;  1XNQ M;  4MGI E;  1T6O A;  4RF1 A;  1TR8 A;  1KFV A;  4AQY M;  2J7N A;  4G4O A;  3U6S A;  4Z8X A;  1NJG A;  2VQE M;  3KXE C;  5KO3 A;  2KRK A;  2ZBK B;  3K9O A;  1OAO C;  5LMN M;  3HHW A;  2G5G X;  2XH9 A;  1V33 A;  4JXJ A;  3QWL A;  3Q8G A;  4DBG B;  2LVQ D;  2DZO B;  1NY6 A;  2X4A A;  3GRU A;  4B3M M;  3B9P A;  2OOB A;  4PDG A;  2XZU A;  3LVW A;  5EP2 A;  2DVW B;  3FUT A;  3CF0 A;  2JWS A;  1HR0 M;  2V1U A;  3HGI A;  1Y8G A;  2F5O A;  2BWE A;  4I4L A;  4IJF A;  2QBY A;  2W82 A;  1E94 E;  3M7G A;  4GC5 A;  4P17 A;  1EE8 A;  3KOW E;  5EXT A;  4JI7 M;  4FVM A;  1J09 A;  1E32 A;  4AKI A;  3E21 A;  1R7R A;  3A42 A;  1RU3 A;  5C18 A;  1NNJ A;  3VK8 A;  2DKL A;  3CTW B;  4QHT A;  2NQ8 C;  2O5R A;  5EP1 A;  1SXJ C;  4LRT A;  4L16 A;  2L7H A;  4CIZ A;  1E9R A;  1NO1 A;  1WR1 B;  2N35 A;  5FTN A;  5IRE B;  4GH9 A;  2Q2E B;  2R6F A;  2OQ4 A;  3M6A A;  4FD2 A;  4PD2 A;  1R2Z A;  3L25 A;  1Q3C A;  4NL4 H;  4RNA A;  5DFL A;  4CJ6 A;  4JI2 M;  3KFU G;  4LFA M;  5ITX A;  2CRU A;  1QAM A;  5FTK A;  2MH8 A;  1G71 A;  2LVN C;  3T38 A;  2EKK A;  4KOD A;  1V34 A;  1IBM M;  3K92 A;  4FWD A;  3L29 A;  4MGH A;  4DUZ M;  1IQP A;  3D8B A;  4AKG A;  4MM3 B;  4DV0 M;  4GRI A;  1QYR A;  2V1C A;  1ZV1 A;  3FTC A;  3HHX A;  3SBJ A;  2EUC A;  4L78 A;  1G3I A;  4FCT A;  2QQ8 A;  3GRY A;  3HHY A;  3U60 A;  2DZN B;  1OKS A;  4UN2 B;  3RE8 A;  3HY5 A;  1L1Z A;  2JY5 A;  2F5S A;  1UM8 A;  4LJ8 A;  3GO8 A;  2L7I A;  4DR6 M;  2RGO A;  3C3E A;  3TWM A;  4BLC A;  1JR3 E;  4DUY M;  1SXJ D;  1NV8 A;  3GLG B;  2CEA A;  1MJG M;  4B7G A;  1NHW C;  2ZAN A;  1Q02 A;  4DV6 M;  2QHO B;  4S12 A;  5FTM A;  3J2P B;  4LRS A;  1K82 A;  2QNJ A;  2APL A;  5KQD A;  3GLG A;  2H5X A;  3AV0 A;  4I81 A;  4NXN M;  4DV5 M;  4MH0 E;  2R45 A; 
#chains in the Genus database with same CATH homology
 3SMS A;  2CE7 A;  1TH3 A;  3GLH A;  4Z6Y A;  3GRV A;  1N32 M;  3K2L A;  1XMQ M;  1NNU C;  2XFT A;  3UMM A;  3GQ5 A;  1N77 A;  2F5Q A;  2XLJ A;  2E5L M;  3AFH A;  4AI6 A;  2I7N A;  3EIH A;  3FKE A;  1Z59 A;  1HNW M;  3TE6 A;  4MB7 A;  4CIS A;  5ITT A;  1IXS B;  4AZF A;  2XEP A;  1HT1 E;  4M0W A;  4REZ A;  4I5S A;  3JR5 A;  3U6M A;  1N34 M;  2R65 A;  2L6O A;  1Q3B A;  5DYG A;  3KSX A;  3VKH A;  1QZM A;  2RKO A;  3SAU A;  1SXJ E;  3ZC7 B;  3AOE A;  1H6U A;  3SAV A;  4LGY A;  3TPZ A;  1HNX M;  3QAU A;  2XSZ A;  4PDI A;  5KPT A;  1TDH A;  3K1J A;  1NVM A;  2R4J A;  4DR5 M;  4NSR A;  4KO8 A;  4B7F A;  2CHG A;  3PVS A;  4LF6 M;  3H4M A;  4NOO B;  4YHH M;  1QQW A;  5LMU M;  3I4V A;  2C5R A;  5JI3 E;  2UUA M;  2LH0 A;  4FCW A;  2R18 A;  3W0F A;  3ZCB B;  3J81 S;  1E9S A;  3PNY A;  3SAR A;  1DGH A;  1L8Q A;  2DWL A;  4FWH A;  1X37 A;  1HQC A;  4LY6 A;  1PJI A;  2Y21 A;  1L2D A;  5ITY A;  3GLF A;  1QAQ A;  2I7P A;  2CV0 A;  5FLX S;  1N78 A;  4DR3 M;  1SXJ B;  1DGG A;  1TGU A;  4WW0 A;  2HL7 A;  5EQT A;  5IWA M;  1Q39 A;  3GLH B;  5BR8 M;  3U6P A;  2EA0 A;  3TQS A;  2CHQ A;  5JI2 E;  1QAO A;  3R9X B;  4KHP M;  3Q8X A;  4X66 M;  2L09 A;  1IY1 A;  4FCV A;  4QNR A;  4PT5 A;  1XMO M;  3TWK A;  4W5W A;  3AL0 C;  2HKJ A;  5FTL A;  5KQ8 A;  2RGH A;  4B3T M;  3WHL A;  4GHA A;  1QAN A;  1OFI A;  2Y0Q A;  4M9Z A;  1HNZ M;  4OVZ A;  3HJS A;  1PM5 A;  3U6E A;  3KS8 A;  1PJJ A;  3AOE C;  4LZJ A;  3ILK A;  4FW9 A;  1N36 M;  2Z4S A;  1N33 M;  3SHG B;  5ITU A;  4IBC A;  3RFW A;  2H1R A;  3A98 B;  3DOA A;  3HWS A;  3AOG A;  3U61 B;  2DXI A;  3SAT A;  5ITX E;  4XBO A;  2CV2 A;  3A46 A;  1JR3 D;  5EXS A;  2CFO A;  8CAT A;  4LZZ A;  2LWX A;  1NSF A;  3GQ4 A;  3GPP A;  2QP9 X;  1KYI A;  4M0D A;  3AKZ A;  3W0L B;  4AG6 A;  1LV7 A;  4LFB M;  3GLF B;  2CUZ A;  2DWM A;  2KZS A;  2F5P A;  4LF7 M;  4DR4 M;  1XHB A;  4NRV A;  4D82 A;  4DV1 M;  1GL7 A;  2V6Z M;  2R62 A;  1J5E M;  2UUB M;  1Z6T A;  3FTD A;  1KSF X;  1IN8 A;  2J7O A;  3THG A;  1VDD A;  3UZU A;  4DR1 M;  1GLN A;  1JQJ C;  2YFQ A;  4LJ9 A;  4JI0 M;  1L2B A;  5FSW A;  3SAS A;  4OW0 A;  4A3V B;  4B3R M;  3UGJ A;  1NY5 A;  3T1Y M;  4B3S M;  1Z5C A;  3IG8 A;  3U6D A;  2LNH C;  4G4Q A;  2XZF A;  1NHG C;  2XGN A;  4JI5 M;  1FJG M;  4MGZ E;  2KA6 B;  3L2A A;  2UUC M;  2F4V M;  1IN5 A;  2CV1 A;  1DGF A;  2ZAO A;  3E4R A;  3SFZ A;  1QVR A;  5EP3 A;  1R6B X;  3VK7 A;  2XSZ D;  2CHV A;  4GIT A;  3TWL A;  4JI6 M;  1J7K A;  3C58 A;  4QOS A;  4JV5 M;  2Z4R A;  3ZH9 B;  1XXH A;  4G4N A;  2DWZ B;  3U61 A;  1G4A E;  4KLN A;  1JR3 A;  4B7H A;  1L1T A;  2FOI C;  2HHH M;  3A45 A;  4JN6 A;  1XXH B;  3U5Z B;  4L8R C;  4NRW A;  5ITR A;  1ZAE A;  4LGM A;  4PCZ A;  2K47 A;  4II7 A;  4ZPX A;  4BB9 A;  3GPU A;  3VFD A;  4LCB A;  1YE9 A;  3KVW A;  4R7G A;  3GQ3 A;  1XC8 A;  2X49 A;  2Z3X A;  1G59 A;  4L15 A;  4CGY B;  2ZAM A;  2UU9 M;  3RGS A;  1S3S A;  1W5T A;  1K3X A;  1MU5 A;  5H37 D;  2UXD M;  3I51 A;  2EO2 A;  3FUV A;  4G6Z A;  4LF9 M;  1GKI A;  3HJ8 A;  4DV7 M;  3JAM S;  4LG2 A;  1G8P A;  3KSJ A;  4D81 A;  3VLF B;  2P5T A;  4MGY E;  4NXM M;  1DO0 A;  4QHS A;  2YR0 A;  2KRU A;  4JI8 M;  2YNM D;  5A2Q S;  5IZ7 D;  1D2N A;  4DV2 M;  4TUW A;  5C1B A;  1MX0 A;  5BPV A;  4IBE A;  3HHZ A;  3GPY A;  1IBK M;  4FWG A;  4IBG A;  1R2Y A;  4GC9 A;  1TH4 A;  3GRR A;  3FD9 A;  2FFJ A;  4LJ4 A;  4QOZ C;  2FE8 A;  4X65 M;  2KW0 A;  4LF8 M;  4I8O A;  2XFS A;  4P16 A;  4B08 A;  3U5Z A;  1ORY B;  2QBY B;  3MK6 A;  2D7H A;  3T1H M;  1Z5B A;  4XGI A;  4AW4 A;  2VQF M;  1IM2 A;  3KS4 A;  1XWI A;  2KXE A;  3I4Y A;  2F5N A;  3U6O A;  2C9C A;  1IN4 A;  2R4E A;  2Y0T A;  1IY0 A;  3KW6 A;  4GIP A;  1IN7 A;  1T3T A;  3FUU A;  2QZ4 A;  4LF5 M;  1DGB A;  4QNM A;  1K3W A;  3KP0 E;  3KOY E;  4IBJ A;  4DV3 M;  4IBB A;  3SAW A;  3PXG A;  5DNY A;  3KDS E;  3NBI A;  3PNV A;  4IIW A;  2M5Z A;  4LJ7 A;  1GVN A;  1FNN A;  3DZD A;  1YUB A;  3FUW A;  1TH2 A;  1L2C A;  4JI1 M;  5KPZ A;  3U60 B;  3RGP A;  3VKG A;  4GMQ A;  1IXZ A;  2D7E A;  3FYC A;  4R3D A;  1N75 A;  2D7G A;  3HU2 A;  3KOZ E;  5EJC A;  5EXP A;  3FYD A;  3HKP A;  4DV4 M;  5IT9 S;  3VDU A;  2C98 A;  4OU7 A;  4EIW A;  4LJA A;  3WHK A;  4MGK E;  3SMP A;  4LF4 M;  1OJL A;  3HU1 A;  4IBI A;  3GP1 A;  4AG5 A;  2ZM6 M;  3U6C A;  3KP1 E;  3TL4 X;  2HCB A;  2JA2 A;  5F3W A;  3HJQ A;  5E26 A;  2X8A A;  3MHV C;  4ITQ A;  3L27 A;  1G41 A;  3UK6 A;  1C1K A;  4M9S A;  4NSO B;  2LXE A;  1XNR M;  1IBL M;  3D8L A;  2C99 A;  3L26 A;  3FTF A;  3DFZ A;  4IBK A;  4K0K M;  2VII A;  4M9X A;  4OVZ B;  2BJV A;  4X64 M;  4AKH A;  3LQR A;  2QPA A;  2FNA A;  2UXC M;  1IN6 A;  2YQZ A;  4GKK M;  3FUX A;  4RF0 A;  3JR4 A;  1ZQ9 A;  3SHF A;  1YSY A;  7CAT A;  4G4R A;  4OX9 M;  4DR7 M;  4GKJ M;  3R8F A;  2C96 A;  5DYI A;  4BBA A;  4DR2 M;  3U6Q A;  4JI4 M;  1HT2 E;  2KEB A;  4X62 M;  2QEN A;  1DO2 A;  4IBF A;  3LVV A;  3FTE A;  2Y20 A;  2A5Y B;  3CF2 A;  3PFI A;  4HLQ A;  5E6J A;  3SYK A;  3GPX A;  1SXJ A;  1IY2 A;  3LQQ A;  2R46 A;  3SC3 A;  3VDP A;  3KOX E;  4GHL A;  3HU3 A;  2DWN A;  4IJE A;  2C9O A;  3LMM A;  2Z7J A;  3J7B A;  4IBD A;  2UXB M;  1DGH B;  3DA1 A;  3CF6 E;  3AJI B;  3E9S A;  4LFC M;  2BNK A;  1OFH A;  4YY3 M;  4JI3 M;  3J27 B;  2G8L A;  3EIE A;  3M0E A;  2DHR A;  3T15 A;  1HQY E;  3IG5 A;  5EXX A;  3UJN A;  3OTO M;  3GLI B;  4JYA M;  2M60 A;  1WXQ A;  1NJF A;  5EP4 A;  3J80 S;  3SYL A;  1GL6 A;  3BOS A;  1W5S A;  5KPR A;  3K8Z A;  5FTJ A;  5GKN A;  1TDZ A;  2OPF A;  1Z5A A;  3J7A S;  3MJ5 A;  2ERC A;  2QCU A;  3U6L A;  1IXR C;  1I94 M;  1I4W A;  2XF3 A;  3NWL A;  4D80 A;  3GLI A;  4CHT B;  2KZU A;  2BJW A;  3L28 A;  4LJ5 A;  4WUR A;  5ITQ A;  4DV6 M;  4L4U A;  4HL4 A;  4LJ6 A;  4JI2 M;  2AHM A;  1XNQ M;  4MGI E;  4RF1 A;  1KFV A;  4AQY M;  2J7N A;  4G4O A;  3U6S A;  4Z8X A;  1NJG A;  2VQE M;  3KXE C;  5KO3 A;  2KRK A;  2ZBK B;  5LMN M;  3HHW A;  2G5G X;  2XH9 A;  4JXJ A;  3QWL A;  4B3M M;  2DZO B;  1NY6 A;  2X4A A;  3GRU A;  3B9P A;  4PDG A;  2XZU A;  3LVW A;  5EP2 A;  2DVW B;  3FUT A;  3CF0 A;  1HR0 M;  2V1U A;  3HGI A;  2F5O A;  2QBY A;  4I4L A;  4IJF A;  4GC5 A;  2W82 A;  1E94 E;  3M7G A;  1EE8 A;  3KOW E;  5EXT A;  4JI7 M;  4FVM A;  1J09 A;  1E32 A;  4AKI A;  1R7R A;  3A42 A;  5C18 A;  1NNJ A;  3VK8 A;  3CTW B;  4QHT A;  2NQ8 C;  2O5R A;  5EP1 A;  1SXJ C;  4LRT A;  4L16 A;  2L7H A;  1E9R A;  5FTN A;  5IRE B;  4GH9 A;  2Q2E B;  2OQ4 A;  3M6A A;  4FD2 A;  4PD2 A;  1R2Z A;  3L25 A;  1Q3C A;  4NL4 H;  4RNA A;  3KFU G;  4LFA M;  5ITX A;  1QAM A;  5FTK A;  3T38 A;  4KOD A;  1IBM M;  3K92 A;  4FWD A;  3L29 A;  4MGH A;  4DUZ M;  1IQP A;  3D8B A;  4AKG A;  4MM3 B;  4DV0 M;  4GRI A;  1QYR A;  2V1C A;  3HHX A;  3FTC A;  3SBJ A;  2EUC A;  4L78 A;  4FCT A;  1G3I A;  3GRY A;  3HHY A;  3U60 A;  2DZN B;  3RE8 A;  1L1Z A;  2F5S A;  1UM8 A;  4LJ8 A;  3GO8 A;  2L7I A;  4DR6 M;  2RGO A;  3TWM A;  4BLC A;  4DUY M;  1SXJ D;  3GLG B;  2CEA A;  4B7G A;  1NHW C;  2ZAN A;  4S12 A;  5FTM A;  3J2P B;  4LRS A;  1K82 A;  5KQD A;  3GLG A;  3AV0 A;  4I81 A;  4NXN M;  4DV5 M;  4MH0 E;  2R45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...