2OPFA

Crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli (r252a) in complex with ap-site containing dna substrate
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
262
structure length
256
Chain Sequence
PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGQVDALFRFKVFHRDGEPCERCGSIIEKTTLSSAPFYWCPGCQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site plasticity of endonuclease VIII: Conformational changes compensating for different substrates and mutations of critical residues
rcsb
molecule keywords 5'-D(*GP*GP*CP*TP*TP*CP*AP*TP*CP*CP*TP*G)-3'
molecule tags Hydrolase/dna
source organism Escherichia coli
total genus 83
structure length 256
sequence length 262
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2007-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2opfA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 2opfA01
1R2ZA 3DOAA 5LMUM 4DUYM 2Q2EB 1L2CA 4DV5M 1N32M 3U6SA 1Q3BA 2UUAM 1HNWM 1Q39A 1Z5CA 3TWMA 5ITXE 4X62M 1HNXM 3GO8A 2F5PA 1MX0A 3JAMS 2OPFA 4B3RM 4JI7M 4JI8M 1K82A 3T1HM 2F5SA 4JI6M 1PM5A 4DV4M 5ITXA 2UUCM 1PJJA 1TDHA 3GPPA 5A2QS 2UXDM 1J5EM 3U6MA 3J7AS 3VK8A 5ITRA 4PDGA 3OTOM 1L1TA 2F5QA 4JI2M 4LFCM 1Z5BA 5ITYA 4JI0M 3SARA 1PJIA 5ITQA 1K3WA 4LF4M 2F4VM 4JYAM 3JR4A 4LF8M 3VK7A 4DR6M 2HHHM 4X64M 4NXMM 1N36M 4B3MM 3GPUA 4DV2M 1NNJA 1XMQM 3SBJA 1XC8A 1TDZA 1IBKM 5IWAM 3U6OA 2F5OA 4DR3M 5ITTA 5FLXS 3J80S 3GQ5A 1L2BA 4JI4M 4GKJM 4G4RA 3T1YM 4B3TM 4DR4M 4DR7M 4X65M 4B3SM 4DUZM 2UUBM 1KFVA 4PCZA 3U6QA 3W0FA 3SAWA 4JI3M 2VQFM 4X66M 1N33M 4LFBM 4PDIA 4DR5M 1R2YA 3SASA 4LF7M 4NXNM 3U6PA 3GQ3A 4PD2A 4G4QA 2UXCM 2VQEM 4YHHM 3JR5A 4NRWA 4G4NA 2E5LM 4JI5M 2OQ4A 4DV7M 4GKKM 3TWLA 1EE8A 4AQYM 3A46A 1N34M 4DV6M 4YY3M 2XZUA 1L1ZA 2XZFA 5IT9S 2UXBM 3J81S 5BR8M 3A42A 4DR1M 4CISA 1L2DA 1HR0M 5LMNM 4MB7A 1MU5A 1I94M 3A45A 3SAUA 1IBLM 1HNZM 4JV5M 4KHPM 2F5NA 3SATA 1Z5AA 3GP1A 3TWKA 3GQ4A 3U6CA 2UU9M 1XNQM 3SAVA 3C58A 4LF6M 1XMOM 4K0KM 1Z59A 1XNRM 2ZBKB 4JI1M 1Q3CA 4DV1M 4LFAM 3U6DA 4LF5M 4LF9M 2EA0A 2ZM6M 4DV0M 4NRVA 3GPXA 3U6LA 4OX9M 4DV3M 3GPYA 5ITUA 4G4OA 4ITQA 2HKJA 4DR2M 1IBMM 3U6EA 1FJGM 1K3XA
chains in the Genus database with same CATH superfamily
1IXRC 5E6JA 4M9XA 3HHZA 4F1IA 4DUYM 2Y0QA 1KYIA 1Y8GA 2KXEA 4GRIA 2ZTDA 1Q3BA 3GLGB 4GC5A 4EIWA 3F92A 1NVMA 3C3EA 1XHBA 2DWNA 1MX0A 2Z4RA 3JAMS 4B3RM 3VLFB 1K82A 1WR1B 3HHWA 1ZQ9A 4KLNA 2C98A 5C18A 4DV4M 3J2PB 2V1UA 4BLCA 2MR9A 1TDHA 2UXDM 3GRRA 4GITA 4LJ4A 2BNKA 3M6AA 3TL4X 1QAMA 3OTOM 3QYBA 2DAIA 3HGIA 3CGWA 2QNJA 1NV8A 3AOEA 4L16A 4S12A 1IN7A 1SXJE 5ITYA 1AIPC 1G41A 4JI0M 3FTCA 2C9OA 1NY5A 1JR3D 3JR4A 4LF8M 3VK7A 4F2LA 7CATA 1IY0A 1ZMVA 2JZ0A 3B7ZA 4NXMM 1IFYA 2XFSA 1DGBA 4REZA 3I4VA 1GVNA 1WGNA 3FUTA 3SBJA 1NY6A 2FE8A 2JNHA 2L4FA 1VEGA 2Z8YM 4MM3B 2F5OA 1HQYE 5DYIA 3FTFA 2DAMA 1V33A 4I5SA 1DGHB 1GO5A 2HL7A 3GLFB 2FNAA 3T1YM 3VDPA 1NSFA 4WP2A 4HEOA 1E9SA 4IBBA 1IY1A 2OO9A 4DUZM 2MROB 4QOZC 1GL6A 3K1JA 1MN3A 2LBCA 4PCZA 3HU3A 1ZMUA 3KOYE 4UN2B 3HJQA 4XBOA 3KS8A 4CJ6A 2B3TA 2Y0TA 3E9SA 3CF2A 3LVVA 4LCBA 2XH9A 2QENA 2LXEA 3HHXA 4KODA 4NL4H 1TR8A 2ZANA 2UXCM 4AKIA 5H37D 3JR5A 1LV7A 3GLIE 4Y28F 4NRWA 4LGYA 4G4NA 2MJ5B 1QDRA 2CEAA 3LMMA 4RF0A 2OQ4A 4JI5M 2CRUA 1TF0B 4IJFA 2XZUA 1VEKA 1PRBA 3NBIA 2BJWA 2XZFA 1IXSB 4M9SA 3CTWB 5EP2A 3HHYA 2UXBM 4M0DA 3RGPA 2P5TA 3PVSA 2CFOA 3U60B 5KO3A 2JY7A 1DO0A 2R6FA 1YE9A 4L6V6 1ORYB 4L15A 3SAUA 2LVPC 1HNZM 4HL4A 4OU7A 4L8RC 3ZH9B 2DWLA 3VFDA 3GLHE 3GQ4A 2XLJA 2G8LA 4QNRA 1JR3A 3KVWA 2CV2A 4GHLA 1Z59A 1TH3A 3FUVA 2VIIA 4LFAM 4RF1A 2RGHA 1N75A 5FTNA 4R71A 2LVNC 4NRVA 1OTRA 3WHKA 3FE3A 3KXEC 4DV3M 1C7YA 2XEPA 3GPYA 4IJEA 1W5SA 2R46A 4G4OA 2DENA 4D81A 3U6EA 3AFHA 4D80A 3DOAA 3GLGA 2V1CA 5LMUM 2Q2EB 4FD2A 2Z4SA 4LG2A 5KPRA 1IN4A 1Z5CA 2L7IA 1QVRA 3GO8A 1HNXM 2OPFA 1IN5A 2LNHC 1OIZA 2KZSA 4JI8M 2LWXA 3T1HM 1QAQA 2VF7A 2F5SA 1OAIA 3UJNA 3V76A 2CUZA 2I7PA 5ITXA 2YFQA 3FD9A 2DZOB 4NC6A 3H4MA 2DI0A 2DHYA 1J5EM 2QPAA 4FW9A 1N78A 5ITRA 3B7NA 3K9OA 2QCUA 3R8FA 1RU3A 1Z5BA 4LJ8A 2J7NA 5FTJA 2FOIC 4Q7JA 1WGLA 4NSOB 4R3DA 3HY5A 2R4EA 1SXJC 1K3WA 1VQ1A 2HWJA 2L2DA 2J5YA 3E21A 5BPVA 1NHWC 4X64M 3Q8GA 4ZPXA 4DV2M 1XC8A 4FCWA 4HLQA 3M0EA 2A5YB 1DGHA 5E26A 3L27A 3SC3A 3W67A 3GQ5A 3LW5F 3GLFA 4MGHA 2JXNA 1IXZA 2MGWA 4G4RA 4B3TM 2MH8A 3KSJA 4DR4M 4DR7M 3HU1A 3ILKA 4JI2M 2C96A 2C99A 2R0IA 3GRUA 8CATA 2Z3XA 1SXJD 3THGA 1KFVA 4FWGA 2QSFX 2YNMD 5FSWA 4FWHA 2APLA 4JI3M 3W0FA 2VQFM 1N33M 1YUBA 1VDDA 4LFBM 2LVQD 4B7HA 4L78A 3KFUG 3SASA 2DAEA 4JN6A 5GKNA 3L28A 1P3QQ 3U6PA 2BWBA 3ZC7B 2X4AA 2KNAA 2VDBB 3CF6E 4LJ7A 4LRTA 1G3IA 4G4QA 2LHGA 4CGYB 1ZV1A 3DFZA 2R18A 5FTKA 2E5LM 4DV7M 5KPTA 1TH4A 3FUXA 4DV6M 4YY3M 4OW0A 1D0MA 1IXSA 1HJPA 3TE6A 1XXHB 2DHRA 1ZAEA 4AG6A 2QBYB 1IY2A 4LGMA 3W0LB 3J81S 2XSZD 3U60A 4CISA 1X37A 2Y21A 4GMQA 3SYKA 3FTDA 3FUUA 4JXJA 1HR0M 2ZAOA 2WSFF 5DFLA 1MU5A 1V92A 2LVOC 4TUWA 2KRUA 3E4RA 4GEWA 4JV5M 4L4UA 4QHSA 3D8LA 2N35A 4IBGA 3U6CA 2KA6B 4BBAA 2M5ZA 3C58A 1LTMA 2OOAA 2Z7JA 1NJGA 3MMPA 4IBCA 3ZQJA 1UM8A 2ERCA 3T38A 5DYGA 1G4AE 3HWSA 3C9PA 1Q02A 4LF5M 4LF9M 3SYLA 2DWMA 3GLGE 4LZZA 3HKPA 3HZJA 3FTEA 4IIWA 4M0WA 3PNVA 2K0BX 2VF8A 3RGSA 1T43A 4ITQA 2HKJA 1CUKA 3HX3A 5FTLA 3KDSE 2R65A 2JZ1A 3SHGB 3AJIB 2R44A 4KT0F 3HJ8A 3UK6A 1R2ZA 4RKUF 2JY6B 1L2CA 3BOSA 4DV5M 2UUAM 5KQ8A 1SXJA 5ITXE 3TWMA 4X62M 2ZTCA 4B7GA 2F5PA 3J27B 1QZEA 1GL7A 1OAOC 1WJ7A 2JA2A 1FNNA 4JI7M 2RKOA 1W5TA 2HCBA 4JI6M 3SMSA 4LJAA 2XGNA 1WIVA 2R62A 3U5ZB 3A98B 2UUCM 3VKHA 3SHFA 5EJCA 5FTMA 5JI2E 2D7GA 5A2QS 3EIHA 1DV0A 1D0LA 3J7AS 2YR0A 3VK8A 2G3QA 2M60A 1GJSA 1DGGA 4P16A 4PDGA 4IBIA 1L1TA 3KP1E 2WSCF 3KP0E 3B9PA 3B74A 3KOWE 2XFTA 5ITQA 3QYEA 1N77A 2Y20A 2XSZA 4BB9A 2F4VM 3T6PA 4DR6M 1PJTA 2QP9X 2O25A 2G5GX 1N36M 3GLFE 2QHOB 4IBEA 3C3DA 3GPUA 1SXJB 4CHTB 1OJLA 4G6ZA 2KZUA 1XMQM 2C9CA 2RGOA 1TDZA 1ZMWA 3SFZA 1VEJA 1QZMA 3WHLA 3U6OA 1IBKM 5EXPA 5ITTA 4JI4M 1PJSA 2KRKA 1JB0F 2FFJA 4IBFA 1I4WA 3VDUA 4KO8A 2KNZA 1SG9A 1T6OA 4QOSA 2CV1A 5EP1A 4AKHA 3I4YA 3KW6A 2UUBM 4DBGB 2QZ4A 4I8OA 4PT5A 3U6QA 4IBJA 3AL0C 1TTEA 1J7KA 2FH0A 4X66M 2K6BA 1NV9A 3KOXE 2AHMA 2WSEF 3TPZA 4DR5M 1IQPA 3B7QA 4XK8F 3T15A 1R2YA 4LF7M 3E46A 3L2AA 3QWLA 1R4GA 4PD2A 1TGUA 2VQEM 1OIPA 3I51A 4YHHM 5KPZA 2LTUA 5KQDA 3AOGA 4I81A 2XF3A 4GKKM 1JQJC 1YSYA 1XXHA 3DZDA 2L4EA 1L1ZA 1OFIA 2QQ8A 2QBYA 1WHCA 3UMMA 1OKSA 5IT9S 4IBKA 2K9DA 5BR8M 3CF0A 3GLIB 1DGFA 1L2DA 4Z6YA 3L25A 4FWDA 2KEBA 4IBDA 4LRSA 3IECA 2O01F 4MB7A 5JI3E 2EKKA 2KHHA 4LJ9A 2CHGA 1I94M 3B89A 2DNAA 5IREB 3TQSA 1IBLM 4P17A 4KHPM 2GQFA 4QHTA 3SATA 3GP1A 4NSRA 1V34A 1XB2B 2EUCA 3SAVA 4XGIA 1L8QA 2J7OA 3GRYA 4K0KM 5IZ7D 3FYDA 2CWBA 1NNUC 4FCTA 4WW0A 5EP3A 1YLAA 1KSFX 2DVWB 1DO2A 3FRHA 1J09A 1Q3CA 3FYCA 2EA0A 1G71A 3GLHB 3GRVA 4MH0E 2ZM6M 4DV0M 2L09A 1OQYA 3LCVB 1EIJA 4II7A 3IG8A 3NWLA 4Z8XA 3U6DA 5F3WA 1IBMM 1K3XA 1H6UA 2WZJA 4ANRA 2JY5A 4AG5A 4OVZA 2DXIA 3U61B 3K92A 1JR3E 4RNAA 4M9ZA 1N32M 2BWEA 3M7GA 3QAUA 3U6SA 4AW4A 1C1KA 1HNWM 1G8PA 1Q39A 3PNYA 1QQWA 2X8AA 4QNMA 4GH9A 3L26A 1VG5A 1AUAA 1TH2A 3NBXX 1S3SA 1GABA 2R45A 1IM2A 3I04M 3UGJA 3U5ZA 2FS1A 3J7BA 2K47A 3LCUA 1PM5A 2ZAMA 1NO1A 2CP8A 2JUJA 1E9RA 1PJJA 2L7HA 3SMPA 3GPPA 3LQRA 2DZLA 2LH0A 4NOOB 3U6MA 1PGYA 2EJSA 3RFWA 2DZNB 3HU2A 3VKGA 3R9XB 1QYRA 2R4JA 3LQQA 3UZUA 2F5QA 1R5LA 4B08A 1HT1E 2W82A 2CV0A 2LHCA 2RRUA 2BJVA 3AV0A 3BXWA 4LFCM 3SARA 1NJFA 1D0KA 1R7RA 1PJIA 1QANA 3FUWA 2EO2A 3LVWA 3ZCBB 4LF4M 2H1RA 4OVZB 4JYAM 2HHHM 1WXQA 2OOBA 5DNYA 4B3MM 2JWSA 2V6ZM 5EXSA 5L8RF 1F4IA 2DAKA 3BBZA 1NNJA 3KS4A 1QUSA 2NQ8C 3KSXA 5IWAM 2JP7A 1IN8A 4G3OA 4AZFA 4DR3M 3MJ5A 5FLXS 2YQZA 3J80S 1L2BA 3IHPA 1PJQA 2CHQA 5EXXA 3W68A 4GKJM 4GIPA 1EFUB 5C1BA 4LJ5A 2I7NA 3AOEC 3DA1A 4W5WA 4X65M 4B3SM 3EIEA 2EKFA 1QDTA 3K2LA 4GC9A 3KOZE 3SAWA 4AI6A 1VDLA 2HAKA 2GNOA 4PDIA 4GHAA 1R6BX 4NXNM 1OFHA 1XXHE 4I4LA 3GQ3A 2CE7A 4AKGA 2L6OA 3FRIA 3PFIA 4R7GA 5EXTA 4B7FA 1HT2E 5EP4A 4CIZA 2O5RA 3MHVC 3H4JA 2KNVA 2DWZB 4MGZE 3TWLA 3FKEA 1EE8A 3HJSA 3A46A 4AQYM 1N34M 1Z6TA 1A5TA 1UFZA 3GLIA 1GLNA 2KW0A 3A42A 4WURA 4DR1M 2C5RA 1MJGM 4LZJA 4MGKE 5LMNM 1D2NA 1NHGC 1G59A 4MGYE 3A45A 1HQCA 2D7HA 2H5XA 4FCVA 3D8BA 3IG5A 2F5NA 1Z5AA 3TWKA 1GJTA 2UU9M 1XNQM 1QUTA 4LF6M 1XMOM 1GKIA 3PXGA 3L29A 3MK6A 1E32A 2KDLA 1XNRM 2ZBKB 2X49A 4JI1M 1XWIA 3RE8A 1E94E 2CHVA 3GLHA 4DV1M 1T3TA 2LVAA 2DKLA 1IN6A 4A3VB 4D82A 3AKZA 5EQTA 3GPXA 3U6LA 4OX9M 4FVMA 3I01M 2JY8A 4MGIE 3K8ZA 4LY6A 1BVSA 5ITUA 2DAGA 3Q8XA 1FJGM 3K9PA 4DR2M 2D7EA 1QAOA 3U61A 4LJ6A
chains in the Genus database with same CATH topology
1IXRC 5E6JA 4M9XA 3HHZA 4DUYM 2Y0QA 1KYIA 2KXEA 4GRIA 3GLGB 1Q3BA 4GC5A 4EIWA 2DWNA 1NVMA 1XHBA 1MX0A 2Z4RA 3JAMS 4B3RM 3VLFB 1K82A 3HHWA 1ZQ9A 4KLNA 2C98A 5C18A 4DV4M 3J2PB 2V1UA 4BLCA 1TDHA 2UXDM 3GRRA 4GITA 4LJ4A 2BNKA 3M6AA 3TL4X 1QAMA 3OTOM 3HGIA 4S12A 3AOEA 4L16A 1IN7A 1SXJE 5ITYA 1G41A 4JI0M 3FTCA 2C9OA 1NY5A 1JR3D 3JR4A 4LF8M 3VK7A 7CATA 1IY0A 4NXMM 2XFSA 1DGBA 4REZA 3I4VA 1GVNA 3FUTA 3SBJA 1NY6A 2FE8A 4MM3B 2F5OA 1HQYE 5DYIA 3FTFA 4I5SA 1DGHB 2HL7A 3GLFB 2FNAA 3T1YM 3VDPA 1NSFA 1E9SA 4IBBA 1IY1A 4DUZM 4QOZC 1GL6A 3K1JA 4PCZA 3HU3A 3KOYE 3HJQA 4XBOA 3KS8A 2Y0TA 3E9SA 3CF2A 3LVVA 4LCBA 2XH9A 2QENA 2LXEA 3HHXA 4KODA 4NL4H 2ZANA 2UXCM 4AKIA 5H37D 3JR5A 1LV7A 4NRWA 4LGYA 4G4NA 2CEAA 3LMMA 4RF0A 2OQ4A 4JI5M 4IJFA 2XZUA 3NBIA 2BJWA 2XZFA 1IXSB 4M9SA 3CTWB 5EP2A 3HHYA 2UXBM 4M0DA 3RGPA 2P5TA 3PVSA 2CFOA 3U60B 5KO3A 1DO0A 1YE9A 1ORYB 4L15A 3SAUA 1HNZM 4HL4A 4OU7A 4L8RC 3ZH9B 2DWLA 3VFDA 3GQ4A 2XLJA 2G8LA 4QNRA 1JR3A 3KVWA 2CV2A 4GHLA 1Z59A 1TH3A 3FUVA 2VIIA 4LFAM 4RF1A 2RGHA 1N75A 5FTNA 4NRVA 3WHKA 3KXEC 4DV3M 2XEPA 3GPYA 4IJEA 1W5SA 2R46A 4G4OA 4D81A 3U6EA 3AFHA 4D80A 3DOAA 3GLGA 2V1CA 5LMUM 2Q2EB 4FD2A 2Z4SA 4LG2A 5KPRA 1IN4A 1Z5CA 2L7IA 1QVRA 3GO8A 1HNXM 2OPFA 1IN5A 2LNHC 2KZSA 4JI8M 2LWXA 3T1HM 1QAQA 2F5SA 3UJNA 2CUZA 2I7PA 5ITXA 2YFQA 3FD9A 2DZOB 3H4MA 1J5EM 2QPAA 4FW9A 1N78A 5ITRA 2QCUA 3R8FA 1Z5BA 4LJ8A 2J7NA 5FTJA 2FOIC 4NSOB 4R3DA 2R4EA 1SXJC 1K3WA 5BPVA 1NHWC 4X64M 4ZPXA 4DV2M 1XC8A 4FCWA 4HLQA 3M0EA 2A5YB 1DGHA 5E26A 3L27A 3SC3A 3GQ5A 3GLFA 4MGHA 1IXZA 4G4RA 4B3TM 3KSJA 4DR4M 4DR7M 3HU1A 3ILKA 2C96A 2C99A 3GRUA 8CATA 2Z3XA 1SXJD 3THGA 1KFVA 4FWGA 2YNMD 5FSWA 4FWHA 3W0FA 4JI3M 2VQFM 1N33M 1YUBA 1VDDA 4LFBM 4B7HA 4L78A 3KFUG 3SASA 4JN6A 5GKNA 3L28A 3U6PA 3ZC7B 2X4AA 4LJ7A 3CF6E 4LRTA 1G3IA 4G4QA 4CGYB 3DFZA 2R18A 5FTKA 2E5LM 4DV7M 5KPTA 1TH4A 3FUXA 4DV6M 4YY3M 4OW0A 3TE6A 1XXHB 2DHRA 1ZAEA 4AG6A 2QBYB 1IY2A 4LGMA 3W0LB 3J81S 2XSZD 3U60A 4CISA 1X37A 2Y21A 4GMQA 3SYKA 3FTDA 3FUUA 4JXJA 1HR0M 2ZAOA 1MU5A 4TUWA 2KRUA 3E4RA 4JV5M 4L4UA 4QHSA 3D8LA 4IBGA 3U6CA 2KA6B 4BBAA 2M5ZA 3C58A 2Z7JA 1NJGA 4IBCA 1UM8A 2ERCA 3T38A 5DYGA 1G4AE 3HWSA 4LF5M 4LF9M 3SYLA 2DWMA 4LZZA 3HKPA 3FTEA 4IIWA 4M0WA 3PNVA 4ITQA 3RGSA 2HKJA 5FTLA 3KDSE 2R65A 3SHGB 3AJIB 3UK6A 1R2ZA 3HJ8A 1L2CA 3BOSA 4DV5M 2UUAM 5KQ8A 1SXJA 5ITXE 3TWMA 4X62M 4B7GA 2F5PA 3J27B 1GL7A 2JA2A 4JI7M 1FNNA 2RKOA 1W5TA 2HCBA 4JI6M 3SMSA 4LJAA 2XGNA 2UUCM 2R62A 3U5ZB 3A98B 3VKHA 3SHFA 5EJCA 5FTMA 5JI2E 2D7GA 5A2QS 3EIHA 3J7AS 2YR0A 3VK8A 2M60A 1DGGA 4P16A 4PDGA 4IBIA 1L1TA 3KP1E 3KP0E 3B9PA 3KOWE 2XFTA 5ITQA 1N77A 2Y20A 2XSZA 4BB9A 2F4VM 4DR6M 2QP9X 2G5GX 1N36M 4IBEA 3GPUA 1SXJB 4CHTB 1OJLA 4G6ZA 2KZUA 1XMQM 2C9CA 2RGOA 1TDZA 3SFZA 3WHLA 1IBKM 1QZMA 3U6OA 5EXPA 5ITTA 4JI4M 2KRKA 2FFJA 4IBFA 1I4WA 3VDUA 4KO8A 4QOSA 2CV1A 5EP1A 4AKHA 3I4YA 3KW6A 2UUBM 2QZ4A 4I8OA 4PT5A 3U6QA 4IBJA 3AL0C 1J7KA 4X66M 3KOXE 2AHMA 3TPZA 4DR5M 1R2YA 1IQPA 4LF7M 3T15A 3L2AA 3QWLA 4PD2A 1TGUA 2VQEM 3I51A 4YHHM 5KPZA 5KQDA 3AOGA 4I81A 2XF3A 4GKKM 1JQJC 1YSYA 1XXHA 3DZDA 1L1ZA 1OFIA 2QBYA 3UMMA 5IT9S 4IBKA 5BR8M 3CF0A 3GLIB 1DGFA 1L2DA 4Z6YA 3L25A 4FWDA 2KEBA 4IBDA 4LRSA 4MB7A 5JI3E 4LJ9A 2CHGA 1I94M 3TQSA 5IREB 1IBLM 4KHPM 4QHTA 3SATA 3GP1A 4NSRA 2EUCA 3SAVA 4XGIA 1L8QA 2J7OA 3GRYA 4K0KM 5IZ7D 3FYDA 4FCTA 1NNUC 4WW0A 5EP3A 1KSFX 2DVWB 1DO2A 1J09A 1Q3CA 3FYCA 2EA0A 3GLHB 3GRVA 4MH0E 2ZM6M 4DV0M 2L09A 4II7A 3IG8A 3NWLA 4Z8XA 3U6DA 5F3WA 1IBMM 1K3XA 1H6UA 2DXIA 4AG5A 4OVZA 3U61B 3K92A 4RNAA 4M9ZA 1N32M 3M7GA 3QAUA 3U6SA 4AW4A 1C1KA 1HNWM 1G8PA 1Q39A 3PNYA 1QQWA 2X8AA 4QNMA 4GH9A 3L26A 1TH2A 1S3SA 2R45A 1IM2A 3UGJA 3U5ZA 3J7BA 2K47A 1PM5A 2ZAMA 1E9RA 1PJJA 2L7HA 3SMPA 3GPPA 3LQRA 2LH0A 4NOOB 3U6MA 3RFWA 2DZNB 3HU2A 3VKGA 3R9XB 1QYRA 2R4JA 3LQQA 3UZUA 2F5QA 4JI2M 4B08A 1HT1E 2W82A 2CV0A 3AV0A 4LFCM 2BJVA 3SARA 1NJFA 1R7RA 1PJIA 1QANA 3FUWA 2EO2A 3LVWA 3ZCBB 4LF4M 2H1RA 4OVZB 4JYAM 2HHHM 1WXQA 5DNYA 4B3MM 5EXSA 2V6ZM 1NNJA 3KS4A 2NQ8C 3KSXA 5IWAM 1IN8A 4AZFA 4DR3M 3MJ5A 5FLXS 2YQZA 3J80S 1L2BA 2CHQA 5EXXA 4GKJM 4GIPA 5C1BA 4LJ5A 2I7NA 3AOEC 3DA1A 4W5WA 4X65M 4B3SM 3EIEA 3K2LA 4GC9A 3KOZE 3SAWA 4AI6A 4GHAA 4PDIA 1R6BX 4NXNM 1OFHA 4I4LA 3GQ3A 2CE7A 4AKGA 2L6OA 5EXTA 3PFIA 4R7GA 4B7FA 1HT2E 5EP4A 2O5RA 3MHVC 2DWZB 4MGZE 3TWLA 3FKEA 1EE8A 3HJSA 3A46A 4AQYM 1N34M 1Z6TA 3GLIA 1GLNA 2KW0A 3A42A 4WURA 4DR1M 2C5RA 4LZJA 4MGKE 5LMNM 1D2NA 1NHGC 1G59A 4MGYE 3A45A 1HQCA 2D7HA 4FCVA 3D8BA 3IG5A 2F5NA 1Z5AA 3TWKA 2UU9M 1XNQM 4LF6M 1XMOM 1GKIA 3PXGA 3L29A 3MK6A 1E32A 1XNRM 2ZBKB 2X49A 4JI1M 1XWIA 3RE8A 1E94E 2CHVA 3GLHA 4DV1M 1T3TA 1IN6A 4A3VB 4D82A 3AKZA 5EQTA 3GPXA 3U6LA 4OX9M 4FVMA 4MGIE 3K8ZA 4LY6A 5ITUA 3Q8XA 1FJGM 4DR2M 2D7EA 1QAOA 3U61A 4LJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R2Z A;  3DOA A;  5LMU M;  4DUY M;  2Q2E B;  1L2C A;  4DV5 M;  1N32 M;  3U6S A;  1Q3B A;  2UUA M;  1HNW M;  1Q39 A;  1Z5C A;  3TWM A;  5ITX E;  4X62 M;  1HNX M;  3GO8 A;  2F5P A;  1MX0 A;  3JAM S;  2OPF A;  4B3R M;  4JI7 M;  4JI8 M;  1K82 A;  3T1H M;  2F5S A;  4JI6 M;  1PM5 A;  4DV4 M;  5ITX A;  2UUC M;  1PJJ A;  1TDH A;  3GPP A;  5A2Q S;  2UXD M;  1J5E M;  3U6M A;  3J7A S;  3VK8 A;  5ITR A;  4PDG A;  3OTO M;  1L1T A;  2F5Q A;  4JI2 M;  4LFC M;  1Z5B A;  5ITY A;  4JI0 M;  3SAR A;  1PJI A;  5ITQ A;  1K3W A;  4LF4 M;  2F4V M;  4JYA M;  3JR4 A;  4LF8 M;  3VK7 A;  4DR6 M;  2HHH M;  4X64 M;  4NXM M;  1N36 M;  4B3M M;  3GPU A;  4DV2 M;  1NNJ A;  1XMQ M;  3SBJ A;  1XC8 A;  1TDZ A;  1IBK M;  5IWA M;  3U6O A;  2F5O A;  4DR3 M;  5ITT A;  5FLX S;  3J80 S;  3GQ5 A;  1L2B A;  4JI4 M;  4GKJ M;  4G4R A;  3T1Y M;  4B3T M;  4DR4 M;  4DR7 M;  4X65 M;  4B3S M;  4DUZ M;  2UUB M;  1KFV A;  4PCZ A;  3U6Q A;  3W0F A;  3SAW A;  4JI3 M;  2VQF M;  4X66 M;  1N33 M;  4LFB M;  4PDI A;  4DR5 M;  1R2Y A;  3SAS A;  4LF7 M;  4NXN M;  3U6P A;  3GQ3 A;  4PD2 A;  4G4Q A;  2UXC M;  2VQE M;  4YHH M;  3JR5 A;  4NRW A;  4G4N A;  2E5L M;  4JI5 M;  2OQ4 A;  4DV7 M;  4GKK M;  3TWL A;  1EE8 A;  4AQY M;  3A46 A;  1N34 M;  4DV6 M;  4YY3 M;  2XZU A;  1L1Z A;  2XZF A;  5IT9 S;  2UXB M;  3J81 S;  5BR8 M;  3A42 A;  4DR1 M;  4CIS A;  1L2D A;  1HR0 M;  5LMN M;  4MB7 A;  1MU5 A;  1I94 M;  3A45 A;  3SAU A;  1IBL M;  1HNZ M;  4JV5 M;  4KHP M;  2F5N A;  3SAT A;  1Z5A A;  3GP1 A;  3TWK A;  3GQ4 A;  3U6C A;  2UU9 M;  1XNQ M;  3SAV A;  3C58 A;  4LF6 M;  1XMO M;  4K0K M;  1Z59 A;  1XNR M;  2ZBK B;  4JI1 M;  1Q3C A;  4DV1 M;  4LFA M;  3U6D A;  4LF5 M;  4LF9 M;  2EA0 A;  2ZM6 M;  4DV0 M;  4NRV A;  3GPX A;  3U6L A;  4OX9 M;  4DV3 M;  3GPY A;  5ITU A;  4G4O A;  4ITQ A;  2HKJ A;  4DR2 M;  1IBM M;  3U6E A;  1FJG M;  1K3X A; 
#chains in the Genus database with same CATH topology
 1IXR C;  5E6J A;  4M9X A;  3HHZ A;  4F1I A;  4DUY M;  2Y0Q A;  1KYI A;  1Y8G A;  2KXE A;  4GRI A;  2ZTD A;  1Q3B A;  3GLG B;  4GC5 A;  4EIW A;  3F92 A;  1NVM A;  3C3E A;  1XHB A;  2DWN A;  1MX0 A;  2Z4R A;  3JAM S;  4B3R M;  3VLF B;  1K82 A;  1WR1 B;  3HHW A;  1ZQ9 A;  4KLN A;  2C98 A;  5C18 A;  4DV4 M;  3J2P B;  2V1U A;  4BLC A;  2MR9 A;  1TDH A;  2UXD M;  3GRR A;  4GIT A;  4LJ4 A;  2BNK A;  3M6A A;  3TL4 X;  1QAM A;  3OTO M;  3QYB A;  2DAI A;  3HGI A;  3CGW A;  2QNJ A;  1NV8 A;  3AOE A;  4L16 A;  4S12 A;  1IN7 A;  1SXJ E;  5ITY A;  1AIP C;  1G41 A;  4JI0 M;  3FTC A;  2C9O A;  1NY5 A;  1JR3 D;  3JR4 A;  4LF8 M;  3VK7 A;  4F2L A;  7CAT A;  1IY0 A;  1ZMV A;  2JZ0 A;  3B7Z A;  4NXM M;  1IFY A;  2XFS A;  1DGB A;  4REZ A;  3I4V A;  1GVN A;  1WGN A;  3FUT A;  3SBJ A;  1NY6 A;  2FE8 A;  2JNH A;  2L4F A;  1VEG A;  2Z8Y M;  4MM3 B;  2F5O A;  1HQY E;  5DYI A;  3FTF A;  2DAM A;  1V33 A;  4I5S A;  1DGH B;  1GO5 A;  2HL7 A;  3GLF B;  2FNA A;  3T1Y M;  3VDP A;  1NSF A;  4WP2 A;  4HEO A;  1E9S A;  4IBB A;  1IY1 A;  2OO9 A;  4DUZ M;  2MRO B;  4QOZ C;  1GL6 A;  3K1J A;  1MN3 A;  2LBC A;  4PCZ A;  3HU3 A;  1ZMU A;  3KOY E;  4UN2 B;  3HJQ A;  4XBO A;  3KS8 A;  4CJ6 A;  2B3T A;  2Y0T A;  3E9S A;  3CF2 A;  3LVV A;  4LCB A;  2XH9 A;  2QEN A;  2LXE A;  3HHX A;  4KOD A;  4NL4 H;  1TR8 A;  2ZAN A;  2UXC M;  4AKI A;  5H37 D;  3JR5 A;  1LV7 A;  3GLI E;  4Y28 F;  4NRW A;  4LGY A;  4G4N A;  2MJ5 B;  1QDR A;  2CEA A;  3LMM A;  4RF0 A;  2OQ4 A;  4JI5 M;  2CRU A;  1TF0 B;  4IJF A;  2XZU A;  1VEK A;  1PRB A;  3NBI A;  2BJW A;  2XZF A;  1IXS B;  4M9S A;  3CTW B;  5EP2 A;  3HHY A;  2UXB M;  4M0D A;  3RGP A;  2P5T A;  3PVS A;  2CFO A;  3U60 B;  5KO3 A;  2JY7 A;  1DO0 A;  2R6F A;  1YE9 A;  4L6V 6;  1ORY B;  4L15 A;  3SAU A;  2LVP C;  1HNZ M;  4HL4 A;  4OU7 A;  4L8R C;  3ZH9 B;  2DWL A;  3VFD A;  3GLH E;  3GQ4 A;  2XLJ A;  2G8L A;  4QNR A;  1JR3 A;  3KVW A;  2CV2 A;  4GHL A;  1Z59 A;  1TH3 A;  3FUV A;  2VII A;  4LFA M;  4RF1 A;  2RGH A;  1N75 A;  5FTN A;  4R71 A;  2LVN C;  4NRV A;  1OTR A;  3WHK A;  3FE3 A;  3KXE C;  4DV3 M;  1C7Y A;  2XEP A;  3GPY A;  4IJE A;  1W5S A;  2R46 A;  4G4O A;  2DEN A;  4D81 A;  3U6E A;  3AFH A;  4D80 A;  3DOA A;  3GLG A;  2V1C A;  5LMU M;  2Q2E B;  4FD2 A;  2Z4S A;  4LG2 A;  5KPR A;  1IN4 A;  1Z5C A;  2L7I A;  1QVR A;  3GO8 A;  1HNX M;  2OPF A;  1IN5 A;  2LNH C;  1OIZ A;  2KZS A;  4JI8 M;  2LWX A;  3T1H M;  1QAQ A;  2VF7 A;  2F5S A;  1OAI A;  3UJN A;  3V76 A;  2CUZ A;  2I7P A;  5ITX A;  2YFQ A;  3FD9 A;  2DZO B;  4NC6 A;  3H4M A;  2DI0 A;  2DHY A;  1J5E M;  2QPA A;  4FW9 A;  1N78 A;  5ITR A;  3B7N A;  3K9O A;  2QCU A;  3R8F A;  1RU3 A;  1Z5B A;  4LJ8 A;  2J7N A;  5FTJ A;  2FOI C;  4Q7J A;  1WGL A;  4NSO B;  4R3D A;  3HY5 A;  2R4E A;  1SXJ C;  1K3W A;  1VQ1 A;  2HWJ A;  2L2D A;  2J5Y A;  3E21 A;  5BPV A;  1NHW C;  4X64 M;  3Q8G A;  4ZPX A;  4DV2 M;  1XC8 A;  4FCW A;  4HLQ A;  3M0E A;  2A5Y B;  1DGH A;  5E26 A;  3L27 A;  3SC3 A;  3W67 A;  3GQ5 A;  3LW5 F;  3GLF A;  4MGH A;  2JXN A;  1IXZ A;  2MGW A;  4G4R A;  4B3T M;  2MH8 A;  3KSJ A;  4DR4 M;  4DR7 M;  3HU1 A;  3ILK A;  4JI2 M;  2C96 A;  2C99 A;  2R0I A;  3GRU A;  8CAT A;  2Z3X A;  1SXJ D;  3THG A;  1KFV A;  4FWG A;  2QSF X;  2YNM D;  5FSW A;  4FWH A;  2APL A;  4JI3 M;  3W0F A;  2VQF M;  1N33 M;  1YUB A;  1VDD A;  4LFB M;  2LVQ D;  4B7H A;  4L78 A;  3KFU G;  3SAS A;  2DAE A;  4JN6 A;  5GKN A;  3L28 A;  1P3Q Q;  3U6P A;  2BWB A;  3ZC7 B;  2X4A A;  2KNA A;  2VDB B;  3CF6 E;  4LJ7 A;  4LRT A;  1G3I A;  4G4Q A;  2LHG A;  4CGY B;  1ZV1 A;  3DFZ A;  2R18 A;  5FTK A;  2E5L M;  4DV7 M;  5KPT A;  1TH4 A;  3FUX A;  4DV6 M;  4YY3 M;  4OW0 A;  1D0M A;  1IXS A;  1HJP A;  3TE6 A;  1XXH B;  2DHR A;  1ZAE A;  4AG6 A;  2QBY B;  1IY2 A;  4LGM A;  3W0L B;  3J81 S;  2XSZ D;  3U60 A;  4CIS A;  1X37 A;  2Y21 A;  4GMQ A;  3SYK A;  3FTD A;  3FUU A;  4JXJ A;  1HR0 M;  2ZAO A;  2WSF F;  5DFL A;  1MU5 A;  1V92 A;  2LVO C;  4TUW A;  2KRU A;  3E4R A;  4GEW A;  4JV5 M;  4L4U A;  4QHS A;  3D8L A;  2N35 A;  4IBG A;  3U6C A;  2KA6 B;  4BBA A;  2M5Z A;  3C58 A;  1LTM A;  2OOA A;  2Z7J A;  1NJG A;  3MMP A;  4IBC A;  3ZQJ A;  1UM8 A;  2ERC A;  3T38 A;  5DYG A;  1G4A E;  3HWS A;  3C9P A;  1Q02 A;  4LF5 M;  4LF9 M;  3SYL A;  2DWM A;  3GLG E;  4LZZ A;  3HKP A;  3HZJ A;  3FTE A;  4IIW A;  4M0W A;  3PNV A;  2K0B X;  2VF8 A;  3RGS A;  1T43 A;  4ITQ A;  2HKJ A;  1CUK A;  3HX3 A;  5FTL A;  3KDS E;  2R65 A;  2JZ1 A;  3SHG B;  3AJI B;  2R44 A;  4KT0 F;  3HJ8 A;  3UK6 A;  1R2Z A;  4RKU F;  2JY6 B;  1L2C A;  3BOS A;  4DV5 M;  2UUA M;  5KQ8 A;  1SXJ A;  5ITX E;  3TWM A;  4X62 M;  2ZTC A;  4B7G A;  2F5P A;  3J27 B;  1QZE A;  1GL7 A;  1OAO C;  1WJ7 A;  2JA2 A;  1FNN A;  4JI7 M;  2RKO A;  1W5T A;  2HCB A;  4JI6 M;  3SMS A;  4LJA A;  2XGN A;  1WIV A;  2R62 A;  3U5Z B;  3A98 B;  2UUC M;  3VKH A;  3SHF A;  5EJC A;  5FTM A;  5JI2 E;  2D7G A;  5A2Q S;  3EIH A;  1DV0 A;  1D0L A;  3J7A S;  2YR0 A;  3VK8 A;  2G3Q A;  2M60 A;  1GJS A;  1DGG A;  4P16 A;  4PDG A;  4IBI A;  1L1T A;  3KP1 E;  2WSC F;  3KP0 E;  3B9P A;  3B74 A;  3KOW E;  2XFT A;  5ITQ A;  3QYE A;  1N77 A;  2Y20 A;  2XSZ A;  4BB9 A;  2F4V M;  3T6P A;  4DR6 M;  1PJT A;  2QP9 X;  2O25 A;  2G5G X;  1N36 M;  3GLF E;  2QHO B;  4IBE A;  3C3D A;  3GPU A;  1SXJ B;  4CHT B;  1OJL A;  4G6Z A;  2KZU A;  1XMQ M;  2C9C A;  2RGO A;  1TDZ A;  1ZMW A;  3SFZ A;  1VEJ A;  1QZM A;  3WHL A;  3U6O A;  1IBK M;  5EXP A;  5ITT A;  4JI4 M;  1PJS A;  2KRK A;  1JB0 F;  2FFJ A;  4IBF A;  1I4W A;  3VDU A;  4KO8 A;  2KNZ A;  1SG9 A;  1T6O A;  4QOS A;  2CV1 A;  5EP1 A;  4AKH A;  3I4Y A;  3KW6 A;  2UUB M;  4DBG B;  2QZ4 A;  4I8O A;  4PT5 A;  3U6Q A;  4IBJ A;  3AL0 C;  1TTE A;  1J7K A;  2FH0 A;  4X66 M;  2K6B A;  1NV9 A;  3KOX E;  2AHM A;  2WSE F;  3TPZ A;  4DR5 M;  1IQP A;  3B7Q A;  4XK8 F;  3T15 A;  1R2Y A;  4LF7 M;  3E46 A;  3L2A A;  3QWL A;  1R4G A;  4PD2 A;  1TGU A;  2VQE M;  1OIP A;  3I51 A;  4YHH M;  5KPZ A;  2LTU A;  5KQD A;  3AOG A;  4I81 A;  2XF3 A;  4GKK M;  1JQJ C;  1YSY A;  1XXH A;  3DZD A;  2L4E A;  1L1Z A;  1OFI A;  2QQ8 A;  2QBY A;  1WHC A;  3UMM A;  1OKS A;  5IT9 S;  4IBK A;  2K9D A;  5BR8 M;  3CF0 A;  3GLI B;  1DGF A;  1L2D A;  4Z6Y A;  3L25 A;  4FWD A;  2KEB A;  4IBD A;  4LRS A;  3IEC A;  2O01 F;  4MB7 A;  5JI3 E;  2EKK A;  2KHH A;  4LJ9 A;  2CHG A;  1I94 M;  3B89 A;  2DNA A;  5IRE B;  3TQS A;  1IBL M;  4P17 A;  4KHP M;  2GQF A;  4QHT A;  3SAT A;  3GP1 A;  4NSR A;  1V34 A;  1XB2 B;  2EUC A;  3SAV A;  4XGI A;  1L8Q A;  2J7O A;  3GRY A;  4K0K M;  5IZ7 D;  3FYD A;  2CWB A;  1NNU C;  4FCT A;  4WW0 A;  5EP3 A;  1YLA A;  1KSF X;  2DVW B;  1DO2 A;  3FRH A;  1J09 A;  1Q3C A;  3FYC A;  2EA0 A;  1G71 A;  3GLH B;  3GRV A;  4MH0 E;  2ZM6 M;  4DV0 M;  2L09 A;  1OQY A;  3LCV B;  1EIJ A;  4II7 A;  3IG8 A;  3NWL A;  4Z8X A;  3U6D A;  5F3W A;  1IBM M;  1K3X A;  1H6U A;  2WZJ A;  4ANR A;  2JY5 A;  4AG5 A;  4OVZ A;  2DXI A;  3U61 B;  3K92 A;  1JR3 E;  4RNA A;  4M9Z A;  1N32 M;  2BWE A;  3M7G A;  3QAU A;  3U6S A;  4AW4 A;  1C1K A;  1HNW M;  1G8P A;  1Q39 A;  3PNY A;  1QQW A;  2X8A A;  4QNM A;  4GH9 A;  3L26 A;  1VG5 A;  1AUA A;  1TH2 A;  3NBX X;  1S3S A;  1GAB A;  2R45 A;  1IM2 A;  3I04 M;  3UGJ A;  3U5Z A;  2FS1 A;  3J7B A;  2K47 A;  3LCU A;  1PM5 A;  2ZAM A;  1NO1 A;  2CP8 A;  2JUJ A;  1E9R A;  1PJJ A;  2L7H A;  3SMP A;  3GPP A;  3LQR A;  2DZL A;  2LH0 A;  4NOO B;  3U6M A;  1PGY A;  2EJS A;  3RFW A;  2DZN B;  3HU2 A;  3VKG A;  3R9X B;  1QYR A;  2R4J A;  3LQQ A;  3UZU A;  2F5Q A;  1R5L A;  4B08 A;  1HT1 E;  2W82 A;  2CV0 A;  2LHC A;  2RRU A;  2BJV A;  3AV0 A;  3BXW A;  4LFC M;  3SAR A;  1NJF A;  1D0K A;  1R7R A;  1PJI A;  1QAN A;  3FUW A;  2EO2 A;  3LVW A;  3ZCB B;  4LF4 M;  2H1R A;  4OVZ B;  4JYA M;  2HHH M;  1WXQ A;  2OOB A;  5DNY A;  4B3M M;  2JWS A;  2V6Z M;  5EXS A;  5L8R F;  1F4I A;  2DAK A;  3BBZ A;  1NNJ A;  3KS4 A;  1QUS A;  2NQ8 C;  3KSX A;  5IWA M;  2JP7 A;  1IN8 A;  4G3O A;  4AZF A;  4DR3 M;  3MJ5 A;  5FLX S;  2YQZ A;  3J80 S;  1L2B A;  3IHP A;  1PJQ A;  2CHQ A;  5EXX A;  3W68 A;  4GKJ M;  4GIP A;  1EFU B;  5C1B A;  4LJ5 A;  2I7N A;  3AOE C;  3DA1 A;  4W5W A;  4X65 M;  4B3S M;  3EIE A;  2EKF A;  1QDT A;  3K2L A;  4GC9 A;  3KOZ E;  3SAW A;  4AI6 A;  1VDL A;  2HAK A;  2GNO A;  4PDI A;  4GHA A;  1R6B X;  4NXN M;  1OFH A;  1XXH E;  4I4L A;  3GQ3 A;  2CE7 A;  4AKG A;  2L6O A;  3FRI A;  3PFI A;  4R7G A;  5EXT A;  4B7F A;  1HT2 E;  5EP4 A;  4CIZ A;  2O5R A;  3MHV C;  3H4J A;  2KNV A;  2DWZ B;  4MGZ E;  3TWL A;  3FKE A;  1EE8 A;  3HJS A;  3A46 A;  4AQY M;  1N34 M;  1Z6T A;  1A5T A;  1UFZ A;  3GLI A;  1GLN A;  2KW0 A;  3A42 A;  4WUR A;  4DR1 M;  2C5R A;  1MJG M;  4LZJ A;  4MGK E;  5LMN M;  1D2N A;  1NHG C;  1G59 A;  4MGY E;  3A45 A;  1HQC A;  2D7H A;  2H5X A;  4FCV A;  3D8B A;  3IG5 A;  2F5N A;  1Z5A A;  3TWK A;  1GJT A;  2UU9 M;  1XNQ M;  1QUT A;  4LF6 M;  1XMO M;  1GKI A;  3PXG A;  3L29 A;  3MK6 A;  1E32 A;  2KDL A;  1XNR M;  2ZBK B;  2X49 A;  4JI1 M;  1XWI A;  3RE8 A;  1E94 E;  2CHV A;  3GLH A;  4DV1 M;  1T3T A;  2LVA A;  2DKL A;  1IN6 A;  4A3V B;  4D82 A;  3AKZ A;  5EQT A;  3GPX A;  3U6L A;  4OX9 M;  4FVM A;  3I01 M;  2JY8 A;  4MGI E;  3K8Z A;  4LY6 A;  1BVS A;  5ITU A;  2DAG A;  3Q8X A;  1FJG M;  3K9P A;  4DR2 M;  2D7E A;  1QAO A;  3U61 A;  4LJ6 A; 
#chains in the Genus database with same CATH homology
 1IXR C;  5E6J A;  4M9X A;  3HHZ A;  4DUY M;  2Y0Q A;  1KYI A;  2KXE A;  4GRI A;  3GLG B;  1Q3B A;  4GC5 A;  4EIW A;  2DWN A;  1NVM A;  1XHB A;  1MX0 A;  2Z4R A;  3JAM S;  4B3R M;  3VLF B;  1K82 A;  3HHW A;  1ZQ9 A;  4KLN A;  2C98 A;  5C18 A;  4DV4 M;  3J2P B;  2V1U A;  4BLC A;  1TDH A;  2UXD M;  3GRR A;  4GIT A;  4LJ4 A;  2BNK A;  3M6A A;  3TL4 X;  1QAM A;  3OTO M;  3HGI A;  4S12 A;  3AOE A;  4L16 A;  1IN7 A;  1SXJ E;  5ITY A;  1G41 A;  4JI0 M;  3FTC A;  2C9O A;  1NY5 A;  1JR3 D;  3JR4 A;  4LF8 M;  3VK7 A;  7CAT A;  1IY0 A;  4NXM M;  2XFS A;  1DGB A;  4REZ A;  3I4V A;  1GVN A;  3FUT A;  3SBJ A;  1NY6 A;  2FE8 A;  4MM3 B;  2F5O A;  1HQY E;  5DYI A;  3FTF A;  4I5S A;  1DGH B;  2HL7 A;  3GLF B;  2FNA A;  3T1Y M;  3VDP A;  1NSF A;  1E9S A;  4IBB A;  1IY1 A;  4DUZ M;  4QOZ C;  1GL6 A;  3K1J A;  4PCZ A;  3HU3 A;  3KOY E;  3HJQ A;  4XBO A;  3KS8 A;  2Y0T A;  3E9S A;  3CF2 A;  3LVV A;  4LCB A;  2XH9 A;  2QEN A;  2LXE A;  3HHX A;  4KOD A;  4NL4 H;  2ZAN A;  2UXC M;  4AKI A;  5H37 D;  3JR5 A;  1LV7 A;  4NRW A;  4LGY A;  4G4N A;  2CEA A;  3LMM A;  4RF0 A;  2OQ4 A;  4JI5 M;  4IJF A;  2XZU A;  3NBI A;  2BJW A;  2XZF A;  1IXS B;  4M9S A;  3CTW B;  5EP2 A;  3HHY A;  2UXB M;  4M0D A;  3RGP A;  2P5T A;  3PVS A;  2CFO A;  3U60 B;  5KO3 A;  1DO0 A;  1YE9 A;  1ORY B;  4L15 A;  3SAU A;  1HNZ M;  4HL4 A;  4OU7 A;  4L8R C;  3ZH9 B;  2DWL A;  3VFD A;  3GQ4 A;  2XLJ A;  2G8L A;  4QNR A;  1JR3 A;  3KVW A;  2CV2 A;  4GHL A;  1Z59 A;  1TH3 A;  3FUV A;  2VII A;  4LFA M;  4RF1 A;  2RGH A;  1N75 A;  5FTN A;  4NRV A;  3WHK A;  3KXE C;  4DV3 M;  2XEP A;  3GPY A;  4IJE A;  1W5S A;  2R46 A;  4G4O A;  4D81 A;  3U6E A;  3AFH A;  4D80 A;  3DOA A;  3GLG A;  2V1C A;  5LMU M;  2Q2E B;  4FD2 A;  2Z4S A;  4LG2 A;  5KPR A;  1IN4 A;  1Z5C A;  2L7I A;  1QVR A;  3GO8 A;  1HNX M;  2OPF A;  1IN5 A;  2LNH C;  2KZS A;  4JI8 M;  2LWX A;  3T1H M;  1QAQ A;  2F5S A;  3UJN A;  2CUZ A;  2I7P A;  5ITX A;  2YFQ A;  3FD9 A;  2DZO B;  3H4M A;  1J5E M;  2QPA A;  4FW9 A;  1N78 A;  5ITR A;  2QCU A;  3R8F A;  1Z5B A;  4LJ8 A;  2J7N A;  5FTJ A;  2FOI C;  4NSO B;  4R3D A;  2R4E A;  1SXJ C;  1K3W A;  5BPV A;  1NHW C;  4X64 M;  4ZPX A;  4DV2 M;  1XC8 A;  4FCW A;  4HLQ A;  3M0E A;  2A5Y B;  1DGH A;  5E26 A;  3L27 A;  3SC3 A;  3GQ5 A;  3GLF A;  4MGH A;  1IXZ A;  4G4R A;  4B3T M;  3KSJ A;  4DR4 M;  4DR7 M;  3HU1 A;  3ILK A;  2C96 A;  2C99 A;  3GRU A;  8CAT A;  2Z3X A;  1SXJ D;  3THG A;  1KFV A;  4FWG A;  2YNM D;  5FSW A;  4FWH A;  3W0F A;  4JI3 M;  2VQF M;  1N33 M;  1YUB A;  1VDD A;  4LFB M;  4B7H A;  4L78 A;  3KFU G;  3SAS A;  4JN6 A;  5GKN A;  3L28 A;  3U6P A;  3ZC7 B;  2X4A A;  4LJ7 A;  3CF6 E;  4LRT A;  1G3I A;  4G4Q A;  4CGY B;  3DFZ A;  2R18 A;  5FTK A;  2E5L M;  4DV7 M;  5KPT A;  1TH4 A;  3FUX A;  4DV6 M;  4YY3 M;  4OW0 A;  3TE6 A;  1XXH B;  2DHR A;  1ZAE A;  4AG6 A;  2QBY B;  1IY2 A;  4LGM A;  3W0L B;  3J81 S;  2XSZ D;  3U60 A;  4CIS A;  1X37 A;  2Y21 A;  4GMQ A;  3SYK A;  3FTD A;  3FUU A;  4JXJ A;  1HR0 M;  2ZAO A;  1MU5 A;  4TUW A;  2KRU A;  3E4R A;  4JV5 M;  4L4U A;  4QHS A;  3D8L A;  4IBG A;  3U6C A;  2KA6 B;  4BBA A;  2M5Z A;  3C58 A;  2Z7J A;  1NJG A;  4IBC A;  1UM8 A;  2ERC A;  3T38 A;  5DYG A;  1G4A E;  3HWS A;  4LF5 M;  4LF9 M;  3SYL A;  2DWM A;  4LZZ A;  3HKP A;  3FTE A;  4IIW A;  4M0W A;  3PNV A;  4ITQ A;  3RGS A;  2HKJ A;  5FTL A;  3KDS E;  2R65 A;  3SHG B;  3AJI B;  3UK6 A;  1R2Z A;  3HJ8 A;  1L2C A;  3BOS A;  4DV5 M;  2UUA M;  5KQ8 A;  1SXJ A;  5ITX E;  3TWM A;  4X62 M;  4B7G A;  2F5P A;  3J27 B;  1GL7 A;  2JA2 A;  4JI7 M;  1FNN A;  2RKO A;  1W5T A;  2HCB A;  4JI6 M;  3SMS A;  4LJA A;  2XGN A;  2UUC M;  2R62 A;  3U5Z B;  3A98 B;  3VKH A;  3SHF A;  5EJC A;  5FTM A;  5JI2 E;  2D7G A;  5A2Q S;  3EIH A;  3J7A S;  2YR0 A;  3VK8 A;  2M60 A;  1DGG A;  4P16 A;  4PDG A;  4IBI A;  1L1T A;  3KP1 E;  3KP0 E;  3B9P A;  3KOW E;  2XFT A;  5ITQ A;  1N77 A;  2Y20 A;  2XSZ A;  4BB9 A;  2F4V M;  4DR6 M;  2QP9 X;  2G5G X;  1N36 M;  4IBE A;  3GPU A;  1SXJ B;  4CHT B;  1OJL A;  4G6Z A;  2KZU A;  1XMQ M;  2C9C A;  2RGO A;  1TDZ A;  3SFZ A;  3WHL A;  1IBK M;  1QZM A;  3U6O A;  5EXP A;  5ITT A;  4JI4 M;  2KRK A;  2FFJ A;  4IBF A;  1I4W A;  3VDU A;  4KO8 A;  4QOS A;  2CV1 A;  5EP1 A;  4AKH A;  3I4Y A;  3KW6 A;  2UUB M;  2QZ4 A;  4I8O A;  4PT5 A;  3U6Q A;  4IBJ A;  3AL0 C;  1J7K A;  4X66 M;  3KOX E;  2AHM A;  3TPZ A;  4DR5 M;  1R2Y A;  1IQP A;  4LF7 M;  3T15 A;  3L2A A;  3QWL A;  4PD2 A;  1TGU A;  2VQE M;  3I51 A;  4YHH M;  5KPZ A;  5KQD A;  3AOG A;  4I81 A;  2XF3 A;  4GKK M;  1JQJ C;  1YSY A;  1XXH A;  3DZD A;  1L1Z A;  1OFI A;  2QBY A;  3UMM A;  5IT9 S;  4IBK A;  5BR8 M;  3CF0 A;  3GLI B;  1DGF A;  1L2D A;  4Z6Y A;  3L25 A;  4FWD A;  2KEB A;  4IBD A;  4LRS A;  4MB7 A;  5JI3 E;  4LJ9 A;  2CHG A;  1I94 M;  3TQS A;  5IRE B;  1IBL M;  4KHP M;  4QHT A;  3SAT A;  3GP1 A;  4NSR A;  2EUC A;  3SAV A;  4XGI A;  1L8Q A;  2J7O A;  3GRY A;  4K0K M;  5IZ7 D;  3FYD A;  4FCT A;  1NNU C;  4WW0 A;  5EP3 A;  1KSF X;  2DVW B;  1DO2 A;  1J09 A;  1Q3C A;  3FYC A;  2EA0 A;  3GLH B;  3GRV A;  4MH0 E;  2ZM6 M;  4DV0 M;  2L09 A;  4II7 A;  3IG8 A;  3NWL A;  4Z8X A;  3U6D A;  5F3W A;  1IBM M;  1K3X A;  1H6U A;  2DXI A;  4AG5 A;  4OVZ A;  3U61 B;  3K92 A;  4RNA A;  4M9Z A;  1N32 M;  3M7G A;  3QAU A;  3U6S A;  4AW4 A;  1C1K A;  1HNW M;  1G8P A;  1Q39 A;  3PNY A;  1QQW A;  2X8A A;  4QNM A;  4GH9 A;  3L26 A;  1TH2 A;  1S3S A;  2R45 A;  1IM2 A;  3UGJ A;  3U5Z A;  3J7B A;  2K47 A;  1PM5 A;  2ZAM A;  1E9R A;  1PJJ A;  2L7H A;  3SMP A;  3GPP A;  3LQR A;  2LH0 A;  4NOO B;  3U6M A;  3RFW A;  2DZN B;  3HU2 A;  3VKG A;  3R9X B;  1QYR A;  2R4J A;  3LQQ A;  3UZU A;  2F5Q A;  4JI2 M;  4B08 A;  1HT1 E;  2W82 A;  2CV0 A;  3AV0 A;  4LFC M;  2BJV A;  3SAR A;  1NJF A;  1R7R A;  1PJI A;  1QAN A;  3FUW A;  2EO2 A;  3LVW A;  3ZCB B;  4LF4 M;  2H1R A;  4OVZ B;  4JYA M;  2HHH M;  1WXQ A;  5DNY A;  4B3M M;  5EXS A;  2V6Z M;  1NNJ A;  3KS4 A;  2NQ8 C;  3KSX A;  5IWA M;  1IN8 A;  4AZF A;  4DR3 M;  3MJ5 A;  5FLX S;  2YQZ A;  3J80 S;  1L2B A;  2CHQ A;  5EXX A;  4GKJ M;  4GIP A;  5C1B A;  4LJ5 A;  2I7N A;  3AOE C;  3DA1 A;  4W5W A;  4X65 M;  4B3S M;  3EIE A;  3K2L A;  4GC9 A;  3KOZ E;  3SAW A;  4AI6 A;  4GHA A;  4PDI A;  1R6B X;  4NXN M;  1OFH A;  4I4L A;  3GQ3 A;  2CE7 A;  4AKG A;  2L6O A;  5EXT A;  3PFI A;  4R7G A;  4B7F A;  1HT2 E;  5EP4 A;  2O5R A;  3MHV C;  2DWZ B;  4MGZ E;  3TWL A;  3FKE A;  1EE8 A;  3HJS A;  3A46 A;  4AQY M;  1N34 M;  1Z6T A;  3GLI A;  1GLN A;  2KW0 A;  3A42 A;  4WUR A;  4DR1 M;  2C5R A;  4LZJ A;  4MGK E;  5LMN M;  1D2N A;  1NHG C;  1G59 A;  4MGY E;  3A45 A;  1HQC A;  2D7H A;  4FCV A;  3D8B A;  3IG5 A;  2F5N A;  1Z5A A;  3TWK A;  2UU9 M;  1XNQ M;  4LF6 M;  1XMO M;  1GKI A;  3PXG A;  3L29 A;  3MK6 A;  1E32 A;  1XNR M;  2ZBK B;  2X49 A;  4JI1 M;  1XWI A;  3RE8 A;  1E94 E;  2CHV A;  3GLH A;  4DV1 M;  1T3T A;  1IN6 A;  4A3V B;  4D82 A;  3AKZ A;  5EQT A;  3GPX A;  3U6L A;  4OX9 M;  4FVM A;  4MGI E;  3K8Z A;  4LY6 A;  5ITU A;  3Q8X A;  1FJG M;  4DR2 M;  2D7E A;  1QAO A;  3U61 A;  4LJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...