2OPFA

Crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli (r252a) in complex with ap-site containing dna substrate
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
262
structure length
256
Chain Sequence
b'PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGQVDALFRFKVFHRDGEPCERCGSIIEKTTLSSAPFYWCPGCQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*GP*CP*TP*TP*CP*AP*TP*CP*CP*TP*G)-3'
publication title Active site plasticity of endonuclease VIII: Conformational changes compensating for different substrates and mutations of critical residues
rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 83
structure length 256
sequence length 262
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2007-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2opfA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 2opfA01
1HNZM 2F5QA 1Q39A 3T1YM 2UUBM 3JR4A 5ITUA 3VK8A 1N33M 1XC8A 4PCZA 3JAMS 1R2ZA 4B3RM 4LF8M 4YY3M 2OPFA 4PDIA 3VK7A 1NNJA 1MU5A 4LFBM 3A46A 3SATA 4G4QA 1L2BA 1HNWM 1PM5A 1FJGM 1Q3BA 1HR0M 2F5NA 5IT9S 1J5EM 3TWLA 4G4OA 3SARA 3GQ3A 3C58A 2UU9M 4DV5M 5ITXA 4X62M 1KFVA 4JI6M 2XZFA 3GPXA 4JYAM 2ZM6M 4DV1M 1L2CA 3SBJA 3U6DA 3U6PA 4JI1M 1TDZA 2ZBKB 4DR1M 1K82A 1N36M 3SAVA 1K3XA 3GQ4A 1Z5CA 2UXDM 4DR5M 4JI8M 4JI7M 1MX0A 2HHHM 1XMQM 4GKKM 4DV3M 5BR8M 4G4RA 4DV7M 3GPYA 1XMOM 1L1TA 4DV4M 4JI4M 4LFAM 3U6QA 4NXMM 3SAWA 1I94M 1N32M 3W0FA 4LF6M 1N34M 4JV5M 4LF5M 4NRWA 4K0KM 4B3SM 1R2YA 5ITTA 1IBMM 3GO8A 4JI5M 1Z5BA 4X66M 3J81S 2VQEM 4CISA 4OX9M 5LMNM 3A42A 4X65M 2UXBM 3U6SA 4DR7M 2UUCM 3TWKA 4DV2M 1XNQM 3U6OA 1Z59A 2OQ4A 5ITRA 2F4VM 5A2QS 5ITXE 5FLXS 4JI3M 2E5LM 2F5SA 4DR2M 4YHHM 3U6EA 1PJIA 4B3TM 1IBLM 5ITQA 4X64M 4NRVA 3GPPA 1L1ZA 4ITQA 2Q2EB 3SAUA 4LF9M 3U6CA 3A45A 3T1HM 3DOAA 4MB7A 3U6MA 3JR5A 3SASA 3J7AS 3U6LA 4LF7M 3OTOM 2F5OA 4LF4M 4GKJM 1TDHA 4DUYM 1K3WA 2UUAM 1IBKM 3TWMA 2HKJA 3J80S 1XNRM 5IWAM 1EE8A 3GP1A 4AQYM 4JI2M 4LFCM 2F5PA 2UXCM 4DV6M 4DR6M 1L2DA 4DV0M 4PD2A 3GPUA 4B3MM 2XZUA 4DR4M 5LMUM 1PJJA 1HNXM 3GQ5A 4DR3M 4KHPM 4PDGA 4DUZM 4NXNM 4JI0M 1Q3CA 2EA0A 5ITYA 4G4NA 1Z5AA 2VQFM
chains in the Genus database with same CATH superfamily
5EXPA 1HNZM 2FNAA 1MN3A 2LNHC 5IREB 2DENA 2XEPA 1R2ZA 1YUBA 4II7A 4PDIA 1NNJA 4LFBM 2MGWA 3FYCA 3U61A 3RE8A 1OAIA 1XWIA 3FD9A 4G4QA 1HNWM 1PM5A 1FJGM 1KYIA 1T6OA 2JY8A 2F5NA 2R4JA 3TWLA 4G4OA 3L28A 1YE9A 3SARA 2ZANA 2C5RA 4R3DA 2JXNA 2R4EA 4MGHA 3VLFB 1X37A 1KFVA 4M9XA 1PRBA 3B7QA 2CEAA 4B7HA 3KFUG 3HU2A 1GVNA 3IHPA 2JY5A 2WSCF 3GPXA 1D0LA 3GLHA 2I7NA 4DV1M 3SBJA 2QBYA 1TF0B 2CRUA 3U61B 5EJCA 2ZBKB 1WIVA 4WW0A 3ZH9B 2LXEA 2CUZA 1T3TA 2KZSA 3IG8A 4NC6A 2DXIA 3L2AA 4GH9A 3WHKA 4JI8M 5C18A 4IBGA 3E46A 2HHHM 2Y0TA 3T6PA 4DV3M 2L09A 2MH8A 2BWBA 2CHVA 1IXSA 2QQ8A 2C9OA 4DV4M 3K2LA 2D7HA 3GLGA 4FWDA 4PT5A 4FCTA 2LWXA 1IY1A 2R46A 1QAOA 1XXHE 4CIZA 4LF6M 1IM2A 1SXJE 2R45A 4NRWA 4K0KM 3KS4A 1QZMA 5ITTA 2R65A 1GL6A 3KVWA 2QNJA 3GO8A 1IBMM 2V1CA 3RFWA 3GLFA 1GLNA 1P3QQ 4X66M 3M0EA 3J81S 4OX9M 1GABA 3AOGA 4OU7A 4IBBA 3U60B 4KO8A 4W5WA 5GKNA 1XB2B 4L8RC 4M0DA 4FVMA 4Q7JA 3GLGB 1G71A 2Z4RA 4LJAA 3BBZA 4BBAA 2E5LM 2LTUA 2HWJA 4RKUF 1Z6TA 1PJIA 4I5SA 1D0KA 2DKLA 4NRVA 5F3WA 2DWMA 1OKSA 4IBDA 3SAUA 4LF9M 1HQYE 2JNHA 1QUSA 3RGSA 2NQ8C 1R5LA 1AUAA 3U6LA 4QOSA 3QYBA 3KDSE 2Z7JA 3GRYA 1IBKM 3ZQJA 3L26A 2CV0A 2M60A 3KOYE 3CTWB 4AQYM 1V92A 5KPZA 3PVSA 2YNMD 3DFZA 2LHCA 1OAOC 5DYIA 3FRIA 2DZLA 3M7GA 2KZUA 8CATA 2Y20A 3GQ5A 2DAIA 1NO1A 2K0BX 2EA0A 2R44A 5ITYA 3WHLA 4LJ5A 5KPTA 3J27B 4LJ7A 4HL4A 1XXHA 4LRTA 3HY5A 1C7YA 1NVMA 3B89A 3T1YM 1SXJA 2QZ4A 1VDLA 4CHTB 3FUXA 2AHMA 4CJ6A 1N78A 4WP2A 3U5ZB 1WJ7A 2ZAOA 4PCZA 4OW0A 3GRRA 7CATA 4B3RM 1LV7A 1JR3D 1NSFA 3ILKA 4D82A 1TH3A 2VF8A 1IN8A 4QHTA 2CV2A 4MGYE 3HGIA 3GRUA 1WHCA 4HLQA 2EKKA 3FKEA 4REZA 4R7GA 2QP9X 4NSOB 1J5EM 2MR9A 4NOOB 4CGYB 2VIIA 3SHFA 3GQ3A 1IN7A 4GMQA 4LG2A 2CHGA 4MGZE 4LJ8A 2CV1A 2UU9M 1QYRA 1XXHB 1WXQA 2QPAA 3QWLA 2LVNC 2BJVA 2X4AA 2HL7A 5FTLA 2XZFA 1J09A 4IBFA 1OTRA 1E94E 3HHWA 4I8OA 4XK8F 3I04M 2ZM6M 1L2CA 2N35A 4IJEA 4P16A 1JB0F 3LCUA 1TDZA 4L78A 4DR1M 3LQRA 1N36M 1K82A 5EP2A 3GQ4A 1K3XA 2JWSA 2XH9A 3L25A 1V34A 3IECA 5E6JA 2ZTCA 2UXDM 2XFSA 3AOEC 3KOZE 5BR8M 1Y8GA 2O01F 4XBOA 3FUVA 3GPYA 4DV7M 1GL7A 5FTJA 2KW0A 2O25A 4AG5A 4LFAM 1NHGC 4A3VB 4NXMM 3J2PB 2OOBA 2X49A 3AL0C 4IIWA 4LY6A 2KNVA 4B7GA 3C3DA 3FUUA 4GITA 5E26A 1N34M 3FUWA 3VKHA 3R9XB 3QAUA 1E9RA 3FUTA 2LVPC 3R8FA 2C98A 1QAQA 3I4YA 1Z5BA 2VQEM 2YR0A 5LMNM 2JY7A 3AFHA 4Y28F 2Z4SA 4B7FA 3U6SA 2QHOB 2QCUA 3NBIA 3EIHA 4DR7M 3U6OA 2X8AA 3HU1A 2OQ4A 4R71A 3U60A 2DWZB 2Z8YM 3B7ZA 3KP1E 3KSXA 2RKOA 5ITRA 2KNAA 3B7NA 3PFIA 2B3TA 3UK6A 5ITXE 5A2QS 2V1UA 4AKHA 3K92A 2DI0A 1OIPA 2DVWB 3U6EA 2J7OA 2O5RA 2WSEF 2JA2A 5ITQA 4B3TM 4F2LA 1DO0A 4MM3B 5DYGA 3GPPA 1G41A 2I7PA 3LMMA 3LW5F 4XGIA 2Q2EB 5FTNA 1GJSA 3U6CA 1OIZA 4QNRA 2KHHA 3U6MA 2KXEA 3VFDA 1NY6A 2GQFA 3HJQA 3J7AS 4GHAA 4LZJA 2JZ1A 5L8RF 1TDHA 3VDUA 1K3WA 2XSZA 1ZAEA 3MHVC 3TQSA 1TGUA 3BOSA 1VG5A 2EO2A 3PNYA 1A5TA 3W0LB 1QZEA 1XNRM 2J7NA 4M9SA 3E9SA 4DR6M 4DV0M 2R6FA 5EXTA 3GPUA 3TL4X 4TUWA 1VEJA 2DWLA 2C99A 1PJJA 4DR3M 1GKIA 2K6BA 3B9PA 3RGPA 4FCVA 4PDGA 4DUZM 2CE7A 1Q3CA 3J7BA 1PGYA 3PXGA 1WGLA 3VK8A 2FH0A 2C9CA 4LRSA 2D7GA 1UFZA 2R18A 5ITUA 1N33M 2CP8A 4IBKA 4MH0E 4WURA 2LVOC 1ZMWA 3UMMA 1Q02A 1G4AE 1GO5A 3UJNA 2OPFA 1DO2A 3HX3A 4NSRA 5EP3A 4AKIA 1RU3A 1I4WA 2XGNA 3U5ZA 3SATA 3I4VA 1C1KA 3I01M 2RGHA 1IXRC 3GRVA 4QOZC 1QAMA 2ERCA 1QQWA 2LVAA 3CF2A 4FW9A 1UM8A 3W68A 3C58A 2Y21A 3C9PA 3FTDA 4DV5M 4KLNA 1L8QA 5ITXA 4X62M 3GLIE 2EUCA 4ZPXA 4JI6M 4FWGA 2JY6B 1YSYA 4M9ZA 2GNOA 4JYAM 1HQCA 4AZFA 3U6DA 3U6PA 4JI1M 2G3QA 3CF6E 4I81A 5KO3A 1ZMVA 4AG6A 1IN4A 4NL4H 4JI7M 1MX0A 4GKKM 1DGHA 2DAKA 2L6OA 3HKPA 4LCBA 1XMOM 1JR3E 4IBIA 4KODA 1ZQ9A 3U6QA 2RGOA 2V6ZM 4L16A 1PJQA 3HWSA 4F1IA 2MJ5B 3SAWA 1I94M 1N32M 2VF7A 2DNAA 1MJGM 4P17A 3K1JA 4JV5M 1Z5AA 2EJSA 3UGJA 4LF5M 3SC3A 1ZMUA 2KDLA 1GJTA 1R2YA 1T43A 2LHGA 4MGKE 3K9OA 2A5YB 4B3SM 4LJ6A 3SMPA 3HJ8A 3SFZA 1IY0A 2WSFF 2P5TA 2ZTDA 4CISA 1NJGA 2DWNA 1JQJC 3KP0E 3QYEA 5EXXA 3C3EA 1QUTA 3A42A 2UXBM 1F4IA 5KPRA 2K9DA 1IFYA 1DGHB 1FNNA 3MK6A 3TWKA 4DV2M 2R0IA 3M6AA 5DFLA 4LGYA 1S3SA 2W82A 3KSJA 3SYLA 2Z3XA 4JI3M 3Q8XA 1DGFA 2H5XA 5C1BA 2G5GX 2M5ZA 4YHHM 2KA6B 4RF0A 4LJ4A 3HU3A 2C96A 1J7KA 4X64M 1SG9A 2KRKA 1G3IA 1L1ZA 4ITQA 1V33A 1NY5A 2APLA 2OOAA 4L15A 1TH4A 3GLIA 3SASA 2QSFX 5EP1A 2JUJA 4LJ9A 3T38A 3V76A 1R6BX 3OTOM 2J5YA 4GC5A 2F5OA 1OJLA 4LF4M 4GKJM 5BPVA 4G6ZA 1HT1E 4LGMA 3B74A 1G8PA 2HKJA 3J80S 3LVVA 5FSWA 3HZJA 2VDBB 1EE8A 2CWBA 5IWAM 3H4JA 1QDRA 3HHYA 4D80A 3GP1A 4JI2M 1D0MA 4FD2A 4GHLA 2UXCM 1G59A 3W67A 4JXJA 1SXJC 1NHWC 1L2DA 1W5TA 2DAEA 3H4MA 5H37D 3NWLA 2XZUA 4DR4M 2H1RA 1HNXM 1JR3A 3FRHA 4KT0F 3KOWE 2EKFA 5IZ7D 4NXNM 1LTMA 2DAGA 2KNZA 3PNVA 4GIPA 4JI0M 4DV6M 1DGBA 2L7HA 3GLIB 3F92A 4G4NA 2YQZA 2F5QA 1Q39A 4AKGA 2UUBM 3JR4A 2DHRA 2HCBA 3UZUA 1XC8A 3FYDA 3LQQA 3JAMS 4DBGB 4UN2B 1D2NA 4LF8M 4QHSA 3ZCBB 4YY3M 3VK7A 1MU5A 4HEOA 3A46A 3Q8GA 1PJSA 3D8LA 5DNYA 3AV0A 1CUKA 5EXSA 3CF0A 4GC9A 1L2BA 2FE8A 1Q3BA 3LCVB 4AW4A 1NV8A 3FTCA 1HR0M 1SXJD 5IT9S 4Z6YA 4GRIA 3HHZA 2QENA 3TPZA 4FCWA 3I51A 3VKGA 3GLHB 3FTFA 3KOXE 2QBYB 1R4GA 2RRUA 1TR8A 1N77A 5FTKA 3DA1A 1HJPA 1W5SA 3T15A 2ZAMA 3L29A 4OVZA 3AKZA 3KW6A 1DGGA 3K9PA 1QDTA 2YFQA 3CGWA 1NNUC 2JP7A 5EP4A 3SAVA 1N75A 3LVWA 1IXSB 4BB9A 1Z5CA 2HAKA 1VEKA 4DR5M 1KSFX 4L6V6 1XMQM 2DZOB 1QANA 3THGA 4G4RA 2CFOA 2G8LA 3MJ5A 2LH0A 1L1TA 4Z8XA 3KXEC 2CHQA 2D7EA 1IN6A 4IJFA 1R7RA 4JI4M 1OFHA 2R62A 3HJSA 3A98B 5EQTA 4IBCA 1OFIA 3W0FA 2LBCA 4L4UA 4D81A 4MGIE 3DZDA 2BNKA 3GLFB 4GEWA 3L27A 1NJFA 1E32A 4I4LA 4LZZA 4OVZB 3AOEA 2MROB 4S12A 1BVSA 3E4RA 2XFTA 1NV9A 3MMPA 4JI5M 1DV0A 1WGNA 4ANRA 1XHBA 1VQ1A 5KQDA 3SMSA 2WZJA 4IBJA 3VDPA 3EIEA 2KEBA 3TE6A 3FTEA 4X65M 1IN5A 1VEGA 2DAMA 3SYKA 2UUCM 2BJWA 1HT2E 3K8ZA 4AI6A 1EFUB 1XNQM 3AJIB 2L2DA 1Z59A 2L4FA 1TTEA 1OQYA 2LVQD 1YLAA 3ZC7B 2F4VM 2KRUA 5KQ8A 5FLXS 2F5SA 2DHYA 3BXWA 3D8BA 5JI2E 3E21A 4DR2M 2L7IA 4G3OA 1IBLM 2L4EA 4M0WA 4B08A 3GLHE 2JZ0A 1VDDA 1EIJA 1IY2A 3A45A 5FTMA 3T1HM 2OO9A 2FOIC 3DOAA 1WR1B 4MB7A 1H6UA 5JI3E 3JR5A 4RNAA 4QNMA 4LF7M 4DUYM 2Y0QA 4FWHA 3NBXX 1QVRA 2UUAM 3TWMA 2DZNB 2K47A 2XLJA 3IG5A 3GLGE 1IXZA 4EIWA 4LFCM 1IQPA 2F5PA 4JN6A 3SHGB 2XF3A 4PD2A 3HHXA 1E9SA 4IBEA 4RF1A 1TH2A 2FFJA 2FS1A 5LMUM 1ZV1A 2XSZD 1AIPC 1PJTA 3KS8A 4KHPM 4BLCA 3FE3A 1SXJB 3GLFE 1ORYB 4B3MM 2BWEA 2VQFM
chains in the Genus database with same CATH topology
5EXPA 1HNZM 2FNAA 2LNHC 5IREB 2XEPA 1R2ZA 1YUBA 4II7A 4PDIA 1NNJA 4LFBM 3FYCA 3U61A 3RE8A 1XWIA 3FD9A 4G4QA 1HNWM 1PM5A 1FJGM 1KYIA 2F5NA 2R4JA 3TWLA 4G4OA 3L28A 1YE9A 3SARA 2ZANA 2C5RA 4R3DA 2R4EA 4MGHA 3VLFB 1X37A 1KFVA 4M9XA 4B7HA 2CEAA 3KFUG 3HU2A 1GVNA 3GPXA 3GLHA 2I7NA 4DV1M 3SBJA 2QBYA 3U61B 5EJCA 2ZBKB 4WW0A 3ZH9B 2LXEA 2CUZA 1T3TA 2KZSA 3IG8A 2DXIA 3L2AA 4GH9A 3WHKA 4JI8M 5C18A 4IBGA 2HHHM 2Y0TA 4DV3M 2L09A 2CHVA 2C9OA 4DV4M 3K2LA 2D7HA 3GLGA 4FWDA 4PT5A 4FCTA 2LWXA 1IY1A 2R46A 1QAOA 4LF6M 1IM2A 1SXJE 2R45A 4NRWA 4K0KM 3KS4A 1QZMA 5ITTA 2R65A 1GL6A 3KVWA 3GO8A 1IBMM 2V1CA 3RFWA 3GLFA 1GLNA 4X66M 3M0EA 3J81S 4OX9M 3AOGA 4OU7A 4IBBA 3U60B 4KO8A 4W5WA 5GKNA 4L8RC 4M0DA 4FVMA 3GLGB 2Z4RA 4LJAA 4BBAA 2E5LM 1Z6TA 1PJIA 4I5SA 4NRVA 5F3WA 2DWMA 4IBDA 3SAUA 4LF9M 1HQYE 3RGSA 2NQ8C 3U6LA 4QOSA 3KDSE 2Z7JA 3GRYA 1IBKM 3L26A 2CV0A 2M60A 3KOYE 3CTWB 4AQYM 5KPZA 3PVSA 2YNMD 3DFZA 5DYIA 3M7GA 2KZUA 8CATA 2Y20A 3GQ5A 2EA0A 5ITYA 3WHLA 4LJ5A 5KPTA 3J27B 4LJ7A 4HL4A 1XXHA 4LRTA 1NVMA 3T1YM 1SXJA 2QZ4A 4CHTB 3FUXA 2AHMA 1N78A 3U5ZB 2ZAOA 4PCZA 4OW0A 3GRRA 7CATA 4B3RM 1LV7A 1JR3D 1NSFA 3ILKA 4D82A 1TH3A 1IN8A 4QHTA 2CV2A 4MGYE 3HGIA 3GRUA 4HLQA 4REZA 3FKEA 4R7GA 2QP9X 4NSOB 1J5EM 4NOOB 4CGYB 2VIIA 3SHFA 3GQ3A 1IN7A 4GMQA 4LG2A 2CHGA 4MGZE 4LJ8A 2CV1A 2UU9M 1QYRA 1XXHB 1WXQA 2QPAA 3QWLA 2BJVA 2X4AA 2HL7A 5FTLA 2XZFA 1J09A 4IBFA 1E94E 3HHWA 4I8OA 2ZM6M 1L2CA 4IJEA 4P16A 1TDZA 4L78A 4DR1M 3LQRA 1N36M 1K82A 5EP2A 3GQ4A 1K3XA 2XH9A 3L25A 2UXDM 5E6JA 2XFSA 3AOEC 3KOZE 5BR8M 4XBOA 4DV7M 3FUVA 3GPYA 1GL7A 5FTJA 2KW0A 4AG5A 4LFAM 1NHGC 4A3VB 4NXMM 3J2PB 2X49A 3AL0C 4IIWA 4LY6A 4B7GA 3FUUA 5E26A 4GITA 1N34M 3FUWA 3VKHA 3R9XB 3QAUA 1E9RA 3FUTA 3R8FA 2C98A 1QAQA 3I4YA 1Z5BA 2VQEM 2YR0A 5LMNM 3AFHA 2Z4SA 4B7FA 3U6SA 2QCUA 4DR7M 3NBIA 3EIHA 3U6OA 2X8AA 3HU1A 2OQ4A 3U60A 2DWZB 3KP1E 3KSXA 5ITRA 2RKOA 5ITXE 5A2QS 3PFIA 3UK6A 4AKHA 2V1UA 3K92A 2DVWB 3U6EA 4B3TM 2J7OA 2O5RA 2JA2A 5ITQA 1DO0A 4MM3B 5DYGA 3GPPA 1G41A 2I7PA 3LMMA 4XGIA 2Q2EB 5FTNA 3U6CA 4QNRA 3U6MA 2KXEA 3VFDA 1NY6A 3HJQA 3J7AS 4GHAA 4LZJA 1TDHA 3VDUA 1K3WA 2XSZA 1ZAEA 3MHVC 3TQSA 1TGUA 3BOSA 3PNYA 2EO2A 1XNRM 3W0LB 2J7NA 4M9SA 3E9SA 4DR6M 4DV0M 5EXTA 3GPUA 3TL4X 4TUWA 2DWLA 2C99A 1PJJA 4DR3M 1GKIA 3B9PA 3RGPA 4FCVA 4PDGA 4DUZM 2CE7A 1Q3CA 3J7BA 3PXGA 3VK8A 2C9CA 4LRSA 2D7GA 2R18A 5ITUA 1N33M 4IBKA 4MH0E 4WURA 3UMMA 1G4AE 3UJNA 2OPFA 1DO2A 4NSRA 5EP3A 4AKIA 1I4WA 2XGNA 3U5ZA 3SATA 3I4VA 1C1KA 2RGHA 1IXRC 3GRVA 4QOZC 1QAMA 2ERCA 1QQWA 3CF2A 4FW9A 1UM8A 3C58A 1G59A 2Y21A 3FTDA 4DV5M 4KLNA 1L8QA 5ITXA 4X62M 2EUCA 4ZPXA 4JI6M 4FWGA 1YSYA 4M9ZA 4JYAM 1HQCA 4AZFA 3U6DA 3U6PA 4JI1M 3CF6E 4I81A 5KO3A 4AG6A 1IN4A 4NL4H 4JI7M 1MX0A 4GKKM 1DGHA 2L6OA 3HKPA 4LCBA 1XMOM 4IBIA 4KODA 1ZQ9A 3U6QA 2RGOA 2V6ZM 4L16A 3HWSA 3SAWA 1I94M 1N32M 3K1JA 4JV5M 3UGJA 4LF5M 3SC3A 4B3SM 1R2YA 4MGKE 2A5YB 4LJ6A 3SMPA 3HJ8A 3SFZA 1IY0A 2P5TA 4CISA 1NJGA 2DWNA 1JQJC 3KP0E 5EXXA 3A42A 2UXBM 5KPRA 1DGHB 1FNNA 3MK6A 3TWKA 4DV2M 3M6AA 4LGYA 1S3SA 2W82A 3KSJA 3SYLA 2Z3XA 4JI3M 3Q8XA 1DGFA 5C1BA 2G5GX 2M5ZA 4YHHM 2KA6B 4RF0A 4LJ4A 3HU3A 2C96A 1J7KA 4X64M 2KRKA 1G3IA 1L1ZA 4ITQA 1NY5A 4L15A 1TH4A 3GLIA 3SASA 5EP1A 4LJ9A 3T38A 1R6BX 3OTOM 2F5OA 4GC5A 4LF4M 1OJLA 4GKJM 5BPVA 4G6ZA 1HT1E 4LGMA 1G8PA 2HKJA 3J80S 3LVVA 5FSWA 5IWAM 1EE8A 3HHYA 4D80A 3GP1A 4JI2M 4FD2A 2UXCM 4GHLA 1L2DA 4JXJA 1SXJC 1NHWC 1W5TA 3H4MA 5H37D 3NWLA 2XZUA 4DR4M 2H1RA 1HNXM 1JR3A 3KOWE 5IZ7D 4NXNM 4GIPA 4JI0M 3PNVA 4DV6M 1DGBA 2L7HA 3GLIB 4G4NA 2YQZA 2F5QA 1Q39A 4AKGA 2UUBM 3JR4A 2DHRA 2HCBA 3UZUA 1XC8A 3FYDA 3LQQA 3JAMS 1D2NA 4LF8M 4QHSA 3ZCBB 4YY3M 3VK7A 1MU5A 3A46A 3D8LA 5DNYA 3AV0A 5EXSA 3CF0A 4GC9A 1L2BA 2FE8A 1Q3BA 4AW4A 3FTCA 1HR0M 1SXJD 5IT9S 4Z6YA 4GRIA 3HHZA 2QENA 3TPZA 4FCWA 3I51A 3VKGA 3GLHB 3FTFA 3KOXE 2QBYB 1N77A 5FTKA 3DA1A 1W5SA 3T15A 2ZAMA 3L29A 4OVZA 3AKZA 3KW6A 1DGGA 2YFQA 1NNUC 5EP4A 3SAVA 1N75A 3LVWA 1IXSB 4BB9A 1Z5CA 4DR5M 1KSFX 1XMQM 2DZOB 1QANA 3THGA 4G4RA 2CFOA 2G8LA 3MJ5A 2LH0A 1L1TA 4Z8XA 3KXEC 2CHQA 2D7EA 1IN6A 4IJFA 1R7RA 4JI4M 1OFHA 2R62A 3HJSA 3A98B 5EQTA 4IBCA 1OFIA 3W0FA 4L4UA 4D81A 4MGIE 3DZDA 2BNKA 3GLFB 4I4LA 3L27A 1NJFA 1E32A 4LZZA 4OVZB 3AOEA 4S12A 3E4RA 2XFTA 4JI5M 1XHBA 5KQDA 3SMSA 4IBJA 3VDPA 3EIEA 2KEBA 3TE6A 3FTEA 4X65M 1IN5A 3SYKA 2UUCM 2BJWA 1HT2E 3K8ZA 4AI6A 1XNQM 3AJIB 1Z59A 3ZC7B 2F4VM 2KRUA 5KQ8A 5FLXS 2F5SA 5JI2E 3D8BA 4DR2M 2L7IA 1IBLM 4M0WA 4B08A 1VDDA 1IY2A 3A45A 5FTMA 3T1HM 2FOIC 3DOAA 4MB7A 5JI3E 1H6UA 3JR5A 4RNAA 4QNMA 4LF7M 4DUYM 2Y0QA 4FWHA 1QVRA 2UUAM 3TWMA 2DZNB 2K47A 2XLJA 3IG5A 1IXZA 4EIWA 4LFCM 1IQPA 2F5PA 4JN6A 3SHGB 2XF3A 4PD2A 3HHXA 1E9SA 4IBEA 4RF1A 1TH2A 2FFJA 5LMUM 3KS8A 2XSZD 4KHPM 4BLCA 1SXJB 1ORYB 4B3MM 1Z5AA 2VQFM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ M;  2F5Q A;  1Q39 A;  3T1Y M;  2UUB M;  3JR4 A;  5ITU A;  3VK8 A;  1N33 M;  1XC8 A;  4PCZ A;  3JAM S;  1R2Z A;  4B3R M;  4LF8 M;  4YY3 M;  2OPF A;  4PDI A;  3VK7 A;  1NNJ A;  1MU5 A;  4LFB M;  3A46 A;  3SAT A;  4G4Q A;  1L2B A;  1HNW M;  1PM5 A;  1FJG M;  1Q3B A;  1HR0 M;  2F5N A;  5IT9 S;  1J5E M;  3TWL A;  4G4O A;  3SAR A;  3GQ3 A;  3C58 A;  2UU9 M;  4DV5 M;  5ITX A;  4X62 M;  1KFV A;  4JI6 M;  2XZF A;  3GPX A;  4JYA M;  2ZM6 M;  4DV1 M;  1L2C A;  3SBJ A;  3U6D A;  3U6P A;  4JI1 M;  1TDZ A;  2ZBK B;  4DR1 M;  1K82 A;  1N36 M;  3SAV A;  1K3X A;  3GQ4 A;  1Z5C A;  2UXD M;  4DR5 M;  4JI8 M;  4JI7 M;  1MX0 A;  2HHH M;  1XMQ M;  4GKK M;  4DV3 M;  5BR8 M;  4G4R A;  4DV7 M;  3GPY A;  1XMO M;  1L1T A;  4DV4 M;  4JI4 M;  4LFA M;  3U6Q A;  4NXM M;  3SAW A;  1I94 M;  1N32 M;  3W0F A;  4LF6 M;  1N34 M;  4JV5 M;  4LF5 M;  4NRW A;  4K0K M;  4B3S M;  1R2Y A;  5ITT A;  1IBM M;  3GO8 A;  4JI5 M;  1Z5B A;  4X66 M;  3J81 S;  2VQE M;  4CIS A;  4OX9 M;  5LMN M;  3A42 A;  4X65 M;  2UXB M;  3U6S A;  4DR7 M;  2UUC M;  3TWK A;  4DV2 M;  1XNQ M;  3U6O A;  1Z59 A;  2OQ4 A;  5ITR A;  2F4V M;  5A2Q S;  5ITX E;  5FLX S;  4JI3 M;  2E5L M;  2F5S A;  4DR2 M;  4YHH M;  3U6E A;  1PJI A;  4B3T M;  1IBL M;  5ITQ A;  4X64 M;  4NRV A;  3GPP A;  1L1Z A;  4ITQ A;  2Q2E B;  3SAU A;  4LF9 M;  3U6C A;  3A45 A;  3T1H M;  3DOA A;  4MB7 A;  3U6M A;  3JR5 A;  3SAS A;  3J7A S;  3U6L A;  4LF7 M;  3OTO M;  2F5O A;  4LF4 M;  4GKJ M;  1TDH A;  4DUY M;  1K3W A;  2UUA M;  1IBK M;  3TWM A;  2HKJ A;  3J80 S;  1XNR M;  5IWA M;  1EE8 A;  3GP1 A;  4AQY M;  4JI2 M;  4LFC M;  2F5P A;  2UXC M;  4DV6 M;  4DR6 M;  1L2D A;  4DV0 M;  4PD2 A;  3GPU A;  4B3M M;  2XZU A;  4DR4 M;  5LMU M;  1PJJ A;  1HNX M;  3GQ5 A;  4DR3 M;  4KHP M;  4PDG A;  4DUZ M;  4NXN M;  4JI0 M;  1Q3C A;  2EA0 A;  5ITY A;  4G4N A;  1Z5A A;  2VQF M; 
#chains in the Genus database with same CATH topology
 5EXP A;  1HNZ M;  2FNA A;  1MN3 A;  2LNH C;  5IRE B;  2DEN A;  2XEP A;  1R2Z A;  1YUB A;  4II7 A;  4PDI A;  1NNJ A;  4LFB M;  2MGW A;  3FYC A;  3U61 A;  3RE8 A;  1OAI A;  1XWI A;  3FD9 A;  4G4Q A;  1HNW M;  1PM5 A;  1FJG M;  1KYI A;  1T6O A;  2JY8 A;  2F5N A;  2R4J A;  3TWL A;  4G4O A;  3L28 A;  1YE9 A;  3SAR A;  2ZAN A;  2C5R A;  4R3D A;  2JXN A;  2R4E A;  4MGH A;  3VLF B;  1X37 A;  1KFV A;  4M9X A;  1PRB A;  3B7Q A;  2CEA A;  4B7H A;  3KFU G;  3HU2 A;  1GVN A;  3IHP A;  2JY5 A;  2WSC F;  3GPX A;  1D0L A;  3GLH A;  2I7N A;  4DV1 M;  3SBJ A;  2QBY A;  1TF0 B;  2CRU A;  3U61 B;  5EJC A;  2ZBK B;  1WIV A;  4WW0 A;  3ZH9 B;  2LXE A;  2CUZ A;  1T3T A;  2KZS A;  3IG8 A;  4NC6 A;  2DXI A;  3L2A A;  4GH9 A;  3WHK A;  4JI8 M;  5C18 A;  4IBG A;  3E46 A;  2HHH M;  2Y0T A;  3T6P A;  4DV3 M;  2L09 A;  2MH8 A;  2BWB A;  2CHV A;  1IXS A;  2QQ8 A;  2C9O A;  4DV4 M;  3K2L A;  2D7H A;  3GLG A;  4FWD A;  4PT5 A;  4FCT A;  2LWX A;  1IY1 A;  2R46 A;  1QAO A;  1XXH E;  4CIZ A;  4LF6 M;  1IM2 A;  1SXJ E;  2R45 A;  4NRW A;  4K0K M;  3KS4 A;  1QZM A;  5ITT A;  2R65 A;  1GL6 A;  3KVW A;  2QNJ A;  3GO8 A;  1IBM M;  2V1C A;  3RFW A;  3GLF A;  1GLN A;  1P3Q Q;  4X66 M;  3M0E A;  3J81 S;  4OX9 M;  1GAB A;  3AOG A;  4OU7 A;  4IBB A;  3U60 B;  4KO8 A;  4W5W A;  5GKN A;  1XB2 B;  4L8R C;  4M0D A;  4FVM A;  4Q7J A;  3GLG B;  1G71 A;  2Z4R A;  4LJA A;  3BBZ A;  4BBA A;  2E5L M;  2LTU A;  2HWJ A;  4RKU F;  1Z6T A;  1PJI A;  4I5S A;  1D0K A;  2DKL A;  4NRV A;  5F3W A;  2DWM A;  1OKS A;  4IBD A;  3SAU A;  4LF9 M;  1HQY E;  2JNH A;  1QUS A;  3RGS A;  2NQ8 C;  1R5L A;  1AUA A;  3U6L A;  4QOS A;  3QYB A;  3KDS E;  2Z7J A;  3GRY A;  1IBK M;  3ZQJ A;  3L26 A;  2CV0 A;  2M60 A;  3KOY E;  3CTW B;  4AQY M;  1V92 A;  5KPZ A;  3PVS A;  2YNM D;  3DFZ A;  2LHC A;  1OAO C;  5DYI A;  3FRI A;  2DZL A;  3M7G A;  2KZU A;  8CAT A;  2Y20 A;  3GQ5 A;  2DAI A;  1NO1 A;  2K0B X;  2EA0 A;  2R44 A;  5ITY A;  3WHL A;  4LJ5 A;  5KPT A;  3J27 B;  4LJ7 A;  4HL4 A;  1XXH A;  4LRT A;  3HY5 A;  1C7Y A;  1NVM A;  3B89 A;  3T1Y M;  1SXJ A;  2QZ4 A;  1VDL A;  4CHT B;  3FUX A;  2AHM A;  4CJ6 A;  1N78 A;  4WP2 A;  3U5Z B;  1WJ7 A;  2ZAO A;  4PCZ A;  4OW0 A;  3GRR A;  7CAT A;  4B3R M;  1LV7 A;  1JR3 D;  1NSF A;  3ILK A;  4D82 A;  1TH3 A;  2VF8 A;  1IN8 A;  4QHT A;  2CV2 A;  4MGY E;  3HGI A;  3GRU A;  1WHC A;  4HLQ A;  2EKK A;  3FKE A;  4REZ A;  4R7G A;  2QP9 X;  4NSO B;  1J5E M;  2MR9 A;  4NOO B;  4CGY B;  2VII A;  3SHF A;  3GQ3 A;  1IN7 A;  4GMQ A;  4LG2 A;  2CHG A;  4MGZ E;  4LJ8 A;  2CV1 A;  2UU9 M;  1QYR A;  1XXH B;  1WXQ A;  2QPA A;  3QWL A;  2LVN C;  2BJV A;  2X4A A;  2HL7 A;  5FTL A;  2XZF A;  1J09 A;  4IBF A;  1OTR A;  1E94 E;  3HHW A;  4I8O A;  4XK8 F;  3I04 M;  2ZM6 M;  1L2C A;  2N35 A;  4IJE A;  4P16 A;  1JB0 F;  3LCU A;  1TDZ A;  4L78 A;  4DR1 M;  3LQR A;  1N36 M;  1K82 A;  5EP2 A;  3GQ4 A;  1K3X A;  2JWS A;  2XH9 A;  3L25 A;  1V34 A;  3IEC A;  5E6J A;  2ZTC A;  2UXD M;  2XFS A;  3AOE C;  3KOZ E;  5BR8 M;  1Y8G A;  2O01 F;  4XBO A;  3FUV A;  3GPY A;  4DV7 M;  1GL7 A;  5FTJ A;  2KW0 A;  2O25 A;  4AG5 A;  4LFA M;  1NHG C;  4A3V B;  4NXM M;  3J2P B;  2OOB A;  2X49 A;  3AL0 C;  4IIW A;  4LY6 A;  2KNV A;  4B7G A;  3C3D A;  3FUU A;  4GIT A;  5E26 A;  1N34 M;  3FUW A;  3VKH A;  3R9X B;  3QAU A;  1E9R A;  3FUT A;  2LVP C;  3R8F A;  2C98 A;  1QAQ A;  3I4Y A;  1Z5B A;  2VQE M;  2YR0 A;  5LMN M;  2JY7 A;  3AFH A;  4Y28 F;  2Z4S A;  4B7F A;  3U6S A;  2QHO B;  2QCU A;  3NBI A;  3EIH A;  4DR7 M;  3U6O A;  2X8A A;  3HU1 A;  2OQ4 A;  4R71 A;  3U60 A;  2DWZ B;  2Z8Y M;  3B7Z A;  3KP1 E;  3KSX A;  2RKO A;  5ITR A;  2KNA A;  3B7N A;  3PFI A;  2B3T A;  3UK6 A;  5ITX E;  5A2Q S;  2V1U A;  4AKH A;  3K92 A;  2DI0 A;  1OIP A;  2DVW B;  3U6E A;  2J7O A;  2O5R A;  2WSE F;  2JA2 A;  5ITQ A;  4B3T M;  4F2L A;  1DO0 A;  4MM3 B;  5DYG A;  3GPP A;  1G41 A;  2I7P A;  3LMM A;  3LW5 F;  4XGI A;  2Q2E B;  5FTN A;  1GJS A;  3U6C A;  1OIZ A;  4QNR A;  2KHH A;  3U6M A;  2KXE A;  3VFD A;  1NY6 A;  2GQF A;  3HJQ A;  3J7A S;  4GHA A;  4LZJ A;  2JZ1 A;  5L8R F;  1TDH A;  3VDU A;  1K3W A;  2XSZ A;  1ZAE A;  3MHV C;  3TQS A;  1TGU A;  3BOS A;  1VG5 A;  2EO2 A;  3PNY A;  1A5T A;  3W0L B;  1QZE A;  1XNR M;  2J7N A;  4M9S A;  3E9S A;  4DR6 M;  4DV0 M;  2R6F A;  5EXT A;  3GPU A;  3TL4 X;  4TUW A;  1VEJ A;  2DWL A;  2C99 A;  1PJJ A;  4DR3 M;  1GKI A;  2K6B A;  3B9P A;  3RGP A;  4FCV A;  4PDG A;  4DUZ M;  2CE7 A;  1Q3C A;  3J7B A;  1PGY A;  3PXG A;  1WGL A;  3VK8 A;  2FH0 A;  2C9C A;  4LRS A;  2D7G A;  1UFZ A;  2R18 A;  5ITU A;  1N33 M;  2CP8 A;  4IBK A;  4MH0 E;  4WUR A;  2LVO C;  1ZMW A;  3UMM A;  1Q02 A;  1G4A E;  1GO5 A;  3UJN A;  2OPF A;  1DO2 A;  3HX3 A;  4NSR A;  5EP3 A;  4AKI A;  1RU3 A;  1I4W A;  2XGN A;  3U5Z A;  3SAT A;  3I4V A;  1C1K A;  3I01 M;  2RGH A;  1IXR C;  3GRV A;  4QOZ C;  1QAM A;  2ERC A;  1QQW A;  2LVA A;  3CF2 A;  4FW9 A;  1UM8 A;  3W68 A;  3C58 A;  2Y21 A;  3C9P A;  3FTD A;  4DV5 M;  4KLN A;  1L8Q A;  5ITX A;  4X62 M;  3GLI E;  2EUC A;  4ZPX A;  4JI6 M;  4FWG A;  2JY6 B;  1YSY A;  4M9Z A;  2GNO A;  4JYA M;  1HQC A;  4AZF A;  3U6D A;  3U6P A;  4JI1 M;  2G3Q A;  3CF6 E;  4I81 A;  5KO3 A;  1ZMV A;  4AG6 A;  1IN4 A;  4NL4 H;  4JI7 M;  1MX0 A;  4GKK M;  1DGH A;  2DAK A;  2L6O A;  3HKP A;  4LCB A;  1XMO M;  1JR3 E;  4IBI A;  4KOD A;  1ZQ9 A;  3U6Q A;  2RGO A;  2V6Z M;  4L16 A;  1PJQ A;  3HWS A;  4F1I A;  2MJ5 B;  3SAW A;  1I94 M;  1N32 M;  2VF7 A;  2DNA A;  1MJG M;  4P17 A;  3K1J A;  4JV5 M;  1Z5A A;  2EJS A;  3UGJ A;  4LF5 M;  3SC3 A;  1ZMU A;  2KDL A;  1GJT A;  1R2Y A;  1T43 A;  2LHG A;  4MGK E;  3K9O A;  2A5Y B;  4B3S M;  4LJ6 A;  3SMP A;  3HJ8 A;  3SFZ A;  1IY0 A;  2WSF F;  2P5T A;  2ZTD A;  4CIS A;  1NJG A;  2DWN A;  1JQJ C;  3KP0 E;  3QYE A;  5EXX A;  3C3E A;  1QUT A;  3A42 A;  2UXB M;  1F4I A;  5KPR A;  2K9D A;  1IFY A;  1DGH B;  1FNN A;  3MK6 A;  3TWK A;  4DV2 M;  2R0I A;  3M6A A;  5DFL A;  4LGY A;  1S3S A;  2W82 A;  3KSJ A;  3SYL A;  2Z3X A;  4JI3 M;  3Q8X A;  1DGF A;  2H5X A;  5C1B A;  2G5G X;  2M5Z A;  4YHH M;  2KA6 B;  4RF0 A;  4LJ4 A;  3HU3 A;  2C96 A;  1J7K A;  4X64 M;  1SG9 A;  2KRK A;  1G3I A;  1L1Z A;  4ITQ A;  1V33 A;  1NY5 A;  2APL A;  2OOA A;  4L15 A;  1TH4 A;  3GLI A;  3SAS A;  2QSF X;  5EP1 A;  2JUJ A;  4LJ9 A;  3T38 A;  3V76 A;  1R6B X;  3OTO M;  2J5Y A;  4GC5 A;  2F5O A;  1OJL A;  4LF4 M;  4GKJ M;  5BPV A;  4G6Z A;  1HT1 E;  4LGM A;  3B74 A;  1G8P A;  2HKJ A;  3J80 S;  3LVV A;  5FSW A;  3HZJ A;  2VDB B;  1EE8 A;  2CWB A;  5IWA M;  3H4J A;  1QDR A;  3HHY A;  4D80 A;  3GP1 A;  4JI2 M;  1D0M A;  4FD2 A;  4GHL A;  2UXC M;  1G59 A;  3W67 A;  4JXJ A;  1SXJ C;  1NHW C;  1L2D A;  1W5T A;  2DAE A;  3H4M A;  5H37 D;  3NWL A;  2XZU A;  4DR4 M;  2H1R A;  1HNX M;  1JR3 A;  3FRH A;  4KT0 F;  3KOW E;  2EKF A;  5IZ7 D;  4NXN M;  1LTM A;  2DAG A;  2KNZ A;  3PNV A;  4GIP A;  4JI0 M;  4DV6 M;  1DGB A;  2L7H A;  3GLI B;  3F92 A;  4G4N A;  2YQZ A;  2F5Q A;  1Q39 A;  4AKG A;  2UUB M;  3JR4 A;  2DHR A;  2HCB A;  3UZU A;  1XC8 A;  3FYD A;  3LQQ A;  3JAM S;  4DBG B;  4UN2 B;  1D2N A;  4LF8 M;  4QHS A;  3ZCB B;  4YY3 M;  3VK7 A;  1MU5 A;  4HEO A;  3A46 A;  3Q8G A;  1PJS A;  3D8L A;  5DNY A;  3AV0 A;  1CUK A;  5EXS A;  3CF0 A;  4GC9 A;  1L2B A;  2FE8 A;  1Q3B A;  3LCV B;  4AW4 A;  1NV8 A;  3FTC A;  1HR0 M;  1SXJ D;  5IT9 S;  4Z6Y A;  4GRI A;  3HHZ A;  2QEN A;  3TPZ A;  4FCW A;  3I51 A;  3VKG A;  3GLH B;  3FTF A;  3KOX E;  2QBY B;  1R4G A;  2RRU A;  1TR8 A;  1N77 A;  5FTK A;  3DA1 A;  1HJP A;  1W5S A;  3T15 A;  2ZAM A;  3L29 A;  4OVZ A;  3AKZ A;  3KW6 A;  1DGG A;  3K9P A;  1QDT A;  2YFQ A;  3CGW A;  1NNU C;  2JP7 A;  5EP4 A;  3SAV A;  1N75 A;  3LVW A;  1IXS B;  4BB9 A;  1Z5C A;  2HAK A;  1VEK A;  4DR5 M;  1KSF X;  4L6V 6;  1XMQ M;  2DZO B;  1QAN A;  3THG A;  4G4R A;  2CFO A;  2G8L A;  3MJ5 A;  2LH0 A;  1L1T A;  4Z8X A;  3KXE C;  2CHQ A;  2D7E A;  1IN6 A;  4IJF A;  1R7R A;  4JI4 M;  1OFH A;  2R62 A;  3HJS A;  3A98 B;  5EQT A;  4IBC A;  1OFI A;  3W0F A;  2LBC A;  4L4U A;  4D81 A;  4MGI E;  3DZD A;  2BNK A;  3GLF B;  4GEW A;  3L27 A;  1NJF A;  1E32 A;  4I4L A;  4LZZ A;  4OVZ B;  3AOE A;  2MRO B;  4S12 A;  1BVS A;  3E4R A;  2XFT A;  1NV9 A;  3MMP A;  4JI5 M;  1DV0 A;  1WGN A;  4ANR A;  1XHB A;  1VQ1 A;  5KQD A;  3SMS A;  2WZJ A;  4IBJ A;  3VDP A;  3EIE A;  2KEB A;  3TE6 A;  3FTE A;  4X65 M;  1IN5 A;  1VEG A;  2DAM A;  3SYK A;  2UUC M;  2BJW A;  1HT2 E;  3K8Z A;  4AI6 A;  1EFU B;  1XNQ M;  3AJI B;  2L2D A;  1Z59 A;  2L4F A;  1TTE A;  1OQY A;  2LVQ D;  1YLA A;  3ZC7 B;  2F4V M;  2KRU A;  5KQ8 A;  5FLX S;  2F5S A;  2DHY A;  3BXW A;  3D8B A;  5JI2 E;  3E21 A;  4DR2 M;  2L7I A;  4G3O A;  1IBL M;  2L4E A;  4M0W A;  4B08 A;  3GLH E;  2JZ0 A;  1VDD A;  1EIJ A;  1IY2 A;  3A45 A;  5FTM A;  3T1H M;  2OO9 A;  2FOI C;  3DOA A;  1WR1 B;  4MB7 A;  1H6U A;  5JI3 E;  3JR5 A;  4RNA A;  4QNM A;  4LF7 M;  4DUY M;  2Y0Q A;  4FWH A;  3NBX X;  1QVR A;  2UUA M;  3TWM A;  2DZN B;  2K47 A;  2XLJ A;  3IG5 A;  3GLG E;  1IXZ A;  4EIW A;  4LFC M;  1IQP A;  2F5P A;  4JN6 A;  3SHG B;  2XF3 A;  4PD2 A;  3HHX A;  1E9S A;  4IBE A;  4RF1 A;  1TH2 A;  2FFJ A;  2FS1 A;  5LMU M;  1ZV1 A;  2XSZ D;  1AIP C;  1PJT A;  3KS8 A;  4KHP M;  4BLC A;  3FE3 A;  1SXJ B;  3GLF E;  1ORY B;  4B3M M;  2BWE A;  2VQF M; 
#chains in the Genus database with same CATH homology
 5EXP A;  1HNZ M;  2FNA A;  2LNH C;  5IRE B;  2XEP A;  1R2Z A;  1YUB A;  4II7 A;  4PDI A;  1NNJ A;  4LFB M;  3FYC A;  3U61 A;  3RE8 A;  1XWI A;  3FD9 A;  4G4Q A;  1HNW M;  1PM5 A;  1FJG M;  1KYI A;  2F5N A;  2R4J A;  3TWL A;  4G4O A;  3L28 A;  1YE9 A;  3SAR A;  2ZAN A;  2C5R A;  4R3D A;  2R4E A;  4MGH A;  3VLF B;  1X37 A;  1KFV A;  4M9X A;  4B7H A;  2CEA A;  3KFU G;  3HU2 A;  1GVN A;  3GPX A;  3GLH A;  2I7N A;  4DV1 M;  3SBJ A;  2QBY A;  3U61 B;  5EJC A;  2ZBK B;  4WW0 A;  3ZH9 B;  2LXE A;  2CUZ A;  1T3T A;  2KZS A;  3IG8 A;  2DXI A;  3L2A A;  4GH9 A;  3WHK A;  4JI8 M;  5C18 A;  4IBG A;  2HHH M;  2Y0T A;  4DV3 M;  2L09 A;  2CHV A;  2C9O A;  4DV4 M;  3K2L A;  2D7H A;  3GLG A;  4FWD A;  4PT5 A;  4FCT A;  2LWX A;  1IY1 A;  2R46 A;  1QAO A;  4LF6 M;  1IM2 A;  1SXJ E;  2R45 A;  4NRW A;  4K0K M;  3KS4 A;  1QZM A;  5ITT A;  2R65 A;  1GL6 A;  3KVW A;  3GO8 A;  1IBM M;  2V1C A;  3RFW A;  3GLF A;  1GLN A;  4X66 M;  3M0E A;  3J81 S;  4OX9 M;  3AOG A;  4OU7 A;  4IBB A;  3U60 B;  4KO8 A;  4W5W A;  5GKN A;  4L8R C;  4M0D A;  4FVM A;  3GLG B;  2Z4R A;  4LJA A;  4BBA A;  2E5L M;  1Z6T A;  1PJI A;  4I5S A;  4NRV A;  5F3W A;  2DWM A;  4IBD A;  3SAU A;  4LF9 M;  1HQY E;  3RGS A;  2NQ8 C;  3U6L A;  4QOS A;  3KDS E;  2Z7J A;  3GRY A;  1IBK M;  3L26 A;  2CV0 A;  2M60 A;  3KOY E;  3CTW B;  4AQY M;  5KPZ A;  3PVS A;  2YNM D;  3DFZ A;  5DYI A;  3M7G A;  2KZU A;  8CAT A;  2Y20 A;  3GQ5 A;  2EA0 A;  5ITY A;  3WHL A;  4LJ5 A;  5KPT A;  3J27 B;  4LJ7 A;  4HL4 A;  1XXH A;  4LRT A;  1NVM A;  3T1Y M;  1SXJ A;  2QZ4 A;  4CHT B;  3FUX A;  2AHM A;  1N78 A;  3U5Z B;  2ZAO A;  4PCZ A;  4OW0 A;  3GRR A;  7CAT A;  4B3R M;  1LV7 A;  1JR3 D;  1NSF A;  3ILK A;  4D82 A;  1TH3 A;  1IN8 A;  4QHT A;  2CV2 A;  4MGY E;  3HGI A;  3GRU A;  4HLQ A;  4REZ A;  3FKE A;  4R7G A;  2QP9 X;  4NSO B;  1J5E M;  4NOO B;  4CGY B;  2VII A;  3SHF A;  3GQ3 A;  1IN7 A;  4GMQ A;  4LG2 A;  2CHG A;  4MGZ E;  4LJ8 A;  2CV1 A;  2UU9 M;  1QYR A;  1XXH B;  1WXQ A;  2QPA A;  3QWL A;  2BJV A;  2X4A A;  2HL7 A;  5FTL A;  2XZF A;  1J09 A;  4IBF A;  1E94 E;  3HHW A;  4I8O A;  2ZM6 M;  1L2C A;  4IJE A;  4P16 A;  1TDZ A;  4L78 A;  4DR1 M;  3LQR A;  1N36 M;  1K82 A;  5EP2 A;  3GQ4 A;  1K3X A;  2XH9 A;  3L25 A;  2UXD M;  5E6J A;  2XFS A;  3AOE C;  3KOZ E;  5BR8 M;  4XBO A;  4DV7 M;  3FUV A;  3GPY A;  1GL7 A;  5FTJ A;  2KW0 A;  4AG5 A;  4LFA M;  1NHG C;  4A3V B;  4NXM M;  3J2P B;  2X49 A;  3AL0 C;  4IIW A;  4LY6 A;  4B7G A;  3FUU A;  5E26 A;  4GIT A;  1N34 M;  3FUW A;  3VKH A;  3R9X B;  3QAU A;  1E9R A;  3FUT A;  3R8F A;  2C98 A;  1QAQ A;  3I4Y A;  1Z5B A;  2VQE M;  2YR0 A;  5LMN M;  3AFH A;  2Z4S A;  4B7F A;  3U6S A;  2QCU A;  4DR7 M;  3NBI A;  3EIH A;  3U6O A;  2X8A A;  3HU1 A;  2OQ4 A;  3U60 A;  2DWZ B;  3KP1 E;  3KSX A;  5ITR A;  2RKO A;  5ITX E;  5A2Q S;  3PFI A;  3UK6 A;  4AKH A;  2V1U A;  3K92 A;  2DVW B;  3U6E A;  4B3T M;  2J7O A;  2O5R A;  2JA2 A;  5ITQ A;  1DO0 A;  4MM3 B;  5DYG A;  3GPP A;  1G41 A;  2I7P A;  3LMM A;  4XGI A;  2Q2E B;  5FTN A;  3U6C A;  4QNR A;  3U6M A;  2KXE A;  3VFD A;  1NY6 A;  3HJQ A;  3J7A S;  4GHA A;  4LZJ A;  1TDH A;  3VDU A;  1K3W A;  2XSZ A;  1ZAE A;  3MHV C;  3TQS A;  1TGU A;  3BOS A;  3PNY A;  2EO2 A;  1XNR M;  3W0L B;  2J7N A;  4M9S A;  3E9S A;  4DR6 M;  4DV0 M;  5EXT A;  3GPU A;  3TL4 X;  4TUW A;  2DWL A;  2C99 A;  1PJJ A;  4DR3 M;  1GKI A;  3B9P A;  3RGP A;  4FCV A;  4PDG A;  4DUZ M;  2CE7 A;  1Q3C A;  3J7B A;  3PXG A;  3VK8 A;  2C9C A;  4LRS A;  2D7G A;  2R18 A;  5ITU A;  1N33 M;  4IBK A;  4MH0 E;  4WUR A;  3UMM A;  1G4A E;  3UJN A;  2OPF A;  1DO2 A;  4NSR A;  5EP3 A;  4AKI A;  1I4W A;  2XGN A;  3U5Z A;  3SAT A;  3I4V A;  1C1K A;  2RGH A;  1IXR C;  3GRV A;  4QOZ C;  1QAM A;  2ERC A;  1QQW A;  3CF2 A;  4FW9 A;  1UM8 A;  3C58 A;  1G59 A;  2Y21 A;  3FTD A;  4DV5 M;  4KLN A;  1L8Q A;  5ITX A;  4X62 M;  2EUC A;  4ZPX A;  4JI6 M;  4FWG A;  1YSY A;  4M9Z A;  4JYA M;  1HQC A;  4AZF A;  3U6D A;  3U6P A;  4JI1 M;  3CF6 E;  4I81 A;  5KO3 A;  4AG6 A;  1IN4 A;  4NL4 H;  4JI7 M;  1MX0 A;  4GKK M;  1DGH A;  2L6O A;  3HKP A;  4LCB A;  1XMO M;  4IBI A;  4KOD A;  1ZQ9 A;  3U6Q A;  2RGO A;  2V6Z M;  4L16 A;  3HWS A;  3SAW A;  1I94 M;  1N32 M;  3K1J A;  4JV5 M;  3UGJ A;  4LF5 M;  3SC3 A;  4B3S M;  1R2Y A;  4MGK E;  2A5Y B;  4LJ6 A;  3SMP A;  3HJ8 A;  3SFZ A;  1IY0 A;  2P5T A;  4CIS A;  1NJG A;  2DWN A;  1JQJ C;  3KP0 E;  5EXX A;  3A42 A;  2UXB M;  5KPR A;  1DGH B;  1FNN A;  3MK6 A;  3TWK A;  4DV2 M;  3M6A A;  4LGY A;  1S3S A;  2W82 A;  3KSJ A;  3SYL A;  2Z3X A;  4JI3 M;  3Q8X A;  1DGF A;  5C1B A;  2G5G X;  2M5Z A;  4YHH M;  2KA6 B;  4RF0 A;  4LJ4 A;  3HU3 A;  2C96 A;  1J7K A;  4X64 M;  2KRK A;  1G3I A;  1L1Z A;  4ITQ A;  1NY5 A;  4L15 A;  1TH4 A;  3GLI A;  3SAS A;  5EP1 A;  4LJ9 A;  3T38 A;  1R6B X;  3OTO M;  2F5O A;  4GC5 A;  4LF4 M;  1OJL A;  4GKJ M;  5BPV A;  4G6Z A;  1HT1 E;  4LGM A;  1G8P A;  2HKJ A;  3J80 S;  3LVV A;  5FSW A;  5IWA M;  1EE8 A;  3HHY A;  4D80 A;  3GP1 A;  4JI2 M;  4FD2 A;  2UXC M;  4GHL A;  1L2D A;  4JXJ A;  1SXJ C;  1NHW C;  1W5T A;  3H4M A;  5H37 D;  3NWL A;  2XZU A;  4DR4 M;  2H1R A;  1HNX M;  1JR3 A;  3KOW E;  5IZ7 D;  4NXN M;  4GIP A;  4JI0 M;  3PNV A;  4DV6 M;  1DGB A;  2L7H A;  3GLI B;  4G4N A;  2YQZ A;  2F5Q A;  1Q39 A;  4AKG A;  2UUB M;  3JR4 A;  2DHR A;  2HCB A;  3UZU A;  1XC8 A;  3FYD A;  3LQQ A;  3JAM S;  1D2N A;  4LF8 M;  4QHS A;  3ZCB B;  4YY3 M;  3VK7 A;  1MU5 A;  3A46 A;  3D8L A;  5DNY A;  3AV0 A;  5EXS A;  3CF0 A;  4GC9 A;  1L2B A;  2FE8 A;  1Q3B A;  4AW4 A;  3FTC A;  1HR0 M;  1SXJ D;  5IT9 S;  4Z6Y A;  4GRI A;  3HHZ A;  2QEN A;  3TPZ A;  4FCW A;  3I51 A;  3VKG A;  3GLH B;  3FTF A;  3KOX E;  2QBY B;  1N77 A;  5FTK A;  3DA1 A;  1W5S A;  3T15 A;  2ZAM A;  3L29 A;  4OVZ A;  3AKZ A;  3KW6 A;  1DGG A;  2YFQ A;  1NNU C;  5EP4 A;  3SAV A;  1N75 A;  3LVW A;  1IXS B;  4BB9 A;  1Z5C A;  4DR5 M;  1KSF X;  1XMQ M;  2DZO B;  1QAN A;  3THG A;  4G4R A;  2CFO A;  2G8L A;  3MJ5 A;  2LH0 A;  1L1T A;  4Z8X A;  3KXE C;  2CHQ A;  2D7E A;  1IN6 A;  4IJF A;  1R7R A;  4JI4 M;  1OFH A;  2R62 A;  3HJS A;  3A98 B;  5EQT A;  4IBC A;  1OFI A;  3W0F A;  4L4U A;  4D81 A;  4MGI E;  3DZD A;  2BNK A;  3GLF B;  4I4L A;  3L27 A;  1NJF A;  1E32 A;  4LZZ A;  4OVZ B;  3AOE A;  4S12 A;  3E4R A;  2XFT A;  4JI5 M;  1XHB A;  5KQD A;  3SMS A;  4IBJ A;  3VDP A;  3EIE A;  2KEB A;  3TE6 A;  3FTE A;  4X65 M;  1IN5 A;  3SYK A;  2UUC M;  2BJW A;  1HT2 E;  3K8Z A;  4AI6 A;  1XNQ M;  3AJI B;  1Z59 A;  3ZC7 B;  2F4V M;  2KRU A;  5KQ8 A;  5FLX S;  2F5S A;  5JI2 E;  3D8B A;  4DR2 M;  2L7I A;  1IBL M;  4M0W A;  4B08 A;  1VDD A;  1IY2 A;  3A45 A;  5FTM A;  3T1H M;  2FOI C;  3DOA A;  4MB7 A;  5JI3 E;  1H6U A;  3JR5 A;  4RNA A;  4QNM A;  4LF7 M;  4DUY M;  2Y0Q A;  4FWH A;  1QVR A;  2UUA M;  3TWM A;  2DZN B;  2K47 A;  2XLJ A;  3IG5 A;  1IXZ A;  4EIW A;  4LFC M;  1IQP A;  2F5P A;  4JN6 A;  3SHG B;  2XF3 A;  4PD2 A;  3HHX A;  1E9S A;  4IBE A;  4RF1 A;  1TH2 A;  2FFJ A;  5LMU M;  3KS8 A;  2XSZ D;  4KHP M;  4BLC A;  1SXJ B;  1ORY B;  4B3M M;  1Z5A A;  2VQF M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...