2OPFA

Crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli (r252a) in complex with ap-site containing dna substrate
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
262
structure length
256
Chain Sequence
b'PEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHVTHVETRGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGQVDALFRFKVFHRDGEPCERCGSIIEKTTLSSAPFYWCPGCQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site plasticity of endonuclease VIII: Conformational changes compensating for different substrates and mutations of critical residues
rcsb
molecule keywords 5'-D(*GP*GP*CP*TP*TP*CP*AP*TP*CP*CP*TP*G)-3'
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 83
structure length 256
sequence length 262
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2007-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06827 zf-FPG_IleRS Zinc finger found in FPG and IleRS
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2opfA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 2opfA01
3C58A 4G4RA 1L1TA 1N36M 1R2YA 5ITRA 4JI3M 4DR1M 4MB7A 5FLXS 5ITQA 4G4QA 4LF7M 1HR0M 4YY3M 2OPFA 3DOAA 2F5OA 2UUAM 3SAWA 3J80S 2HHHM 1L2BA 4YHHM 4DR5M 4DR6M 4DR7M 4DV5M 3U6MA 3U6SA 2UU9M 1XNQM 4KHPM 4PD2A 3A42A 4AQYM 4DV1M 1I94M 4LF8M 1HNXM 3A45A 4B3TM 1Q3BA 1KFVA 4JYAM 1TDHA 1EE8A 1IBMM 3GQ3A 4JI5M 4DV6M 3VK7A 2VQFM 3GO8A 1IBLM 3GP1A 2UXBM 1L2CA 4B3MM 4LF5M 4ITQA 4DV7M 4GKKM 5ITXA 4JI1M 4JI4M 4X65M 3SATA 2Q2EB 3SARA 4DR4M 4JI7M 2F5QA 4LF6M 4PCZA 3U6LA 1N32M 4DUYM 5IT9S 5LMNM 3GPYA 4NRWA 2F5NA 4JI8M 3U6OA 1FJGM 3U6EA 4PDIA 3GQ4A 4X62M 1R2ZA 3OTOM 2F5PA 3U6QA 2XZFA 1MX0A 4NXMM 1N33M 1NNJA 5BR8M 5ITXE 4LFAM 3GPXA 3JAMS 4G4NA 2UXCM 4LFBM 4LF4M 3GQ5A 1HNWM 2F4VM 3U6DA 4DV2M 4X66M 1J5EM 3TWKA 4NXNM 2E5LM 2EA0A 4DV3M 3U6PA 1XMOM 4NRVA 3T1YM 3J7AS 4PDGA 3TWMA 1PJJA 1MU5A 4B3RM 3T1HM 3JR5A 4DV4M 5A2QS 3J81S 3VK8A 2UXDM 3U6CA 1K3XA 4DUZM 1Z5CA 1XC8A 5LMUM 1N34M 4B3SM 4JI2M 3A46A 4DR2M 1XMQM 1Q3CA 5ITTA 5ITUA 4LFCM 1Z5BA 3JR4A 2UUCM 4OX9M 1Q39A 3SBJA 5IWAM 1Z59A 1K82A 2ZM6M 4JI6M 4K0KM 1TDZA 2XZUA 2VQEM 3TWLA 3SAUA 4DV0M 4LF9M 1PM5A 4X64M 5ITYA 4JV5M 4G4OA 2F5SA 1L1ZA 2ZBKB 3GPUA 4JI0M 4GKJM 2OQ4A 3SASA 2HKJA 2UUBM 1L2DA 1PJIA 1IBKM 1HNZM 1K3WA 1Z5AA 3SAVA 3W0FA 4CISA 4DR3M 1XNRM 3GPPA
chains in the Genus database with same CATH superfamily
3C58A 2BJWA 1N36M 4OVZB 1R2YA 4DR1M 5DYIA 1IXSB 5ITQA 1IY0A 4LF7M 4QOZC 2OPFA 4QHSA 4F1IA 1DGGA 3LVWA 4MGZE 3SAWA 1MN3A 1WJ7A 2CP8A 1R6BX 2LVAA 3DA1A 1TTEA 3KP0E 4DR5M 2G3QA 3AKZA 4DV5M 3U6MA 4IBBA 2D7EA 3PNVA 2UU9M 1JR3D 4KHPM 1XXHE 2L4EA 4PD2A 3KOYE 3SYLA 3A42A 1IY2A 1I94M 4LF8M 4WP2A 2R62A 3LW5F 3A45A 1XB2B 1I4WA 2B3TA 4DV6M 2QPAA 1SXJC 3FTCA 2VQFM 2QNJA 2DWNA 3GO8A 3L29A 3PVSA 2UXBM 4IJFA 1E94E 2EKKA 4DV7M 1YUBA 4JI1M 1VG5A 2ZTCA 1OIPA 3SARA 1GJSA 1NHGC 2LWXA 1BVSA 2ZAMA 2C98A 5IT9S 3U6LA 5GKNA 1S3SA 2JY5A 1VEGA 2BWEA 3WHLA 1WIVA 1JR3E 2Z3XA 2F5NA 3TQSA 2LH0A 1NVMA 1D0MA 2HCBA 2H1RA 3IG8A 4AW4A 4WURA 1QAMA 2D7GA 4GITA 3UGJA 1L8QA 2LNHC 4XGIA 1PJTA 2V6ZM 4LJ8A 1E9SA 2DHRA 2DZNB 3AV0A 2QBYA 5ITXE 4D80A 3DFZA 2C5RA 3C3EA 1WGLA 3TPZA 2UXCM 4CGYB 4LF4M 1D2NA 4OW0A 3NBXX 3GLFA 3GLGE 2WSEF 2YQZA 4AKGA 2OOBA 3VLFB 3GRUA 3PNYA 1SXJD 2BWBA 3HU3A 3K92A 2P5TA 2VF7A 1OFHA 3FTEA 1WR1B 1TF0B 3I4VA 1XMOM 3T1YM 3J7AS 2LVPC 2J7NA 4AZFA 2R4JA 4BLCA 4DV4M 1IQPA 2G5GX 2WSFF 1VDLA 2UXDM 1GABA 3U6CA 1Z5CA 3UJNA 5LMUM 5EXTA 4FWGA 2QBYB 4DR2M 3LVVA 3RFWA 1XMQM 4LJ4A 5FTLA 1Q3CA 1F4IA 1Z6TA 3SYKA 1TH2A 3VDPA 3SMPA 4OU7A 1Z5BA 3JR4A 2KA6B 3GLFB 1Z59A 2ERCA 2X4AA 4K0KM 1ZMUA 4LY6A 3KS8A 1WXQA 3QYBA 3TWLA 5KPZA 1DV0A 2YFQA 4DV0M 1PM5A 1H6UA 5EP1A 3FRHA 2F5SA 2N35A 4KLNA 1YLAA 2HWJA 4LRTA 2CFOA 1WHCA 2KZSA 3FTFA 3R9XB 4II7A 2KEBA 3I04M 1NY5A 1HQYE 2NQ8C 4DR3M 3KSJA 3E46A 3HU1A 1NNUC 2JZ0A 5FTNA 1OIZA 2DWMA 2QCUA 5ITRA 4I8OA 3CF2A 2XEPA 2R4EA 2VDBB 4LCBA 2JUJA 2K6BA 4L6V6 4QNMA 3KDSE 3HU2A 1G59A 2UUAM 2KW0A 2GNOA 3K9PA 3FTDA 2HHHM 1L2BA 2DWLA 3KSXA 2QENA 4B7GA 3A98B 4DR6M 1QAOA 2LHCA 1IN5A 2JXNA 2Z7JA 4NSRA 1IN4A 3H4JA 2QSFX 3VKGA 3J27B 1ZMVA 3FRIA 1NV9A 2DAMA 3GLIA 2RGHA 4AQYM 1PRBA 1T43A 1E9RA 3IECA 1OKSA 4IBFA 3L26A 3KOZE 1DGHA 4JN6A 2DZLA 3HKPA 3GQ3A 1IBMM 1MJGM 2HAKA 1OTRA 3VK7A 4L15A 1GO5A 4AG5A 5L8RF 1IFYA 1IBLM 2M60A 3U60A 3GP1A 2JP7A 2XSZA 4B3MM 2CHVA 2LVNC 2OO9A 4ITQA 2V1CA 4JI4M 3GLHA 5EJCA 3AJIB 1YE9A 4F2LA 4PCZA 2APLA 5KQ8A 3L25A 1HJPA 2JWSA 4Y28F 4NRWA 3GLIB 5C18A 3J7BA 1FJGM 1NY6A 4D82A 1JB0F 3GQ4A 2VF8A 4NOOB 4HL4A 2DI0A 1G4AE 3ILKA 2Z4SA 3U6QA 1DGHB 3HJ8A 5EXPA 3NWLA 3UZUA 1ORYB 5EP2A 3HGIA 3AOEC 5H37D 1PJQA 5KQDA 2JY6B 2M5ZA 4LFAM 3JAMS 1ZMWA 2R65A 4G4NA 3U60B 5JI3E 5IZ7D 3GQ5A 2FE8A 3GRVA 1W5SA 5DNYA 4Q7JA 2LBCA 3R8FA 1HNWM 4BB9A 3HX3A 2XGNA 3U6DA 2ZANA 3GLHB 1J5EM 2WSCF 1TH4A 4I5SA 4QNRA 4NXNM 3VDUA 4NRVA 3PFIA 3J2PB 4CHTB 1C1KA 4GC9A 2DVWB 4LJ6A 1T3TA 2JY7A 3MK6A 5EQTA 3VK8A 2CE7A 2DXIA 1GL7A 3FUUA 4DUZM 3MHVC 4B3SM 4Z6YA 4JI2M 2L6OA 2G8LA 2QQ8A 3HHYA 3GLFE 2DZOB 3W68A 4IIWA 4GMQA 4G3OA 3T38A 3E9SA 4LFCM 3TL4X 4MGIE 2UUCM 4OX9M 2CV1A 5IWAM 2DWZB 1XWIA 2YNMD 4Z8XA 1ZQ9A 4A3VB 1R5LA 4LF9M 2DAEA 2FOIC 1QUSA 4KO8A 1UFZA 1V34A 1J09A 1L1ZA 3GPUA 4BBAA 4JI0M 4GKJM 1G8PA 3B89A 5F3WA 1TR8A 3D8LA 3SASA 1HT2E 1V92A 1PJIA 1IBKM 4KT0F 3L2AA 2KDLA 3KOWE 1KSFX 4G4RA 1T6OA 4RF1A 3W0LB 1GLNA 3WHKA 4QHTA 1AIPC 1QZMA 2KHHA 4LJ7A 1JQJC 1QQWA 3L28A 1PJSA 4MB7A 1QDTA 3B9PA 4YY3M 2DKLA 5IREB 3RGPA 1SXJE 3J80S 1G41A 3C3DA 1KYIA 4L16A 7CATA 1G3IA 1VQ1A 2KRKA 2LVQD 2MROB 1D0KA 3ZCBB 2K0BX 3AOEA 5KPRA 3I4YA 2L09A 2ZTDA 3LCVB 1OJLA 2YR0A 2CRUA 3FUWA 2CV0A 1XNQM 3THGA 2FS1A 4MGHA 1FNNA 2F4VM 1OQYA 2XF3A 1QUTA 1YSYA 2C9CA 4DV1M 1HNXM 1QDRA 3HZJA 4B3TM 3Q8XA 1Q3BA 4M9SA 3AL0C 2OOAA 1EE8A 3BOSA 3QWLA 4ANRA 2XSZD 4JI5M 2Y0QA 3HHXA 4GRIA 4NC6A 4IBKA 3CF6E 4GEWA 1ZAEA 4M0WA 2WZJA 2JNHA 2RRUA 3M0EA 5DYGA 4P16A 4MGKE 4M0DA 3SATA 2Q2EB 1TGUA 1NHWC 3ZQJA 4DR4M 1QVRA 4JI7M 2F5QA 4LF6M 2R46A 3L27A 1N32M 4DUYM 1QANA 2V1UA 2DAIA 4IJEA 3MMPA 4B7HA 2Z8YM 3U6OA 2Y20A 1OAOC 5EXXA 2XLJA 2L4FA 4CIZA 3U6EA 3BBZA 1NJFA 1VEJA 1DO0A 2EJSA 1N75A 4FVMA 3UK6A 3ZH9B 4RF0A 1PGYA 3T15A 1MX0A 2XZFA 3HY5A 2L7IA 1NNJA 2EUCA 2CHGA 2GQFA 5BR8M 2C96A 1X37A 3SFZA 2LTUA 2XH9A 1V33A 2LVOC 3FYCA 3T6PA 4DV2M 3PXGA 2I7NA 2R18A 3C9PA 2DNAA 5KO3A 3W67A 3FYDA 1IXZA 4FW9A 4DV3M 3U6PA 1NV8A 3HHZA 4PDGA 2F5OA 1QYRA 3TE6A 3TWMA 2JA2A 5FTMA 2H5XA 3K1JA 2O5RA 3J81S 2L7HA 2XFSA 4NSOB 1K3XA 5FSWA 3QAUA 5C1BA 3KVWA 4MH0E 4S12A 2DAKA 2CUZA 2R6FA 1N34M 3A46A 1RU3A 1EFUB 3LCUA 3Q8GA 4IBIA 3AFHA 3ZC7B 4AKHA 3SHGB 5ITTA 3KXEC 5ITUA 2KZUA 4LG2A 1LTMA 1Q39A 4JI6M 4B7FA 1Q02A 3MJ5A 1TDZA 5BPVA 4DBGB 1N78A 3U61A 2A5YB 1IXRC 1LV7A 4AI6A 3KW6A 1IN8A 3KFUG 2CV2A 3B7ZA 4JV5M 4G4OA 4CJ6A 1G71A 2FNAA 2VIIA 2ZBKB 1N77A 2MH8A 4GHLA 3EIEA 3LQRA 4XBOA 4I81A 1XHBA 1HNZM 4HEOA 4UN2B 5JI2E 3LQQA 1Y8GA 1GJTA 2Z4RA 4B08A 2LXEA 4CISA 1CUKA 1EIJA 3FD9A 1XXHA 1L1TA 2C9OA 2KNAA 2KXEA 2R45A 4L78A 2FFJA 4JI3M 3SMSA 3HJQA 3I51A 3UMMA 8CATA 4L8RC 1DO2A 5FTJA 1OAIA 4LJ9A 1DGBA 5FLXS 3M7GA 4G4QA 4LZZA 1HR0M 2BNKA 3M6AA 3DOAA 4QOSA 3U5ZA 4MGYE 4M9ZA 3D8BA 2MR9A 4HLQA 3U61B 2C99A 3LMMA 5EXSA 4YHHM 3V76A 4NL4H 2L2DA 2CWBA 4DR7M 3SHFA 5KPTA 4FWHA 3U6SA 3QYEA 2O01F 3F92A 3B74A 3FUVA 4LJ5A 1W5TA 2I7PA 1OFIA 1P3QQ 2Y0TA 4G6ZA 2X49A 4R3DA 3RGSA 2K47A 1R4GA 2XFTA 1XXHB 4P17A 1JR3A 4R7GA 3KOXE 4MM3B 1HQCA 4FWDA 3RE8A 1KFVA 1TDHA 4JYAM 1ZV1A 2O25A 1UM8A 2RKOA 4TUWA 2KRUA 2K9DA 4GH9A 3U5ZB 3BXWA 3I01M 1L2CA 4LF5M 3SC3A 3K9OA 4GKKM 5E6JA 5ITXA 1IM2A 4X65M 4FCVA 4FD2A 1QAQA 3CF0A 1VDDA 2QZ4A 3GLGA 2DAGA 3EIHA 4GIPA 5LMNM 3GPYA 4GC5A 1D0LA 3IHPA 4JI8M 3CGWA 2AHMA 4L4UA 4LRSA 2EO2A 4PDIA 4IBCA 3E21A 3IG5A 1QZEA 4LZJA 4X62M 1R2ZA 3OTOM 2HL7A 2F5PA 4KODA 1IN7A 3H4MA 1R7RA 3NBIA 1DGFA 2W82A 4NXMM 4LGMA 1N33M 2D7HA 3FUXA 3GRYA 3GPXA 4AKIA 1E32A 5E26A 4FCWA 4WW0A 4GHAA 2Y21A 4X66M 3TWKA 2E5LM 2EA0A 5EP4A 3GLGB 4LJAA 3HJSA 2DENA 2ZAOA 3GLIE 2BJVA 1SXJA 4IBDA 2X8AA 3FE3A 1PJJA 1MU5A 3DZDA 2LHGA 3JR5A 4B3RM 3CTWB 5A2QS 4I4LA 2QP9X 2J7OA 2CEAA 2R44A 1J7KA 2DHYA 1XC8A 1SG9A 1NO1A 5DFLA 1VEKA 4M9XA 4R71A 4XK8F 1HT1E 4LGYA 2R0IA 2CHQA 3AOGA 3VKHA 4OVZA 4W5WA 1NJGA 3HHWA 4ZPXA 1A5TA 3FKEA 2QHOB 1WGNA 3GLHE 2MGWA 4EIWA 2JY8A 2KNVA 2MJ5B 2ZM6M 3SBJA 3B7NA 1K82A 2XZUA 1C7YA 4D81A 1IXSA 1IY1A 1GKIA 1IN6A 5FTKA 4AG6A 2VQEM 3FUTA 3SAUA 3E4RA 3KP1E 3KS4A 4IBJA 1NSFA 3K2LA 1GL6A 2J5YA 4PT5A 5EP3A 5ITYA 4X64M 1SXJB 2KNZA 3VFDA 1AUAA 3B7QA 1TH3A 4RNAA 1GVNA 4RKUF 2EKFA 2FH0A 2RGOA 3GRRA 2OQ4A 2HKJA 2UUBM 3K8ZA 1L2DA 4LFBM 4REZA 4IBEA 1Z5AA 2JZ1A 4IBGA 3HWSA 3SAVA 1K3WA 4FCTA 3W0FA 4JXJA 3T1HM 1XNRM 3GPPA
chains in the Genus database with same CATH topology
3C58A 2BJWA 1N36M 4OVZB 1R2YA 4DR1M 5DYIA 1IXSB 5ITQA 1IY0A 4LF7M 4QOZC 2OPFA 4QHSA 1DGGA 3LVWA 4MGZE 3SAWA 1R6BX 3DA1A 4DR5M 3KP0E 3AKZA 4DV5M 3U6MA 4IBBA 2D7EA 3PNVA 2UU9M 1JR3D 4KHPM 4PD2A 3KOYE 3SYLA 3A42A 1IY2A 1I94M 4LF8M 2R62A 3A45A 1I4WA 4DV6M 2QPAA 1SXJC 3FTCA 2VQFM 2DWNA 3GO8A 3L29A 3PVSA 2UXBM 4IJFA 1E94E 4DV7M 1YUBA 4JI1M 3SARA 1NHGC 2LWXA 2ZAMA 2C98A 5IT9S 3U6LA 5GKNA 1S3SA 3WHLA 2Z3XA 2F5NA 3TQSA 2LH0A 1NVMA 2HCBA 2H1RA 3IG8A 4AW4A 4WURA 1QAMA 2D7GA 4GITA 3UGJA 1L8QA 2LNHC 4XGIA 2V6ZM 4LJ8A 1E9SA 2DHRA 2DZNB 3AV0A 2QBYA 5ITXE 4D80A 3DFZA 2C5RA 3TPZA 2UXCM 4CGYB 4LF4M 1D2NA 4OW0A 3GLFA 2YQZA 4AKGA 3VLFB 3GRUA 3PNYA 1SXJD 3HU3A 3K92A 2P5TA 1OFHA 3FTEA 3I4VA 1XMOM 3T1YM 3J7AS 2J7NA 4AZFA 2R4JA 4BLCA 4DV4M 1IQPA 2G5GX 2UXDM 3U6CA 1Z5CA 3UJNA 5LMUM 5EXTA 4FWGA 2QBYB 4DR2M 3LVVA 3RFWA 1XMQM 4LJ4A 5FTLA 1Q3CA 1Z6TA 3SYKA 1TH2A 3VDPA 3SMPA 4OU7A 1Z5BA 3JR4A 2KA6B 3GLFB 1Z59A 2ERCA 2X4AA 4K0KM 4LY6A 3KS8A 1WXQA 3TWLA 5KPZA 2YFQA 4DV0M 1PM5A 1H6UA 5EP1A 2F5SA 4KLNA 4LRTA 2CFOA 2KZSA 3FTFA 3R9XB 4II7A 2KEBA 1NY5A 1HQYE 2NQ8C 4DR3M 3KSJA 3HU1A 1NNUC 5FTNA 2DWMA 2QCUA 5ITRA 4I8OA 3CF2A 2XEPA 2R4EA 4LCBA 4QNMA 3KDSE 3HU2A 1G59A 2UUAM 2KW0A 3FTDA 2HHHM 1L2BA 2DWLA 3KSXA 2QENA 4B7GA 3A98B 4DR6M 1QAOA 1IN5A 2Z7JA 4NSRA 1IN4A 3VKGA 3J27B 3GLIA 2RGHA 4AQYM 1E9RA 4IBFA 3L26A 3KOZE 1DGHA 4JN6A 3HKPA 3GQ3A 1IBMM 3VK7A 4L15A 4AG5A 1IBLM 2M60A 3U60A 3GP1A 2XSZA 4B3MM 2CHVA 4ITQA 2V1CA 4JI4M 3GLHA 5EJCA 3AJIB 1YE9A 4PCZA 5KQ8A 3L25A 4NRWA 3GLIB 5C18A 3J7BA 1FJGM 1NY6A 4D82A 3GQ4A 4NOOB 4HL4A 1G4AE 3ILKA 2Z4SA 3U6QA 1DGHB 3HJ8A 5EXPA 3NWLA 3UZUA 1ORYB 5EP2A 3HGIA 3AOEC 5H37D 5KQDA 2M5ZA 4LFAM 3JAMS 2R65A 4G4NA 3U60B 5JI3E 5IZ7D 3GQ5A 2FE8A 3GRVA 1W5SA 5DNYA 3R8FA 1HNWM 2F4VM 4BB9A 2XGNA 3U6DA 2ZANA 3GLHB 1J5EM 1TH4A 4I5SA 4QNRA 4NXNM 3VDUA 4NRVA 3PFIA 3J2PB 4CHTB 1C1KA 4GC9A 2DVWB 4LJ6A 1T3TA 3MK6A 5EQTA 3VK8A 2CE7A 2DXIA 1GL7A 3FUUA 4DUZM 3MHVC 4B3SM 4Z6YA 4JI2M 2L6OA 2G8LA 3HHYA 2DZOB 4IIWA 4GMQA 3T38A 3E9SA 4LFCM 3TL4X 4MGIE 2UUCM 4OX9M 2CV1A 5IWAM 2DWZB 1XWIA 2YNMD 4Z8XA 1ZQ9A 4A3VB 4LF9M 2FOIC 4KO8A 1J09A 1L1ZA 3GPUA 4BBAA 4JI0M 4GKJM 1G8PA 5F3WA 3D8LA 3SASA 1HT2E 1PJIA 1IBKM 3L2AA 3KOWE 1KSFX 4G4RA 4RF1A 3W0LB 1GLNA 3WHKA 4QHTA 4LJ7A 1QZMA 1JQJC 1QQWA 3L28A 4MB7A 3B9PA 4YY3M 5IREB 3RGPA 1SXJE 3J80S 1G41A 1KYIA 4L16A 7CATA 1G3IA 2KRKA 3ZCBB 3AOEA 5KPRA 3I4YA 2L09A 1OJLA 2YR0A 2CV0A 3FUWA 1XNQM 3THGA 4MGHA 1FNNA 2XF3A 1YSYA 4DV1M 2C9CA 1HNXM 4B3TM 3Q8XA 1Q3BA 4M9SA 3AL0C 3BOSA 1EE8A 3QWLA 2XSZD 4JI5M 2Y0QA 3HHXA 4GRIA 4IBKA 3CF6E 1ZAEA 4M0WA 3M0EA 5DYGA 4P16A 4MGKE 4M0DA 3SATA 2Q2EB 1TGUA 1NHWC 4DR4M 1QVRA 4JI7M 2F5QA 4LF6M 2R46A 3L27A 1N32M 4DUYM 1QANA 2V1UA 4IJEA 4B7HA 3U6OA 2Y20A 5EXXA 2XLJA 3U6EA 1NJFA 1DO0A 1N75A 4FVMA 3UK6A 3ZH9B 4RF0A 3T15A 2XZFA 1MX0A 2L7IA 1NNJA 2EUCA 2CHGA 5BR8M 2C96A 1X37A 3SFZA 2XH9A 3FYCA 4DV2M 3PXGA 2I7NA 2R18A 5KO3A 3FYDA 1IXZA 4FW9A 4DV3M 3U6PA 3HHZA 4PDGA 2F5OA 1QYRA 3TE6A 3TWMA 2JA2A 5FTMA 3K1JA 2O5RA 3J81S 2L7HA 2XFSA 4NSOB 1K3XA 5FSWA 3QAUA 5C1BA 3KVWA 4MH0E 4S12A 1N34M 2CUZA 3A46A 4IBIA 3AFHA 3ZC7B 4AKHA 3SHGB 5ITTA 3KXEC 5ITUA 2KZUA 4LG2A 1Q39A 4JI6M 4B7FA 3MJ5A 1TDZA 5BPVA 1N78A 3U61A 2A5YB 1IXRC 1LV7A 4AI6A 3KW6A 1IN8A 3KFUG 2CV2A 4JV5M 4G4OA 2FNAA 2VIIA 2ZBKB 1N77A 4GHLA 3EIEA 3LQRA 4XBOA 4I81A 1XHBA 1HNZM 5JI2E 3LQQA 4B08A 4CISA 2Z4RA 2LXEA 3FD9A 1XXHA 1L1TA 2C9OA 2KXEA 2R45A 4L78A 2FFJA 4JI3M 3SMSA 3HJQA 3I51A 3UMMA 8CATA 4L8RC 1DO2A 5FTJA 5FLXS 4LJ9A 1DGBA 3M7GA 4G4QA 4LZZA 1HR0M 2BNKA 3M6AA 3DOAA 4QOSA 3U5ZA 4MGYE 4M9ZA 3D8BA 3U61B 4HLQA 2C99A 3LMMA 5EXSA 4YHHM 4NL4H 4DR7M 3SHFA 5KPTA 4FWHA 3U6SA 3FUVA 4LJ5A 1W5TA 2I7PA 1OFIA 2Y0TA 4G6ZA 4R3DA 2X49A 3RGSA 2K47A 2XFTA 1XXHB 4R7GA 1JR3A 3KOXE 4MM3B 1HQCA 4FWDA 3RE8A 1KFVA 1TDHA 4JYAM 1UM8A 2RKOA 4TUWA 2KRUA 4GH9A 3U5ZB 1L2CA 4LF5M 3SC3A 4GKKM 5E6JA 5ITXA 1IM2A 4X65M 4FCVA 4FD2A 1QAQA 3CF0A 1VDDA 2QZ4A 3GLGA 4GIPA 3EIHA 5LMNM 3GPYA 4GC5A 4JI8M 4L4UA 2AHMA 4LRSA 2EO2A 4PDIA 4IBCA 3IG5A 4LZJA 4X62M 1R2ZA 3OTOM 2HL7A 2F5PA 4KODA 1IN7A 3H4MA 1R7RA 3NBIA 1DGFA 2W82A 4NXMM 4LGMA 1N33M 2D7HA 3FUXA 3GRYA 3GPXA 4AKIA 1E32A 5E26A 4FCWA 4WW0A 4GHAA 2Y21A 4X66M 3TWKA 2E5LM 2EA0A 5EP4A 3GLGB 4LJAA 3HJSA 2ZAOA 2BJVA 1SXJA 4IBDA 2X8AA 1PJJA 1MU5A 3DZDA 4B3RM 3JR5A 3CTWB 5A2QS 4I4LA 2QP9X 2J7OA 2CEAA 1J7KA 1XC8A 4M9XA 1HT1E 4LGYA 2CHQA 3AOGA 3VKHA 4OVZA 4W5WA 1NJGA 3HHWA 4ZPXA 3FKEA 4EIWA 3SBJA 1K82A 2ZM6M 2XZUA 4D81A 5FTKA 1IY1A 1GKIA 1IN6A 4AG6A 2VQEM 3SAUA 3FUTA 3E4RA 3KP1E 3KS4A 4IBJA 1NSFA 3K2LA 1GL6A 4PT5A 5EP3A 5ITYA 4X64M 1SXJB 3VFDA 1TH3A 4RNAA 1GVNA 3GRRA 2RGOA 2OQ4A 2HKJA 2UUBM 3K8ZA 1L2DA 4LFBM 4REZA 4IBEA 1Z5AA 4IBGA 3SAVA 3HWSA 1K3WA 4FCTA 3W0FA 4JXJA 3T1HM 1XNRM 3GPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C58 A;  4G4R A;  1L1T A;  1N36 M;  1R2Y A;  5ITR A;  4JI3 M;  4DR1 M;  4MB7 A;  5FLX S;  5ITQ A;  4G4Q A;  4LF7 M;  1HR0 M;  4YY3 M;  2OPF A;  3DOA A;  2F5O A;  2UUA M;  3SAW A;  3J80 S;  2HHH M;  1L2B A;  4YHH M;  4DR5 M;  4DR6 M;  4DR7 M;  4DV5 M;  3U6M A;  3U6S A;  2UU9 M;  1XNQ M;  4KHP M;  4PD2 A;  3A42 A;  4AQY M;  4DV1 M;  1I94 M;  4LF8 M;  1HNX M;  3A45 A;  4B3T M;  1Q3B A;  1KFV A;  4JYA M;  1TDH A;  1EE8 A;  1IBM M;  3GQ3 A;  4JI5 M;  4DV6 M;  3VK7 A;  2VQF M;  3GO8 A;  1IBL M;  3GP1 A;  2UXB M;  1L2C A;  4B3M M;  4LF5 M;  4ITQ A;  4DV7 M;  4GKK M;  5ITX A;  4JI1 M;  4JI4 M;  4X65 M;  3SAT A;  2Q2E B;  3SAR A;  4DR4 M;  4JI7 M;  2F5Q A;  4LF6 M;  4PCZ A;  3U6L A;  1N32 M;  4DUY M;  5IT9 S;  5LMN M;  3GPY A;  4NRW A;  2F5N A;  4JI8 M;  3U6O A;  1FJG M;  3U6E A;  4PDI A;  3GQ4 A;  4X62 M;  1R2Z A;  3OTO M;  2F5P A;  3U6Q A;  2XZF A;  1MX0 A;  4NXM M;  1N33 M;  1NNJ A;  5BR8 M;  5ITX E;  4LFA M;  3GPX A;  3JAM S;  4G4N A;  2UXC M;  4LFB M;  4LF4 M;  3GQ5 A;  1HNW M;  2F4V M;  3U6D A;  4DV2 M;  4X66 M;  1J5E M;  3TWK A;  4NXN M;  2E5L M;  2EA0 A;  4DV3 M;  3U6P A;  1XMO M;  4NRV A;  3T1Y M;  3J7A S;  4PDG A;  3TWM A;  1PJJ A;  1MU5 A;  4B3R M;  3T1H M;  3JR5 A;  4DV4 M;  5A2Q S;  3J81 S;  3VK8 A;  2UXD M;  3U6C A;  1K3X A;  4DUZ M;  1Z5C A;  1XC8 A;  5LMU M;  1N34 M;  4B3S M;  4JI2 M;  3A46 A;  4DR2 M;  1XMQ M;  1Q3C A;  5ITT A;  5ITU A;  4LFC M;  1Z5B A;  3JR4 A;  2UUC M;  4OX9 M;  1Q39 A;  3SBJ A;  5IWA M;  1Z59 A;  1K82 A;  2ZM6 M;  4JI6 M;  4K0K M;  1TDZ A;  2XZU A;  2VQE M;  3TWL A;  3SAU A;  4DV0 M;  4LF9 M;  1PM5 A;  4X64 M;  5ITY A;  4JV5 M;  4G4O A;  2F5S A;  1L1Z A;  2ZBK B;  3GPU A;  4JI0 M;  4GKJ M;  2OQ4 A;  3SAS A;  2HKJ A;  2UUB M;  1L2D A;  1PJI A;  1IBK M;  1HNZ M;  1K3W A;  1Z5A A;  3SAV A;  3W0F A;  4CIS A;  4DR3 M;  1XNR M;  3GPP A; 
#chains in the Genus database with same CATH topology
 3C58 A;  2BJW A;  1N36 M;  4OVZ B;  1R2Y A;  4DR1 M;  5DYI A;  1IXS B;  5ITQ A;  1IY0 A;  4LF7 M;  4QOZ C;  2OPF A;  4QHS A;  4F1I A;  1DGG A;  3LVW A;  4MGZ E;  3SAW A;  1MN3 A;  1WJ7 A;  2CP8 A;  1R6B X;  2LVA A;  3DA1 A;  1TTE A;  3KP0 E;  4DR5 M;  2G3Q A;  3AKZ A;  4DV5 M;  3U6M A;  4IBB A;  2D7E A;  3PNV A;  2UU9 M;  1JR3 D;  4KHP M;  1XXH E;  2L4E A;  4PD2 A;  3KOY E;  3SYL A;  3A42 A;  1IY2 A;  1I94 M;  4LF8 M;  4WP2 A;  2R62 A;  3LW5 F;  3A45 A;  1XB2 B;  1I4W A;  2B3T A;  4DV6 M;  2QPA A;  1SXJ C;  3FTC A;  2VQF M;  2QNJ A;  2DWN A;  3GO8 A;  3L29 A;  3PVS A;  2UXB M;  4IJF A;  1E94 E;  2EKK A;  4DV7 M;  1YUB A;  4JI1 M;  1VG5 A;  2ZTC A;  1OIP A;  3SAR A;  1GJS A;  1NHG C;  2LWX A;  1BVS A;  2ZAM A;  2C98 A;  5IT9 S;  3U6L A;  5GKN A;  1S3S A;  2JY5 A;  1VEG A;  2BWE A;  3WHL A;  1WIV A;  1JR3 E;  2Z3X A;  2F5N A;  3TQS A;  2LH0 A;  1NVM A;  1D0M A;  2HCB A;  2H1R A;  3IG8 A;  4AW4 A;  4WUR A;  1QAM A;  2D7G A;  4GIT A;  3UGJ A;  1L8Q A;  2LNH C;  4XGI A;  1PJT A;  2V6Z M;  4LJ8 A;  1E9S A;  2DHR A;  2DZN B;  3AV0 A;  2QBY A;  5ITX E;  4D80 A;  3DFZ A;  2C5R A;  3C3E A;  1WGL A;  3TPZ A;  2UXC M;  4CGY B;  4LF4 M;  1D2N A;  4OW0 A;  3NBX X;  3GLF A;  3GLG E;  2WSE F;  2YQZ A;  4AKG A;  2OOB A;  3VLF B;  3GRU A;  3PNY A;  1SXJ D;  2BWB A;  3HU3 A;  3K92 A;  2P5T A;  2VF7 A;  1OFH A;  3FTE A;  1WR1 B;  1TF0 B;  3I4V A;  1XMO M;  3T1Y M;  3J7A S;  2LVP C;  2J7N A;  4AZF A;  2R4J A;  4BLC A;  4DV4 M;  1IQP A;  2G5G X;  2WSF F;  1VDL A;  2UXD M;  1GAB A;  3U6C A;  1Z5C A;  3UJN A;  5LMU M;  5EXT A;  4FWG A;  2QBY B;  4DR2 M;  3LVV A;  3RFW A;  1XMQ M;  4LJ4 A;  5FTL A;  1Q3C A;  1F4I A;  1Z6T A;  3SYK A;  1TH2 A;  3VDP A;  3SMP A;  4OU7 A;  1Z5B A;  3JR4 A;  2KA6 B;  3GLF B;  1Z59 A;  2ERC A;  2X4A A;  4K0K M;  1ZMU A;  4LY6 A;  3KS8 A;  1WXQ A;  3QYB A;  3TWL A;  5KPZ A;  1DV0 A;  2YFQ A;  4DV0 M;  1PM5 A;  1H6U A;  5EP1 A;  3FRH A;  2F5S A;  2N35 A;  4KLN A;  1YLA A;  2HWJ A;  4LRT A;  2CFO A;  1WHC A;  2KZS A;  3FTF A;  3R9X B;  4II7 A;  2KEB A;  3I04 M;  1NY5 A;  1HQY E;  2NQ8 C;  4DR3 M;  3KSJ A;  3E46 A;  3HU1 A;  1NNU C;  2JZ0 A;  5FTN A;  1OIZ A;  2DWM A;  2QCU A;  5ITR A;  4I8O A;  3CF2 A;  2XEP A;  2R4E A;  2VDB B;  4LCB A;  2JUJ A;  2K6B A;  4L6V 6;  4QNM A;  3KDS E;  3HU2 A;  1G59 A;  2UUA M;  2KW0 A;  2GNO A;  3K9P A;  3FTD A;  2HHH M;  1L2B A;  2DWL A;  3KSX A;  2QEN A;  4B7G A;  3A98 B;  4DR6 M;  1QAO A;  2LHC A;  1IN5 A;  2JXN A;  2Z7J A;  4NSR A;  1IN4 A;  3H4J A;  2QSF X;  3VKG A;  3J27 B;  1ZMV A;  3FRI A;  1NV9 A;  2DAM A;  3GLI A;  2RGH A;  4AQY M;  1PRB A;  1T43 A;  1E9R A;  3IEC A;  1OKS A;  4IBF A;  3L26 A;  3KOZ E;  1DGH A;  4JN6 A;  2DZL A;  3HKP A;  3GQ3 A;  1IBM M;  1MJG M;  2HAK A;  1OTR A;  3VK7 A;  4L15 A;  1GO5 A;  4AG5 A;  5L8R F;  1IFY A;  1IBL M;  2M60 A;  3U60 A;  3GP1 A;  2JP7 A;  2XSZ A;  4B3M M;  2CHV A;  2LVN C;  2OO9 A;  4ITQ A;  2V1C A;  4JI4 M;  3GLH A;  5EJC A;  3AJI B;  1YE9 A;  4F2L A;  4PCZ A;  2APL A;  5KQ8 A;  3L25 A;  1HJP A;  2JWS A;  4Y28 F;  4NRW A;  3GLI B;  5C18 A;  3J7B A;  1FJG M;  1NY6 A;  4D82 A;  1JB0 F;  3GQ4 A;  2VF8 A;  4NOO B;  4HL4 A;  2DI0 A;  1G4A E;  3ILK A;  2Z4S A;  3U6Q A;  1DGH B;  3HJ8 A;  5EXP A;  3NWL A;  3UZU A;  1ORY B;  5EP2 A;  3HGI A;  3AOE C;  5H37 D;  1PJQ A;  5KQD A;  2JY6 B;  2M5Z A;  4LFA M;  3JAM S;  1ZMW A;  2R65 A;  4G4N A;  3U60 B;  5JI3 E;  5IZ7 D;  3GQ5 A;  2FE8 A;  3GRV A;  1W5S A;  5DNY A;  4Q7J A;  2LBC A;  3R8F A;  1HNW M;  4BB9 A;  3HX3 A;  2XGN A;  3U6D A;  2ZAN A;  3GLH B;  1J5E M;  2WSC F;  1TH4 A;  4I5S A;  4QNR A;  4NXN M;  3VDU A;  4NRV A;  3PFI A;  3J2P B;  4CHT B;  1C1K A;  4GC9 A;  2DVW B;  4LJ6 A;  1T3T A;  2JY7 A;  3MK6 A;  5EQT A;  3VK8 A;  2CE7 A;  2DXI A;  1GL7 A;  3FUU A;  4DUZ M;  3MHV C;  4B3S M;  4Z6Y A;  4JI2 M;  2L6O A;  2G8L A;  2QQ8 A;  3HHY A;  3GLF E;  2DZO B;  3W68 A;  4IIW A;  4GMQ A;  4G3O A;  3T38 A;  3E9S A;  4LFC M;  3TL4 X;  4MGI E;  2UUC M;  4OX9 M;  2CV1 A;  5IWA M;  2DWZ B;  1XWI A;  2YNM D;  4Z8X A;  1ZQ9 A;  4A3V B;  1R5L A;  4LF9 M;  2DAE A;  2FOI C;  1QUS A;  4KO8 A;  1UFZ A;  1V34 A;  1J09 A;  1L1Z A;  3GPU A;  4BBA A;  4JI0 M;  4GKJ M;  1G8P A;  3B89 A;  5F3W A;  1TR8 A;  3D8L A;  3SAS A;  1HT2 E;  1V92 A;  1PJI A;  1IBK M;  4KT0 F;  3L2A A;  2KDL A;  3KOW E;  1KSF X;  4G4R A;  1T6O A;  4RF1 A;  3W0L B;  1GLN A;  3WHK A;  4QHT A;  1AIP C;  1QZM A;  2KHH A;  4LJ7 A;  1JQJ C;  1QQW A;  3L28 A;  1PJS A;  4MB7 A;  1QDT A;  3B9P A;  4YY3 M;  2DKL A;  5IRE B;  3RGP A;  1SXJ E;  3J80 S;  1G41 A;  3C3D A;  1KYI A;  4L16 A;  7CAT A;  1G3I A;  1VQ1 A;  2KRK A;  2LVQ D;  2MRO B;  1D0K A;  3ZCB B;  2K0B X;  3AOE A;  5KPR A;  3I4Y A;  2L09 A;  2ZTD A;  3LCV B;  1OJL A;  2YR0 A;  2CRU A;  3FUW A;  2CV0 A;  1XNQ M;  3THG A;  2FS1 A;  4MGH A;  1FNN A;  2F4V M;  1OQY A;  2XF3 A;  1QUT A;  1YSY A;  2C9C A;  4DV1 M;  1HNX M;  1QDR A;  3HZJ A;  4B3T M;  3Q8X A;  1Q3B A;  4M9S A;  3AL0 C;  2OOA A;  1EE8 A;  3BOS A;  3QWL A;  4ANR A;  2XSZ D;  4JI5 M;  2Y0Q A;  3HHX A;  4GRI A;  4NC6 A;  4IBK A;  3CF6 E;  4GEW A;  1ZAE A;  4M0W A;  2WZJ A;  2JNH A;  2RRU A;  3M0E A;  5DYG A;  4P16 A;  4MGK E;  4M0D A;  3SAT A;  2Q2E B;  1TGU A;  1NHW C;  3ZQJ A;  4DR4 M;  1QVR A;  4JI7 M;  2F5Q A;  4LF6 M;  2R46 A;  3L27 A;  1N32 M;  4DUY M;  1QAN A;  2V1U A;  2DAI A;  4IJE A;  3MMP A;  4B7H A;  2Z8Y M;  3U6O A;  2Y20 A;  1OAO C;  5EXX A;  2XLJ A;  2L4F A;  4CIZ A;  3U6E A;  3BBZ A;  1NJF A;  1VEJ A;  1DO0 A;  2EJS A;  1N75 A;  4FVM A;  3UK6 A;  3ZH9 B;  4RF0 A;  1PGY A;  3T15 A;  1MX0 A;  2XZF A;  3HY5 A;  2L7I A;  1NNJ A;  2EUC A;  2CHG A;  2GQF A;  5BR8 M;  2C96 A;  1X37 A;  3SFZ A;  2LTU A;  2XH9 A;  1V33 A;  2LVO C;  3FYC A;  3T6P A;  4DV2 M;  3PXG A;  2I7N A;  2R18 A;  3C9P A;  2DNA A;  5KO3 A;  3W67 A;  3FYD A;  1IXZ A;  4FW9 A;  4DV3 M;  3U6P A;  1NV8 A;  3HHZ A;  4PDG A;  2F5O A;  1QYR A;  3TE6 A;  3TWM A;  2JA2 A;  5FTM A;  2H5X A;  3K1J A;  2O5R A;  3J81 S;  2L7H A;  2XFS A;  4NSO B;  1K3X A;  5FSW A;  3QAU A;  5C1B A;  3KVW A;  4MH0 E;  4S12 A;  2DAK A;  2CUZ A;  2R6F A;  1N34 M;  3A46 A;  1RU3 A;  1EFU B;  3LCU A;  3Q8G A;  4IBI A;  3AFH A;  3ZC7 B;  4AKH A;  3SHG B;  5ITT A;  3KXE C;  5ITU A;  2KZU A;  4LG2 A;  1LTM A;  1Q39 A;  4JI6 M;  4B7F A;  1Q02 A;  3MJ5 A;  1TDZ A;  5BPV A;  4DBG B;  1N78 A;  3U61 A;  2A5Y B;  1IXR C;  1LV7 A;  4AI6 A;  3KW6 A;  1IN8 A;  3KFU G;  2CV2 A;  3B7Z A;  4JV5 M;  4G4O A;  4CJ6 A;  1G71 A;  2FNA A;  2VII A;  2ZBK B;  1N77 A;  2MH8 A;  4GHL A;  3EIE A;  3LQR A;  4XBO A;  4I81 A;  1XHB A;  1HNZ M;  4HEO A;  4UN2 B;  5JI2 E;  3LQQ A;  1Y8G A;  1GJT A;  2Z4R A;  4B08 A;  2LXE A;  4CIS A;  1CUK A;  1EIJ A;  3FD9 A;  1XXH A;  1L1T A;  2C9O A;  2KNA A;  2KXE A;  2R45 A;  4L78 A;  2FFJ A;  4JI3 M;  3SMS A;  3HJQ A;  3I51 A;  3UMM A;  8CAT A;  4L8R C;  1DO2 A;  5FTJ A;  1OAI A;  4LJ9 A;  1DGB A;  5FLX S;  3M7G A;  4G4Q A;  4LZZ A;  1HR0 M;  2BNK A;  3M6A A;  3DOA A;  4QOS A;  3U5Z A;  4MGY E;  4M9Z A;  3D8B A;  2MR9 A;  4HLQ A;  3U61 B;  2C99 A;  3LMM A;  5EXS A;  4YHH M;  3V76 A;  4NL4 H;  2L2D A;  2CWB A;  4DR7 M;  3SHF A;  5KPT A;  4FWH A;  3U6S A;  3QYE A;  2O01 F;  3F92 A;  3B74 A;  3FUV A;  4LJ5 A;  1W5T A;  2I7P A;  1OFI A;  1P3Q Q;  2Y0T A;  4G6Z A;  2X49 A;  4R3D A;  3RGS A;  2K47 A;  1R4G A;  2XFT A;  1XXH B;  4P17 A;  1JR3 A;  4R7G A;  3KOX E;  4MM3 B;  1HQC A;  4FWD A;  3RE8 A;  1KFV A;  1TDH A;  4JYA M;  1ZV1 A;  2O25 A;  1UM8 A;  2RKO A;  4TUW A;  2KRU A;  2K9D A;  4GH9 A;  3U5Z B;  3BXW A;  3I01 M;  1L2C A;  4LF5 M;  3SC3 A;  3K9O A;  4GKK M;  5E6J A;  5ITX A;  1IM2 A;  4X65 M;  4FCV A;  4FD2 A;  1QAQ A;  3CF0 A;  1VDD A;  2QZ4 A;  3GLG A;  2DAG A;  3EIH A;  4GIP A;  5LMN M;  3GPY A;  4GC5 A;  1D0L A;  3IHP A;  4JI8 M;  3CGW A;  2AHM A;  4L4U A;  4LRS A;  2EO2 A;  4PDI A;  4IBC A;  3E21 A;  3IG5 A;  1QZE A;  4LZJ A;  4X62 M;  1R2Z A;  3OTO M;  2HL7 A;  2F5P A;  4KOD A;  1IN7 A;  3H4M A;  1R7R A;  3NBI A;  1DGF A;  2W82 A;  4NXM M;  4LGM A;  1N33 M;  2D7H A;  3FUX A;  3GRY A;  3GPX A;  4AKI A;  1E32 A;  5E26 A;  4FCW A;  4WW0 A;  4GHA A;  2Y21 A;  4X66 M;  3TWK A;  2E5L M;  2EA0 A;  5EP4 A;  3GLG B;  4LJA A;  3HJS A;  2DEN A;  2ZAO A;  3GLI E;  2BJV A;  1SXJ A;  4IBD A;  2X8A A;  3FE3 A;  1PJJ A;  1MU5 A;  3DZD A;  2LHG A;  3JR5 A;  4B3R M;  3CTW B;  5A2Q S;  4I4L A;  2QP9 X;  2J7O A;  2CEA A;  2R44 A;  1J7K A;  2DHY A;  1XC8 A;  1SG9 A;  1NO1 A;  5DFL A;  1VEK A;  4M9X A;  4R71 A;  4XK8 F;  1HT1 E;  4LGY A;  2R0I A;  2CHQ A;  3AOG A;  3VKH A;  4OVZ A;  4W5W A;  1NJG A;  3HHW A;  4ZPX A;  1A5T A;  3FKE A;  2QHO B;  1WGN A;  3GLH E;  2MGW A;  4EIW A;  2JY8 A;  2KNV A;  2MJ5 B;  2ZM6 M;  3SBJ A;  3B7N A;  1K82 A;  2XZU A;  1C7Y A;  4D81 A;  1IXS A;  1IY1 A;  1GKI A;  1IN6 A;  5FTK A;  4AG6 A;  2VQE M;  3FUT A;  3SAU A;  3E4R A;  3KP1 E;  3KS4 A;  4IBJ A;  1NSF A;  3K2L A;  1GL6 A;  2J5Y A;  4PT5 A;  5EP3 A;  5ITY A;  4X64 M;  1SXJ B;  2KNZ A;  3VFD A;  1AUA A;  3B7Q A;  1TH3 A;  4RNA A;  1GVN A;  4RKU F;  2EKF A;  2FH0 A;  2RGO A;  3GRR A;  2OQ4 A;  2HKJ A;  2UUB M;  3K8Z A;  1L2D A;  4LFB M;  4REZ A;  4IBE A;  1Z5A A;  2JZ1 A;  4IBG A;  3HWS A;  3SAV A;  1K3W A;  4FCT A;  3W0F A;  4JXJ A;  3T1H M;  1XNR M;  3GPP A; 
#chains in the Genus database with same CATH homology
 3C58 A;  2BJW A;  1N36 M;  4OVZ B;  1R2Y A;  4DR1 M;  5DYI A;  1IXS B;  5ITQ A;  1IY0 A;  4LF7 M;  4QOZ C;  2OPF A;  4QHS A;  1DGG A;  3LVW A;  4MGZ E;  3SAW A;  1R6B X;  3DA1 A;  4DR5 M;  3KP0 E;  3AKZ A;  4DV5 M;  3U6M A;  4IBB A;  2D7E A;  3PNV A;  2UU9 M;  1JR3 D;  4KHP M;  4PD2 A;  3KOY E;  3SYL A;  3A42 A;  1IY2 A;  1I94 M;  4LF8 M;  2R62 A;  3A45 A;  1I4W A;  4DV6 M;  2QPA A;  1SXJ C;  3FTC A;  2VQF M;  2DWN A;  3GO8 A;  3L29 A;  3PVS A;  2UXB M;  4IJF A;  1E94 E;  4DV7 M;  1YUB A;  4JI1 M;  3SAR A;  1NHG C;  2LWX A;  2ZAM A;  2C98 A;  5IT9 S;  3U6L A;  5GKN A;  1S3S A;  3WHL A;  2Z3X A;  2F5N A;  3TQS A;  2LH0 A;  1NVM A;  2HCB A;  2H1R A;  3IG8 A;  4AW4 A;  4WUR A;  1QAM A;  2D7G A;  4GIT A;  3UGJ A;  1L8Q A;  2LNH C;  4XGI A;  2V6Z M;  4LJ8 A;  1E9S A;  2DHR A;  2DZN B;  3AV0 A;  2QBY A;  5ITX E;  4D80 A;  3DFZ A;  2C5R A;  3TPZ A;  2UXC M;  4CGY B;  4LF4 M;  1D2N A;  4OW0 A;  3GLF A;  2YQZ A;  4AKG A;  3VLF B;  3GRU A;  3PNY A;  1SXJ D;  3HU3 A;  3K92 A;  2P5T A;  1OFH A;  3FTE A;  3I4V A;  1XMO M;  3T1Y M;  3J7A S;  2J7N A;  4AZF A;  2R4J A;  4BLC A;  4DV4 M;  1IQP A;  2G5G X;  2UXD M;  3U6C A;  1Z5C A;  3UJN A;  5LMU M;  5EXT A;  4FWG A;  2QBY B;  4DR2 M;  3LVV A;  3RFW A;  1XMQ M;  4LJ4 A;  5FTL A;  1Q3C A;  1Z6T A;  3SYK A;  1TH2 A;  3VDP A;  3SMP A;  4OU7 A;  1Z5B A;  3JR4 A;  2KA6 B;  3GLF B;  1Z59 A;  2ERC A;  2X4A A;  4K0K M;  4LY6 A;  3KS8 A;  1WXQ A;  3TWL A;  5KPZ A;  2YFQ A;  4DV0 M;  1PM5 A;  1H6U A;  5EP1 A;  2F5S A;  4KLN A;  4LRT A;  2CFO A;  2KZS A;  3FTF A;  3R9X B;  4II7 A;  2KEB A;  1NY5 A;  1HQY E;  2NQ8 C;  4DR3 M;  3KSJ A;  3HU1 A;  1NNU C;  5FTN A;  2DWM A;  2QCU A;  5ITR A;  4I8O A;  3CF2 A;  2XEP A;  2R4E A;  4LCB A;  4QNM A;  3KDS E;  3HU2 A;  1G59 A;  2UUA M;  2KW0 A;  3FTD A;  2HHH M;  1L2B A;  2DWL A;  3KSX A;  2QEN A;  4B7G A;  3A98 B;  4DR6 M;  1QAO A;  1IN5 A;  2Z7J A;  4NSR A;  1IN4 A;  3VKG A;  3J27 B;  3GLI A;  2RGH A;  4AQY M;  1E9R A;  4IBF A;  3L26 A;  3KOZ E;  1DGH A;  4JN6 A;  3HKP A;  3GQ3 A;  1IBM M;  3VK7 A;  4L15 A;  4AG5 A;  1IBL M;  2M60 A;  3U60 A;  3GP1 A;  2XSZ A;  4B3M M;  2CHV A;  4ITQ A;  2V1C A;  4JI4 M;  3GLH A;  5EJC A;  3AJI B;  1YE9 A;  4PCZ A;  5KQ8 A;  3L25 A;  4NRW A;  3GLI B;  5C18 A;  3J7B A;  1FJG M;  1NY6 A;  4D82 A;  3GQ4 A;  4NOO B;  4HL4 A;  1G4A E;  3ILK A;  2Z4S A;  3U6Q A;  1DGH B;  3HJ8 A;  5EXP A;  3NWL A;  3UZU A;  1ORY B;  5EP2 A;  3HGI A;  3AOE C;  5H37 D;  5KQD A;  2M5Z A;  4LFA M;  3JAM S;  2R65 A;  4G4N A;  3U60 B;  5JI3 E;  5IZ7 D;  3GQ5 A;  2FE8 A;  3GRV A;  1W5S A;  5DNY A;  3R8F A;  1HNW M;  2F4V M;  4BB9 A;  2XGN A;  3U6D A;  2ZAN A;  3GLH B;  1J5E M;  1TH4 A;  4I5S A;  4QNR A;  4NXN M;  3VDU A;  4NRV A;  3PFI A;  3J2P B;  4CHT B;  1C1K A;  4GC9 A;  2DVW B;  4LJ6 A;  1T3T A;  3MK6 A;  5EQT A;  3VK8 A;  2CE7 A;  2DXI A;  1GL7 A;  3FUU A;  4DUZ M;  3MHV C;  4B3S M;  4Z6Y A;  4JI2 M;  2L6O A;  2G8L A;  3HHY A;  2DZO B;  4IIW A;  4GMQ A;  3T38 A;  3E9S A;  4LFC M;  3TL4 X;  4MGI E;  2UUC M;  4OX9 M;  2CV1 A;  5IWA M;  2DWZ B;  1XWI A;  2YNM D;  4Z8X A;  1ZQ9 A;  4A3V B;  4LF9 M;  2FOI C;  4KO8 A;  1J09 A;  1L1Z A;  3GPU A;  4BBA A;  4JI0 M;  4GKJ M;  1G8P A;  5F3W A;  3D8L A;  3SAS A;  1HT2 E;  1PJI A;  1IBK M;  3L2A A;  3KOW E;  1KSF X;  4G4R A;  4RF1 A;  3W0L B;  1GLN A;  3WHK A;  4QHT A;  4LJ7 A;  1QZM A;  1JQJ C;  1QQW A;  3L28 A;  4MB7 A;  3B9P A;  4YY3 M;  5IRE B;  3RGP A;  1SXJ E;  3J80 S;  1G41 A;  1KYI A;  4L16 A;  7CAT A;  1G3I A;  2KRK A;  3ZCB B;  3AOE A;  5KPR A;  3I4Y A;  2L09 A;  1OJL A;  2YR0 A;  2CV0 A;  3FUW A;  1XNQ M;  3THG A;  4MGH A;  1FNN A;  2XF3 A;  1YSY A;  4DV1 M;  2C9C A;  1HNX M;  4B3T M;  3Q8X A;  1Q3B A;  4M9S A;  3AL0 C;  3BOS A;  1EE8 A;  3QWL A;  2XSZ D;  4JI5 M;  2Y0Q A;  3HHX A;  4GRI A;  4IBK A;  3CF6 E;  1ZAE A;  4M0W A;  3M0E A;  5DYG A;  4P16 A;  4MGK E;  4M0D A;  3SAT A;  2Q2E B;  1TGU A;  1NHW C;  4DR4 M;  1QVR A;  4JI7 M;  2F5Q A;  4LF6 M;  2R46 A;  3L27 A;  1N32 M;  4DUY M;  1QAN A;  2V1U A;  4IJE A;  4B7H A;  3U6O A;  2Y20 A;  5EXX A;  2XLJ A;  3U6E A;  1NJF A;  1DO0 A;  1N75 A;  4FVM A;  3UK6 A;  3ZH9 B;  4RF0 A;  3T15 A;  2XZF A;  1MX0 A;  2L7I A;  1NNJ A;  2EUC A;  2CHG A;  5BR8 M;  2C96 A;  1X37 A;  3SFZ A;  2XH9 A;  3FYC A;  4DV2 M;  3PXG A;  2I7N A;  2R18 A;  5KO3 A;  3FYD A;  1IXZ A;  4FW9 A;  4DV3 M;  3U6P A;  3HHZ A;  4PDG A;  2F5O A;  1QYR A;  3TE6 A;  3TWM A;  2JA2 A;  5FTM A;  3K1J A;  2O5R A;  3J81 S;  2L7H A;  2XFS A;  4NSO B;  1K3X A;  5FSW A;  3QAU A;  5C1B A;  3KVW A;  4MH0 E;  4S12 A;  1N34 M;  2CUZ A;  3A46 A;  4IBI A;  3AFH A;  3ZC7 B;  4AKH A;  3SHG B;  5ITT A;  3KXE C;  5ITU A;  2KZU A;  4LG2 A;  1Q39 A;  4JI6 M;  4B7F A;  3MJ5 A;  1TDZ A;  5BPV A;  1N78 A;  3U61 A;  2A5Y B;  1IXR C;  1LV7 A;  4AI6 A;  3KW6 A;  1IN8 A;  3KFU G;  2CV2 A;  4JV5 M;  4G4O A;  2FNA A;  2VII A;  2ZBK B;  1N77 A;  4GHL A;  3EIE A;  3LQR A;  4XBO A;  4I81 A;  1XHB A;  1HNZ M;  5JI2 E;  3LQQ A;  4B08 A;  4CIS A;  2Z4R A;  2LXE A;  3FD9 A;  1XXH A;  1L1T A;  2C9O A;  2KXE A;  2R45 A;  4L78 A;  2FFJ A;  4JI3 M;  3SMS A;  3HJQ A;  3I51 A;  3UMM A;  8CAT A;  4L8R C;  1DO2 A;  5FTJ A;  5FLX S;  4LJ9 A;  1DGB A;  3M7G A;  4G4Q A;  4LZZ A;  1HR0 M;  2BNK A;  3M6A A;  3DOA A;  4QOS A;  3U5Z A;  4MGY E;  4M9Z A;  3D8B A;  3U61 B;  4HLQ A;  2C99 A;  3LMM A;  5EXS A;  4YHH M;  4NL4 H;  4DR7 M;  3SHF A;  5KPT A;  4FWH A;  3U6S A;  3FUV A;  4LJ5 A;  1W5T A;  2I7P A;  1OFI A;  2Y0T A;  4G6Z A;  4R3D A;  2X49 A;  3RGS A;  2K47 A;  2XFT A;  1XXH B;  4R7G A;  1JR3 A;  3KOX E;  4MM3 B;  1HQC A;  4FWD A;  3RE8 A;  1KFV A;  1TDH A;  4JYA M;  1UM8 A;  2RKO A;  4TUW A;  2KRU A;  4GH9 A;  3U5Z B;  1L2C A;  4LF5 M;  3SC3 A;  4GKK M;  5E6J A;  5ITX A;  1IM2 A;  4X65 M;  4FCV A;  4FD2 A;  1QAQ A;  3CF0 A;  1VDD A;  2QZ4 A;  3GLG A;  4GIP A;  3EIH A;  5LMN M;  3GPY A;  4GC5 A;  4JI8 M;  4L4U A;  2AHM A;  4LRS A;  2EO2 A;  4PDI A;  4IBC A;  3IG5 A;  4LZJ A;  4X62 M;  1R2Z A;  3OTO M;  2HL7 A;  2F5P A;  4KOD A;  1IN7 A;  3H4M A;  1R7R A;  3NBI A;  1DGF A;  2W82 A;  4NXM M;  4LGM A;  1N33 M;  2D7H A;  3FUX A;  3GRY A;  3GPX A;  4AKI A;  1E32 A;  5E26 A;  4FCW A;  4WW0 A;  4GHA A;  2Y21 A;  4X66 M;  3TWK A;  2E5L M;  2EA0 A;  5EP4 A;  3GLG B;  4LJA A;  3HJS A;  2ZAO A;  2BJV A;  1SXJ A;  4IBD A;  2X8A A;  1PJJ A;  1MU5 A;  3DZD A;  4B3R M;  3JR5 A;  3CTW B;  5A2Q S;  4I4L A;  2QP9 X;  2J7O A;  2CEA A;  1J7K A;  1XC8 A;  4M9X A;  1HT1 E;  4LGY A;  2CHQ A;  3AOG A;  3VKH A;  4OVZ A;  4W5W A;  1NJG A;  3HHW A;  4ZPX A;  3FKE A;  4EIW A;  3SBJ A;  1K82 A;  2ZM6 M;  2XZU A;  4D81 A;  5FTK A;  1IY1 A;  1GKI A;  1IN6 A;  4AG6 A;  2VQE M;  3SAU A;  3FUT A;  3E4R A;  3KP1 E;  3KS4 A;  4IBJ A;  1NSF A;  3K2L A;  1GL6 A;  4PT5 A;  5EP3 A;  5ITY A;  4X64 M;  1SXJ B;  3VFD A;  1TH3 A;  4RNA A;  1GVN A;  3GRR A;  2RGO A;  2OQ4 A;  2HKJ A;  2UUB M;  3K8Z A;  1L2D A;  4LFB M;  4REZ A;  4IBE A;  1Z5A A;  4IBG A;  3SAV A;  3HWS A;  1K3W A;  4FCT A;  3W0F A;  4JXJ A;  3T1H M;  1XNR M;  3GPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...