2OPPA

Crystal structure of hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
542
structure length
518
Chain Sequence
b'PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 136
structure length 518
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2oppA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oppA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oppA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oppA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2oppA05
3HSTB 3Q8RB 2Z1IA 1ZETA 4EP5A 2IGIA 3K58A 3QLHA 1SH2A 1TGOA 2QV6A 4KB7A 4Z4HA 3LWLA 4NZ0A 3V1QA 1C0MA 5KFRA 1EP4B 3SFUA 2G8UA 1R0AB 4B9MA 3MXIA 3KD1E 2RPIA 4DEZA 2GBZA 4F8RA 1KLMA 1LAVA 3ITHA 3RMAA 1JLAB 2NUBA 4BWMA 4F4XA 4DLEA 5HLFB 4KFBB 4KKOA 1MU2A 1K1SA 3AVHA 4F3OA 4E0DA 3OS0A 3U3YA 2FBTA 3DMJB 1RT4A 4URSA 4IOBA 1S9EB 1SL1A 4CJPA 1SKRA 4NLGA 1FKOA 3KKRA 2JC0A 3HYFA 3FSIA 4CESA 3VQQA 4Y2AA 1ZBUA 2G8FA 4TSXA 4QWAA 4YFUA 3KHGA 4HYKA 1LAWA 3AA3A 1D1UA 4JV1A 3KHRA 4CHPA 4Z4FA 2ZQBA 4AHUA 1X9MA 3QIOA 1Y97A 3HO1A 2R8KA 3C6TA 2AX1A 1KFDA 3DRPB 3ZT4A 2FBXA 4MKBA 4K4XA 3MR2A 3LP2A 4O0IA 4CCHA 3DRRB 4ZPDA 1D5AA 4AH9A 4CIEA 4J2EA 4EP4A 3L3VA 4RNMA 1NK0A 2EX3A 4OVLA 3V9XA 1D0EA 4CJFA 1EP4A 1R0AA 2VWJA 3SZ2A 3OYCA 4ECUA 3BGRB 3RWUA 1HMVA 4ZP9A 1TV6B 3SQ2A 2IMWP 1NK6A 1Q8IA 3QEVA 3F73A 4RW9B 2E9TA 4J2AA 3SQ4A 5HLFA 3KLIB 1J9AA 1WNSA 3TI0A 3O3GA 4Q5VA 3Q8PB 4DS5A 3DMJA 1RT6B 5DG8A 3QO9B 4RNFA 4CHOA 4JV2A 3C95A 2XGPA 3GYNA 3ISNC 4MFBA 3O4QA 3MFHA 3NGIA 2HNZB 4DFPA 3RRGA 4EBEA 3OS2A 5DLFA 4KSEB 1ASWA 1XHZA 3DYAB 4LD0A 3QZ8A 1SKWA 3CO9A 2HB5A 2HHWA 1JLEB 4DSIA 2R7YA 3TARA 4ECSA 2VWKA 1TQLA 3DRPA 2ITGA 1KVCA 4Y1CA 1IG9A 2FJVA 3M8QB 4CF8A 1C2PA 1HARA 4DSLA 3DRRA 2YNHB 2BRLA 1RA6A 3ZT3A 4DSJA 4KTQA 4RNHA 4OJRA 4FYDA 5EUHA 5CYQB 4H8KA 4IH7A 3AA5X 1QE1A 4HKQA 3LP1A 5JXSA 2VG6A 3QZ7A 4TY8B 5K14B 2E4LA 3DOLA 1U4BA 3BGRA 3C6UB 4M42A 4OGEA 3MF5A 1VSFA 3VQ4A 1TV6A 3IG1B 2IBKA 1IKYB 4ECXA 1XR5A 1U49A 3SQ1A 4IFYB 2VG5B 4K8ZA 3CFOA 3KLIA 1UAXA 1BGXT 1IH7A 1QSYA 1T7PA 2YNGB 4AHRA 2B6AB 4X2BA 2ETJA 4HUFA 4NCGB 2OPSB 1TK8A 3QO9A 3ZSZA 2BDPA 4IDKA 4CJRA 1RBTA 4FK2A 4NLOA 4LSNB 4O5BA 4CK1A 1UWBB 4K4ZA 5F8JA 5KFHA 4BWJA 3KK1A 4HVJA 3QINA 4FVMA 4BDPA 4GC7A 4KHNA 1JLEA 3VQEA 5I3UB 1LW2B 3QIPA 4WXWA 3M9NB 3GV5B 3AVKA 1HPZA 4FM0A 4QW9A 2C2DA 3I8DA 4KB0A 5L1JA 2YNHA 4E7IA 3I5BA 2BANB 3DLKB 3VN5A 4B8CA 2JC1A 4RW8B 4ZPCA 1N5YB 3MEEA 2PYLA 1HYVA 3H5SA 4Y3CA 1VSEA 4IRCA 3QYYA 3T5KA 5KGWA 4ID1A 4TY8A 5K14A 1XC9A 3C6UA 3RAQA 3RMBA 1OS5A 1VRUA 4NYZA 5F8HA 1BI4B 4KHYA 3CJ3A 5KFGA 2XWYA 4HCCA 4J9KA 2XY5A 5L1KA 1WAJA 2YNGA 4FJMA 3RAXA 2B6AA 2AU0A 2KW4A 3H59A 4ECWA 2OPSA 4PY5A 4AHSA 3NAHA 1MMLA 4LSNA 4ZVFA 3HKWA 4E19A 3IRXB 4DL2A 4ZVEA 4E1NA 2V4RA 3NHGA 5KT5A 3WNEA 2YNIA 4IH5A 3ZSOA 4CGJA 4MH8A 4JS4A 3MXMA 3OYHA 3CYMA 1JLCB 3OJUA 3TANA 1DLOA 5T7BA 5I3UA 1RT1B 1TKZA 2XGQA 4DFMA 4Q8EA 4ELUA 1IKWA 1RTIB 3KIOA 1RT7A 4NLRA 4FJKA 5C25B 2BANA 2KFZA 4DL4A 3DLKA 1S0MA 2P1JA 1GX6A 3L2UA 4RW8A 3LZIA 4CK2A 5KG0A 5KFOA 1CZBA 1TKTA 4XPCA 1C0TB 2D3ZA 3KLEB 3OYDA 3KLHB 3NDKA 3CWJA 1NHVA 3AVNA 3VA3A 2BRKA 2AWZA 4K4TA 3I5CA 1JXLA 1D9DA 4LH5A 4RW6B 4CEQA 5DG7A 1LWEB 3NF9A 5KGXA 1UOCA 3NH0A 5F8LA 2IC3B 2W8LA 3NE6A 1S1UB 4J2DA 1N48A 3AO5A 4CFAA 1BCMA 3WNHA 4FLZA 2HNDB 3SYZA 4TLRA 3DM2A 1RBRA 4H4MB 4JV0A 3A2FA 3IRXA 4DL3A 3K59A 4ELVA 3ZCMA 4JRQA 1SV5B 4CEFA 1JLCA 5KFVA 1RBUA 4WXOA 2XRIA 2RF2A 3UR0A 2FLNA 2HVIA 1A5WA 4M95A 3PX6A 1NJYA 3PW4A 1TVRB 1TK0A 4F4KA 1YT3A 4HHTA 3E01A 2GIQA 3VQPA 3L2RA 4B9LA 2BE2B 2BQRA 4NCBA 4FM2A 2FVRA 4O3SA 1SL0A 1TL1B 4O55A 3JSMB 3KKSA 1XHXA 1I6JA 4WFXA 1C0TA 5FRMA 5DK5A 4XIUA 2WOMB 2FVQA 2R2RA 4U7CA 3HP6A 1RBVA 3TWHA 4FCYA 4O3PA 3LP0B 5EWGA 3RR7A 4CEOA 1JL2A 3L3UA 5F9LA 1N56A 1W0HA 5KT3A 4EBCA 4ECZA 1LWEA 4ZP8A 4M3UA 2W9CA 2J6TA 4TYAA 4FS1A 2XY7A 4FJ9A 1T03B 3IGNA 1U09A 3NF6A 2KZZA 3PX4A 3DI6B 3EZ5A 3DLRA 4AILC 4OKEA 1S9FA 4CEBA 3OYAA 1YVFA 1KLNA 3T5JA 2Z1HA 3UQSA 1HQUB 3H08A 1SV5A 5KFLA 4F4ZA 3NKYA 4KBIA 5F9NA 4QWEA 3SQ0A 4I9LA 2CJQA 2D0CA 1S6QA 3TAQA 1TVRA 2OA8A 3BQ2A 3QEPA 3TAFA 1GX5A 3M9MB 1QS4A 4CK3A 3SV4A 2BE2A 1CSJA 3KK3B 3RB4A 5HBMA 5F8NA 2DFFA 3HT3A 3JSMA 4WE1B 1RTJB 3I5AA 2YNFB 4K4UA 1IO2A 4B3OA 2B5JB 4TQRA 4KE5A 2WOMA 2UVWA 4NLYA 3QETA 3ASMA 1C1BB 3BR9A 4ZPBA 4EBDA 1RDAA 3VQ5A 1IM4A 4KHQA 3T5LA 1QTMA 4R5PA 3BQ1A 3VQAA 5D3GB 5KFDA 2YKNB 3NGZA 4ECVA 2F96A 3V9ZA 4QWCA 3SUQA 4RU9A 4DL5A 4M94A 5KG4A 4WZMA 4W5RA 3S3OA 2V0NA 3T19A 5CYMB 4M3TA 3K2PA 2J6SA 3EYZA 3DI6A 2KFNA 3PY8A 3KMSA 4WZQA 4K4YA 2IS3A 3HVRA 1ZYQA 4BE0A 4W5QA 4DQQA 3PR4A 1VSDA 3B6OA 3IAYA 4C8NA 3C94A 3PHEA 4R8UA 2LSNA 1HQUA 4NLWA 3P5JA 4NCAA 5FRNA 3OYEA 5KT2A 3NCIA 2OYQA 2OZSA 2JEFA 3LALA 5J2PA 1DTTB 3RBEA 3OYGA 5KG5A 1TKDA 5HROA 3ULDA 4FW2A 5CZ1A 3LPTA 4DTSA 4IR1A 4MK9A 3LAKA 3AVIA 3MXJA 1NKBA 1TKXB 2A1RA 1RTJA 4CJ4A 2YNFA 3MECA 4IQXA 1HJRA 1S9GB 2B5JA 3M8SA 2HHSA 3LDSA 1BQMA 4YR2A 2GV9A 4EEYA 2WTFA 1VSIA 5KFYA 2ASLA 4I2QB 4FJJA 3CJ4A 3CJ0A 4JS5A 4KREA 3OYMA 3RRHA 2G8HA 4I2PA 4Q0BB 2YKNA 4NLVA 4F50A 1HYSB 1WAFA 2W9BB 4ECTA 3G86A 2IOCA 4O4GB 3D0PA 3MEGB 4FLXA 1B9FA 3QERA 5KG2A 4ZHRB 4CIGA 2C22A 1S1VB 3HK2A 4KAIA 4GW6A 2HAIA 4OGCA 2AGOA 3NF8A 3BSAA 2OPRB 2Y1IA 2R2TA 4FK4A 4Q8FA 3SNNA 1NK8A 2VG7B 2HWHA 3OL8A 4KTZA 3ZSWA 4CEDA 4KO0B 3V4IB 3AVFA 3RB6A 3QGIA 2JGUA 2BQUA 3D45A 5KG7A 4QW8A 3OYNA 1JIHA 5KT6A 1S1TB 1JLAA 4Z0UA 3HXMA 1NK4A 3DOKB 1WSEA 3PJXA 2XY8A 4KTWA 3SPYA 4OPKA 3FQKA 4B9UA 5HRPA 4N76A 4FJ8A 3UDLA 4KFBA 1FXXA 4DFKA 1F21A 4TXSA 4MKAA 1ZBIA 1RT3B 3LPUA 3KHLA 2R8JA 3KD5E 3K5LA 2G8KA 4IFVB 2D3UA 1S9EA 4MIBA 4HTUA 2OPQB 4DSFA 4IRKA 4DTRA 4ELTA 3V6JA 5L1IA 3HM9A 2E9RX 4QAGA 3CM6A 4NLPA 3BSCA 4I2QA 4N5SA 2IM2A 2C2RA 1JLBB 3AO4A 4CF2A 3M8RA 2F8SA 4TN2A 2G8WA 3TVKA 3KTQA 4ED2A 1HYSA 2W9BA 1L3SA 4FLTA 5L1LA 1N6QB 3OY9A 2GC8A 3MEGA 3KK2B 2UUWA 4ZHRA 1S1VA 3H4DA 5C5JA 3L8BA 4IG3B 1NNDA 4CHYA 4ICLB 4Y34A 4TYBA 4C8LA 1S0NA 1BL3A 4KHUA 3S9HA 4RW7B 2R8IA 3AO1A 4OKJA 4YR0A 4WYWA 1YTUA 2WONB 3CJ2A 5JS1A 2IA6A 1KFSA 1S1TA 2JLEA 1RDDA 3TAPA 4OLAA 3GIIA 4DS4A 4C8MA 1KTQA 2J6UA 4HCBA 2XY6A 2G8VA 4RW9A 4IR9A 4PUOB 4CEEA 3PUFA 5I42B 4FLYA 3TQ1A 1BISA 3SUPA 3NH2A 1JX4A 4CEAA 3OVNA 2I5JB 1RTDB 1RT6A 1RDBA 1QHTA 3H40A 1S4FA 3B6PA 1LWCB 3CDUA 2FLLA 3HPGA 2HNZA 2YKMB 5KT7A 2W42A 3G0ZA 2OPPB 3NAIA 3DLGB 3DYAA 3QGHA 5KG6A 1NJZA 4KI4A 4DL6A 3JYTB 3KHHA 3NFAA 2AQ4A 2E9ZA 2IJNA 4TQSA 3H98A 4ID5B 3AVCA 2D0AA 1CXUA 2YV0X 5DQGA 3M8QA 3V9SA 4K4SA 3KJVB 3PZPA 3FRZA 2ILYA 2O5DA 5KI6A 5C24B 5C42B 2RDIA 3UPFA 5CYQA 4GC6A 3DRSB 3AA2A 1JLFB 3DLBA 1KVBA 4NLXA 1RBSA 4DSKA 2HWIA 2XI2A 3DLHA 3RMDA 4CGDA 4FJIA 2QXFA 2B43A 2WONA 1HYZA 3MFIA 1X1PA 3OYKA 4LQ9A 2DFHA 4QWDA 4NLDA 3IG1A 4XPEA 1IKYA 4PQUB 3HJFA 2DTUA 1VSLA 4E3SA 4CEZA 3HVTB 2VG5A 4IFYA 2P5OA 5FDLB 5I42A 1I39A 4Q43A 4W5TA 1DTQB 2I5JA 1BIZA 3OSNA 3OLBA 4G1QB 4NCGA 2AGQA 2R2SA 4OKKA 4FJLA 4IKFA 3T3FA 2PZSA 1LWCA 4CE9A 1VRTB 1I3AA 5KFJA 5KFMA 4M3WA 2YKMA 4BE2A 1UWBA 1JLGB 2GUIA 1NJWA 1Q9YA 2OZMA 4ED6A 3PO4A 3DLGA 1RA7A 3OHAA 3JYTA 1C0UB 1ZTWA 3ZT2A 3OYLA 3M8PB 4IRDA 4UQGA 5CY4A 4JLHA 4PWDB 2KQ2A 1LW2A 2OH2A 2EHGA 4FZYA 2QE5A 2HHVA 3VA0A 4K8XA 4URQU 4QWBA 4ED3A 2W8KA 1B9DA 2X6SA 3KJVA 3OYJA 3LANA 5J2QB 1RAJA 4ZMMA 4DF8A 4DU3A 1K1QA 4K4WA 2Q3SA 5C24A 5C42A 3V81B 1EX4A 3NAEA 1N5YA 4E7JA 5KG1A 3KMQA 4Z4EA 4RUAA 2RN2A 3V9WA 2UVRA 2HHUA 1EETB 4IG0B 4ECYA 4B9NA 3SUNA 1ITGA 1EKEA 4RNNA 1EXQA 3SPZA 4KPYA 4CHNA 3MR3A 4PQUA 4CJVA 1BI4A 1JL1A 3TAMB 3PW2A 2C28A 4KV8B 1RYSA 4RNOA 3CG7A 5FDLA 5KFSA 1Z26A 1JKHB 3P83D 3CVKA 1T8EA 1KRPA 2XI3A 3OYIA 3KNAA 4NYFA 4J9OA 3KOAA 4CJSA 4CJWA 3S3NA 3O3HA 4B9SA 1HNIB 3SFGA 1VSHA 2CKWA 2Y1JA 3ZSRA 5CZ2A 3HPOA 4U6PA 1JLGA 5J1EB 5KFIA 3K5OA 2R8HA 3QGGA 3E51A 2C2EA 1C0UA 3L2VA 4FLWA 3KLVA 5DLGA 4DQIA 4PWDA 1SKSA 1RT1A 2IJFA 4WFZA 3H5XA 1RTIA 1RDRA 4QCLA 3WNGA 5C25A 2I1RA 2HMIB 4F2RA 3KLFB 5DMRA 1FKPB 3V81A 2FVPA 4H4OB 4LY7A 5F8MA 2V4QA 1BIUA 4EO6A 1Q9XA 3KLEA 3GQCA 1KCFA 3KLHA 1KVAA 4CECA 1EETA 3EPGA 4MK8A 3NMAA 3OL6A 3T5HA 4ZP6A 3HP9A 3OYFA 4NLSA 4EYHB 3G6XA 4MIAA 1UA1A 4OPJA 4RW6A 3V1RA 1HQEB 3N6LA 3QEWA 4KV8A 3Q8SB 3VQ9A 4LSLB 4N56A 2XC9A 4DTUA 5JS2A 1JKHA 4CGFA 2IC3A 1GOBA 1S1UA 4ZVHA 1S0OA 3NGYA 4FM1A 3ZT0A 4C8OA 2IDOA 5KFQA 3RMCA 2HNDA 2R8GA 2HNYB 1HNIA 4ECQA 3CFPA 3I0SB 4ED1A 1JXBA 4DTOA 3ZT1A 4H4MA 5KFTA 4KHMA 4RG8A 3GILA 3K5NA 3MR6A 1A5XA 1RT5B 2V9WA 4FJXA 3PJWA 4E7KA 1A5VA 1QSLA 1ZBLA 1HRHA 5KG3A 2AX0A 3GIKA 2ALZA 1S49A 3VQBA 4PA1A 3QLHB 2BQ3A 3OL9A 2ZE2B 5KFZA 4BACA 1G15A 3OSPA 3HPHA 4FJ7A 2Z1JA 2E6LA 4HUGA 3KLFA 5DG9A 1WSGA 1TL1A 4DQRA 4H4OA 3BREA 3N6NA 1XWLA 4DU1A 1YTAA 5FROA 3QEXA 3ALYA 2FJWA 5KFAA 3NF7A 1KSPA 3CM5A 2WRMA 1L5UA 3ITHB 2UVVA 1SH3A 3OYBA 4CFDA 4CERA 1J53A 2BR0A 4NLQA 3LP0A 1MU2B 4GMJB 1HQEA 3KLGB 3SUOA 1RT4B 2XCAA 4DG1B 2VA3A 5SZTA 1VSKA 3MTKA 3NL0A 4ED8A 5KTQA 1X9SA 4O3RA 1T03A 3PX0A 4DTJA 2QK9A 3VQ6A 5HP1B 4K50A 5L9XA 3I0SA 3ZSQA 4CJLA 3QNOA 3IGVA 3MAQA 1NKEA 3G10A 3K57A 3C6TB 1RT5A 2YHBA 2FVSA 3EY1A 1HNVB 4O4RA 1T05B 5KFCA 5KFKA 4Q45A 5T14A 3LP2B 5J2NB 2RDJA 3BSNA 4CF1A 3O4NA 1TK5A 3L2QA 4QPXA 4KRFA 2ZE2A 4C8KA 4FW1A 1WNEA 2PY5A 1WSJA 1Z25A 3KK3A 3OS1A 4MQ3A 4CJ3A 3PO5A 2FBYA 4WE1A 1BCOA 4B08A 1RDCA 3HVAA 4YNQA 1U47A 2G8IA 1S1WB 4KHRA 1HMVB 3HL8A 2HW3A 4Z4CA 4IBNA 1C1BA 4CFBA 3MR5A 3CDWA 2FC0A 3CJ5A 1L3UA 4J9SA 1QQCA 4O0JA 3ZSXA 4DL7A 3ICLA 1S1XB 3KLGA 5D3GA 1QSSA 3TR8A 4LH4A 4DSEA 2DY4A 4ZPAA 4DG1A 4FJNA 5CYMA 3N6MA 4MFBB 4FLVA 5HP1A 1IKVB 1U45A 4YP3A 4KHSA 1U48A 5E41A 4DQPA 4RW4B 1QAIA 1WLJA 3V6HA 1U04A 1HNVA 4Z4GA 1C1CB 1T05A 1ZBFA 1RNHA 3GV8B 4F3TA 5J2NA 1DTTA 4CFCA 2UUTA 3PW7A 4KB1A 1IKXB 2HHQA 4YR3A 5J2MB 2X78A 2JEIA 1QE1B 2RKIB 5KFBA 3ISND 1L3TA 3P1GA 4OLBA 3LAMA 3LP1B 1NJXA 3TAEA 2VG6B 1TKXA 3K5MA 4FJHA 1L3VA 3GIJA 3ZSVA 3DOLB 1S1WA 1S9GA 4J9RA 4M3ZA 4EZ6A 4DWIA 2O4GA 4H54A 3U3GA 4XO0A 3UIQA 3T1AA 5F8IA 1S1XA 3CFRA 5KRTA 1RILA 4N41A 4Q0BA 2XO7A 2A1SA 1K6YA 3VQ7A 2F8TA 3H4BA 4Y2CA 4IDKB 1S48A 1YVUA 4M41A 4O4GA 3AVLA 4URGA 5HRSA 4Y1DA 1IKVA 2VA2A 3RB0A 1Z4UA 4J9PA 3KK1B 2Z1GA 2OPRA 4CHQA 4RW4A 3GIMA 1D8YA 4CGGA 2VG7A 4RUCA 3PVXA 3QIPB 4KO0A 3V4IA 3O3FA 1HPZB 1C1CA 4CGIA 3D28A 2QKBA 3WNFA 2W9AA 2AGPA 4AHTA 3V1OA 4CJKA 4F2SA 4ZVGA 4DTMA 3F9KA 1VSMA 1IKXA 4R0EA 2IAJB 3DLEB 3DOKA 2W7OA 4CGHA 5J2MA 3L2WA 2W7PA 3MEEB 3V6KA 2RKIA 1XI1A 4B8AB 1RT3A 1CZ9A 1KHWA 4E89A 4IFVA 3LWMA 2OPQA 4CHZA 3QNNA 4NYNA 1WN7A 3QEIA 1S5JA 1VRUB 1D9FA 2JEGA 4J2BA 4CJEA 5EWEA 4WYLA 2GIRA 4KI6A 4E1MA 3FQLA 4TY9A 2ASJA 1JLBA 4DFJA 4FJ5A 4JUZA 1XR6A 4F4YA 3EZUA 4LQ3A 4L8RB 4FXDA 3VQCA 1J5OB 1N6QA 4I7FB 1NK9A 2WCXA 1B92A 2IM1A 3KK2A 3EPIA 5KFNA 1TAUA 2YNIB 4IG3A 1REVB 2ILZA 4ICLA 4N47A 1CXQA 1SH0A 4ZP7A 3RR8A 1DLOB 5KFUA 5KFXA 4NLTA 1W9HA 2E6MA 1S6PB 4RW7A 1TKZB 1WSHA 3CQ8A 2D5RA 3NH1A 1IKWB 1RT7B 1RTHB 1VK0A 3RB3A 4FBUA 4FZXC 2IAJA 5KFPA 4YQWA 4E7HA 3DLEA 3PW5A 3H5UA 2QKKA 3BDPA 4CJUA 1TKTB 5DQHA 4PUOA 1O1WA 4ED0A 1ZTTA 1ASUA 4B9VA 1RTDA 1ASVA 3NBPB 2FJXA 1NHUA 2DPIA 2ZD1B 4YMEA 1ZBHA 2OPPA 5DQIA 3SV3A 3HVWA 3V6DB 4CJQA 4NLUA 4CF0A 5KFWA 4ZTJA 3VQDA 3OLAA 4EO8A 1J5OA 4OL8A 5KFEA 5JUMA 4I7FA 2DFEA 3DM2B 4ID5A 3BSOA 4ECRA 3AVAA 2PYJA 4O3QA 4HUEA 2P51A 1SL2A 2FVCA 5SWMA 3RTVA 1NKCA 4IH6A 4IKAA 3H2LA 1REVA 4DF4A 2BGGA 4M3RA 3D5MA 2UVUA 1C1AA 4BDYA 2JEJA 1RT2B 2RF2B 1S6PA 3DRSA 1JLFA 5HRRA 5DGBA 1XR7A 4WFYA 3E01B 3I0RB 3SCXA 3AVMA 4BDZA 1RTHA 4FS2A 1S10A 5KT4A 1FK9B 2R2UA 1WSFA 2O4IA 3HVTA 1KHVA 1S97A 1W25A 4FZZA 3U6FA 3H5YA 1DTQA 4CIFA 1LWFB 4B9TA 1GOAA 2ATQA 4G3IA 4G1QA 4W5NA 2P5GA 3NBPA 3AVJA 1TP7A 4CJTA 1LV5A 4ZTFA 3FFIB 1VRTA 3OHBA 3SI8A 4M45A 4GVMA 3HHKA 3AV9A 2ZD1A 3NGDA 2W9CB 2FLPA 4E7LA 5DGAA 3V6DA 3LP3A 1T94A 1LW0B 3M8PA 2YHAA 3PW0A 1J54A 3BJYA 3SI6A 3FDSA 4O3OA 3G6YA 1JLQB 2WHOA 4EZ9A 1RYRA 1NOZA 1JXEA 4DMNA 3AVBA 5J2QA 2D41A 4DTPA 3CDEA 4DQSA 3MEDB 1RT2A 4MK7A 4F4WA 1S6QB 1N4LA 2ATLA 4J9MA 4DLGA 2HVHA 3I0RA 1NOYA 4IG0A 3PR5B 1RCHA 3IN5A 2D7SA 2KTQA 5HBMB 4CF9A 3AA4A 3IS9B 1FK9A 1SUQB 4DTXA 3OJSA 3TAMA 4RZRA 5KRSA 4B3OB 3AO3A 1UA0A 4J9QA 3TABA 1GOCA 4QOZB 1TL3B 1LWFA 2WK4A 2D0BA 2HHXA 1QAJA 3FFIA 4M3XA 4O44B 2XCPA 4AHCA 2KZMA 4FJGA 1BQNB 2ZKUA 3AO2A 2IM3A 4R5PB 2IM0A 4J9LA 2X74A 4KAZA 4O3NA 2B4JA 5J1EA 3CIZA 3VQSA 1LW0A 4FBTA 2HHTA 4FK0A 2X6NA 5HRNA 4I9QA 1JLQA 3Q8QB 4ED7A 4KHWA 3GV7B 1BHLA 1TAQA 1CLQA 2ASDA 2FBVA 4R8UB 5EU7A 3ZSYA 2HMIA 1NK5A 1VSJA 3PV8A 1FKPA 1QUVA 3MEDA 1NK7A 4DTNA 3LZJA 5J2PB 4AHVA 4NRTA 3VQ8A 4CJ5A 5HROB 4NRUA 1KLMB 3QIDA 3SJJA 3RBDA 5F8GA 1X9WA 4Q44A 3AVGA 3THVA 4J9NA 1WSIA 3G6VA 2EC0A 4KKOB 5EDWA 3IS9A 1SUQA 2WB4A 1T3NA 3BQ0A 3TAGA 3MECB 4LSLA 4BE1A 4W5OA 3S3MA 4Z4IA 1TL3A 1FKOB 1BQMB 3M9OB 2DPJA 5EWFA 3OL7A 3QESA 4K4VA 4EYIB 2F8EX 2HNYA 4O44A 1BQNA 4FLUA 4I2PB 3V9UA 4DU4A 2XHBA 4JRPA 1C6VA 5KFFA 3DDKA 2AJQA 4M3YA
chains in the Genus database with same CATH superfamily
3HSTB 1UMJA 2MKIA 1RJJA 2ZH4A 2GQ2A 3MURP 1O6XA 2COLA 3SCLE 3QLHA 5E3CA 3AB2B 3O9RA 1U0SA 2CQGA 1J5EJ 2HRYA 2QV6A 3QBXA 3R97A 2VDHA 3I56S 2H5JB 5HMWA 3MWBA 3V1QA 1GK8A 1R0AB 2R4FA 2GCFA 2FC9A 4IOAL 2CZVC 1KLMA 2ZVSA 2NUBA 3OT9A 1ZAWA 4WBFA 4ES1A 1MU2A 3AVHA 4Z7YA 3W3SA 5M1PA 2B8PA 4MLEA 4FPAA 3DMJB 1RT4A 1S9EB 1VQPN 1WTBA 3CD0A 3FZBA 3MOZA 4QR2A 3DNCA 4NLGA 3AGRA 4PKIA 3KWMA 3C3LA 4CESA 4Y2AA 1ZBUA 4YFUA 1EAYC 2ZBIA 1DZ5A 1LAWA 1X7VA 1LKZA 1D1UA 3KHRA 4Z4FA 1MROA 2BJEA 3DLJA 1OMSA 4C0BA 2FBXA 1BWVA 2KJVA 2Q1LA 4ZJLA 3MR2A 4X4VA 3LP2A 4O0IA 3DRRB 2DGOA 1YAGA 2BJ1A 4OX6A 2E5GA 1U1KA 1NK0A 4OI1A 3V9XA 3ZNUA 3IC1A 4BVOA 3IP0A 3IXQA 1UTAA 3H3OB 1R0AA 3QRRA 3PEJA 1SXLA 3EEQA 3U27A 3SZ2A 2FJDB 2RH3A 3GE9A 5DM7L 4ECUA 2P9CA 1HMVA 4ZP9A 3RG6A 3O3LA 3QEVA 1HWKA 3MM5A 3F73A 1Q7LB 2CAJA 4HEA9 5F1XA 3KDNA 1YBTA 2EWSA 2CPZA 3O3GA 5B0EA 2HLTA 5I3QA 1HL6A 3DMJA 4CYUA 3F56A 3CQXA 4DV3F 4OFZA 2HHHK 4JV2A 4AQYJ 5AE3A 4FPRA 4WFNL 3O4QA 3NGIA 3RRKA 3CMAS 2BBEA 4EBEA 3OS2A 1M5HA 1VQKN 3DYAB 2OIHA 5FIIA 3QZ8A 1SJFA 1NPKA 1JLEB 3T9ZA 4DSIA 3G8TA 1IBKJ 4M63A 4UZBA 2ITGA 3ETMA 1IG9A 1NDCA 4Z37A 3OVAA 2WVBA 3TYTA 3DRRA 2YNHB 2BRLA 1UFWA 4USIA 4DSJA 1P8ZA 3R8EA 3CPWR 4HH1A 4JI1F 3MD3A 5EUHA 3OHRA 2J9DA 4JK9A 4H5TA 3GYGA 2OANA 3AA5X 1DJ0A 1HQ2A 3LP1A 4YB6A 3K0SA 2YX1A 2VHGA 3DOLA 1RHJB 3C6UB 4M42A 4OGEA 3MMCB 2IBKA 4K42A 5KQ8A 3QJPA 4K8ZA 1IH7A 1QSYA 3FR0A 4AHRA 1T9UA 1RGVA 2OPSB 4DR6K 2L08A 5GAGI 4B3MK 1Y9OA 1ILYA 4FK2A 4NLOA 1UWBB 2J0QD 4K4ZA 2J0XA 3JTOA 3SSRA 3KK1A 3VV2B 4XTTA 4GC7A 1AW0A 4WP8A 2ALYB 1JLEA 1LW2B 3QIPA 1JWWA 3H1VX 3H2UB 4EUVA 3ADAC 5A2QU 3P8BB 2YNHA 4E7IA 2BANB 3DLKB 2Q6CA 1WG4A 1QZ5A 1DBDA 4RW8B 1O51A 2XEXA 4ZPCA 4LF4J 3PG9A 3NNAA 1SIWB 3V4MA 1VSEA 2QWQA 5KGWA 4ID1A 4HDGA 1MWMA 1XC9A 2LEAA 4LRAA 4NMXA 3C6UA 1WUUA 3RAQA 3MMCA 1VRUA 3ZX2A 5F8HA 1GMWD 3CJ3A 5L1KA 3TZZA 1T9VA 3GZ7A 4NXNF 2V67A 4FJMA 2IHR1 4USTA 3RAXA 2AU0A 2KW4A 3OXGA 3H59A 5L38A 2ZH6A 2OPSA 4AHSA 2KKZA 2E1AA 3B78A 3NAHA 2BKNA 2EBGA 3ZC4A 2ZOFA 1B3TA 4JI8J 3O5BA 3HKWA 3AD7C 2V8PA 1IQTA 4UOHA 3NHGA 2O8FB 4CGJA 3C7NB 2IVNA 1CBKA 1XK8A 4PKDB 3I31A 5I3PA 3VAHA 4CJ7A 3J80U 4Q8EA 5CE3A 1RT7A 4NLRA 3BDEA 2BANA 3DLKA 3HOSA 3L2UA 2GO8A 4RW8A 1BWFO 3I9V9 2MXYA 2FTRA 4GKKF 4YY3J 2UXBF 1CZBA 3D7EO 1TKTA 4XPCA 3EL2A 2NZTA 3ATVA 3CWJA 3CULA 1NHVA 3ATUA 3W63A 2BRKA 5LMNJ 3NNCA 2AWZA 3TW0A 4K4TA 4GY2B 3D4JA 3FE1A 4RW6B 1N8RO 2JNJA 1XMQF 4CEQA 3O1BA 1LWEB 5KPTA 5KGXA 5F8LA 2KT2A 3NE6A 1QHAA 2X3GA 2EEYA 1N48A 4CFAA 3P31A 4MYUA 4ZVRB 2DH7A 4ZS6A 3RW6A 3SYZA 2VF3A 4X4TA 2LU2A 4I6AA 4JV0A 2JFKA 5KOWA 3ZCMA 4WK3A 4YEAA 2MB0B 1B99A 2CGKA 4HHUA 1RBUA 4WXOA 1XJWB 3OTOK 2FLNA 1A5WA 2YVSA 2A40A 3BBCA 3HFZB 2Q6BA 1NU4A 1HNWK 4H0OA 2Q0RA 7FD1A 3OR1A 2JL9A 4FM2A 3VAMA 1FTRA 4B17A 2P9IB 4RBTA 2UZAA 4DR5K 5T41A 2C2MB 3GBTA 1TL1B 4JI3F 3KKSA 4WFXA 4AL7A 4HACB 2WVDA 3NMUA 1FJGK 5M1KA 3D6FB 4A8QA 1H38A 4FSVA 1YJ7A 4O3PA 2HRUA 3QT5A 5HVGA 3ENVA 4CEOA 4DV6F 3L3UA 1VQOS 3CJ1A 4ECZA 1KAZA 3TTDA 1LWEA 4P7TA 1FNOA 1U09A 1FE4A 1WDTA 3PX4A 4BLGA 1WC3A 3EZ5A 3RUBL 3KKFA 2WW4A 2DHHA 3RSEB 1XMQJ 1KLNA 3NMRA 2NSCA 2Z1HA 2EI5A 2J7KA 1T95A 3HOTA 2U1AA 4HHHA 3AQOA 2EKNA 5GINA 2D0CA 5ELZA 1WG5A 3HD2A 3TAFA 2M3DA 2ZWPA 1NEEA 1CSJA 3KK3B 2P9IA 3RB4A 1MDUB 3I8BA 1VQ4S 5DM6L 4DHYA 5EHHA 5F8NA 4DPXA 2XMVA 3T9NA 4CW7B 1KOHA 1RDUA 4LF6K 1IJFB 1IO2A 4OHVA 4TQRA 3BF4A 2Y0BB 2F7TA 2XYPB 4DR3J 4NLYA 3JQMA 2KM8B 3ASMA 1YUWA 3AY0A 1C1BB 1B70B 2GMHA 3J8AA 2XMWA 2XMTA 4C48A 3QATA 1IXKA 3T5LA 1QTMA 1LOTB 5D3GB 4IXCA 5KFDA 2YKNB 4A4JA 3SUQA 5KG4A 3H90A 1GNKA 2V0NA 3T19A 4PG7A 2J6SA 1TMJA 2KFNA 2FF3B 4AL5A 4HT5A 3L4BC 2N3OA 2HHPA 3C6AA 3RSEA 4QIWD 4W5QA 4DQQA 3MM6B 2ZZMA 3TOQA 2LSNA 1FDDA 4OYAA 3P5JA 5FRNA 3AXKA 1X4AA 5DZ6A 4HTJA 2OZSA 1APSA 3B8HA 4JI2F 1DTTB 3OYGA 2RQCA 3CCQN 3ULDA 1DRZA 1PJ7A 1W2BR 4CTAB 2V2KA 3A5MC 2P9SA 1RWVB 2FB0A 2RVJA 1JJCB 2G4BA 4V19X 4CJ4A 3D2FA 4PXCA 3MECA 2Y9HA 5E3AA 1S9GB 4DZDA 2ZBCA 3L7UA 4GV3A 1BQMA 2GV9A 1PBUA 4EEYA 2XB2D 3VGVA 4IO1A 1RUSA 2ZBPA 3ENQA 4FJJA 1CVJA 3J7A1 5H9EJ 2YKNA 4NLVA 2E2NA 4H5VA 4OZJA 2W9BB 2AMCB 1ITPA 2JVOA 3FBCA 2IOCA 3VQTA 1RHKB 3K7RA 4V19J 2IMOA 4DX5A 4KAIA 4GW6A 2W4CA 5M1FA 2R2TA 1IN0A 1UW9A 1I1GA 1NDPA 3I4HX 4X64K 2RDDA 4WCEQ 2DGSA 2EK1A 2YQ1A 3W5ZA 2GQQA 3ZTRA 2BQUA 5KG7A 2Z56B 4OI6A 4IUFA 1GMWA 2UUAJ 4JI5F 1JIHA 1S1TB 1IBMF 3TTFA 4CTAA 3CCRN 2M4MA 1WSEA 5B0GA 3PJXA 3SPYA 3Q22A 4OPKA 2M0GB 4B9UA 4FJ8A 3ZZOA 4DFKA 1RB0A 3RW7A 2QMUB 3ILLA 1TL4A 3KHLA 2R8JA 2D1KA 4DV0J 2G8KA 3W5YA 2OCEA 1P9QC 1HPMA 2CXEA 4OI4A 4DN9A 2E9RX 3CD6N 3CM6A 4AM7A 2RNEA 2BOAA 1SCJB 2C2RA 5JLHA 3CMEN 1JLBB 3OUYA 1F6TA 3LTOA 4CF2A 5LMUJ 4TN2A 4PHTX 2W9BA 1L3SA 2DGTA 1ZM2A 4CLKA 1N6QB 4UW2A 1NGJA 1KN6A 3OW2R 4CI6A 2VQEK 3A3OB 1HI1A 2WW8A 1YBAA 1HKGA 1BL3A 3DN9A 5ETQA 1E4GT 4WK1A 1IBCB 4ZIWA 3AO1A 4OKJA 5JVHQ 5B08A 4YR0A 4QJVA 5HK4A 3E66A 1S1TA 2JLEA 1RDDA 3O5TB 1KTQA 4KGXB 4B1YB 4RW9A 5E3RA 3CCVN 4CEEA 2ZGYA 3PUFA 2RIJA 1VC6A 5I42B 1QQNA 4FLYA 3TQ1A 3NH2A 1JX4A 2E5LF 3R7BB 4K41A 4X4NA 1RT6A 1R6YA 1R8PA 3H40A 1H73A 4BQZA 4LF1A 3B6PA 3VF2A 4P2FA 1LWCB 3H46O 2AJ0A 1BD6A 1F2HA 2FLLA 4NYOA 1NSPA 1S4EA 2XMUA 1KXPA 3SMPA 5GIPA 5AQYA 2OPPB 1YHQN 1KBRA 3QGHA 5KG6A 4DL6A 1I94J 1YJVA 4A8YA 3NFAA 4ZCIA 2E1YA 2VDIA 4UY8T 1D3WA 1RAOA 5D0EA 3FSXA 1U2FA 3PZPA 3FRZA 1R43A 2JX2A 2O5DA 3TUIC 2OTJN 3IAS9 3GP9A 5CYQA 3DRSB 4JI0F 2YX6A 1ZM4A 2CA9A 1KVBA 4QR0A 1WI6A 4X65J 1HD0A 4FJIA 2QXFA 1HYZA 3ILOA 1HWJA 3MR7A 3VEOA 4QWDA 2CGLA 2QC3A 4NLDA 4XPEA 3UVJA 3HJFA 2HBJA 1FFGB 4A2BA 2RS8A 3HVTB 2VG5A 4IFYA 5I42A 2UXDJ 1Q81O 3OSNA 3MTJA 4G1QB 2F4VF 1HFEL 4FJLA 2PZSA 2DITA 1LWCA 2H65B 4CE9A 1I3AA 4DV3K 3C8YA 1Q9YA 3PO4A 5C15A 3W2VA 1RA7A 4QYZJ 2H3GX 5K9FA 1KQFB 2XO6A 2IA0A 2GHWA 2ZM6J 2O01C 1S7IA 4A48A 2E1CA 2OH2A 4WFAL 3M2VB 4K8XA 2W8KA 1OPZA 3SSQA 1NMEB 1RAJA 4DF8A 1FF2A 4DU3A 1K1QA 2AJ1A 5G4DA 3NAEA 4C3KA 4E7JA 2LDYA 2B4UA 1HBNB 4JI1K 3VGUA 1YI2N 2ZWOA 3SUNA 1FX4A 3CO0P 4GO5X 1EXQA 3FUYA 1GAOA 2CVEA 4CJVA 1LXNA 2FSJA 4JI0J 3JTNA 3LQVA 3NS5A 1JKHB 3P83D 3EN9A 3OYIA 1NWKA 1IG8A 3KNAA 4CJSA 3KOAA 4CJWA 1RBLA 1FCAA 1KONA 2Y1JA 2G2YA 5J1EB 1WDDA 1Y7PA 3K5OA 4F3MA 2Q43A 4A8WA 4M5DB 3IR5B 3BO2A 5J1PA 3L2VA 2K7JA 2F3JA 1ZA1B 1RT1A 1XEZA 1VQNS 2X3DA 3P45B 4J5OA 1WOQA 2W6KA 3M2VA 1RDRA 1S3XA 2XMAA 2DH9A 3PLAA 2Z30B 3M6XA 3QT7A 2KKHA 4LY7A 5F8MA 5IT9Y 5D78A 1R31A 3ZZRA 3DRXA 2DGWA 2MSTA 3N9UC 5EX0A 2YPZA 3EPGA 4KH1B 4USKA 4MK8A 3T5HA 5D4PA 2FHOB 2ZZTA 4C0OC 3AOBA 4P7VA 3QEWA 4JP8A 2QM1A 4DOZA 2DO0A 4CO0A 2MQMA 1JKHA 5HQLA 2IC3A 1S6UA 1S1UA 3HHNB 2KHOA 3RMCA 2KL8A 3ZTSA 2V52B 4F02A 4YDUC 4NXNK 3FNNA 2WFBA 2VBXA 4KHMA 1Q78A 3GJTB 4AT1B 4RG8A 1RAGB 3K5NA 3J7AP 3MUMP 4IOAQ 1RT5B 2XG8A 3KJQB 4YHHJ 4LJMA 2KG1A 3PSIA 3Q83A 5BPLA 3QWUA 2P9PB 4IDHA 4CLUA 3VQBA 3TR5A 3H20A 2RMLA 1VHIA 5K20B 2OEMA 5HN0A 1G15A 4JI4F 3MD1A 1GMVA 4FJ7A 1DAXA 1UJ5A 4UZCA 1SC1B 4HUGA 5D0GA 1MWQA 1FRJA 4C4WA 4DV2F 3QEXA 3T69A 4IFEA 5KFAA 3NF7A 4CO5A 2MGZB 3QBCA 2PDAA 2OHDA 2EG1A 3JS9A 3ITHB 4NO7A 2UXBK 4GKKK 4LF8F 2DPNA 1YRTA 4NLQA 3Q23A 2BR0A 2K2PA 3KLGB 1FHTA 2GX8A 1OSDA 2VA3A 5SZTA 2XZWA 5HVFA 5KTQA 1HW9A 2J7UA 3G2XA 1XMQK 4DTJA 3VQ6A 3GDQA 2HLUA 5AE2A 2NS1B 4DXLA 4Y28C 4MKYA 4ZPWR 5DM7Q 3C6TB 1RT5A 1HNVB 4OZ0A 3P4UB 2HBKA 4DX7A 1HR0F 5KFKA 5AQMA 5T14A 2P9PA 2RDJA 2HSEB 3OVSA 5AQWA 3MMBB 4B3RF 2B9XA 3CDBA 3OS1A 2QA2A 2HMPA 2W2PP 2CRLA 1QZ6A 3BF3A 3PO5A 5C10A 2FBYA 3CETA 3WC2A 3HVAA 4BRPA 1S1WB 2MGZA 2Q3PA 2UP1A 2QWMA 2WSEC 3BZCA 3KWGA 4JI3K 3CDWA 1YTYA 1L3UA 3FGUA 3VF4A 3TWZA 3SCKE 1SQKA 4O0JA 3ZSXA 3E9LA 4ANEA 3UDEA 3KLGA 3FSYA 3BPSP 4DU8A 1K47A 2F65A 1E6YA 2VKZG 3IMQJ 5EOYA 4DV6K 3N6MA 4MFBB 1YJ9N 4USWA 2QSFA 4FLVA 2VQFJ 1IKVB 1Z2ZA 1EQMA 2OTLS 4ISEA 3DJCA 3PIPL 1RHMB 2ROPA 3QT8A 4DQPA 4RW4B 1HWUA 2N7YA 1ATSA 2VUGA 1HNVA 4PQAA 3NCRA 1C1CB 1ZBFA 3LDLA 3AARA 2PMZD 1IJJA 1JJ2R 4CNYA 2UUTA 4FKXA 3MMBA 2HHQA 3D1HA 4GKJJ 4YR3A 5J2MB 2JEIA 1EKSA 4OLBA 1L3TA 3G6ES 3LAMA 1OQ3A 4LIRA 3E8OA 2D4WA 2AZ1A 2RU3A 1TKXA 1UPPA 1L3VA 4I6MA 2DXDA 3ZSVA 1S1WA 3J7ZO 1R8AA 4J9RA 4DR2J 3BN7A 5FPNA 5DS7A 4EFAC 2O4GA 4DR7F 4H54A 2D9OA 3QNWB 4XDCA 2XZDB 4A62A 1TU0B 3W2WA 2MKSA 3CFRA 1RILA 4N41A 1AFJA 2XO7A 2VJVA 3CPEA 3X3UA 3O2IA 4CLWA 3VQ7A 3SAGA 1N0UA 3TU5A 4A8OA 2MKYA 5ITHA 3W62A 1UW4A 3MMAA 1YVUA 4M41A 4O4GA 3ZZTA 3D6RA 3E9OA 4K59A 1TYQB 2AF6A 3MN6A 1IKVA 1RCXB 2WVFA 1XMBA 4GO7X 4RW4A 4DV5F 4ILHA 2EFQA 1FFSB 2VG7A 1XNQF 3PVXA 2MQOA 4KO0A 1KVKA 3V4IA 2UUAK 1C1CA 4CGIA 3WNFA 3ZTPA 3UR3C 1HLUA 3ZZYA 2ROGA 3SDEB 1FD2A 4LF9F 2FSKA 4ZVGA 4DU7A 4OYOA 4IYQA 1VSMA 3B8AX 3WHIA 1ZOTA 4JI2K 1OVQA 2H5IB 2ZH5A 2W7OA 4DV0K 5J2MA 1U1LA 5IZHA 3LPYA 2UU9F 4C3LA 3KHYA 4B8AB 5FPEA 2CNLB 4ZIVA 1KHWA 1J6ZA 4Z94A 3JB9k 3CJAA 2OPQA 4ZCLA 4BHQA 3MCPA 4L3KA 3KJNB 3QSIA 1D9FA 3GPAA 2EKYA 5EWEA 2A10A 4F0KA 4GVBA 2LVWA 4TY9A 2PFFB 4DFJA 2M70A 1DURA 1BOTO 1EARA 2F9JA 3EZUA 1RZMA 2QFIA 1J5OB 2GJ2A 3IR7B 2GZOA 2WCXA 1VK3A 2IM1A 4YOXA 4EK2A 4H0VB 4X66J 4ILJA 4DR4F 4IG3A 1REVB 2ILZA 3QFUA 2OMOA 3AJ1A 3RR8A 2AYEA 1WSHA 3FEYB 3CQ8A 2D5RA 2C3MA 1K8KB 5DETA 2YHXA 4FBUA 5KFPA 4YQWA 4E7HA 2MY7A 3PW5A 3H5UA 1IUJA 5DQHA 4PUOA 1O1WA 1HKCA 4JI5K 1XN9A 1IBMK 2A3ZA 2MJNA 3LDQA 3KDOA 4B9VA 3UCZP 4QR1A 5B0CA 1Q1KA 4BC7A 1VQPS 3R5GA 1I94K 2QYGA 2V7ZA 4LREA 3CIMA 3IWNC 3SV3A 1QVFR 2APOA 3V6DB 4CJQA 1ZAVA 2D69A 3GTYX 3OLAA 4ZTJA 4EO8A 1J5OA 1SJ3P 5KFEA 3DM2B 4ECRA 3AVAA 1RDWX 2P51A 1ZA2B 2HZAA 1NKCA 4FF3A 1REVA 4HWIA 2EPIA 1C1AA 4ATNA 3BH7B 1OWXA 5B0FA 4FO0A 1U1NA 5BPNA 2DNYA 1HBOA 3NP5A 1K8KA 3I0RB 1U24A 2BA9A 4BDZA 2R7OA 3DHXA 3M30A 1VISA 3FZ2A 5KT4A 2QTWA 1W25A 2GVZA 4EFHA 3OBWA 1DTQA 1NPRA 3IMXA 1LWFB 4B9TA 1ZM9A 1GOAA 2XSJB 5F0UA 4CZGA 4KH0B 3FFIB 1YRUA 4ZDNA 1HW8A 2E5LK 2QFJA 4QYZK 1FESA 5CZVA 3NGDA 1E6VB 4E7LA 4BR2A 5AQPA 1VQKS 5H9FK 3V6DA 5BYSA 3M8PA 5LXRA 3ENBA 4NI2B 3D67A 1J54A 1HD1A 3BJYA 1YJWS 5FJ4A 3GCXP 3KG0A 2J9DE 3G6YA 2B51A 1FKAF 1JLQB 3UD5A 1RYRA 3AVBA 1BHNA 5J2QA 3F2KA 2J7WA 3CDEA 3MEDB 6FD1A 1RSCA 3ULHA 3M6GA 2ATLA 2B4VA 4J9MA 1WHXA 3I0RA 3I6PA 1WC4A 4JI0K 1A0OB 1VQ8N 3R6LB 2D7SA 3WZ0A 4QYRA 4CF9A 3DC2A 4BRCA 3OJSA 4WF9L 1WBBA 4OI0A 4PXEA 1YLXA 4Y65A 1KDNA 4B3OB 4ILGB 4WIIA 2YX4A 5M1QA 1LWFA 1UCNA 2CUYA 3BO3A 1T3OA 1NSAA 3PXGa 2HHXA 3M6WA 3FFIA 4O44B 4OQJA 2IM3A 4R5PB 2QN6B 2X74A 1DY3A 3O9QA 2F4VK 3VGLA 2G9OA 1E6VA 2UUCF 3CIZA 2BMBA 1WD6A 2ZH1A 4MLHA 4FK0A 1KC8T 1G4CA 5HQMA 1X4EA 1K0TA 1SC3B 4QPTA 4I9QA 1BQXA 1JLQA 4PKHA 3HI0A 2BM0A 3BEGB 5IM0B 1BHLA 1TAQA 2FBVA 3ULEB 2HMIA 1VSJA 1FKPA 1QUVA 3MEDA 1S79A 1NDKA 4P74A 3ENOA 1P8GA 4FN5A 1PC4A 4I6YA 3RBDA 2NRWA 1X9WA 3AVGA 3L7OA 2XYGB 3GJQB 3THVA 2EC0A 1WSIA 5EDWA 2X1BA 1BG3A 2W2QP 3BQ0A 4DN0A 4LSLA 2DKOB 4CZMA 1U0HB 3S3MA 3BS9A 3L0QA 1XQSC 4RWTA 2JOQA 5BR8J 3CJSA 2VICA 2F8EX 3RVCA 4O44A 4I2PB 4QS7A 3A8EA 2GNKA 3HHEA 4BRGA 5IQ6A 1C6VA 2A3JA 4M3YA 1TUWA 3Q8RB 3P38A 2Z1IA 5AXKA 4FOEA 3KZBA 4EP5A 4LFBF 3NGTA 3Q89A 1SH2A 1NGIA 1SBRA 5IM0A 4KB7A 2DEIA 2SXLA 1WKJA 3ZO7A 1C0MA 5KFRA 1FEEA 1EP4B 4TVAB 4CH1A 3O9SA 3VGKA 5HMYA 3MXIA 3KD1E 2RPIA 2K3IA 4F8RA 1LAVA 1JLAB 1V3SA 4F4XA 3FBEA 4JKEA 1H0HB 1WOSA 5HLFB 4KFBB 1K1SA 5B0DA 4F3OA 3OS0A 3CCLN 2FBTA 3QBWA 3W66A 4URSA 2A1BA 4X4SA 2ZDPA 3VCDA 1SKRA 3NY0A 3KKRA 3HYFA 3HJVA 1VC0A 4TSXA 3KHGA 4D3GA 4Y0FA 1FA0A 2M88A 2K1RB 4BR9A 4NXMF 1HKBA 1QVGM 1H3DA 3K17A 3EXYA 4JK8A 4MKBA 4K4XA 2G1DA 5AZIB 3CCWA 2P2CB 1YX2A 4K0KF 2R7TA 4JD2A 4F04B 2WSFC 2C3PA 4A46A 2YKQA 4CM0A 2BXJA 4RNMA 4CJFA 3S1TA 1EP4A 1GMUA 3CC2N 4JI4K 1RBOB 4CH7A 3OYCA 3BGRB 1TV6B 2BE9B 1Q8IA 4DV2K 1H74A 1YJNN 1NBWA 4J2AA 5HLFA 1WNSA 4Q5VA 5JVGL 3G96A 5FPMA 4IZ9A 4LF8K 4GVEA 2VFVA 1Y11A 3QO9B 3VEWA 5CHIA 2FHMA 2PT0A 2AA4A 3B82A 3H6EA 3GYNA 1CQMA 3ISNC 3N28A 1K0VA 2HNZB 1Q5YA 3VZHA 3HZEA 1RBAA 1ASWA 1IR1A 4G6VB 4FWKA 4JI6F 4USJC 2K1RA 4BRAA 5AT1B 3CO9A 2HHWA 3U1MA 2EK6A 3FBFA 3TARA 1S12A 2VWKA 3AD8C 5AZIA 3JS6A 4M5KA 3HCXA 1RA6A 2BEFA 4KTQA 4DPUA 2VD3A 1ZC6A 1HR0K 1Y0HA 4RKUC 5LL6d 4H8KA 2FLOA 4IH7A 2ZZNA 1QE1A 3CD5A 3UN3A 5F0WA 1EQ0A 2VG6A 4B3RK 4LFCF 4TY8B 1GLFO 1U4BA 3BGRA 2VODA 1A6LA 4WPAA 3T1YJ 1VSFA 3VQ4A 1TV6A 3IG1B 4CD3A 1X60A 1CJVA 3GOIA 1RI7A 1B64A 1XR5A 1U49A 3SQ1A 2N3LA 5HAOA 4OPHA 3EVMA 2A2CA 3M8WA 4X2BA 2GV1A 1F2GA 1CEZA 4HUFA 4NCGB 3QO9A 3ZSZA 4BRMA 2BUNA 2W2OP 4IDKA 3R7NB 2U2FA 2BW2A 1B7FA 2CYYA 3J7YU 5D0HA 4CK1A 3KVGA 4ZVSB 5KFHA 2NPIA 4HVJA 3WDOA 3QINA 4FVMA 4MYTA 3TA2A 3IRWP 2UUBJ 3LDPA 3MPWA 4FWMA 2IPOB 2HBRB 3UFCX 5C0YA 5I3UB 3AA9A 3GV5B 1DARA 3AVKA 3THXB 1N32F 1FWKA 1PGZA 2KO1A 3U1NA 4CIOA 1GFWB 2ZVIA 3I5BA 4S0MA 3CCQS 2NUUG 4B8CA 1YF5L 2ZNZA 4ZKAA 1N5YB 3MEKA 2L9DA 3Q7CA 3MEEA 2JVRA 2Y8WA 1H2TZ 2PYLA 2NLXA 4B1VA 4L73A 4IRCA 3OFEA 4NPOA 3EM1A 3P3DA 2KRRA 2FDNA 3CCES 4TY8A 2HQDA 1LFPA 3GFZA 2HIQA 1RWOB 1SC6A 3D6MB 1XUPO 3FZKA 4KHYA 3IM9A 2JZ5A 2Y3YA 4PWWA 1FW6A 4HCCA 3TA0A 1U6BA 4FVCA 4DR7K 2Y1LB 3M1FA 4F26A 3CF5Q 4PY5A 1OVYA 1MNEA 5MAOA 4RLEA 2HSTA 3R1LA 4ZVFA 4E19A 3VEZA 3IRXB 5HL7Q 4IH5A 3MPYA 5A2QY 3OYHA 1JLCB 3OJUA 3TANA 2W6LA 5I3UA 4LVNP 3HM8A 4BC9A 4H0XB 1TKZA 3THXA 1RACB 2DXEA 1RTIB 4DV5K 4C97A 2DTJA 5C25B 1S0MA 1NU0A 4BRHA 1HBMA 2XBPA 2CPDA 4CK2A 3CCRS 5KG0A 4AE5A 5KFOA 4XH1A 1TELA 3DGVA 2D3ZA 3PKMA 1S57A 1CLFA 2VFRA 3KLHB 3NDKA 3VA3A 2P9NA 3TA1A 5IT9U 1WOOA 4M1KA 2UU9K 4JKDA 3CD6S 4I4BA 3EZOA 5LSRA 2DCUB 2D0OA 2W8LA 2GFFA 2AEJA 3DLLQ 2Z2ZA 4MAKA 3QRQA 3ZZPA 4PL8A 3WNHA 4FLZA 2HNDB 4CO4A 1RKIA 1RBRA 4H4MB 2PAVA 3IRXA 2CQ2A 3FRYA 1RWWB 3J80Y 1SV5B 4LR7A 2J8AA 1CULB 1JLCA 1FRLA 5KFVA 2J0SD 1C0GA 2XRIA 2HVIA 3IFEA 4DR4K 4M95A 3Q8VA 1NJYA 3CNQP 4JHDB 1TK0A 4F4KA 1YT3A 4HHTA 3VQPA 2FD2A 2BKOA 2RAQA 2BE2B 2OI2A 3LA0A 1SL0A 3PRBA 3M1VA 5B0AA 1GLBG 3OXLA 2UXCF 1N5TA 2AIRB 1XHXA 2W7AA 4CLFA 3CCVS 3D7SB 1YITN 3JTPA 1JCFA 2MQ8A 3F41A 4CVNE 2HG4A 4FCYA 1K44A 3ZXWA 2C3OA 2LLZA 5EWGA 3RR7A 3RU0A 2E88A 1CS4B 4EBCA 4M3UA 2W9CA 2XY7A 1YHQS 4FJ9A 1FRXA 1T03B 3R1XA 2CADA 1I3OB 3NF6A 4K5RA 4AILC 5SUHA 1JMTA 4OX9F 1N36J 3VTHA 2QT7A 1K8AO 2KXNB 2PEBA 2YBVA 1HQUB 3QJJA 4LFAJ 1SV5A 3MM7B 4F4ZA 2J9CA 2OTJS 3SQ0A 4I9LA 2CJQA 4C1NK 1S6QA 3BPDA 3BQ2A 2B9EA 4QIGA 4L6V3 2DR9A 1F3FA 1O13A 4QIFA 1QS4A 1IWAA 2CH5A 2BE2A 5HBMA 2FZKB 2DFFA 2EFPA 3HT3A 5AQUA 1RTJB 1OKJA 2YNFB 4JYAF 2B5JB 3QETA 1HHSA 5JMVA 4B1WB 4KJIA 1RDAA 1TL7B 2QMXA 4OYMA 2HPUA 3A8KA 1IM4A 4KHQA 3CCMN 3BQ1A 1VC5A 4NZ6A 3NGZA 3H42A 3IBCB 4ECVA 2DVIA 3C0BA 3THYB 2I8EA 1JK9B 3R2DJ 4WZMA 3A13A 4DL5A 4W5RA 4Q2MA 3MAAA 3S3OA 3H45C 4DCJB 3K2PA 5AQOA 4P75A 3KNGA 3DKDA 4MDBA 3PM9A 1ZPVA 3SCJE 2I7NA 3B6BA 3KMSA 1HKAA 3HVRA 2IS3A 4CLSA 4BE0A 3VPZA 1VSDA 3DWLA 1VIOA 4C8NA 4JKCA 1HQUA 2ZHOA 2E20A 2XLKA 2KLAA 3J81O 5KT2A 3M2RB 4OZ1A 2BACA 2EG2A 1XTZA 2IVFB 4DKWA 4OZLA 3RBEA 1H2UX 1TKDA 5HROA 2XMMA 1Y5NB 4DV7F 1VYAA 3HD1A 5GADI 3AXMA 5CZ1A 2ZJPL 1YI2S 1D4XA 4A59A 4AUKA 3MCOA 1KKHA 4DTSA 3VZIA 3QPIA 3LAKA 2HYIB 2AYGA 2A1RA 2JJ4D 1RTJA 3ELHA 2YNFA 3BN4A 1M5OC 5BR8K 2F5GA 2B5JA 3M8SA 4RTFD 3B4MA 4AD6A 2HHSA 3LDSA 1QAYA 4K2XA 4E1JA 4I2QB 4PWUA 9ATCB 1G99A 1NGEA 3BYRA 4Q0BB 4BG9A 4NEZA 3THYA 1SQGA 1K8AT 4BRLA 2HBLA 3QB0A 3MEGB 4OHYA 1GLDG 2QG9B 5KG2A 2UUCK 2HAIA 4FPBA 4Y0WA 4CZHA 4JN4A 5GIOA 3W8PA 2OEJA 2W2MP 4LUBA 4RBVA 2HWHA 3S8SA 4A61A 3ZSWA 3H1QA 4CEDA 4AL6A 4QU6A 3RB6A 3WBZA 3QGIA 2DHSA 3AAWB 2ZH9A 1IQZA 3O9TA 3OYNA 5C2GA 3DOKB 5D4LA 1S77D 4C0HA 4DV4J 1U6ZA 4OLOA 4N76A 5HRPA 4TXSA 3LPUA 4MIBA 5ETLA 3AT1B 3V6JA 3HM9A 2V69A 4DQ8A 2CZ9A 3MPDA 4TU9A 2W41A 3BSCA 3UDCA 4I2QA 3BH6B 3M8RA 3FCWA 2F8SA 1N52B 5LJ5Y 3TVKA 2RSQA 4QIEA 4L3QA 1P1TA 4ED2A 5LSOA 1DQAA 2OGUA 4N7TA 2DB1A 4DR1J 2PGCA 2GC8A 1BDGA 3MEGA 2UUWA 1S72N 2WB1D 4P72A 5C5JA 1NNDA 1JB0C 3M4XA 4CHYA 1QM9A 4ICLB 4USHA 2HAFA 1S0NA 3ET6B 4BRDA 4KHUA 4FF2A 3S9HA 4CLZA 4LFBK 3CC4N 3HSJA 4K5SA 3R3LA 2ZWHA 2QSWA 1QQOA 2WONB 5B7WA 5JS1A 3PIOL 3EXCX 4UOGA 3PSFA 4GV6A 1KFSA 2C2ZB 3TAPA 2BW7A 5A8KA 2J6UA 4G1PA 4BQLA 1BISA 3SUPA 4NL5A 1OIAA 2FXUA 2UYTA 2OSQA 3T1HF 5HANA 1RAAB 1RDBA 3LUYA 3QAEA 2XULA 2KH9A 1HI0P 5DO2A 1IVZA 2MZJA 3JYTB 3KHHA 3T7ZA 1NJIO 3G8QA 1JCEA 3MI7X 2IJNA 5G0RA 3H98A 3AVCA 3DGPB 2HFUA 3M8QA 3UI3A 2E2OA 3V9SA 3VAFA 4NXMK 2R7UA 2YX7A 2PD1A 4YDUA 3ET6A 1O8BA 3R5JB 3AA2A 3I55S 2BE7D 3KJFB 1JLFB 4K0KK 4JKBA 1R0CB 1ZAXA 2HWIA 2XI2A 4LBHA 2MZ1A 4CGDA 3MAHA 4K8RA 2B43A 1NSQA 2WONA 3MFIA 2GIFA 4LQ9A 4JV5J 4CRJA 1IKYA 4ALZA 2P9EA 1UVJA 2DTUA 3UB5A 1VHFA 4CEZA 1I39A 1RABB 4Q43A 2RQMA 3OFFA 4F67A 4ZITA 4ZJOA 3S6EA 4A5AA 2AGQA 1YG0A 2VASA 4IKFA 3T3FA 3G71N 1HHTP 1SJ4P 1VRTB 2O8DB 5MLCV 1YJ9S 5BRDA 2HK2A 5DDPC 4BE2A 1NJWA 3S7RA 3R1HA 2OZMA 3UD3P 3P49B 3PTWA 1X5SA 3OHAA 4A8MP 3JYTA 1ZTWA 1XNRJ 3OYLA 4PWDB 4B3TJ 4JI6K 5IQQA 4BC3A 2GMLA 3QGPA 3DGPA 4AFFA 1R8CA 1FJCA 2HZVA 3SBGA 2QE5A 2BH1A 4URQU 5LSLA 4WFBQ 3OYJA 2AP6A 4ZMMA 2QEXN 1FNMA 3V81B 5ETOA 1HJOA 5KG1A 3KMQA 1EETB 3FCHA 4IG0B 2VFUA 2VKRA 2Z2LA 4LF7F 1SQFA 3CB4A 3SPZA 4CHNA 1BI4A 4LFCK 2GUPA 2C28A 3W8GA 5IV4A 3HFKA 1C4CA 3CG7A 4KC5A 5KFSA 3CVKA 1XMOF 1T8EA 1IBLJ 1KRPA 4ER8A 4BGBA 1NJIT 3H2VE 5KOXA 2GHVC 2Z58B 4NYFA 1U2CA 1J2VA 3S3NA 4B9SA 3SFGA 1VSHA 2CKWA 2LA6A 3DRYA 3MN7A 1RAEB 2P6TA 2ZJRL 1U26A 3QGGA 3E51A 5AQHA 3GR1A 4BRNA 5DLGA 2IIRA 2M5YA 4PWDA 1SKSA 3CJTA 2HS3A 1AUDA 2V6AA 2IJFA 1WHYA 1Q0NA 3KLFB 5DMRA 1N32K 2HWTA 3V81A 1BIUA 5CD4H 4V19S 1S59A 4EO6A 3KLEA 1AYEA 3GQCA 1KCFA 1KVAA 4NWBA 1EETA 3CXCM 3F44A 4ZP6A 2MDAA 4EYHB 4OJ3A 1HNZF 1HQEB 5IFMA 3IUCA 2JWLA 2HK3A 3DXMB 9RUBA 4ZN3A 3VQ9A 4N56A 2XC9A 3C15B 2ZBRA 4CGFA 3MX2A 2CDRB 1GOBA 1TL5A 5HJXA 4FM1A 5E3QA 2Q0UA 2MKCA 2QLJB 3DU5A 4PYAA 4IOCL 4R0JA 2R8GA 2HNYB 1KOOA 4ECQA 2M52A 4JB8B 1JXBA 3ZT1A 1J5EF 4YOEA 4CLLA 3GILA 3MR6A 3E2EA 4DUTA 2V9WA 3EGNA 3MWTA 3GFYA 2Q79A 4KHPJ 5AQLA 1A5VA 3NGSA 4QS9A 2WSCC 1PYOB 4AXIA 2KYXA 4J8FA 2AX0A 1WB9A 2L3MA 3QLHB 3OL9A 4HR2A 5KFZA 2FJBB 4MDAA 4BR7A 1Q53A 3NCQA 1EKRA 3OSPA 2DNMA 3KLFA 5DG9A 1WSGA 1XWLA 1QAXA 3HHLD 4Y2IA 2P9UA 2WRMA 4GMKA 2NRZA 3UWTA 2GHPA 1X4DA 3OYBA 4CFDA 3MCNA 3W7BA 5J1NA 1J53A 3LP0A 2DD8S 1MU2B 2AHOB 4FXWA 1FNXH 3UO0A 1HQEA 3UN2A 4QBUA 5B0BA 4U95A 1RT4B 3C15A 1PJ5A 2A0FB 4OX8A 2R7XA 4IO8A 1TFWA 2FSNA 4DG1B 4ZCMA 3A8IA 2V2QA 1X9SA 3PX0A 1N36K 5HP1B 4Q7AA 2I38A 3BF1A 1WHWA 2FGOA 1BO5O 2E1ZA 3ID8A 3A8YA 1NZ8A 2PEHA 4LF5J 2FHJD 3MAQA 4ILMA 1NKEA 1HIYA 1MROB 2OD6A 3BZKA 2J9EA 2D1CA 3EY1A 2DR6A 3M7VA 4ID8A 3NNHA 3LP2B 5J2NB 2C2NA 4QPXA 2HF4A 3G82B 2H3EB 5JVGQ 4NMLA 4FW1A 1WNEA 2PY5A 1Z25A 1NXIA 2D74B 3SEOA 2DNKA 5HO4A 4MQ3A 4CJ3A 4YB7A 1WG1A 3BGUA 3CW2C 2ZJQL 4WE1A 4B08A 4YNQA 2Q36A 2G8IA 4AQYF 1HMVB 2UXCK 2HW3A 4O8KA 1F9EB 4Z4CA 3MM5B 4CFBA 3MR5A 4J9SA 1QQCA 5GAHU 4DL7A 3K9KA 4CYUB 1RWNB 1ZBTA 2DY4A 4DG1A 1GEHA 1IBKF 4DHVA 1RAHB 4FJNA 4OZ5A 5CYMA 1N34J 4NLBA 2ZC3A 1RAIB 5HP1A 1U2VA 2ZHBA 4P73A 4C8ZA 2I7PA 4RU2A 2KXHA 4OX9K 3POTB 5J2NA 5AQIA 1VJQA 4CFCA 3G82A 4C23A 1VS3A 1PAUB 1PBAA 3IA0A 2QIFA 3O9UA 1VQ8S 2RKIB 5KFBA 3ISND 2KB2A 3LP1B 1NJXA 1HLWA 2MSSA 5DDOC 1NSKL 3K5MA 2F9DA 3DOLB 3QWPA 3VVUA 4DV1J 2PMWA 4M3ZA 3Q86A 4EZ6A 4DWIA 5AJ3J 3O8WA 4JYAK 3K9JA 1LXJA 3UIQA 3S41A 5F8IA 4ZVTB 1Q18A 2X1AA 3H4BA 1X0FA 3SBMA 1P90A 1VQYA 3PKYA 1S48A 2QO3A 3CI5A 4URGA 2M7SA 4G9ZA 1OH6A 3HTVA 4JOUA 1BMQB 1N5VA 3RB0A 1Z4UA 2NYHA 3KK1B 2Z1GA 2OPRA 1ULRA 1OJ4A 5H1SQ 5L39A 2JWKA 3GIMA 1AA1B 4X62J 2NRRA 4RUCA 4LF4F 3R6GB 3QIPB 1OH7A 2W4PA 1F5AA 3O3FA 3D28A 2QKBA 2NQPA 4R79A 3POTA 2W9AA 2AGPA 4AHTA 3EGZA 4LBIA 4DTMA 2H1YA 4OX7A 2ADCA 2QL7B 2IAJB 1ZZFA 1CJKB 4H0YB 2DNRA 2RKIA 4DV7K 2RUSA 4U7BA 2ASYA 1RT3A 1OY9A 1N33F 4IFVA 2R3VA 2W4DA 4CHZA 4NYNA 5C2CA 4E8UA 3QEIA 4JKAA 1VRUB 2JEGA 4JI8F 1K73O 4J2BA 3J7Z5 4WYLA 4ISFA 3FQLA 1MWZA 4Y2MA 4KYZA 4U8VA 3C66A 4MMOA 4LQ3A 5FLXO 4A47A 4FXDA 3VQCA 4OYZA 2WZ1A 1ZM3A 1NK9A 3IAM9 1U1QA 5C12A 3NVKA 5F41A 4JKGA 3KK2A 2I6WA 3EPIA 1FXRA 5BJRA 2V4JA 1PYSB 3JXOA 5KFNA 1TAUA 2A42A 1VQ9N 1SH0A 2K7KA 4DUYJ 4ZP7A 3HHLB 3ZTOA 5KFXA 4NLTA 4BS2A 4LRFA 4YY3F 4FZVA 4RW7A 2KM8C 3SAFA 4RL1A 1RT7B 3OPKA 5LMNF 2DGUA 2IAJA 4FZXC 4GRSA 3CERA 1CJKA 3BDPA 1TKTB 3R27A 4PPZA 1VK8A 4JAXA 2EFOA 2E5JA 3CCLS 4DMZA 3NOGA 4HTLA 1RTDA 1LQ9A 4WU3A 5AFUA 3NBPB 1FRMA 2VIHA 1YQHA 2ZDOA 5IWAJ 2PIIA 2DPIA 5AQQA 2V63A 4ERDA 4CZFA 2ZD1B 1ZBHA 1GTEA 5A6WA 3OXFA 3K2YA 5C7PA 3C65A 2LEPA 2IRUA 1N33J 3VQDA 1NGFA 2Q66A 4DPYA 1EHWA 2DFEA 4ID5A 3EDQB 4EHUA 4HUEA 2FVCA 2E1RA 5SWMA 3NVMA 4IH6A 3VWSA 2BTFA 4IKAA 2B0GA 3THWB 4DF4A 3W1YC 3PYDA 3WXLA 1PC5A 2ROEA 3HHLA 2GGPA 4RO0A 3IWXA 3AY9A 2VONA 4DUZJ 1HNXJ 2A6MA 2B8QA 5CR4A 3OR1B 3SCXA 2G2OA 1CJUA 4LR9A 4FWPA 1K73T 2X1FA 2B3TB 3M32A 1YJNS 1KHVA 5JLFA 1S97A 4KT0C 2C3UA 3H5YA 3DDNA 4G3IA 1WSVA 3OA9A 2VV5A 2P5GA 3NBPA 4XK8C 1TP7A 1SJQA 2FHJA 3JAMU 1PO6A 4ZTFA 1BA0A 2IRXA 3DDIA 3OHBA 4M45A 4GVMA 3T1HK 3AV9A 2ZD1A 7FDRA 2DRAA 4CWBA 5DGAA 3HDSA 1T94A 1LW0B 1JNZB 2MKJA 4BROA 3A5NC 2J0WA 1VI7A 1NB2A 1T0TV 3TQEA 4UUXA 2BYCA 2Z2MA 1UJ4A 1JXEA 1PIEA 2EWHA 3THWA 3L6QA 3HULA 4DQSA 1LWXA 2OMLA 3M8ZA 4MK7A 3CCJN 3HMJG 2O8EA 1N4LA 4PG8A 2N4CA 5IXUA 4DR3F 3VTIA 3CJ7A 1NOYA 1CPZA 1T6CA 3BV8A 2O8CA 1URRA 3IS9B 4J7CA 5LJWA 2LYVA 3TAMA 2B4PA 5AXLA 4RZRA 3DU6A 5KRSA 4USUA 3QFHA 4J9QA 2PI5A 1GOCA 2D3O1 3CCSN 1DQ9A 4WQ4A 3HBTA 3EZWA 1FX2A 2V8HA 3SMSA 1NGAA 3CIPA 4M3XA 2VPXB 2XCPA 4FJGA 3AO2A 1AZSB 3JSBA 2B56A 2IM0A 3FFKB 4KAZA 1FERA 2P5VA 5CZXA 3H8YA 1LW0A 2CFXA 1URNA 2ZJPQ 1EZZB 2QXLA 2NREA 4FWLA 3G87A 1S76D 4KHWA 1CLQA 3RZAA 5EU7A 1NK5A 2FZGB 1LEOA 4A2AA 2YKAA 2GJFA 3TEHB 5KPRA 1W97L 3J7AN 2G0IA 4CJ5A 3HSCA 1C4AA 4N8OA 4NRUA 5DJBA 4TU7A 2A6OA 3QIDA 2CPEA 2P9SB 1REGX 3IS9A 3L09A 1N8RT 2GAHC 3TAGA 3D2FB 3MECB 1H6KX 4LF7K 2OP5A 3NRBA 4Z4IA 3BBFA 4AYBD 1FKOB 4RUHA 1BQMB 5EWFA 4ANDA 3OL7A 2FGCA 2FIUA 4EYIB 1S0VA 4WQ5A 3WXIA 4FLUA 1AZSA 1XMOK 4ILRA 3P39A 1TZ0A 4B9QA 3EWGA 4I64A 3TZYA 3FLCO 3I96A 5AQTA 1H72C 5GVQA 3R2CJ 1QTNB 2UUAF 4OZ2A 3BEXA 1TGOA 4I56A 1EQYA 4AF1A 1VLYA 2FHKA 1ACMB 1N5QA 4AXJA 3LWLA 1YSJA 4NZ0A 2DK2A 3SFUA 2OD4A 4B9MA 1MMDA 4DV0F 5HSPA 4PRFA 4OI3A 2QA1A 2M8HA 1SJ1A 3Q2SC 3RMAA 2DHGA 1H98A 2JLGA 3ID6A 4DLEA 3VEYA 5F2RA 1T9WA 3US5A 2ZH2A 4RJVA 3U3YA 5A8RB 1WACA 5LMUF 1ELOA 5HQ8A 1WF1A 4IOBA 1SL1A 4U96A 3I32A 1FKOA 4H0TB 1HNZK 1UZHA 5GAEU 4LF5K 2XS5A 3J7YP 2HHHJ 4PR6A 3OUYB 2OEKA 4CZJA 2Z57B 3AA3A 3TEGA 5D15A 3VAJA 1X9MA 5A8WA 3CJBA 4FDFA 2R8KA 1KFDA 2O3DA 3DRPB 3AHPA 1J5EK 2GJIA 4X4UA 3D0IE 1GLCG 4ZPDA 2J5AA 1D5AA 2IFXA 4IO9L 1SAZA 2CQDA 2ATCB 3MWPA 2HBYB 4JKFA 1RADB 5M2RA 2EX3A 4OVLA 2CQCA 2HOEA 3JSYA 2HURA 5LM7E 4KBOA 1VQMS 4FWQA 4FKYA 4PG5A 3LOUA 1YITS 3RWUA 3SQ2A 2IMWP 1KQKA 4RW9B 2XLIA 1ATNA 2A6AA 3SQ4A 3TPQA 3Q8PB 1Y64A 3GJSB 2DR8A 4DS5A 5A8RA 3ZETB 1I94F 4J90A 1RT6B 4RNFA 1U02A 1Z2LA 5CCLA 2XGPA 4FNIA 4BG8A 2BUPA 4DFPA 4DR6J 4KR0B 5DLFA 4KSEB 3A8JA 4B3MJ 2MQQA 1XHZA 2YJEA 1V9OA 2WC9A 2CNKB 4LD0A 4OLPA 2HB5A 2R7YA 1VQNN 3N01A 4ECSA 3DRPA 1OO0B 5A6PA 1C2PA 4X65F 1P9YA 3EE8A 3ZT3A 4OJRA 2ZHAA 3AFGA 4FYDA 4CDIA 1OH8A 5CYQB 1MA9B 1FO1A 1Q95G 2GVDA 4HKQA 3GR0A 3OFGA 2YKOA 5JXSA 2UXDF 1Q8LA 1FFWB 3N4PA 2E4LA 1OY8A 2C2OB 5CYJA 2GMJA 3UVJB 3U9DA 2V94A 4ECXA 3NS7B 4IFYB 2VG5B 3EDRB 4WIQA 3EICA 2F9TA 1UAXA 1BGXT 1T7PA 4KPCA 4AQYK 3CCMS 2B6AB 4DZ6A 3ZETA 2BV3A 2QWNA 2ETJA 3N0VA 2K06A 4EAHD 2ZM6F 4CJRA 2YWGA 1HA1A 1RBTA 1PCAA 4LSNB 4PCQA 3G4SN 2XS7A 1IBKK 4BWJA 2PSZA 2MTLA 4NX9A 3W2VB 2RS2A 2DHAA 4KHNA 1WC5A 3M9NB 1EWQA 3WUHA 5AQGA 1HPZA 4M5NA 4FM0A 3GFXA 4QW9A 4KB0A 4M7XA 2CQ1A 3GYXB 3VN5A 3UKRA 2JC1A 2HFNA 2MZTA 3IKMA 1HYVA 1NNEA 2XNQA 3QYYA 4K43A 3T5KA 2RRAA 1Q79A 2LXFA 2MJUA 4CNZA 1YXQA 2Q31A 3RMBA 5JVHL 2L48A 3NOCA 3T6BA 4NYZA 4C6AA 2V8DA 3VF0B 4ZOSA 5AQRA 2XY5A 4QIVA 5LJVA 1WORA 2KXFA 2B6AA 4EWTA 2QA4N 4CZCA 4ECWA 3TJAA 2BJ3A 4BVPA 3R3TA 4TNOA 5A2QO 5BYRA 4J37A 3FGVA 2RT3A 3THPA 2CJXB 4YS2A 3CC7N 5JJBA 4LSNA 2GWJA 3ILJA 4DL2A 3UE5A 3THTA 2BOPA 4U67Q 4E1NA 1NH7A 1UFKA 4OZ3A 3UN5A 2V4RA 5KT5A 2YNIA 3VAIA 3ZSOA 2MLYA 2KN4A 4J9UE 5AZJA 3MXMA 1XERA 5EY4A 2B9WA 1DLOA 1MW7A 2Q1NA 3P5TL 1RT1B 4CH0S 3EGWB 1P1LA 4ELUA 1IKWA 1F3VA 2AEFA 2XLJA 3OTOJ 3KIOA 4LF4K 4UF4A 2KFZA 1G3OA 3TZWA 3LDNA 3DFEA 1GX6A 5ETVA 2V5HG 3LZIA 3M8YA 1HNWJ 2CVIA 3KUHA 3BR8A 4W92B 4IOCQ 4DR5J 3M2UA 2ZEJA 3OYDA 4WTOB 1BUPA 3AVNA 4DCHA 1CJTB 3LPEA 2AYMA 1FJGJ 3DCAA 4OHZA 2IDEA 1UVNA 3K5PA 3P5BP 2YWHA 1N33K 2QJ3A 1KWMA 3MX5A 3NF9A 5HVHA 4ZLNA 3N4QA 2IC3B 4OYWA 1KQSM 4JI8K 4YHHF 1S1UB 3J80O 4J2DA 1Z05A 4H5NA 3N5FA 2XHWA 2OTLN 5THWA 3KG4A 3SCIE 4TLRA 2XHCA 3A2FA 4DL3A 1S72S 3K59A 4ELVA 4DUZK 2QL5B 3UE2A 3AJDA 2POKA 2F4FA 3E9PA 4CEFA 2FJEB 2RF2A 3U02A 5F3TA 5AQJA 3DHWC 3ENWA 1TVRB 2E8AA 4L76A 3CC4S 4RWWA 1RKJA 3E01A 2GIQA 4YY3K 3QMQA 2BQRA 4B9LA 3D3BJ 2FVRA 3M6UA 4H0PA 3G6EN 3JSMB 1YIJN 3D0GE 5LMNK 1I6JA 5FRMA 5DK5A 4A5BA 3CTRA 2WOMB 3HP6A 1RBVA 1Q81T 5HJYA 4QOTA 1CJTA 4LF6J 5BR9A 1NGHA 2AYBA 4MT1A 5F9LA 3A12A 1N56A 5KT3A 2WBMA 1FVQA 2BJ8A 3O44A 1K9MO 4M5HA 3D54A 4FS1A 2C2KB 1UVMA 2E5HA 3QRPA 3IGNA 1DEJA 4AM6A 3EX7B 2KZZA 1M1HA 3DLRA 1KS2A 4OKEA 3A4TA 3PJ9A 1WEXA 2QLWA 1S9FA 4CEBA 1YVFA 4HT7A 3WEEA 1W2IA 2ZJQQ 3T5JA 3UQSA 3NGUA 1YJUA 1GXTA 4I67A 3OTEA 3C19A 4KH5A 4QWEA 3O6QA 1TVRA 2OA8A 2BKPA 3M9MB 2H4YB 4CK3A 3SV4A 3P6YC 2F1FA 5BXIA 1CG2A 2EFNA 3JSMA 3ZZZA 2B7CB 2WOMA 2UVWA 3TNVA 2RD5C 3MPUB 2IRYA 3BR9A 4ZPBA 3W3DA 1BWEA 3VQ5A 4UOFA 2VQFF 1NCLA 3G71S 3R5BA 1DFDA 2CNNB 2F96A 2KHCA 3V9ZA 1E6YB 3G9CA 4RU9A 5BRHA 3EYZA 1KD1O 3PY8A 1T44A 4WZQA 4K4YA 3E3XA 3B6OA 3O1WA 3IAYA 2NXJA 3C94A 3PHEA 4R8UA 1CC7A 3FMWA 4GKJF 4NLWA 3HZGA 2F40A 2QEXS 3OYEA 3LALA 4WU2A 2VJUA 4YOUA 4ZLPA 5J2PA 1Y4ZB 5KG5A 4X64J 3UDVA 4FW2A 4DR2F 4EGLA 4Q2LA 3LPTA 3LW5C 5C2DA 5ADXA 2PA3A 4IR1A 1OH5A 3LGNA 1R7IA 3QQCD 4DR3K 3AVIA 2CG8A 4WFNQ 1TKXB 2QW9A 3VAKA 4I6MB 4L72B 1K9MT 4CLYA 2R7RA 3MMVA 4X4RA 1B4SA 1VQLN 1XIQA 5LXYA 3JXUA 4YOYA 1VSIA 1U8SA 3CJ4A 3CJ0A 5BYQA 5CXTA 4JS5A 3W2WB 1VQ7N 3RRHA 1HBUA 3EVOA 1F9HA 2NNWA 1HYSB 2V7YA 2MZQA 1D8ZA 3UD4P 5GADU 2DGQA 1NGBA 4ECTA 3MMAB 1WEZA 4O4GB 4P52A 3D0PA 4OPAA 1B9FA 3QERA 4ZHRB 3FZLA 1RU2A 4OGCA 4LR8A 3NF8A 3BSAA 2Y1IA 2HQGA 3H7HB 4F9OA 2RUGA 2VQEJ 3SNNA 1NK8A 5AQVA 2VG7B 4FWSA 4KTZA 4OYPA 4KO0B 3V4IB 3AVFA 2JGUA 3D45A 2M2BA 4QW8A 5HATA 4LRBA 5KT6A 2CNOB 1G6BA 1NK4A 2BX6A 2B4OA 2XY8A 4KTWA 3FQKA 2ZUGA 2GO9A 3UDLA 5CA5A 3WX8A 4LMZA 1TFYA 3KD5E 3K5LA 2D3UA 1S9EA 4HTUA 2OPQB 4DSFA 4HDHA 4DTRA 4ELTA 4BCAA 3NCPA 5H9EK 1P27B 2DRDA 3QDKA 1KD1T 4X66F 4N5SA 4GVBB 2L41A 3AO4A 1M1KO 4YB5A 3KTQA 4OHXA 1HYSA 4CBUA 3FKBA 3NWRA 1V4SA 4FLTA 1YJWN 1IV0A 1GXUA 2KT5A 3NG8A 3ETOA 3L4IA 4ZHRA 3L8BA 4IG3B 2D9PA 4Y34A 4TYBA 1M5PC 1RWPB 3BGOP 2PMHA 3J7YI 2HS4A 2R8IA 2V50A 2I0XA 3VAGA 2R9LA 2GELA 1YTUA 5ADXH 2AT1B 5ETMA 2IA6A 4NOHA 3GIIA 4DS4A 4C8MA 2AD9A 2XY6A 2G8VA 4PUOB 1NBEB 1X3MA 3ZLJA 5IT4A 3OVNA 2I5JB 3OVBA 3PCOB 1QHTA 4H4KA 1S4FA 5AQNA 3DXKB 5LMUK 4LC9B 3VEXA 3KG1A 2YKMB 5KT7A 2W42A 5KAKA 2E1MC 1RWKB 3DYAA 1NJZA 2X7IA 4DV3J 2W24A 3PHTA 3C2PA 2E9ZA 4TQSA 4C9DA 1IR0A 1Y00A 1MWYA 2CJYB 1RWXB 2G2ZA 2W1BA 4YB1P 2D0AA 2YV0X 5DQGA 1WF0A 2OUGA 4YOTA 3SXLA 2YQ3A 2CPHA 4K4SA 3AQPA 2ILYA 2HFZA 3RBXA 5KI6A 4C98A 5C24B 5C42B 2RDIA 3UPFA 3CE8A 3CJ8A 3PYEA 2XM3A 4NLXA 4DSKA 1HBOB 3DLHA 3RMDA 2VZ9A 3AJ2A 1T9XA 1X1PA 3J7ZT 2DFHA 3M30B 1G2EA 3A5OC 3FZHA 4JI1J 1X31C 4PQUB 1VSLA 2PFUA 3LDOA 2P5OA 2RE1A 1ROFA 2QLXA 3PFOA 2GVZB 3VALA 1M1KT 1DTQB 2I5JA 1BIZA 3HHDA 1PAEX 1ZBSA 3R5CA 3O08A 1NGDA 3DXKA 1UJ6A 1Q8KA 1WKKA 2HBMA 4W4MA 2PBDA 2YKMA 1D09B 1UWBA 1W7AA 1JLGB 1FDAA 2GUIA 5E26A 2DNNA 4ED6A 2XMJA 1GLEG 4KH4A 3ZT2A 1C0UB 3OBIA 3M8PB 2XWXA 4UQGA 5CY4A 1AUSL 4JLHA 2RQKA 2KQ2A 1LW2A 2YWKA 5K5MA 2RHSB 2HHVA 1SZ2A 4QWBA 4FP9A 4ED3A 1B9DA 2X6SA 1VBXA 1X0PA 5J2QB 2BJDA 2NR0A 3PFEA 5A0YB 3VGTA 2IY5B 4M7YA 3CCUN 4ZVOB 4X65K 5C24A 5C42A 2WBRA 1EX4A 1FDBA 1NPPA 4Z4EA