2OPPA

Crystal structure of hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
542
structure length
518
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 136
structure length 518
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2oppA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oppA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oppA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oppA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2oppA05
3MECB 3PW5A 4KTWA 1RDRA 4H8KA 1JXBA 5CYQB 4EBDA 3I8DA 3C94A 4DSLA 5FRNA 3HO1A 3SI8A 3RB4A 3VQ6A 2VG5B 1FXXA 1TKTB 1DLOA 3RMDA 2X6NA 3QLHB 4Q44A 5KFVA 1N6QB 3LP0B 3KIOA 4EZ6A 1XI1A 5KT2A 2G8HA 4O0JA 4QWCA 3OYAA 2VG7A 3BQ0A 1BIZA 2D3UA 4CHOA 2OH2A 3H59A 1BHLA 1SV5A 3DRSA 3KMQA 2G8KA 3ZSXA 1SUQB 5KTQA 3ITHB 1S1UB 3QZ8A 3PW2A 2PYJA 2UVVA 2VWKA 4C8NA 5KFWA 5HROA 5EWEA 3MEEA 3VQAA 3TAMB 3H5SA 4M3YA 4CFBA 4WZQA 4B8CA 2E9ZA 2IJFA 4CE9A 2QKKA 3PJWA 3BJYA 4M95A 3KOAA 5KFAA 1NKBA 2YKMA 4TYAA 3DOKA 4ZP6A 2XCAA 1CLQA 1RNHA 3QINA 2ALZA 2HW3A 1HQEA 3IS9B 4QW9A 1JLBB 5KFPA 3N6NA 3L3VA 3SFUA 2RPIA 4W5OA 2W7PA 3LP0A 3BQ2A 1BL3A 4DWIA 3P83D 4CGFA 1RTJA 2IMWP 4J2AA 3LP3A 5C24B 3K5LA 2OPRB 4RG8A 3WNGA 4QWAA 1XHXA 4CCHA 1RT4A 1TV6A 4PUOB 2F96A 2OPPB 2W9CB 1FKOB 5HBMA 1GOBA 1UOCA 4CESA 4H54A 2FLLA 3EYZA 2RN2A 2NUBA 1T7PA 4ZVGA 4U6PA 3MECA 4FK4A 1XR7A 4M45A 5KFMA 3C6TB 2QXFA 3RB3A 1S0NA 4MFBA 4MH8A 1EETA 3L2WA 4QW8A 4YNQA 1S1TB 1CZ9A 4KO0A 3KK3A 4JLHA 3OJUA 3QEPA 4ZTFA 3KTQA 4HVJA 1N48A 4URGA 5KFLA 4DF4A 2W9BB 1BGXT 2BDPA 1C1CB 4IH6A 2QE5A 1HQUB 1JLAA 1LW2B 1WSGA 3GQCA 2D5RA 4CJPA 1HYZA 2P1JA 3KLIB 1JIHA 2IBKA 1G15A 5DMRA 1SH3A 4YFUA 3H4BA 1Q9YA 2JGUA 4PWDA 4IRKA 4G1QB 3OS2A 4ECZA 3HJFA 4B9TA 3KKRA 3HPOA 4FW1A 3JYTA 3IRXA 4OGEA 2XY5A 3NAEA 3RRHA 4CJVA 4FK2A 2XI3A 4R0EA 3AA2A 3QEVA 3HXMA 3VQDA 1JXEA 3HPGA 3IGNA 4B3OA 2Z1JA 1JKHB 1NHVA 3SQ0A 3RBDA 3PJXA 1U09A 3H98A 4Z4FA 5KFYA 2HNZA 4DFKA 4DSIA 2RF2A 1N4LA 4NLYA 3V6HA 4IFYB 4FVMA 3BGRA 2YNIA 2KZZA 4KAZA 3H5XA 1TQLA 3SI6A 3M8PB 1IKWB 1LW0A 2IGIA 2R2SA 4TXSA 4OGCA 5KFGA 3ZSVA 2DY4A 1RTHA 4NLTA 4CFCA 3L2UA 4EYIB 4G3IA 4DTXA 3EPIA 4C8KA 4K4SA 4RW6B 3AO2A 2R7YA 5KFHA 4LSNA 5D3GB 4YMEA 2XHBA 4GMJB 4DU4A 1REVA 2XCPA 1UA0A 3KLEA 2BANB 1RTDA 3SUPA 1HNIA 3IN5A 4RW9A 4IFVA 2OZSA 4R5PB 2OZMA 4E19A 2YNFB 3NMAA 3L2VA 4ZVHA 4FJ5A 1RYRA 1IH7A 4RNMA 4Z4GA 1U4BA 3ZSOA 2CKWA 3CFOA 1SH2A 3ZSYA 1TKZB 4KHMA 4DSJA 1GOCA 3RMAA 1FKPB 1XR5A 5F8LA 5EU7A 3ZT3A 2UVWA 3IGVA 4NCGB 5KFDA 5J2PA 4DQRA 4LSLB 1WAFA 3VQPA 5F8HA 2F8TA 1GX6A 4YR0A 1BIUA 4FW2A 4KAIA 3CQ8A 4R5PA 2FVSA 3U6FA 1JX4A 3ICLA 1Q9XA 4DG1A 4YR3A 4TSXA 4N5SA 2D41A 3S3OA 4CHZA 1TAUA 2ASLA 1HRHA 3H4DA 3KD5E 3KLEB 1RTDB 3NF8A 4KV8B 1QSYA 3PY8A 5L1IA 3KLIA 4JV1A 5C42A 5D3GA 4CGJA 2Z1GA 3OYFA 2HMIB 4AHSA 4BE0A 3GV5B 3H08A 2R8HA 1RBSA 3M9MB 1S1VA 1C1CA 1RA7A 4DFMA 2P5GA 2DPJA 4UQGA 1QTMA 1TKDA 5KFUA 1OS5A 3OVNA 1MU2B 3NH0A 4MQ3A 1IKYA 2IM0A 3AVHA 1QE1A 1I39A 2PZSA 3GV8B 1LW0B 3QGHA 4DSEA 3A2FA 4I7FA 2J6UA 4AHVA 3L2RA 4ZVEA 5KGWA 3MEGB 1RBVA 1WN7A 3AO3A 1TV6B 4PUOA 4O3OA 4OKJA 4DL7A 3OYLA 2KFNA 3VA3A 1JKHA 3QIDA 4OPKA 3T5KA 1W0HA 3T5JA 4ECWA 2AGQA 4O3QA 1B9DA 4F2SA 4M42A 3IRXB 3O3HA 3MR6A 1VSIA 1HQEB 2GV9A 3HT3A 3CYMA 4O0IA 2UUTA 2G8WA 5FDLA 3PX4A 2YHBA 1T03B 3V9WA 3PO4A 4OLBA 2WRMA 4N56A 2X6SA 1HJRA 4IG3B 1D5AA 2KW4A 1LW2A 3EY1A 2FC0A 3QEXA 4E1MA 5CYMA 4DU3A 1S4FA 3CWJA 3NF6A 4J9KA 5HROB 4J9NA 5HRPA 5KFJA 1T05B 4KI4A 3N6MA 1S5JA 1S1TA 1NOYA 4CJQA 3QETA 2BRLA 4NZ0A 3VA0A 3KHGA 2FBYA 1D9DA 4KHUA 2FJXA 1JL2A 2XRIA 1S9GB 1S9EB 1NNDA 4F50A 3GV7B 4CJSA 4KI6A 4I9QA 2VG7B 1YVUA 2WTFA 3KLVA 3KK1A 2R2TA 3C95A 3WNEA 2HNYB 3BSNA 2YKNA 3DOLB 2IJNA 4ECXA 3QLHA 3THVA 1KVBA 3QO9A 3OYMA 3V9XA 4Z0UA 3OYEA 2XGPA 1HPZB 3DLKB 3DYAB 3LWLA 3V6DA 1IO2A 3NAHA 3DOLA 4HUFA 5DK5A 3TANA 5CYQA 5KFEA 4YP3A 4IQXA 3K2PA 4C8MA 3CFPA 1YTUA 3CJ3A 3KK2B 5KFRA 2ZE2B 3PO5A 3HSTB 3HM9A 4DTJA 1TK8A 5L9XA 4WYWA 4KHWA 2W8KA 3FFIB 2V0NA 2FLNA 3PX6A 1T05A 3QYYA 3AVJA 3ZSQA 1C0UB 1VSHA 3L3UA 3GILA 4MKAA 1HMVB 4ECVA 1W9HA 1HNVA 4CECA 4RNOA 1KVAA 1C0UA 1FK9A 3CDEA 3ZSWA 5KT5A 3AO1A 2V9WA 4FLXA 3H40A 2HHWA 3F9KA 1QUVA 3ITHA 4F4YA 1QS4A 2DFEA 5FROA 4KKOB 3KK2A 4CJLA 5KRTA 4K4VA 4CGIA 3OS0A 4ED2A 1WSFA 4CFDA 1N6QA 3DI6A 4FJMA 3OL9A 4KFBB 4ECSA 3OYHA 4K8ZA 4EP4A 4O55A 1NKEA 1HPZA 3DLKA 4CHYA 4K4XA 1QQCA 4E7IA 3T1AA 1TKTA 2GUIA 4DMNA 2QV6A 4DL2A 4EBCA 4WFZA 4H4MA 3OYDA 3G10A 1BI4B 3AVBA 3RTVA 3VQ4A 4FLUA 3IG1A 1KTQA 4Q43A 1RDCA 1VSEA 4TN2A 1F21A 3L2QA 3I0SA 1RA6A 3AVFA 4ZPDA 3VQ8A 4E7JA 3SPYA 2BQRA 3LALA 2GC8A 2HAIA 2D0AA 3OYKA 1QE1B 3UR0A 1LV5A 4B9UA 4J2DA 1S9FA 1MU2A 2P51A 3DM2B 5KFKA 1D1UA 4CF1A 4MK7A 4Q0BB 4ZP9A 3Q8PB 4RW8A 3MXMA 1YVFA 1K6YA 2O4IA 1VSLA 4ZP8A 5C42B 4B9VA 2XI2A 2R8GA 5I3UB 4DTUA 3K5OA 2P5OA 3QNOA 4NLPA 4J9PA 4E7HA 1RTIB 2PY5A 1VRUB 4KHYA 1RT6B 2RKIA 1N5YB 1JLQA 2FVPA 2LSNA 3PVXA 3TABA 1TK0A 1KLNA 1NJWA 1TKXA 4Z4IA 4KHNA 2GIQA 5KFBA 1VRTB 2FBVA 1KLMB 1C6VA 4GW6A 4CK2A 2D0BA 4KRFA 3Q8QB 2VG6A 1ITGA 1DTQA 3TQ1A 3MEGA 4E3SA 3HVRA 2EX3A 4FJXA 4I7FB 3NF7A 4ECTA 4NLQA 1EX4A 4W5NA 3DMJB 2B43A 3M8RA 3V9ZA 1IKXA 4PQUA 5EDWA 4DS5A 4XPEA 1LWFA 2OA8A 3QZ7A 1RT5B 3PHEA 4FBUA 4NLGA 2QKBA 4NRUA 3KHLA 4E1NA 5HP1B 2EC0A 1S1VB 2FJWA 4EBEA 1QSSA 4B9LA 3AVCA 2FVQA 4IFVB 4EO6A 5KFQA 4ZTJA 4DTSA 5KRSA 5JUMA 4CEDA 5F8NA 2Z1IA 4KV8A 4PA1A 2XY6A 4W5RA 1RT3B 1RDAA 4RNHA 2I5JB 2AJQA 1NJYA 1HYVA 3GIKA 3AVIA 2IAJB 5HP1A 4KB0A 3CM5A 2W8LA 1R0AB 2HHXA 4AHUA 3CG7A 1IKXB 2OPSA 4EP5A 1RTHB 3T5HA 3DMJA 3LANA 3HP6A 2R2UA 3ZSRA 1IKWA 4K4WA 2JEFA 1FKPA 4O5BA 4CEZA 2UUWA 4BDPA 4HCBA 3SQ2A 3QIPB 4MIAA 1S49A 4QWDA 4DSKA 1RBUA 3K58A 3OYCA 4EO8A 1VRTA 4CJTA 4XO0A 2AWZA 2HNDB 3UPFA 3BSCA 4JRPA 3LDSA 4CJ3A 4WYLA 2ZD1A 1MMLA 1CXQA 1D9FA 2R2RA 4DF8A 2ZQBA 2I5JA 3KJVA 4FJNA 1JLQB 4Q8EA 1Q8IA 1VRUA 3M9OB 2ILYA 2JEGA 1RCHA 1REVB 2RDJA 2WCXA 3NF9A 3QGIA 3S3NA 3PW0A 4ZHRB 1WNSA 3K5NA 4QAGA 4RW7A 1JLAB 4RNFA 2DFFA 2E6LA 4CIGA 3KLGA 4QWEA 3ASMA 4Z4EA 1S1WB 4OPJA 4HKQA 4PQUB 4Y34A 1LWEA 1BISA 4DFJA 1ZBHA 1EETB 3DLGB 3EZUA 4FJ7A 4K4ZA 2VA2A 3BREA 4I2PB 4F4WA 4O44A 2V4RA 1HYSA 1NK8A 4OKEA 3OYIA 3IG1B 3NL0A 4KHQA 4YQWA 2YNHA 4DL3A 3OL7A 1RTJB 4CIFA 4NLVA 3HK2A 2WOMB 3DI6B 3H5UA 3LP2B 4OVLA 1TP7A 4QOZB 5HRSA 4F3TA 4FJJA 3LPUA 5HRRA 1JLBA 2HHSA 3V1QA 2JC1A 4RUAA 1RT6A 1BQNB 2RKIB 2Y1JA 3VQ5A 4DU1A 4G1QA 2D0CA 2B6AA 1Z25A 1IKVB 1JLEA 1XR6A 1RDDA 5T14A 3KLFB 1X9WA 5I3UA 2YKMB 1ZTWA 4M94A 1NK5A 1U49A 3ALYA 1SKRA 2E6MA 5L1KA 4CF0A 3OHBA 2EHGA 1HNVB 1LAWA 3NFAA 1KSPA 3SV4A 3TAMA 1S1XA 2HB5A 3AA5X 2QK9A 3SUNA 4FK0A 4RU9A 3KK3B 2FLPA 1S0OA 1JLGB 5KFNA 3V9SA 1UA1A 4LQ3A 3TWHA 3SZ2A 1NKCA 2IC3B 2ATLA 2E4LA 2HVHA 4Y1CA 5DG8A 4MIBA 2DPIA 2J6TA 5DQIA 4KB7A 1KVCA 4ZP7A 4B9NA 5SZTA 3SUQA 1VSJA 1D8YA 2OPPA 2W9CA 3V6JA 1ZBLA 3PV8A 5C25A 1HARA 3V6DB 4ZVFA 5CZ2A 2ETJA 4J9QA 4QWBA 4ID5A 4WXOA 1EKEA 4CHNA 1SL1A 3MXIA 4O4RA 1BCOA 3NH2A 1WLJA 1RDBA 3VQBA 3AVGA 1ZETA 4GVMA 4DTRA 5KFOA 1K1QA 4K8XA 1S9EA 1S9GA 2AX0A 4KKOA 2KFZA 3DLBA 2UVRA 1JLGA 3OYJA 4ZPAA 3LZJA 4LH4A 5EUHA 4F3OA 5F8GA 3H5YA 5C5JA 4DTOA 1ASWA 2R8KA 1UAXA 3HP9A 4NLXA 1L5UA 4F4KA 4I2QB 4J2EA 5CYMB 4K4TA 4Z4CA 4I2QA 3I5AA 3RAXA 3OL8A 3M9NB 4O3NA 4CEEA 1S1UA 3FFIA 5L1LA 1T3NA 3G0ZA 4FJLA 1SV5B 5FDLB 4J9SA 4QPXA 1YT3A 1A5WA 2BE2A 1CZBA 5KG7A 1NJXA 3OL6A 4ED1A 1Z4UA 2WOMA 5EWGA 3K5MA 4M3XA 1NK7A 4ID5B 1S97A 3G6YA 2F8SA 1KHWA 3QO9B 2VG5A 4Q8FA 3ISNC 3RMBA 3KK1B 3V4IB 3BQ1A 1NK4A 2XY8A 1HYSB 5KFSA 1X9MA 1RBTA 4CJUA 3NDKA 4IG0A 4X2BA 3RMCA 2JLEA 1JLFB 1SH0A 4CF9A 5KFFA 3LZIA 3VN5A 4WZMA 1IKYB 1LWEB 3QIOA 2J6SA 3S9HA 3CDWA 2O5DA 5I42B 2HVIA 2DTUA 3KLGB 2AGPA 1C1BB 3D0PA 4DL6A 3IAYA 4KE5A 4BE1A 2C2EA 3DLEA 4RW7B 3SNNA 4ZHRA 4OL8A 1JXLA 5DQHA 2RDIA 3LP1B 3ZT0A 5J2NB 1T03A 4M3RA 5KFIA 3OLAA 4NYZA 3B6PA 1LWCA 4LY7A 4FJHA 2G8IA 4ICLA 3CJ0A 2G8FA 3NGYA 1NHUA 2OPQB 2BR0A 2GIRA 3TI0A 4ELUA 4IR1A 2IDOA 2WK4A 5KG6A 2ILZA 4DLGA 4ZPCA 1XC9A 4M3WA 2HNDA 3NBPB 4NLUA 3VQ9A 5JXSA 1TGOA 2XGQA 4E89A 2GBZA 2YNHB 4NLRA 4NCGA 3LWMA 3CO9A 5DGAA 2OYQA 1C0MA 2BRKA 4TY8B 1TKZA 3TR8A 3TAFA 3NE6A 3I5BA 4PY5A 4KSEB 1TL3B 4KPYA 1J9AA 1RT2B 3DLGA 3WNFA 4CJKA 2OPSB 4CEBA 2IM3A 5KI6A 4FZYA 1R0AA 3ZT2A 1EXQA 2A1RA 3SCXA 2G8VA 5SWMA 3I0RB 1NK6A 2WONA 3TAPA 4ED0A 5DG7A 4BDYA 4W5TA 3WNHA 1HNIB 3V6KA 5KT4A 2BANA 3SJJA 4HUEA 4K50A 4M3TA 2HHVA 4Q5VA 3FDSA 4ED8A 5E41A 3DDKA 4CK3A 4MKBA 4ECYA 4LSNB 4FS1A 5KT6A 2X74A 3MR5A 1RILA 4CF2A 2ZD1B 4M3ZA 4DG1B 4FZZA 2Q3SA 3C6UB 4URQU 1VSDA 3OJSA 4F4ZA 4GC7A 4OJRA 3CJ4A 4LSLA 1KFSA 4F4XA 1TL1A 4J9OA 4TY8A 4H4OA 4M3UA 4WFYA 1RT7A 3TARA 1NK9A 1NOZA 1TL1B 4BE2A 1QAIA 3AA3A 2VG6B 5J1EA 5KFCA 4BDZA 4ID1A 2IOCA 3LAKA 1NJZA 4JS4A 4B3OB 3DRPA 1ASVA 1B92A 3RAQA 5KFXA 2HHUA 1XWLA 4DQSA 4FM2A 1BQMA 3HKWA 4AILC 1IM4A 4ICLB 3ZT4A 5JS2A 4WE1A 1L3VA 1LWCB 2X78A 3KHRA 2CJQA 1RTIA 3M8QA 1RT1B 1T8EA 4DSFA 3DLRA 1U47A 1D0EA 4ED3A 4CK1A 2KQ2A 4CHQA 4HCCA 3HVAA 2Y1IA 2G8UA 5EWFA 3D5MA 4TLRA 4RW8B 4KHRA 3CJ5A 3PZPA 4CJRA 2WONB 4EYHB 1C1BA 4Q0BA 2AU0A 3OS1A 4ELVA 4BACA 4DQPA 4FLZA 5I42A 4DQQA 1S10A 4IRCA 3AVAA 4DL5A 4J9RA 4YR2A 5KFTA 1S6QB 3MF5A 4IKAA 1RT2A 4KTZA 2XY7A 4RUCA 5KG3A 4IG0B 5KGXA 3I0SB 3BGRB 1IG9A 2PYLA 3VQ7A 3M8SA 2AGOA 1DTQB 4NYFA 1QHTA 1ASUA 4H4MB 4OKKA 1KLMA 5DLGA 2FVCA 3LAMA 1VSKA 2BGGA 3KHHA 1JLCB 3F73A 5C24A 1RAJA 3O4NA 4NYNA 4CEFA 4R8UA 4JS5A 5DLFA 4CJ4A 4CEQA 4JRQA 3GYNA 1KHVA 4XIUA 3GIJA 1J53A 4IH5A 1N56A 3DRRB 1Z26A 4KTQA 4FCYA 3AO4A 3H2LA 4NLOA 3AA4A 1S48A 5KG1A 2DFHA 3DLEB 3TAGA 3MR2A 4AH9A 4EEYA 5J2MB 2C28A 4IR9A 2BQ3A 3DM2A 2F8EX 4DTPA 4FM1A 1U48A 4E0DA 2XC9A 4HUGA 1SKSA 3OYGA 4IBNA 1SL2A 3PX0A 4RW4A 3HPHA 3VQEA 3KKSA 3C6TA 3MR3A 3T3FA 3NHGA 3V4IA 3P1GA 4Y3CA 5DGBA 1L3TA 3K57A 5HBMB 1FKOA 3E51A 3VQCA 3E01A 4C8LA 1T94A 1RT4B 2ASJA 2IM2A 3ZT1A 4DL4A 2E9RX 4IDKB 3BSAA 4N76A 4IDKA 3PR5B 3G86A 5C25B 1QAJA 4KFBA 4FLTA 2IA6A 2YKNB 2HNYA 4B9SA 4NCBA 3PW7A 4O3SA 3FQKA 2ATQA 4NLDA 2BE2B 3IS9A 3ZSZA 4HHTA 1U45A 5F8MA 5HLFB 3CIZA 3SYZA 3VQSA 4J9MA 1CXUA 3V81B 4FS2A 4RW4B 3G6VA 3BSOA 4CGGA 1XHZA 5CZ1A 4Y1DA 4IH7A 3G6XA 1WSHA 1X9SA 5K14B 4M41A 3EZ5A 3MEEB 2HHQA 4IG3A 4FLYA 4TQSA 3FRZA 3AVMA 4FZXC 3KLFA 4O3RA 3MEDA 3V81A 3MTKA 3MFIA 4JV0A 2C2DA 1IKVA 2VA3A 2B6AB 3D45A 1TAQA 4ELTA 1BQNA 1VSFA 5CY4A 3O3GA 5HLFA 3BDPA 4NLWA 5KG4A 3FQLA 1BCMA 3LP2A 3LPTA 4R8UB 4FJ9A 3DYAA 1A5XA 1ZTTA 1JLCA 1K1SA 5KT7A 1DLOB 3ULDA 3OSPA 3RB6A 1JL1A 4N41A 3E01B 3VQQA 1ZBIA 5L1JA 4C8OA 3BR9A 2HHTA 1NK0A 5J2QB 4I2PA 3QESA 4DTMA 2IC3A 3RRGA 3Q8RB 3AO5A 4CGHA 3NGDA 1S6QA 2XO7A 3KLHB 3OLBA 1TVRB 5F9NA 3GIIA 5FRMA 1S1WA 2B5JB 3V9UA 4LD0A 3T5LA 1S1XB 1DTTA 1UWBB 3RR8A 3OSNA 3NCIA 4CIEA 5J2MA 1J54A 2YHAA 3SFGA 1KRPA 3KNAA 3N6LA 4ECQA 1L3UA 2FVRA 3D28A 4FM0A 3GIMA 4J9LA 3Q8SB 3RWUA 3DRRA 2R8IA 2HWHA 1RT1A 3M8QB 1W25A 1JLEB 5HRNA 4CERA 4Y2AA 4DEZA 4CGDA 1KFDA 3RR7A 2D7SA 3L8BA 3QGGA 3KJVB 2BQUA 3OY9A 2R8JA 1QSLA 3NH1A 2I1RA 2YNGA 3HVTA 3CM6A 3I5CA 3ISND 4DTNA 2V4QA 2YV0X 3JSMB 2ASDA 4L8RB 3RB0A 4U7CA 3PUFA 4FLVA 5F9LA 4HYKA 4URSA 1LAVA 1C2PA 5J1EB 5J2PB 4ZPBA 2C22A 2IM1A 3QIPA 4CJFA 1GOAA 3CVKA 2W7OA 1U04A 1RT7B 4H4OB 1WAJA 3FSIA 1Y97A 4O44B 4E7KA 4TYBA 3V1RA 5DQGA 4IRDA 2W42A 3AVKA 4XPCA 4IOBA 1J5OB 4ED7A 3C6UA 3CJ2A 4CJ5A 4CHPA 2VWJA 4MK8A 4Z4HA 2FBTA 3MFHA 2AQ4A 3SQ4A 3RBEA 2FJVA 5KT3A 4DS4A 3SV3A 1TK5A 1WSEA 1C1AA 4RW9B 1RT3A 2HMIA 4FLWA 2ITGA 4NCAA 1ZBFA 1RBRA 4KBIA 4FJGA 4WE1B 4WXWA 4WFXA 4O4GB 4CJWA 4DFPA 1C0TB 3O3FA 1GX5A 2Z1HA 1BQMB 3O4QA 4NRTA 4J2BA 4ECUA 4LH5A 4B08A 3DRPB 1LWFB 4AHCA 3SQ1A 1J5OA 3PW4A 3CFRA 3S3MA 4TQRA 3V1OA 3NGZA 1EP4B 3PR4A 2AX1A 1L3SA 5KG5A 1RYSA 1S6PB 2C2RA 4F8RA 4IFYA 2FBXA 3U3GA 4O3PA 2KZMA 3AV9A 5KG0A 2A1SA 3SUOA 1S6PA 2JEJA 2HNZB 5KFZA 3NKYA 2WHOA 3HL8A 1EP4A 3NBPA 4K4UA 3OYBA 4FJKA 4KHSA 2YNFA 4RNNA 4CEOA 3HHKA 4GC6A 2IAJA 3HVWA 1WNEA 4Q45A 2YNGB 3HVTB 4ZMMA 1C0TA 3UDLA 4O4GA 1SKWA 5F8JA 3TAQA 2XWYA 3P5JA 2UVUA 5J2NA 4IKFA 4JUZA 1O1WA 4QCLA 3UIQA 2KTQA 4N47A 3B6OA 4FJ8A 1HQUA 2O4GA 3I0RA 1I6JA 4RW6A 4MK9A 1CSJA 1DTTB 2W9BA 2B5JA 5F8IA 1RT5A 4KO0B 1TVRA 3EPGA 3AVNA 4B9MA 2D3ZA 4NLSA 3TAEA 3K59A 3SPZA 4FJIA 4MFBB 3NGIA 1A5VA 5DG9A 4FBTA 3M8PA 1TL3A 4LQ9A 5JS1A 4AHRA 2IS3A 5J2QA 4CFAA 3NAIA 2HWIA 2YNIB 3T19A 2B4JA 3OYNA 5KG2A 4CF8A 3QEIA 3QNNA 3QEWA 2RF2B 1BI4A 4AHTA 4Y2CA 4W5QA 3U3YA 4FXDA 2OPRA 1B9FA 4FYDA 2WB4A 3JSMA 1ZBUA 1TKXB 4CEAA 3TVKA 4CJEA 4RZRA 2OPQA 3KMSA 4DQIA 3JYTB 1WSIA 4TY9A 4I9LA 4DLEA 1N5YA 4HTUA 2JC0A 1WSJA 2W9AA 4B8AB 3KD1E 4PWDB 1VK0A 5T7BA 4BWMA 3MEDB 4ED6A 1YTAA 4BWJA 3HYFA 3DOKB 2ZKUA 3MXJA 4OLAA 3LP1A 3UQSA 1KCFA 1S0MA 1FK9B 3CDUA 3MAQA 1X1PA 1VSMA 4KREA 3DLHA 1ZYQA 5K14A 3OHAA 1HMVA 1UWBA 3ZCMA 1I3AA 3AVLA 1SL0A 2E9TA 3QERA 3KLHA 4E7LA 4KB1A 1SUQA 3DRSB 2JEIA 4K4YA 1JLFA 4F2RA 4ECRA 2ZE2A 4JV2A 4EZ9A
chains in the Genus database with same CATH superfamily
4NI2B 1HNZJ 3PW5A 5LL6d 4J8FA 4KTWA 2QMXA 3OBIA 4QQBA 1YWXA 3I8DA 5DDQC 2RQMA 4DSLA 4ZVSB 1VQOS 1TKTB 1UZHA 2GS8A 4NEYA 1PKUA 3D6FB 3V5RA 2GHVC 4LFCJ 2NXUA 2WC9A 3FSXA 4QU6A 3EXYA 3ET6B 4EZ6A 1XI1A 4QWCA 3BQ0A 4CZJA 2ZJRL 3T1YJ 3H59A 2M8DB 1BHLA 3VEZA 2B9XA 1WC6A 1DKGD 2G8KA 2ACMA 3ITHB 3QZ8A 3NCQA 3UE5A 1A0OB 1KVIA 4BGAA 2VWKA 5C15A 5HROA 3MEEA 1AT1B 1HPMA 4OI2A 4H0TB 5IT9U 1UVMA 1NH7A 2YPYA 4LF2A 4QZVB 3PG9A 3BJYA 2CJXB 4A8SA 2FHJD 3MUVP 5KFAA 3GPAA 3TTCA 2YKMA 4K5SA 3I33A 3PCOB 1CLQA 4ILLA 4IQMA 2HHHF 4X66F 1HQEA 5KFPA 4S0MA 2CRLA 3SFUA 4W5OA 1BWFO 3LP0A 3MN7A 2WSFC 4X66K 3J7AP 4CGFA 3N5BA 1RTJA 2LMIA 4J2AA 3LP3A 3WNGA 4U9RA 3JTOA 3VR1A 3AJ2A 4G1PA 3R2CJ 2HVEA 3QT8A 3UCZP 3MM8A 2F96A 1GOBA 4A8QA 3CCLN 1YZ7A 5AJ3J 4ZVGA 4EAHD 3MECA 4FK4A 1XR7A 4R0JA 3D54A 2QXFA 2WBMA 4MH8A 1EETA 3ELHA 4A4JA 1CZ9A 3OJUA 4ZTFA 2MKKA 4HVJA 4CO2A 1N48A 2RUGA 3HHNB 4P73A 5KFLA 4DF4A 1WJ9A 2MQ8A 2QLBB 5DJBA 3L09A 2E66A 7FD1A 4I6WA 2D5RA 5K8NA 1XMBA 2HBQB 3O9QA 4OZ0A 4YDDB 5DMRA 1D9AA 1Q9YA 3ENWA 3HJVA 4IRKA 4EU0A 1OVQA 1Z2LA 2KU7A 2F8MA 1NB7A 3KKRA 4C11B 3MX2A 4FK2A 5CZVA 4R0EA 3QEVA 1VQ9N 3HHLA 1P27B 3IGNA 5LMUJ 4B3OA 3GB0A 3RBDA 4B3MJ 4LF5F 3QT7A 4LF6K 2UXBK 3IAM9 3W8GA 2HNZA 3JXOA 4DSIA 1N4LA 4NLYA 2P9LB 4R25A 3BGRA 2CQ1A 1SQFA 4YY3F 5LSLA 3SI6A 4OI6A 4OGCA 4OYIA 3RW6A 2DY4A 1R7IA 2BW2A 4LJMA 1RTHA 1C4AA 1X3MA 4CLLA 4G3IA 2DH8A 2DCUB 1S76D 3M6GA 4UQTA 4OX9K 4RW6B 2E1ZA 3E9PA 4ZCLA 2R7YA 3P49B 3THWB 3GFZA 3T1HJ 3WHIA 3TQEA 4LSNA 2H48B 1F3FA 4ES2A 4WK1A 2H51B 1N34J 4GMJB 2U2FA 1FA0A 5B0GA 2XCPA 1RTDA 1ZS6A 1HNIA 6AT1B 4ISFA 2DCLA 2HEKA 2QIFA 2KH9A 1IBKJ 2CWXA 2ZH1A 4CH0S 3L2VA 2C2MB 1WEYA 4HR2A 4LBIA 1IH7A 1H74A 2HHHJ 4M1KA 1QY7A 3JAMY 2CKWA 3EVMA 2YHXA 4DSJA 1GOCA 3TVYA 1XR5A 1KONA 2DRBA 2DNNA 5F8HA 1IG8A 4YR0A 5F0WA 1ITPA 2HFZA 2GAGC 4KAIA 1CJTB 3ICLA 4C3LA 2VGMA 1JXVA 1FX2A 3ZTOA 1Q78A 2D41A 4I0WA 1DFDA 5IM0A 3E2EA 5E3AA 3JTNA 3I82A 1HRHA 3KD5E 3KLEB 2E1AA 3A8EA 3AB2B 5IT9Y 3MHYA 2Z1GA 3P4IA 4MKVA 3RU0A 1AW0A 4BVPA 1JNZB 3C16A 2XHCA 1C1CA 3K0SA 1RA7A 1QTMA 2GX9A 5KFUA 4UZBA 2KRRA 1MU2B 3BN4A 3BO2A 1NLVA 1YUWA 2IM0A 3BYPA 3EE9A 1Y3KA 3GV8B 4OYXA 4DSEA 4ZJOA 5H1SV 1H98A 4H4KC 4PR6A 3FZFA 5AQZA 2J6UA 4AHVA 4UW2A 4C48A 3OR1A 3VALA 5BJRA 4DKWA 5JVGQ 1NSQA 1K73O 4OPHA 4DL7A 2KFNA 2HK3A 1JKHA 3QIDA 3CCMS 3JAMU 3T5KA 3T5JA 4BVOA 2AGQA 1VBXA 1MLAA 4F2SA 3PYFA 1MW7A 3NWGA 3K8WA 4OV1A 2DNGA 4UY8T 3O3HA 1VK3A 3VAMA 2CWKA 2YY3A 3DRXA 3V9WA 4DV2J 4CZFA 1BOTO 4N56A 4X64F 2V63A 1U1PA 2VONA 1HJRA 2QFIA 3GFYA 1D5AA 1GXLA 5AQKA 3QEXA 1S4FA 3NF6A 4HH1A 4J9KA 2OJ3A 1GLJO 4V19S 5HRPA 4KI4A 1T05B 1YLXA 5A76A 4CJQA 4RX6A 3QETA 1ZAXA 4Q2MA 2FBYA 3MMJA 1D9DA 1JL2A 4F50A 4KI6A 4I9QA 3ZZOA 1DHMA 4D3GA 1KQSM 2R2TA 2VDHA 2CQDA 3AJ1A 2IJNA 1LFPA 1KVBA 5D8HB 2FGCA 1IJJA 3DLKB 1Z1ZA 3T69A 5C2FA 2LFVA 4HUFA 1WF0A 4A8KA 2HQ3A 5ETOA 5ETPA 1YTUA 3KK2B 4EWTA 1SQKA 2H65B 1EWQA 2E7XA 2MJNA 4IFEA 2R7TA 4BY9C 3IKMA 4NO7A 1T05A 2GA7A 4FZVA 3ZSQA 3MTJA 1KNZA 4OZ1A 3L3UA 3GILA 4IYQA 1HMVB 4OO1J 4CECA 5CR4A 4B3TF 1B7YB 2MTLA 5LT5A 1C0UA 4E8UA 3ZSWA 1I51B 4FLXA 3H40A 2DEIA 3F9KA 3GCWP 5A8KB 2O8EA 1IBKK 3J7YI 1QS4A 1UL3A 5DDOC 4KKOB 5KRTA 4K4VA 2WVFA 4JKAA 3J81Y 4ED2A 1VQPS 4KFBB 1XQIA 4ZITA 2RQCA 3JSBA 5AQHA 5ETNA 1YHQS 4EP4A 1D09B 3TZWA 1QQCA 3T1AA 2GUIA 2LCWA 4DL2A 4JHDB 5AFUA 2I0XA 2F5GA 3AVBA 3Q8UA 2QWOA 2VYPA 4NLCA 3OR1B 3C15A 1UVJA 5U47A 1TL5A 3I0SA 4AM7A 1NUEA 2E44A 3LALA 1F5BA 3DOMB 3O9RA 5HANA 4B9UA 4J2DA 1S9FA 1MU2A 3W1YC 3DM2B 1IBLJ 3ATVA 2XMUA 4JKGB 4Q0BB 1FJGF 3CCSN 4EGLA 2CAJA 4Y0WA 2VJVA 3QT5A 2JH3A 4DTUA 4DV4K 3CMAN 4LF6F 3EGVA 3AY9A 4E7HA 1RWXB 1FCAA 3E1YA 2ZJQL 1JLQA 3BF1A 2FVPA 2JVRA 2VL1A 2LSNA 3B8AX 5K5MA 3D0HE 1TK0A 3W66A 4DV7K 2RB7A 1RLDA 2A1BA 2GIQA 5KFBA 4PXEA 4EIAA 4CK2A 4KRFA 5GADU 1ITGA 3QMLA 3MEGA 3E3XA 5LJ5Y 2ZBPA 4DV2K 4NLQA 4I68A 3D0IE 4DU7A 4EMDA 4PQUA 2NZCA 5EDWA 2OA8A 4NLGA 4P7TA 3KHLA 4L3KA 1XMQJ 1HKAA 4ILHA 3QJPA 4AE5A 2FJWA 2P9IA 1RAFB 1TUGB 3AVCA 3FBBA 2FDNA 4EO6A 5KFQA 1U26A 1RCOB 3EGZA 1YXQA 4DCHA 4DTSA 3ZZRA 5KRSA 1KD1T 2YQ1A 4CEDA 4KIAA 5F8NA 1T3OA 4JD2B 3ZZUA 1F0XA 1HI1A 3A5LC 2G1HA 1S3XA 3CCRN 1VQNN 3OTOF 2YBVA 3IFEA 1RWUA 3F9MA 1VQPN 3AVIA 3I9ZA 3PLAA 5HP1A 4KB0A 2VQEK 4AHUA 1YIJN 2Q43A 4DV5J 2OPSA 1RTHB 4WF9Q 3T5HA 3B82A 3LANA 4DV4J 4K25A 2JEFA 4O5BA 2YJFA 3TEHB 4BDPA 4HCBA 1SAZA 3HTVA 3I96A 2KG1A 2P5VA 4MIAA 4QWDA 1ZAWA 2YWGA 4DSKA 2POKA 4Y00A 2KN4A 3N4WA 4XO0A 2AWZA 1KTVA 1UKUA 3PIPL 2CZVC 5KQ8A 3A5OC 3QBWA 4ZCIA 1MMLA 2I5JA 4FJNA 2I8EA 2ILYA 2DHHA 1U1MA 2RDJA 1OQ3A 2CPXA 2VIHA 4YB1P 4QAGA 4RW7A 2Y1RI 1AXQA 1HA1A 1NEEA 2M5YA 2E6LA 4YDUA 4CIGA 2E5JA 1VI7A 3GTYX 1S1WB 1WD6A 4CM0A 1LQ9A 1ATSA 1MN9A 3ZZTA 1GAOA 4DFJA 1EETB 3G9CA 3EZUA 3E66A 3TZYA 2VA2A 3LDQA 5HSPA 3BREA 4I2PB 3CD5A 5IXUA 5IWAF 3MPDA 3J7Z5 2V4RA 3TZXA 4DPYA 4LF4F 4RTFD 4OKEA 2ZHOA 3GR1A 3WXMB 1GMWA 1X4DA 3ONQA 1E3MA 1RTJB 1UCNA 2C3UA 3HK2A 2OHDA 3DI6B 3WDOA 3H5UA 1DEJA 3LP2B 3FVYA 1PJ5A 2IPOB 4DR3K 1RB0A 5HRSA 2WSCC 3D2WA 5HRRA 4PEOA 1RWPB 4QIGA 3NOGA 2Y1JA 3VQ5A 4G1QA 1Z25A 3MPWA 1JLEA 5T14A 2BXJA 1EKRA 1X9WA 5I3UA 2YKMB 2J9DA 5G0RB 4M94A 2XYGB 3AQPA 3VEVA 2D1KA 1IBMK 2X1BA 4TU9A 4CF0A 1HNVB 2FD2A 3SLCA 4KY3A 1GT8A 1U1RA 4QIVA 4FK0A 4Z7YA 2MLXA 3ILJA 5KFNA 1Q95G 1UA1A 3TWHA 4N7TA 1FXDA 2ATLA 2E4LA 4MIBA 3RVCA 2YWKA 2J6TA 4IO8A 4ZP7A 3GBTA 2XWXA 1SC1B 1K47A 1HHQA 2W9CA 4ZVOB 1RAOA 1VC0A 4A5BA 2RJZA 4BCAA 3V6DB 4JV5J 4QBUA 4J9QA 5GAHP 3CCMN 1SL1A 2W2OP 2FXUA 1V3RA 3LDPA 4RWWA 3CCJN 1ZETA 2VPXB 4DTRA 1YJTA 5KFOA 2XZTB 1VBZA 2AX0A 4DR1K 3DLBA 3C19A 1HHSA 1IBKF 4KQZA 4XK8C 2OLWA 1KQFB 4ZPAA 3LZJA 2MDAA 5EUHA 3H5YA 2NNWA 1UAXA 3PYDA 4J9UE 2P6SA 4I2QB 3A1YG 4K4TA 3E9LA 2QN6B 3OL8A 4KR0B 3O44A 4DJBA 1ZZFA 4CEEA 2VFSA 4KRWA 1B0TA 3G0ZA 4FJLA 4OHZA 1SV5B 2HBMA 5A2QY 4GKKJ 1M1KT 2UUBK 3OL6A 2VF3A 2WOMA 4BQZA 1ESVA 1NK7A 4ID5B 5CAAA 1XNRK 2J5AA 1KHWA 3M05A 3D3CJ 1YJWN 4HI2A 2V5HG 3GJSB 4Q8FA 1G6BA 2JVOA 3RMBA 4B1WB 1RWNB 1KOOA 3KK1B 4USIA 3V4IB 3BQ1A 1V9OA 1NK4A 3FKBA 2HQCA 3GDQA 1JLFB 3QT6A 4CF9A 5KFFA 4ATNA 3D2FA 4KT0C 3VN5A 4KGXB 3QIOA 3S9HA 2CDRB 4WU3A 2DTUA 1N8RO 4LFCK 1XBWA 2GJFA 1C1BB 3MCAB 3D0PA 1PILA 3IAYA 1F2GA 2C2EA 2VV5A 2K8GA 3SNNA 4ES1A 2E88A 3LP1B 5J2NB 3BBFA 3CXCR 2MSTA 3EJMA 3OLAA 3Q0AA 3MGJA 1VQ7N 4LY7A 4FJHA 5BPLA 2G8IA 4ICLA 3CJ0A 2EW9A 3NGYA 1WHVA 1S77D 2UUAF 1HNWK 2EEYA 2QXLA 4NMLA 3KWGA 2EFNA 2GIRA 4ELUA 3MOZA 3QRRA 2WK4A 3R97A 1JJCB 3ZX2A 2HNDA 2UV8G 1A6LA 3NBPB 1G3OA 2B3TB 5JXSA 3ENVA 1GMVA 4JI7K 2YNHB 4NCGA 4WQ5C 4OJ3A 4JKCA 3BR8A 2OYQA 5AQXA 1C0MA 2BRKA 5CE3A 3TR8A 1DQAA 2AKWB 4TKTA 3S41A 1KN6A 2YWWA 3TA2A 1M90T 3DLGA 1QHAA 2W7AA 4LF6J 4CJKA 5B0AA 3VVTA 3DC2A 3SDEB 3HZGA 2ZM6J 4JKEA 3WXKA 1EXQA 3SCXA 3FC9A 1U2FA 2GWJA 5SWMA 1X0PA 4BDYA 3HI9A 3MMBA 2JDJA 4N8NA 3V6KA 1VHIA 2VBWA 4U96A 4I56A 4Q5VA 3FDSA 2EVZA 3R5JB 4ECYA 4CZGA 4EK2A 1M5KC 2R4FA 3TTDA 3MR5A 1N5QA 4CZEA 2GZOA 1RILA 1EQYA 4M3ZA 1YI2S 1DGKN 2K1RB 1SBRA 4AYBD 2V94A 3TWZA 2DR5A 4JYAJ 2V52B 2B9YA 4U67L 3VGLA 3UN5A 1RAIB 3UN2A 4Z94A 3QWUA 4C0BA 1F3VA 1QQOA 1RT7A 3H45C 2W4DA 1IQTA 1NK9A 1QAIA 5J1EA 2BJ1A 3D7EO 1YITN 5GAGU 1ASVA 4JBCA 1WBBA 4FWOA 1ZXOA 5D0HA 4DQSA 5M2PA 2XMJA 5GAEP 1SVDA 2IRXA 4KH0B 2KDOA 4MO4A 4ICLB 1HJOA 4K2JA 5JS2A 3KHRA 4X4VA 3D6MB 4LMZA 4EFAC 1WKKA 4TLRA 4RW8B 4AD6A 2AMCB 1C1BA 3OS1A 1V4TA 5AXMA 2KI2A 2PBDA 3DXSX 2E5LJ 3HSJA 4YR2A 4WQ4C 3MF5A 2K3KA 1LFWA 1NHKL 4WPAA 3AODA 1R27B 2M70A 3O6QA 1DTQB 3EDQB 4OX8A 3NEKA 2FVCA 1RAJA 2E1PA 1OPIA 3IXQA 4NYNA 4K5RA 1U0HB 4R8UA 2DIUA 4JS5A 1PIEA 3OW2M 5GAEU 1T9YA 4DXLA 4CEQA 4C9DA 3CJBA 2BE9B 1HNZK 2DO0A 3DRRB 3AQOA 1RTZA 1T3VA 2CYYA 4JI5F 4LRDA 4YOYA 4NLOA 3AA4A 5IWAJ 2WVCA 4YY3K 4EEYA 4V1Ak 4AL6A 4RKUC 4FM1A 1SKSA 2Q36A 2FY8A 2BVZA 1ZM2A 4IWVA 3KKSA 3C6TA 4X4PA 5JVHL 3HM8A 3CF5Q 3V4IA 1OYEA 4Y3CA 2OKQA 5DGBA 1L3TA 4U7UK 2UP1A 6FDRA 2ASJA 3MURP 2IM2A 3ZT1A 4QR0A 1P90A 1JJ4A 1ELOA 3R6LB 4IDKA 5AQGA 5GINA 1HKGA 1WF1A 2MJUA 1Q82O 4NLDA 4ILGB 1HLWA 3ZSZA 4HHTA 1VHXA 5HLFB 3SYZA 4CQ1A 2P9PB 2CVIA 1KDNA 1VQON 4RW4B 3G6VA 2Z2MA 1WSHA 1X9SA 5K14B 4M41A 3EUNA 4CLYA 4F02A 2QFJA 1K9MT 1R59O 5G0RA 2Y1LB 3ZTPA 5CA5A 2JLGA 2X3DA 4K8RA 3V81A 3MFIA 1KBRA 1NM1A 3D45A 1VSFA 3WQPA 3I56S 1O8BA 3BDPA 5D0EA 2KL8A 5KG4A 3LP2A 4DR2J 4NLBA 2YCHA 2GJ2A 3ISZA 1JLCA 5M1PA 5DM6Q 2IFXA 2Y0BB 3BO4A 4N41A 1MMDA 3BO3A 2IBOA 4JI8K 4XEIA 1ZBIA 1GEHA 3CNQP 2LU2A 2J9EA 3GJRB 3BR9A 2BKPA 2E2NA 4DPXA 5J2QB 4I2PA 2ZKTA 4X4SA 2AEFA 3BH7B 2IYIA 1VS3A 1PJ6A 3RGIA 2PFDA 5J1NA 3T41A 1S1WA 3CTRA 9ATCB 3V9UA 1OH7A 4LREA 3RR8A 5J2MA 1VQYA 2XSJB 2DITA 1D3WA 1ZAVA 3KNAA 3N6LA 4ECQA 2BTFA 3O4WA 2KHCA 1ZA1B 1L3UA 5M2UA 5B0FA 3U1MA 1N33J 3Q8SB 2HWHA 1W25A 2WB1D 3VMFB 1JLEB 1RADB 1GK8A 4XH1A 4CERA 4CGDA 1KFDA 5E3PA 3L8BA 1IJEB 1E4FT 2VC0A 2AZ1A 3PDNA 1QSLA 2I1RA 2ZHBA 2YNGA 2H1YA 2V4QA 3JSRA 4ZVPB 1B7FA 3P39A 2CFXA 5M1FA 4L8RB 1TL7B 1F9FA 4JK9A 2NUHA 4DV0K 2AYMA 4CI0B 4CJFA 1GOAA 3CVKA 2W7OA 1HLUA 3WQUA 3FZKA 1LWXA 4H4OB 1WAJA 2KM8B 3FSIA 3C7NA 1MROB 3ZEUA 5THWA 3MWPA 4IRDA 4XDCA 4XPCA 2GNKA 2MY7A 3AT1B 3Q86A 4ED7A 3C6UA 3CJ2A 3BP8A 5D4PA 4MK8A 2C2ZB 2GW8A 3MFHA 3SQ4A 5M1QA 5KT3A 1BWEA 1HBOB 2MKHA 1JWWA 1WSEA 3PSFA 2HMIA 2IA0A 3O1WA 5LMUF 1YX2A 2W1BA 3OA9A 1WI8A 4X4NA 5AQVA 4WXWA 3W63A 4O4GB 1K9MO 3AOCA 2GUPA 3O3FA 1LK7A 1HW8A 2VKZG 3P38A 4PL7A 4FVUA 1FE0A 4ECUA 3OXLA 4B08A 3PKYA 3DRPB 4AHCA 4JI1K 1J5OA 3PW4A 3CFRA 1CULA 3S3MA 1P6TA 4TQRA 4RPFA 2J7KA 4AQYF 4JI0J 2AX1A 5KG5A 2DTJA 1RWMB 4IFYA 5H9EK 4LFBF 4PG8A 3AV9A 4CLSA 2NR0A 1S6PA 4BRMA 4BG8A 3EGWB 2PN6A 3HL8A 4PWUA 2DGXA 2YNFA 2CH6A 1FRMA 3HVWA 5AQNA 2CQBA 2DGSA 3THXB 1HKCA 3JS9A 1UEUA 4JD2A 5HI7A 4DR6F 3K2YA 2DR8A 1WI6A 2HWTA 2KTQA 2C3MA 1KAZA 2DNRA 3A8YA 1TUVA 4JKGA 4BC9A 2W9BA 4BR9A 4QS8A 4UY8O 4DV5F 4KO0B 1TVRA 4B9MA 2RT3A 2P8IA 1C0GA 1XK8A 1L3KA 5DG9A 4FBTA 2BH1A 2UXBF 2IS3A 4CFAA 2QWPA 2HWIA 3T19A 5M1NA 4OLPA 1BD6A 4RUBA 4CF8A 3C15B 1HNZF 2R7SA 2GEMA 4DV4F 2B51A 3QGPA 4LFCF 3EWGA 4PXDA 4C97A 4JHDA 3AD9C 3JQKA 3U3YA 4FYDA 5IOLA 2G1DA 4CNZA 4CEAA 2ZNZA 2CNOB 3TVKA 4CJEA 4YB7A 2WBNA 3K5PA 2X1GA 3CC7S 3HFVA 2Z4PA 4I9LA 3WIVA 2UXCK 2HLUA 2CADA 2IDEA 1GFWB 2G2OA 2HYIB 3CDUA 4BC5A 1X1PA 3EL2A 3H1VX 3DLHA 3CCSS 3OBWA 1VFJA 1HMVA 1UWBA 5AQQA 3TW0A 1HBNA 4P2XA 4A8XA 4LF1A 4KB1A 2XM3A 3DRSB 3CULA 4ECRA 2GWKA 2QX0A 2I6WA 5AQJA 3D1OA 2FJEB 4LF9J 3C94A 3BGFA 3SI8A 1R8CA 2VG5B 5DO2A 5AXLA 1FXXA 4H5NA 3RMDA 2IYGA 3OFEA 1XUPO 3W60A 4Q44A 2GMHA 1WORA 3OVSA 4X62K 1K0TA 3ENOA 4O0JA 2EI5A 5TKWA 2L9DA 5A8RB 4CHOA 5BPMA 1MWMA 4JI2F 3DRSA 5KTQA 2RE2A 3BUZB 4IEEA 1G7CB 3CCUS 2A0FB 4OZ5A 4DR4J 4WU2A 4B8CA 1HD0A 1T9XA 2R7QA 2E9ZA 2OGUA 2QKKA 3PJWA 5AR0A 3N4PA 4DL0C 2F7VA 4TYAA 4Z7CA 5AE2A 2WBRA 5L39A 2XCAA 3QBCA 3IS9B 2GVZB 3L3VA 3PFEA 2RPIA 3FUYA 4DWIA 2UXDF 1N36J 1UPMB 2IMWP 4G9ZA 1NAQA 2A42A 2Y9HA 4QWAA 5BYSA 3NCPA 1RT4A 3J7ZO 1FKOB 5HBMA 1VQ7S 4H54A 2FLLA 1XNQJ 5MLCQ 1T7PA 1S7IA 2DNZA 5ADXH 3Q89A 5KFMA 3BV8A 2V8PA 4Y2MA 1RHJB 3N5FA 1S0NA 2P9SB 2EXUA 2NRHA 2QM1A 4QW8A 5HMWA 2Q66A 5BR8K 1IWGA 4KO0A 3KTQA 1N34K 2DGWA 2W9BB 1BGXT 4ZA1A 1C1CB 1Q81O 4WFNL 2F1FA 1MN7A 1N34F 1WSGA 5D4LA 2VZ9A 2IBKA 3MWBA 4YFUA 1SH3A 3IO1A 4FYXB 3OS2A 4OJGA 2OEJA 4X65F 2A18A 2RRAA 2XY5A 4OGEA 3NAEA 3IAS9 4TNOA 2BOAA 1B64A 3J7YP 1VQLN 2F9JA 3TR5A 1DARA 3HXMA 3VQDA 3HPGA 1JKHB 1TUUA 3QJJA 4BRHA 1HBUB 1U2VA 3L4QA 4Z4FA 2V4JB 5KFYA 2CPEA 5CD4H 3O3LA 3GR0A 3V6HA 3UN3A 3HOTA 4IFYB 4FNHA 2PA8D 3H5XA 2R2SA 3Q8VA 3MMVA 1YJNS 2RQ4A 3L2UA 4WKRA 4GKJJ 3I6PA 3ETOA 4L3QA 3EPIA 3VGVA 3DGVA 3LL3A 4LBHA 4K4SA 1VCTA 3BEXA 2QTWA 2W2NP 3OXFA 2ZWHA 4OYZA 5KFHA 2ALYB 2WUSA 2AV5A 2E5HA 1X31C 5AT1B 4DU4A 1QAYA 1UA0A 3KLEA 2DNPA 2E5GA 4MIWA 2KHOA 3IN5A 1MDUB 4IFVA 1N32K 3LPYA 3EM1A 3M5RA 1LXNA 1S57A 1HWUA 2KJWA 4DDFA 2YTCA 2CJAA 2YNFB 5FLXU 5BRFA 3LDOA 4CLPA 2UXCJ 1RYRA 3UDVA 4DHYA 1VQKS 2DNLA 2EK6A 1ICEB 3ZEUB 1KC8T 1SH2A 1MROA 2QO3A 1R8BA 3RMAA 5F8LA 2GVDA 5EU7A 3ZT3A 1HNXJ 5KFDA 4DQRA 4LSLB 1WAFA 4YDXA 1GXUA 3MPUB 2G13A 4P52A 5LY3A 1GX6A 3CQ8A 3U6FA 1JX4A 3IBCB 4LRCA 2EBEA 4P71A 4YR3A 1CJKA 4NEZA 3AXMA 2HGLA 2ASLA 1UEVA 1RTDB 1UWAA 1PSDA 1FX4A 5A6WA 5L1IA 4JV1A 1WHYA 3A5MC 3JXUA 4CGJA 3OYFA 2HMIB 3H08A 3CC4N 5AQRA 2XSFA 1G2EA 3NGSA 1HBOA 2AJ0A 2LQJA 2DPJA 3MM7B 4UQGA 1TKDA 3WC2A 3S01A 1QVFR 1IBCB 4DV7F 4MQ3A 3QFUA 5EX0A 4E98A 3KJNB 2HSEB 1UFWA 1QE1A 3H6EA 4X65J 3A2FA 2Z57B 3H90A 2F9DA 2R7WA 3UNYA 1IR0A 5KOWA 5FPEA 4C8YA 2ROPA 1RBVA 2RHKA 3WXJA 2QYCA 2HHPA 5D15A 3UO0A 3MM8B 2ADCA 3SCKE 1HNWJ 4G65A 3ENHA 1DURA 1WG4A 4OPKA 1RUSA 2E1RA 4NA2A 1FNMA 3D68A 2HBKA 4GO5X 3UCGA 2R9LA 3W62A 2OTLN 3MR6A 3M6XA 1HQEB 1TMMA 2IRYA 2ZVSA 5ETRA 3HT3A 3CYMA 2NRXA 2A40A 2YHBA 2DHSA 1W2BR 3CXCM 1T03B 4KH4A 4OLBA 2WRMA 2Q31A 1VHFA 1NSPA 1Y10A 4C4WA 5LM7E 4XH5A 4QPTA 3UD5A 3R5GA 2XSJA 1VJWA 2RRNA 5BYQA 1PYTA 2C2KB 5HROB 4RUHA 5KFJA 1S5JA 1Q16B 2CA9A 2MZRA 5KQDA 3W7BA 3BZKA 3VA0A 3KHGA 1FDNA 4YOUA 4CNYA 3K17A 4KHUA 2ASOA 2P9PA 2DHXA 2XRIA 1S9EB 3QFPA 4CJSA 4FKYA 1YVUA 5D78A 1AFJA 3ET6A 3QMQA 3A8KA 3GONA 1YITS 4UT4A 5MAOA 3THVA 2AP6A 3FSYA 4OIXA 4TLQA 5AQFA 4Z0UA 3MCPA 2V7YA 2XGPA 5B0BA 1IO2A 4L3NA 5KFEA 1VQ4N 4IQXA 2FSNA 4BR0A 3CJ3A 4H5WA 2ZE2B 2ZWOA 4EHTA 1WUAA 1TK8A 2L48A 3FFIB 2HS3A 4DI6A 2FLNA 2V2VA 3C0BA 2YKPA 5T7LA 4UUWA 2OMLA 1VSHA 1XNRJ 1E6YB 2H5EA 4H0XB 2ABYA 5E3QA 1W9HA 4GVEA 4RNOA 1KVAA 3F0NA 2ASMA 4CO4A 4H0YB 1UETA 4DOZA 3AO1A 2V9WA 1GH8A 2AZ3A 2FC9A 3ITHA 1LXJA 3KUEA 3AOAA 2B8PA 3OS0A 3C8YA 4DV1J 4ECSA 3OYHA 4O55A 1HPZA 4CHYA 3DXBA 4E7IA 1O5JA 1TKTA 2J0WA 2KKZA 1AA1B 4WFAQ 3RTVA 2NPIA 4O8KA 3IG1A 1C4CA 4B3TJ 4Q43A 1VSEA 4TN2A 5HQMA 3VQ8A 3D1QA 2RS2A 2ZHAA 2HAIA 4NA3A 1XMQF 4M63C 4QIWD 2Y0SD 2P51A 1D1UA 3MAAB 4JYAF 4ZP9A 4GKKF 4RW8A 2ZBIA 2ZH9A 4FOIA 3MXMA 2O4IA 1K6YA 5C42B 1IBMJ 2XI2A 5H9FJ 3RZAA 2HG4A 1YVNA 3K5OA 2P5OA 4J9PA 4LRAA 1VRUB 2RKIA 1P9QC 1SKUB 3K9KA 1U0HA 1DJ0A 1V5VA 4OZ3A 2XZDB 1VRTB 2FBVA 2FHOB 2BA9A 2JJ4D 4OX9F 1DTQA 4GRSA 5A2QU 1X8DA 1U6ZA 2JWNA 2EX3A 1B99A 4I7FB 4FYVB 3FE1A 3NF7A 1DZ5A 4DUZJ 2NZTA 1EX4A 3M8RA 3MN6A 4NXNF 4EUVA 4DS5A 1LWFA 2MQQA 1RT5B 3EX7B 2HOEA 3KKFA 4HH0A 4E1NA 2JOQA 2EC0A 4M5JA 2VOOA 1S1VB 1FRJA 3CCVN 4RL1A 2FVQA 1GXTA 2FZKB 4DUYF 1BC6A 4QS9A 2M88A 3R5CA 4FPIA 4KV8A 1JCFA 4PA1A 2HLTA 3FGUA 2XY6A 1RT3B 4FVCA 4X4QA 4B3MK 4FP9A 3DGPB 1RABB 1I1GA 1CZAN 4ETXA 4JKDA 5B8HA 3CG7A 1IKXB 5C0YA 4DCPB 5F0XA 3DMJA 5IQQA 3CJRA 4OHVA 4FWRA 4OZNA 1IKWA 2ZOMA 3Q23A 1FKPA 5C12A 4CEZA 2UUWA 2DY1A 2EFVA 3H1QA 3F44A 3K58A 4EO8A 3KHYA 3UPFA 2HNDB 1VQSA 1VQ5S 2CH5A 1CEZA 4YDUC 4ZIVA 2ZFHA 4U7UD 1NZ8A 2R2RA 4XTTA 3O2IA 4FWQA 3MCSA 3TX0A 1Q8IA 3M9OB 4YB6A 5BRHA 1REVB 1QZ6A 2WCXA 3QGIA 2JLFA 2HMPA 3S3NA 4YOVA 2C2NA 1RHMB 4DV1K 1RJJA 3N79A 4QWEA 4OHXA 3ZX3A 2A3JA 3SMZA 5E26A 2C3OA 4OPJA 2CGJA 2EWSA 4AF1A 2OTJN 4Y34A 5EN1A 2G4BA 3D2FB 3DLGB 2JHEA 3VQTA 5ELZA 2IVNA 4C3KA 2OELA 1ULRA 4ED4A 4GNIA 1X4AA 5HL7L 1NK8A 1OH6A 1H2TZ 4FF4A 4KC5A 2YNHA 2VJUA 3DLLL 3U02A 3OL7A 3AA8A 1SI9A 2WOMB 2WTUA 3WZ0A 4QOZB 4RWXA 4BLGA 2QL5B 1RZMA 3LPUA 4FJJA 1JLBA 2JC1A 3Q7CA 2RKIB 1BQNB 2D0CA 1IKVB 4M5MA 1RDDA 2VGNA 1IJFB 4LSZB 3KLFB 4NXMF 4X66J 1ZTWA 2OAUA 3ALYA 1SKRA 1D4XA 2E6MA 5JICA 1LAWA 3SV4A 4F4AA 1S1XA 2HB5A 1X5TA 2LEPA 3J8AA 3M1FA 4JI8J 3KK3B 2FLPA 3HZ6A 2P9KA 2PGCA 2HVDA 4ES3A 1B4SA 3M2UA 3UKRB 1VOMA 4LQ3A 3AOBA 3HLUA 2LP4A 1CQMA 4C6AA 4KB7A 4LFAJ 5C2GA 2K3IA 3LA0A 4C7QA 2G2ZA 7AT1B 1D8YA 2OPPA 4JI1F 4FOEA 1ZBLA 3PV8A 5C25A 2ETJA 5CZ2A 3FMBA 1VQ5N 4QWBA 4ID5A 4ZN1A 4O4RA 3RYLA 3NH2A 1U8WA 4HT7A 3VQBA 3LH2S 4I6AA 4GVMA 1K1QA 4K8XA 1S9GA 2F4FA 2HQGA 4U95A 4UOFA 2CJKA 4BRPA 2APOA 3UR3C 4FNIA 4RCHA 1Q53A 3IMXA 5F8GA 3W2WB 5H9EJ 1WSRA 2L41A 3LDLA 2BOPA 3NVKA 1RK8A 2GO8A 1YBUA 2H9ZA 2N4CA 5CYMB 3BH6B 4Z4CA 4I2QA 2NRTA 2AT1B 3I5AA 5JLFA 4C8ZA 3UDEA 3VF2A 3M9NB 5BRDA 1S1UA 2VBYA 3FFIA 4K41A 2UUAJ 5KPRA 1Z6RA 4JK8A 5FDLB 4J9SA 4QPXA 1A5WA 3B6BA 1NGEA 1CZBA 3NRBA 3MK6A 4ED1A 2MQMA 1LOUA 4M3XA 1BDGA 3C14B 1S97A 3G4SN 1GLEG 8AT1B 1MWYA 3CPEA 1W2IA 4M7XA 4LVOP 1PO6A 3HHLD 3IC1A 1RSCA 2HF3A 4BRDA 3M6WA 2JLEA 3VVUA 2BE7D 1T9WA 1Y00A 4FWNA 1IKYB 2IVMA 4L72B 3PRBA 3CDWA 2UUBJ 1TR0A 1Q18A 3OXGA 3MX5A 3A3PB 4DPOA 4DL6A 3GG0A 2IVPA 4RW7B 1UVKA 4LF8J 2LVWA 5DQHA 4CZLA 2RDIA 3ENAA 3W2VB 4WQ5A 3I4HX 1P1TA 1T03A 2NXCA 3AFGA 4M3RA 1FE4A 1WUUA 4NYZA 1WBDA 1RAAB 5L38A 2J9DE 3DJCA 3LW5C 2OPQB 3MEKA 4ANDA 3TI0A 2NPFA 4IR1A 2IDOA 4MT1A 5KG6A 2ILZA 2VQFF 1OSDA 4E2FB 4WBFA 1XC9A 4NLUA 2XGQA 4NYPA 3LWMA 1U1LA 4TY8B 1FJ7A 3TU5A 1TKZA 3TAFA 4IOCQ 3L7UA 4B1YB 2YX7A 1S4EA 1UVIA 2OPSB 1YIJS 5KI6A 1WC1A 1RHRB 1T9TA 3OTEA 3ULHA 2A1RA 4Q7AA 2G8VA 3K7RA 1AYEA 3I0RB 1NK6A 2WONA 3EVOA 2ZEJA 4ED0A 5DG7A 3WNHA 2LU1A 3ETMA 5KT4A 2BANA 3KG4A 2R7UA 3DDKA 3T9ZA 3IRWP 3RW7A 3SMSA 2L9WA 4JI4F 3HCXA 4LRBA 2P9IB 3H2UB 3J80U 1CPZA 3CCES 4YUDA 4FZZA 2R42A 3TUPA 4Y28C 3VAIA 3OJSA 1VSDA 2H4WB 1G1XA 5KOXA 2Z2ZA 3CJ4A 4LSLA 2X3GA 2ZVIA 3BGUA 4KGZB 4BR7A 4MAKA 3OTBA 1VIXA 3TARA 4Z2XA 3CCEN 2YX4A 1TL1B 4BE2A 3LQVA 3MD3A 1J5EK 4BDZA 1FF2A 3TA0A 2QZ8A 1Y11A 3LAKA 4DUZK 3HD2A 1NJZA 3DDIA 4YHHJ 5D6GA 3US5A 4HACB 3M4XA 4DU8A 3RAQA 1FDDA 4J37A 4A2AA 1BQMA 1K44A 2D9PA 3CETA 1QTNB 2GJIA 4LF7J 4WE1A 2X78A 2CJQA 2CPZA 3M8QA 3MM9A 4X4TA 3VHQA 4DSFA 4KYZA 4CK1A 5FPDA 3HVAA 3C46A 1YRTA 3CJ5A 3QBXA 4CJRA 2AW0A 3EO3A 4Q0BA 1IQZA 2AU0A 4M63A 4ELVA 4BACA 4DR3F 5D4OA 4DQPA 2B56A 5A8WA 1S10A 4LF4J 1T9UA 2HFVA 3Q7BA 5SUHA 4DV3J 1S6QB 3D2EB 2BKNA 2V8GA 3DOMA 3TVZA 3FK4A 2FHKA 2XY7A 4RUCA 5KG3A 3R8EA 3I0SB 1OYDA 5D0GA 4K43A 1BO5O 1Q7LB 4NYFA 2NSBA 3NMUA 4BRKA 3LAMA 1VSKA 2BGGA 3KHHA 3F73A 5C24A 3FJ2A 3O4NA 1IBMF 4CEFA 1R0CB 3BGOP 1LNQA 2QWNA 4WWSA 2UUCF 2OCEA 3O9UA 3GYNA 4XIUA 3CJKB 1REGX 3CD7A 3MMAB 4F25A 3GIJA 2NXNA 2UUCK 2O8EB 3U1NA 1RFQA 1Z26A 3AGKA 1X5SA 5A8KA 1UAWA 5I3QA 1M5VC 2R7VA 1S48A 5KG1A 2F4VJ 1DY3A 2DFHA 3M2VB 3MR2A 5BREA 2C28A 2DXFA 3KVGA 4IR9A 2BQ3A 3DM2A 2F8EX 5BN8A 3UFCX 1H7WA 3PRDA 1RISA 2N82B 1SL2A 1VQ8S 5AQMA 2K2PA 1VIOA 5CH7B 3RRKA 3MR7A 1HWJA 3W5XA 5HBMB 1FKOA 3E51A 5HVGA 3E01A 5IT9O 1T94A 1RT4B 2E9RX 3GFXA 2QLXA 3KDNA 2EWHA 2FTRA 4KFBA 5JLHA 2V7ZA 2A5XA 3PW7A 2W6LA 5CXTA 3FQKA 4G6VB 4KGMA 3TA1A 2ATQA 2KXFA 3IS9A 5F8MA 2VPZB 3VQSA 2HFOA 3JTPA 1WKLA 4FS2A 2W4PA 3BSOA 4KHPF 4DPUA 4JI3F 1TUYA 3GCXP 4IH7A 1CJVB 3G6XA 4B3SJ 1D8ZA 4LFAF 3CJTA 1RU2A 1RQ0A 4BRAA 2HHQA 4WKYA 2BJEA 1PYSB 4L6V3 5ITHA 1SJ3P 2DR7A 2RE1A 2ZC4A 3MEDA 3O8MA 2VA3A 4HVZA 4M7YA 1ZA2B 2HURA 3OTDA 4YEAA 2F4VK 2E7WA 2XS2A 2JWLA 4X84A 3PRVA 5IQ6A 3T6BA 3FBCA 1ZTTA 2FHMA 1K1SA 2DKOB 5KT7A 5BPNA 3O80A 3PSIA 3E01B 2Z8QA 2DRAA 5A2QO 1LKZA 4PKIA 2G0JA 3VQQA 1XTZA 1LCUA 3IR5B 5L1JA 3BKFA 3B78A 4CLWA 1Q1KA 3GE9A 3Q8RB 1K0VA 4WP3A 3L95X 3R7BB 3DCAA 3FCVA 3OLBA 4D3HA 4USTA 1HBNB 4CD3A 3OTOJ 1UFLA 3NG8A 2B5JB 2E2QA 3T5LA 1DTTA 1UWBB 1LK5A 1J54A 3BS9A 2PI5A 3TUZC 4YHHK 3SFGA 1ATRA 1KRPA 2FVRA 5HN0A 3RWUA 3TUJC 5IV3A 1RT1A 1H0HB 4LF7K 5HRNA 3MMAA 3P45B 4Y2AA 2D7SA 2DNHA 3QGGA 3EXCX 3KJVB 2BQUA 2LXFA 2R8JA 2QTDA 2VBXA 4ALZA 3CM6A 4M5GA 4JKBA 3I5CA 1W7AA 4DTNA 1GNKA 1M1KO 2YV0X 2QGFB 5D4NA 3SSQA 4FLVA 4LFBJ 4URSA 1B0PA 2KXNB 2C22A 2IM1A 3QIPA 1JJ2R 4E7KA 4U8VA 4P2SA 2W42A 3AVKA 3EMTA 1VC6A 4CZIA 5ETKA 1O0PA 1FRXA 1S99A 4CJ5A 1HD1A 1R8HA 3KYLA 2J7WA 4ISGA 3VOVA 5AQYA 2GMLA 2LYVA 1TK5A 1C1AA 4QYZK 1QAXA 3NOCA 2ITGA 1NDLA 2EC2A 1RBRA 5F41A 4B17A 4B3SF 2CG8A 3GYXB 4FJGA 4WE1B 3THWA 4OHYA 1GX5A 1M0SA 2QEXS 1NXIA 3EZOA 1BQMB 5B08A 2E5LK 2DVIA 2M8HA 2Q6CA 3SQ1A 3L3CA 3AY0A 4DX8H 4I6MB 4NOHA 3V1OA 4PXCA 4IEIA 3PR4A 5LJWA 4WFNQ 2MMYA 3M1VB 1S6PB 2C2RA 3NGRA 3OUYA 4O3PA 3NVMA 1FFWB 4DZDA 2HNZB 1X4BA 2VUGA 2WHOA 3CI5A 3QWPA 1ZOTA 3T7ZA 3Q2SC 3J7ZT 3Q8YA 3OYBA 4FJKA 1T95A 4CEOA 2XLJA 2VHGA 2EFGA 3HHKA 4W4MA 2IAJA 2XMKA 4Q45A 4Y6IA 4O4GA 1SKWA 3H46O 3UVJB 1NPKA 2CPDA 1FXRA 1XMQK 1GQEA 3P5JA 3O1LA 4IKFA 4A48A 2XTJP 3TJ9A 3NY0A 2XMMA 1FRHA 2E5IA 1UW4A 3I0RA 1I6JA 2VPYB 4RW6A 4MK9A 4FKXA 1DTTB 2VCPA 2B5JA 3PYGA 4YORA 1UVNA 3SAHA 5ETLA 2D3ZA 4NLSA 3VGSA 3K59A 1IR1A 3SPZA 1JQGA 6FD1A 1S6OA 1PYOB 1JMTA 4LQ9A 1WEZA 4AHRA 5JS1A 5LSRA 3OYNA 1FWKA 4OZLA 1EIYB 3HSDA 5KG2A 3QEIA 3QEWA 3R9LA 2V67A 5M1OA 4OYMA 1J27A 1TL7A 4DR6J 3AJDA 3HHLB 1TKXB 2BYCA 4HHUA 4RZRA 2OPQA 2ZWPA 2GAHC 1Q5VA 2DY9A 3D6HB 4TY9A 4DLEA 1N5YA 1ZM9A 3A5NC 4C0HA 3TJ8A 3MEDB 4ED6A 2IRUA 2HQFA 3ZTQA 2O67A 1FNOA 1NGAA 3UQSA 1S0MA 3MAQA 4USJC 2MZSA 1P8ZA 3TO8A 1VSMA 2RHSB 1ZYQA 3WEEA 2NXEA 3ZCMA 1XERA 4Z37A 3FZ2A 4DUYK 1SC6A 4UF4A 2VKRA 4JKFA 5AQOA 9RUBA 2CNKB 3O9SA 3KXDA 2BV3A 2CVEA 2UXDJ 2FHJA 1BQXA 3MECB 4TU8A 4H8KA 1JXBA 1OH5A 1CS4B 3SQOP 5FRNA 3RB4A 2RHQB 1NNEA 2FYXA 3CSKA 3N01A 3JB9k 3NLCA 5KFVA 4LFAK 1N6QB 3LP0B 3KIOA 5KT2A 1U1KA 2UU9K 3OYAA 2VG7A 3C2PA 3MOJB 2OH2A 3FZLA 4K7QA 3G6EN 1SUQB 4O5FA 1S1UB 3FZBA 3UI3A 2UVVA 2KT3A 4C8NA 3NNAA 1NGFA 4KBOA 4CJ7A 1N0UA 3FGVA 5EWEA 3VQAA 3TAMB 4M3YA 3CCLS 4WZQA 4W98A 5F2RA 4AXIA 4FPBA 2IJFA 4DCJB 1UEKA 4PKHA 3KOAA 3K0JA 1NKBA 2LKZA 4CM2A 1ZPVA 1VQ8N 3DWLA 3DOKA 1UVLA 4J7CA 2R7OA 2SXLA 2HRTA 1JB0C 2V68A 3QINA 4QW9A 2A2DA 4OFZA 3BQ2A 2ZBRA 3P83D 3H2VE 5C24B 2OPRB 1WOQA 4RG8A 4JKHA 3J80Y 4CCHA 4HWIA 3ZO7A 2YX6A 4YB5A 2OPPB 4LVNP 5GAGP 2EFQA 4B1VA 3EYZA 2RN2A 2B4VA 4U6PA 4NI2A 4H0PA 1UPPA 1U6BA 3R8YA 3C6TB 2XYPB 4BRNA 1Y64A 2C2OB 3RB3A 3UKRA 1VGYA 4CBXA 3SBGA 3H3NO 3P6YC 1FRLA 3KK3A 4KGVB 3ZXWA 4OHWA 1YJWS 3QEPA 3DHXA 1N5TA 2A3ZA 5A8WB 4J91A 3OW2R 1X4EA 1M5OC 2P9EA 2QE5A 1HQUB 1JLAA 4B3RK 1LW2B 3B4MA 3OBYA 3GQCA 3VEWA 4LUBA 1EB0A 1EX8A 1JIHA 2YVSA 2A6AA 1DRZA 2JGUA 5EXWA 2UUCJ 4M5NA 3HJFA 3FZHA 1SIZA 4B9TA 3HPOA 2HF4A 4FW1A 3JYTA 3RRHA 2QEXN 4CJVA 3AA2A 1Q4RA 3I31A 4BGBA 1JXEA 4Y0FA 1BE4A 1NHVA 3BN7A 2W01A 1U09A 2IIHA 3H98A 3M8ZA 2O8BA 4DFKA 3P31A 5LMNF 4HDHA 4HHHA 2KZZA 3M8PB 3L4BC 2IGIA 4CLUA 4WYBA 2L3MA 3ZSVA 2ZH3A 4NLTA 4CFCA 4EYIB 1VQ6N 1FJCA 2HVZA 1NDKA 1WHXA 1JCGA 4LT6A 4AQYK 1WC3A 4CT9A 3FFKB 2QWLA 1KR4A 3AO2A 1YRUA 5T41A 3B8HA 5D3GB 3R6GB 1X4CA 3OFFA 1REVA 4WF9L 2BANB 4DV3K 4WCEL 4RW9A 3NGKA 1R8AA 2OZSA 4ZN3A 3MDQA 2DGOA 2MQNA 3X3UA 4P6QA 3VGMA 1NG9A 4ED5A 4E19A 2VPWB 3NMAA 4H5RA 4ZVHA 3IWLA 3DLLQ 3BY5A 4FJ5A 4RNMA 4Z4GA 4ER8A 1U4BA 3ZSOA 1VYAA 3DU6A 4FWMA 3CFOA 1TKZB 1SB6A 2LXIA 4CTAB 4H5VA 5DM7Q 1FKPB 1BWVA 4USUA 3WX8A 2UVWA 3IGVA 1XMOK 1H38A 5J2PA 1QVFM 5GADP 1IVZA 3T9NA 2O66A 1BIUA 4FW2A 4BC2A 4DR5K 5E0OA 4R5PA 1DQ8A 2K1RA 1NU0A 4TSXA 3S3OA 4BG9A 1FJGK 5CQGA 3DDNA 3V4MA 4GKKK 1TAUA 5CZXA 1HFEL 4DBQA 2F7TA 2DNQA 2VQEF 1QSYA 3NF8A 4KV8B 4UZCA 2EG2A 2OTJS 1UMJA 5CD4A 1GTEA 3KLIA 2B4OA 3A4TA 4AHSA 4M5DA 2R8HA 1S1VA 2LLZA 4DFMA 2P5GA 3DNCA 3N9UC 1WELA 1OS5A 2HBLA 4ITSA 4X62J 2Q79A 1HQ2A 2DRDA 2FZGB 1IKYA 4I6YA 3AVHA 2V2KA 2PZSA 1CG2A 3R7SB 1NGDA 4A8OA 1LW0B 3QGHA 1YG0A 2CIMA 3QRQA 4I7FA 4K0KJ 3L2RA 1YQHA 4C98A 1FVQA 4M5IA 5DZ6A 4R79A 2VQFK 1WN7A 3AO3A 3G82A 1TV6B 4PUOA 2PO4A 4O3OA 4OKJA 3VA3A 2E1YA 4OYAA 4ECWA 3HX9A 1B9DA 1WG1A 4M42A 3TNVA 3IRXB 4LF7F 5CHIA 2DXEA 1VSIA 4O0IA 1A7GE 2YH1A 5FDLA 1GLCG 4GV3A 2DGTA 3PHTA 3PO4A 4X4RA 2XMAA 1WSVA 4IJAA 2X6SA 4L74A 1VMBA 1CJUA 3LUYA 5JVGL 4K2XA 2KW4A 3THYB 3EY1A 3FRYA 4LF8K 2DJWA 4KH1B 5CYMA 3MAAA 1SQGA 1Q82T 3WXIA 5AJ3K 1IR2A 3W2WA 3ZETB 1U0SA 1WF2A 1S1TA 1NOYA 1NSKL 1NBEB 2HAFA 3J81j 4NZ0A 3G96A 5AJ3F 3F5TA 1R6VA 2FJXA 3M2RB 1S9GB 1NNDA 3GV7B 1P9YA 3KK1A 2OFHX 3WNEA 2YKNA 4ZVTB 3DOLB 1YGYA 4ECXA 1I94F 3QLHA 3VGTA 1HWIA 4M5LA 1HPZB 3DYAB 3LWLA 4DV7J 3NAHA 3DOLA 5DK5A 5CYQA 1SXLA 3PFOA 1NZAA 1YBTA 3K2PA 4C8MA 1NMEB 3CFPA 1WTFA 1CC8A 3M2RA 4OJ1A 1BU6O 3PO5A 3HSTB 4DTJA 4UUXA 5L9XA 4KHWA 1TELA 4OMFG 4IOXA 3M2UB 2V0NA 5HQ8A 2ZITA 4ISEA 1FTRA 3CCQN 3ZETA 3QYYA 3AVJA 3HSCA 5LJVA 1HNXF 4ECVA 4QJVA 1TFWA 2HRUA 2QT7A 4N77A 3CDEA 1FK9A 5KT5A 3CJ7A 4G1IA 2H4YB 5GAGI 1QUVA 5HVHA 2E2OA 3CD6N 3ZZ0A 4F4YA 2BBEA 2GIFA 2BW7A 4A46A 4DHVA 2ADBA 2FIUA 2XMTA 3P3DA 4CJLA 4ZOSA 5IWAK 4C3MA 2ACYA 5CHCB 2GQCA 4RLEA 1WSFA 4FJMA 3SQGA 4A59A 1GTHA 2MY8A 1T0TV 1NKEA 2XEXA 4M8LA 5LXRA 1URNA 4DMNA 2QV6A 4EBCA 3IR7B 3OYDA 1JJHA 3G10A 1BI4B 3VPZA 2QJ3A 4FLUA 3H3OB 1KTQA 5C10A 1F21A 3L2QA 4X4OA 1RA6A 4ZPDA 4DV0F 1W2BM 2VFTA 4E7JA 2BQRA 3OYKA 3O5TB 2EK1A 4ZLLA 3T1YF 2VFRA 2ZH6A 3RSEB 3A3NB 3LO3A 4XDDA 5KFKA 1WC5A 2AD9A 2EKNA 5IC4B 3CJCA 4CF1A 4MK7A 4RO0A 1RHQB 3CMEN 1XN9A 4CD1A 3Q8PB 4J90A 2W40A 2GTDA 2RQKA 2XNRA 3DU5A 1YVFA 3U9DA 4ZP8A 4B9VA 5I3UB 2OSQA 4USKA 2AEJA 1VISA 2QWQA 3W0LA 3J81U 1S72N 1RTIB 2PY5A 1ZC6A 4KHYA 3M6VA 4P9SA 1RP5A 2RNEA 3AHPA 4JOUA 4P72A 3PVXA 3OR2A 5IV4A 5FPMA 3F2KA 4C0OC 1NJWA 4Z4IA 5GMKa 2K7JA 3UW1A 1SIWB 2PEBA 1C6VA 3NGUA 3A8IA 3Q8QB 2PA3A 2QL7B 2YQ0A 3TQ1A 2WW8A 2NREA 3BF3A 1WG5A 4FJXA 5AQLA 1YI2N 4U8YA 4ECTA 1Y5NB 4W5NA 3DMJB 2BABA 5LJ3Y 2B43A 4ZDNA 2NS1B 3V9ZA 1IKXA 3CMAS 4XPEA 2QA1A 4CIOA 4OPAA 4FBUA 3ZZYA 3OD2A 1U7LA 5AQTA 3L6QA 3G8SA 1X5OA 4EBEA 3ZLJA 2PT0A 4B9LA 1TFYA 2D9OA 2LECA 1N52B 3VWSA 3ULEA 2W25A 4JI3K 2Z1IA 1O13A 4W5RA 2CGKA 4PG7A 1RDAA 3LM2A 2RIJA 4RNHA 2I5JB 2AJQA 1NJYA 4GVBB 4PL8A 2WVBA 5F3TA 3UB5A 3CM5A 2W8LA 1R0AB 1IBLK 2O8CA 2WVEA 2ZZNA 3GU0A 2R2UA 4JK7A 3ZSRA 3L0QA 3W3SA 2GVDB 2WAQD 4PPDA 2B9WA 2FPHX 3O8WA 2F9TA 3HDSA 1QD1A 1S49A 3DXKB 2JFKA 4ILJA 1I3OB 1PBAA 1VRTA 4CJTA 4M5HA 2EFOA 3HT0A 3QB0A 3M8WA 4JRPA 3TEGA 2DO4A 3TSQA 1RBLA 3R1XA 4JN4A 3LDSA 4CJ3A 4WYLA 1G99A 3OFGA 3MD1A 2ZD1A 1NCLA 4BREA 1D9FA 4DF8A 2P9CA 2ZQBA 4F9OA 1VRUA 4LC9B 2JEGA 4NE9C 1T44A 3RJMB 1Y7PA 4I4BA 1HI0P 4ZHRB 3K5NA 5A0YA 2VU5A 1JLAB 1FWLA 1LEOA 4RNFA 1KQSR 2DFFA 1FHTA 3QSYB 4LF9F 3A13A 3KLGA 2CG4A 5HAOA 4DR5J 3G8TA 2QC3A 4TU7A 4HKQA 4PQUB 4O23A 3BKTA 3BBCA 1LWEA 4NPOA 4FJ7A 2EKYA 4K4ZA 3J81O 2PSZA 3ZYYX 4O44A 3CC4S 1NJIO 5AQUA 2QA4G 3FCWA 3OYIA 3IG1B 3NL0A 4KHQA 1S0VA 3WUHA 2V4JA 3M7VA 1RKIA 5BYRA 4JAXA 2V51B 1V4SA 1N36K 1NRKA 1QVGM 2RRBA 2CPIA 4CIFA 4NLVA 4PWWA 4HL9A 3R1LA 2OD6A 4OVLA 5ADZA 1E6VB 2HHSA 4YOTA 3V1QA 4RUAA 3BKUA 2RAQA 4X62F 4DU1A 2B6AA 1XR6A 2K06A 1U24A 3ZNJ1 5AXNA 2VC1A 1RXOB 4YS2A 4ZLNA 3G2XA 2HK2A 1K8KB 5EY4A 3VAHA 2UXBJ 2EHGA 1KSPA 4WIIA 1QJHA 2Z0GA 3TAMA 2E8AA 4A5AA 3CC7N 3AA5X 2QK9A 3SUNA 3J7YU 4RU9A 1JLGB 3MCOA 2DT9A 3V9SA 3Q24A 4M5KA 2IC3B 4Y1CA 2DPIA 5DQIA 5SZTA 3SUQA 2KT2A 3O5BA 2Z2YB 4B3TK 4BR2A 3DXMB 4IJNA 4JI6K 4ZVFA 4PXBA 1ILYA 1WKJA 4CHNA 4WXOA 1Q81T 3MXIA 1VRQC 1BCOA 4JI6F 1CS4A 1YRXA 1RDBA 1W7WA 2YKQA 3AVGA 3Q83A 1KEKA 3A3OB 1FTCA 3HZEA 5HK4A 3CB4A 1S9EA 4KKOA 2KFZA 2QRRA 3ENQA 3WX4A 1QVGR 2AHOB 5DETA 3CC2S 3PNIA 4F3OA 4LH4A 4ZPWR 5C5JA 3H8YA 4IUFA 4DTOA 4F4KA 4J2EA 1PAEX 3WEEB 1WOPA 3X1LB 1U6FA 3CE8A 3RAXA 5A6PA 2AJ4A 4DX6A 4FYWB 1OO0B 4C2MA 4IOAQ 2WVDA 3RG6A 2PFUA 2CDQA 2DNKA 2BX6A 1YT3A 5CCLA 1NBWA 2KJVA 2BE2A 2P9UA 4DR5F 4AXJA 5KG7A 4BBYA 2AP1A 5EX3A 5EWGA 3K5MA 3MPYA 1ZBSA 2F8SA 1YZ6A 2UZAA 2VG5A 3I55N 4HLBA 3MPVA 5LXYA 4JYAK 1XMOJ 2BJ3A 1HYSB 5KFSA 1X9MA 2NRVA 1RBTA 4U7BA 4CJUA 3NDKA 4IG0A 4X2BA 3RMCA 1YJVA 1U25A 4NMXA 1SH0A 2ZNYA 3LZIA 5D77A 4B1XB 3AD7C 2J6SA 2NSCA 2FLOA 2O5DA 5I42B 1QQNA 2CNLB 2F65A 3HHLC 2MQLA 3CJQA 3Q22A 4BE1A 3DLEA 3FBFA 2DEJA 4OL8A 8RUCA 3ZT0A 1NU4A 1NH8A 1P8GA 3BPSP 3D9BA 3W9JA 3FZMA 1LWCA 3I56N 2CZ9A 2G8FA 2HPUA 4DMZA 1KQKA 4JI0K 1ACMB 1U8SA 3OFHA 3BM7A 2N7CA 2BR0A 3KG1A 3IBFB 5ADXA 4AQYJ 4JI0F 2NLXA 4ZPCA 4M3WA 2M7SA 3VQ9A 5HQLA 2CQHA 4QR1A 1TL4A 3VZHA 2ATCB 1YTYA 5DGAA 1VQ4S 4LF4K 2EPIA 2BKOA 4DQ8A 2JNJA 1YJUA 3OUYB 3OTOK 3NE6A 3I5BA 3M1VA 3E8OA 4KSEB 3VCDA 4ZCMA 1RGIA 1SS6A 1J9AA 4PKGA 1RT2B 4IOAL 4C23A 1SC4B 4OX9J 3WNFA 1RCXB 1ZZNA 1F60B 4CEBA 3R2DJ 4WIQA 4DUYJ 5MLCV 2KYZA 1OH8A 2B8QA 3S1TA 4JNEA 1FT8A 3TAPA 4W5TA 1RAEB 1N54B 2OI2A 1IBLF 4B1UB 1X9JA 4KGKA 3D1HA 4HUEA 4BR5A 4M3TA 1TYQA 3JSYA 4ED8A 4MLEA 1VJQA 4IDHA 2GQQA 4PPZA 4FS1A 2XYHB 1NJIT 2QA4N 2LDYA 2X74A 1ZM3A 1J5EJ 3C65A 2RH3A 3M8YA 4A2BA 2Q3SA 2I9SA