2OPPA

Crystal structure of hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
542
structure length
518
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 136
structure length 518
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2oppA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oppA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oppA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oppA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2oppA05
3MEDA 2W9BB 3NKYA 1S6QB 2OPRA 4F4WA 1MMLA 4EYIB 4ECVA 4IH5A 1ASVA 4F50A 1SH3A 1VSEA 4Q0BB 3VQCA 2HVHA 1ZYQA 1J54A 2HHTA 2D0CA 4DSIA 5EWEA 1BHLA 3T5KA 4FLXA 1LV5A 2IAJB 3KK3B 3MF5A 1KLMB 5KT2A 4B9SA 4KFBB 4IR9A 4R0EA 2E6MA 5KFBA 3QLHB 1LW2B 2B5JA 3SUOA 2ITGA 4R8UA 3QESA 1N5YB 4LH4A 3OJUA 3QZ7A 3O3FA 3OYKA 4ZTFA 1L3UA 1JLBB 1NNDA 5EDWA 3NF6A 1TKZB 3MXJA 3PY8A 3K5MA 5KG4A 3C6UB 3MEEA 3FDSA 4ID1A 3S3MA 2ZE2A 4CGIA 5KFJA 1IKYA 4K4VA 4W5QA 1HQEB 2BANA 3DRSB 1ZTWA 1JLFB 1HJRA 4JS5A 1C0UB 3OYGA 3CIZA 1IO2A 2YKMB 2HNZB 4AILC 4IFYB 1EP4B 4K8XA 1S0NA 3KK1B 4OJRA 4IG0A 5JXSA 4KHNA 3DLBA 3V1QA 4FW1A 1HMVA 3OYMA 4NLSA 4M3WA 4I7FA 4J9QA 4ZHRB 5CYQB 2W8LA 3GIMA 2P5GA 3KMQA 1W25A 2QKKA 1S1XB 1T05B 3NGDA 1TL3B 3NL0A 3TAGA 3NFAA 5HRRA 2BQUA 5F8HA 2YHAA 4R5PB 2E9ZA 1HYZA 4FJXA 5DG7A 3ULDA 2JEGA 3I5CA 3V1OA 4N47A 2J6UA 4JV1A 3KMSA 2QE5A 5EU7A 3ZSVA 5HRPA 3SQ0A 3BGRA 4O3OA 2XY7A 3KLIA 5FDLA 4RW7A 3OSNA 3O3HA 3QGGA 5J2QB 4FJKA 2ZQBA 5KI6A 4Z4FA 1N4LA 4DTNA 4DL4A 1D5AA 4DSFA 4E1MA 3RRHA 2DFHA 2BR0A 2G8WA 3PV8A 4O3QA 1HARA 4K4TA 3O4QA 3ZSQA 4MFBB 4I9LA 2UVUA 2IJNA 1UWBA 4KO0A 3NCIA 2YNHA 1NK6A 1WSGA 4W5TA 3TAEA 4KHRA 2OZMA 1Q8IA 4CJQA 3KLEB 4EZ6A 2ATQA 4CEFA 1MU2B 3RMAA 2PYLA 4CGFA 1WNSA 2HMIA 4H4MA 4PY5A 2IMWP 2D5RA 2A1SA 3KTQA 1RDAA 1QUVA 1N6QB 4E3SA 3RB6A 2VG6A 4M95A 1RT4A 3TAFA 4CJPA 1GOBA 3V9XA 3GIKA 3AVMA 4DLGA 4Q5VA 2YNFB 5DLFA 2ILYA 4O44A 2QK9A 5JUMA 2XGPA 3LPTA 2VWKA 2XHBA 4FLUA 1JLQB 4NLTA 5KGWA 4ZMMA 3LP0B 3CJ4A 3DOKA 3AVBA 1S1WB 2FLLA 2CJQA 5HRNA 2OA8A 1RNHA 3TANA 3SPZA 4CJWA 3VA3A 1T03A 5I3UB 5SZTA 4ID5A 3U3GA 3VQ4A 1GOCA 1RT3A 3RAXA 2QKBA 3DI6B 1S97A 3RR7A 4WZQA 5T7BA 4I2PB 4ECTA 1RYSA 4ZVHA 1YT3A 4KHSA 3OS1A 4GVMA 4TQSA 2O5DA 2RKIB 4QWCA 1RTIB 1KTQA 4M3ZA 3UDLA 1CXQA 1WAFA 4CE9A 3CG7A 1HPZA 2G8HA 3VQSA 1B9FA 3IAYA 1FXXA 4KTQA 4ECRA 4RZRA 2OYQA 3H08A 3PR5B 4ELVA 2GIRA 3V4IA 3MFIA 3V9UA 2UVWA 3OYJA 2KTQA 3H5XA 3HVWA 4E7KA 3S3NA 2Z1HA 1SH0A 3VQ7A 4FJMA 1DLOB 4M45A 2P51A 4CJEA 3PHEA 4IG3A 4YR0A 2W9CA 3QINA 1ASWA 3DOLA 4K4ZA 5F8NA 4RW9A 2FVPA 1XR6A 3S9HA 1OS5A 4IKFA 1RBVA 3OL6A 3OL7A 4RNOA 4ICLB 4WZMA 4ED3A 2FJVA 4OL8A 4ZPAA 4M94A 4N76A 1XHZA 1SUQB 3ISNC 4DQSA 1JLGB 4QPXA 2V4QA 3QIPB 3SUQA 1U45A 4F4KA 2R2TA 3I8DA 4RW8A 4Z0UA 4ECSA 4CF1A 3AVHA 1QQCA 4LQ9A 2D7SA 4UQGA 1ZBLA 2BE2B 3KLGB 4CHOA 3AA2A 4NCBA 3QEPA 4KI6A 1WSHA 1NJXA 5KFPA 5JS1A 4IFVA 3MEGB 2YKNA 2VG7B 4B3OA 4OLAA 1T94A 4EP5A 4IH6A 3L2QA 1FKPA 1XHXA 4HTUA 1S6PA 5L1LA 5KFFA 1N56A 2W9AA 5KT5A 1TK5A 2I5JB 5L1IA 1JLEB 1RA6A 1ZBIA 5KT4A 4IBNA 1S9EB 3D5MA 3DRPA 1RT6B 3DMJB 4ZP8A 2FJWA 3PR4A 3MXMA 2OPPB 1NJYA 4CEAA 2R8IA 1C2PA 4C8KA 4HHTA 2AGOA 1TKDA 4CJFA 3BSAA 2XY6A 3WNGA 3ZSXA 2R2RA 4DQRA 4MIBA 5KFVA 5KFDA 4MQ3A 4CHYA 3GILA 3IN5A 3N6NA 2HB5A 5HP1A 3TWHA 5KFGA 3NAHA 3K59A 3CDEA 1WSFA 3V6DA 2G8VA 4F3OA 2I1RA 2AJQA 4G1QB 4N41A 5I42B 4Q43A 1JKHB 1RILA 1BQNA 1S1TA 1LAVA 2Z1IA 4CFCA 3OLAA 4NCAA 1RTDB 2AGQA 3HVTA 4KB7A 5C24A 5CYMA 2HWIA 5L1JA 1LWEA 1U4BA 5KGXA 4YMEA 4W5RA 1QE1A 3ISND 5DG8A 2DFFA 4RW6B 3H2LA 2CKWA 4W5NA 3ASMA 4KB1A 5CZ2A 4CHQA 1JL1A 4FYDA 5KFLA 4EBCA 4DL7A 2R2SA 3KNAA 1KSPA 3MR3A 4TY8B 4FBUA 1C1BB 1SKRA 3QNNA 1YTUA 1JLCB 1CZBA 4XPCA 1VRUB 2YHBA 4DTRA 2DY4A 4CFBA 3CVKA 3CDWA 1TK8A 4W5OA 5KFRA 3LWLA 2FVQA 4I2QA 4OPJA 3NBPB 3LP1B 4NCGB 2IC3A 2BDPA 4RW4B 4Y1DA 1KFSA 1EKEA 3QGHA 3MR5A 3MEDB 1TVRA 3C94A 4NLVA 2OPRB 3TQ1A 4H8KA 1RTJA 3HT3A 1TAQA 4LSLA 4FM1A 1QS4A 3IG1A 3OYIA 2PY5A 4DS4A 3ZT2A 2D3UA 4DFJA 4CJ3A 1FK9A 3LAMA 1TKTA 3UQSA 1BCOA 4NLRA 2JGUA 4F4XA 4MIAA 5D3GA 3KIOA 4KV8A 2VA3A 3QNOA 4ELTA 3MECA 2VA2A 2DTUA 1W0HA 3Q8QB 2B5JB 4J2BA 3T19A 3AO3A 1EXQA 4R8UB 2ZD1A 5KFNA 4KREA 4DWIA 1B9DA 2WK4A 1S1VA 3U3YA 5KFXA 5K14A 4YR2A 3I5AA 5J2MA 2IDOA 4Z4CA 3MEEB 1RA7A 1BGXT 4YNQA 1VSIA 2ZE2B 3RB3A 3KJVA 5KFEA 1IKYB 1RCHA 2DPIA 2BANB 2V9WA 4WXOA 1L5UA 3OYAA 1F21A 3LZIA 4FJ8A 1N48A 3BSOA 3TVKA 3PX0A 4B9NA 4QOZB 2OPSA 4IR1A 2OPQA 1DTQA 3DLEB 4IG0B 4H54A 4J9PA 4NRUA 3TAQA 1HMVB 4EO8A 2B4JA 3PJWA 2WONA 4Q45A 3HXMA 4I7FB 2ALZA 4HUFA 1S9GA 1VSLA 5C42A 2R8JA 1D0EA 1SL2A 1TAUA 2ETJA 3AO2A 4DLEA 4CEZA 3B6OA 3QIDA 2O4GA 4BWJA 4AHSA 5DGBA 1RT2B 3OYCA 1RDDA 2HWHA 1RT7A 4AH9A 4MH8A 3GV5B 3DRRA 4CF0A 4DTJA 2O4IA 3HSTB 1NJWA 3VQEA 4NYZA 4NRTA 3BGRB 1FKOA 5J2PA 5KFWA 2HHSA 4FM0A 3KLIB 5FDLB 4YFUA 4RW7B 4NLPA 4LSNA 2HW3A 2BRLA 3LP2A 1JL2A 4CGDA 1J53A 4M3RA 4J2DA 1LWCA 1EETA 1KHWA 1S49A 3PW5A 3NDKA 5KFMA 4PUOA 1YVUA 5EWFA 4E7HA 1QAIA 1JXEA 3H98A 2X6NA 4LH5A 5KG7A 1RTHA 3LALA 3SV3A 4M3TA 1UWBB 4KO0B 1D1UA 1GX5A 1NJZA 2YNHB 1KFDA 4DFMA 4LQ3A 4FJIA 4NLWA 3NHGA 4ED6A 4DL3A 1GX6A 4B9UA 2HMIB 4H4MB 3MR2A 3DLKA 1L3TA 4N5SA 3AVIA 1NKBA 1IG9A 3G86A 2VG6B 3OS2A 1RT4B 2J6TA 4OLBA 2ATLA 4KKOA 3ITHA 4EP4A 1IM4A 4Q8FA 3ZCMA 5KG0A 4TLRA 4CJRA 3K5NA 1HNVB 4O44B 4K4XA 4K4YA 4J2EA 4MK9A 1TQLA 2HHUA 3DOKB 3OLBA 2UVVA 3B6PA 1K6YA 5F8IA 4NLGA 5HRSA 3OYNA 3PO4A 4FJ5A 1QSYA 3V1RA 1T03B 2DFEA 4ZTJA 3RMBA 3L2RA 3FQKA 4E0DA 2W9BA 3JYTA 3ICLA 1IH7A 2X78A 4OVLA 1RT3B 3E01A 2IM3A 2YV0X 1VSJA 1WNEA 4ZVFA 1KLNA 2BQRA 3AA4A 4AHCA 1I3AA 3BR9A 1Q9YA 1RBTA 4C8LA 4QCLA 1HYSA 3CM5A 4CK3A 3CQ8A 4XIUA 4CIEA 4JS4A 1IKXA 3SQ2A 4NLUA 1CSJA 5KFYA 3UPFA 5KFUA 2FVCA 3H59A 2XY5A 4CK2A 1NHVA 4F4YA 1X1PA 1TKZA 5C25A 3AA5X 3P5JA 3AVAA 1ZBFA 4Y2AA 2P1JA 2B6AA 3AVJA 4DF8A 2HNYA 1DTTA 3QIOA 4IG3B 3T3FA 2G8IA 2W9CB 2GBZA 3CFRA 3DOLB 2XWYA 4WYWA 3MAQA 3SJJA 1JXLA 1EX4A 3I0RA 4TN2A 4XPEA 4BDYA 4RW9B 1VK0A 2JC1A 4CECA 2G8FA 5DQIA 2ASJA 4FVMA 3ZT0A 1I39A 1RT1A 4U7CA 4FJJA 4Q44A 4C8MA 3CO9A 2IGIA 3OL9A 5DG9A 2A1RA 1IKVA 2XCAA 4DQQA 4RW8B 2XRIA 3HHKA 1O1WA 2D0AA 1Z25A 4ED7A 2IOCA 1TL1A 2VG5A 1SKWA 2X74A 4DU4A 1RBRA 4EYHB 3DDKA 1RYRA 3F9KA 4IFVB 4OKKA 2YKNB 4WYLA 4B3OB 4FS2A 1ZETA 1SH2A 3HYFA 4DMNA 3ZT1A 1FKPB 2C2EA 2Y1IA 4ECWA 4EO6A 1S6PB 3EYZA 1S9FA 1C1AA 1A5VA 4DEZA 3TR8A 1NOZA 2F8EX 4DSKA 4F8RA 3IRXA 3DRPB 4BE2A 2F96A 1VSDA 4Z4EA 4O3SA 3RWUA 3V9ZA 5KT3A 3L2VA 3FSIA 4NLDA 1TKXA 4O3PA 4Y2CA 4O4RA 4Y1CA 3TAMB 4HCCA 4CFDA 4K50A 3I0SA 4EBEA 5HP1B 1R0AA 1CLQA 5F8GA 3AVNA 3HP9A 1U09A 3V6DB 4K4SA 4ECYA 4CJKA 3KK2A 3OY9A 1BQNB 1S1TB 3DLGA 5KRSA 2IBKA 3D28A 3VN5A 3NAIA 4H4OB 3JSMA 3HVTB 4KHYA 2D41A 5C24B 5CYMB 3SUNA 4I9QA 1LWEB 5KRTA 4BDPA 1C1CA 1QE1B 1VSFA 1WSEA 4ZPBA 3HKWA 5HROA 3OYEA 1J5OA 1U04A 4E7IA 4FZYA 4O3RA 5KG5A 2P5OA 1S5JA 3O3GA 4BACA 4TYBA 3V6KA 4EZ9A 4G3IA 3LP3A 4RNFA 2Y1JA 1XC9A 3KHRA 4HUGA 1LAWA 2X6SA 3DYAA 4CJVA 2KW4A 3LWMA 3OSPA 4CHNA 3PX4A 1CZ9A 5F8LA 2KZZA 4MK8A 1C0MA 3L2WA 5KFKA 3VQ8A 3PX6A 3KKRA 3QO9A 1VSHA 2AU0A 4WFXA 2EX3A 4E1NA 1C0TA 2FVRA 4OKEA 3CFPA 3UIQA 1JIHA 4I2QB 5FRMA 2IC3B 4O4GB 5KFZA 1LWFA 4WE1A 5HBMA 1NHUA 2D0BA 2YNGB 2BQ3A 2YNIA 1TVRB 5CY4A 4FJNA 4J2AA 3M8QA 1X9WA 4E19A 3TABA 4FJ7A 1RTJB 4LSLB 2WOMA 1T8EA 5JS2A 1A5WA 4KAIA 2FBVA 3PW4A 2IJFA 1FK9B 1TKTB 4L8RB 1S48A 2RF2B 1D9DA 1KVBA 2Z1JA 5KT7A 5D3GB 1Z26A 4KV8B 4KB0A 1BI4A 3MECB 3CDUA 5DK5A 4GMJB 1SV5A 1NKCA 4WFYA 4J9LA 4YQWA 4J9SA 4ZPCA 2HNDA 3BQ2A 2ZD1B 2G8UA 4NLXA 3CJ5A 4Z4IA 2IM0A 5DQHA 3DM2A 1Y97A 1VRTA 1S1VB 1QTMA 5K14B 1W9HA 5J2MB 1LW0A 3HVRA 2FBXA 3VQ5A 1UA1A 4JV0A 3H5YA 4O55A 3MFHA 2W42A 3KJVB 5KFCA 3FFIA 2BGGA 5HLFA 2AX0A 3OJSA 4ICLA 3HO1A 4KHMA 4OPKA 3I5BA 1NKEA 4BE1A 2IA6A 4CGGA 3P83D 4B9TA 2OPSB 4CESA 2OPQB 1KHVA 4CJLA 1DTQB 1ZBHA 1UA0A 2G8KA 4GW6A 1BIUA 3KLGA 4X2BA 5F9LA 4RUAA 1S0OA 3RBDA 1S9GB 5C42B 4M41A 4HKQA 3Q8RB 3GV8B 4CFAA 3ZSWA 3OYHA 1SL0A 3KHLA 4DSLA 3SI8A 2QV6A 3IGVA 2GV9A 4DTUA 3VQ6A 3BDPA 2PZSA 5F8MA 4FLWA 2R8KA 4DFKA 3EZ5A 2I5JA 3OS0A 2JC0A 3AVGA 4FJHA 3DRRB 3CJ2A 4CEOA 3S3OA 2HHVA 4N56A 1UOCA 3PW2A 1WLJA 2OPPA 4EEYA 3AO1A 2FJXA 1FKOB 5J2PB 4DL5A 4PWDA 5EWGA 3G6VA 4IRDA 4LSNB 4U6PA 4RG8A 2KFZA 4M3XA 3BQ1A 3EZUA 3LP2B 1KCFA 1T3NA 3SNNA 4DL2A 3T5LA 1LWCB 1EETB 4FZXC 3LPUA 3WNHA 4PUOB 3VQAA 3H4BA 3OYFA 4EBDA 2C28A 4K4WA 1HQUA 3IS9A 1WAJA 4URQU 4Q8EA 3LANA 3SQ1A 1RTHB 4O0JA 3VQBA 4OGCA 1S4FA 4QWBA 4DU3A 2XY8A 3SV4A 3V9SA 1VSKA 5KG6A 3T5JA 2VWJA 3C6TA 1TGOA 2V0NA 3O4NA 2C22A 1BQMA 1L3VA 3RB0A 4F2RA 4QWEA 4IQXA 1S1UA 2DPJA 1ZTTA 3DLKB 4KAZA 4IOBA 2IM2A 1REVA 4CJUA 1KVCA 4KKOB 4CHPA 3ITHB 1NK9A 4FLYA 3KKSA 1RT5A 3M8PA 4FZZA 3CJ0A 3V6HA 5E41A 3D0PA 4TYAA 4IH7A 1RDCA 3CFOA 2HVIA 4DG1A 5KG3A 4KSEB 4F3TA 4DU1A 2B43A 4FW2A 5J1EA 1JLAA 3GQCA 2HHQA 3ZSOA 4LY7A 1B92A 1BIZA 3JYTB 3HL8A 3L8BA 4M3UA 4J9RA 3NH1A 1K1SA 3E01B 3KLHA 3AO5A 1XR7A 3OHAA 1X9MA 3AVKA 4B9LA 1TV6A 1XR5A 2R7YA 1ASUA 3SFUA 3PVXA 2W7PA 3WNFA 3SYZA 1HYSB 4ECXA 3T5HA 2R8GA 4KPYA 4LD0A 1IKXB 4DTXA 4ZPDA 4OGEA 3KOAA 1NK8A 4DTSA 5J2NA 4PQUA 4CK1A 5C25B 4B8CA 4CEDA 4CCHA 3NF7A 1X9SA 1WSJA 5DGAA 4ED8A 4AHUA 4RNHA 1C6VA 5KFOA 4B8AB 4Y34A 2B6AB 4DTPA 3K5LA 1WSIA 3KLFA 2HNYB 1DTTB 3TAPA 3N6MA 3HPOA 2PYJA 4FJLA 3E51A 4E7JA 3SQ4A 4M3YA 3KD5E 3I0RB 2R2UA 3LDSA 4Y3CA 3GIJA 2WTFA 3ZSRA 3EPGA 4KRFA 1RT1B 3DLEA 4IDKA 1U48A 4FK4A 2HHWA 1HYVA 1IKVB 3SI6A 3BREA 3V81A 3PJXA 4Z4GA 3NE6A 1KVAA 5FRNA 2JEFA 3DLRA 2RN2A 2XGQA 1CXUA 1IKWA 4AHVA 1HNIA 5KG2A 2RDIA 1TL1B 2VG5B 4Z4HA 4ID5B 1RT2A 4XO0A 1S6QA 4CEQA 3PW7A 1G15A 4CJSA 3RMCA 4AHTA 2FBTA 3HP6A 3TARA 1QSLA 4E89A 4Q0BA 1QSSA 2AGPA 3H4DA 3RR8A 1NK0A 4ZVGA 3QEWA 5L9XA 2IAJA 3KK3A 4FM2A 3FRZA 1KLMA 4DF4A 3L3VA 4KFBA 3GV7B 4CF9A 3QLHA 1LW2A 1S0MA 3RTVA 3IRXB 1HPZB 1N5YA 2E9TA 3AVFA 1ZBUA 3RBEA 3A2FA 1JLBA 4QWAA 4CJ5A 3KLVA 3VQDA 1Z4UA 2J6SA 2GIQA 1TKXB 3V9WA 4CEBA 3V4IB 4RNNA 3NH2A 3C6UA 3M9NB 4M42A 2C2DA 3SZ2A 2V4RA 3RRGA 3I0SB 3MR6A 1R0AB 1HQEA 3DRSA 3H5SA 4KI4A 2RDJA 5KT6A 1JLFA 4NYNA 3MXIA 4FCYA 3VQPA 4NLQA 3KK2B 4TXSA 1C0UA 3DLGB 2Z1GA 2YKMA 3CWJA 5T14A 2HNZA 3HK2A 4IFYA 1EP4A 3HPHA 3BSCA 1BCMA 3JSMB 4PA1A 4JRQA 3L2UA 3KK1A 3AVLA 1C1CB 3QEIA 4FLVA 4J9KA 3NGZA 3NMAA 4GC6A 5HROB 2QXFA 3WNEA 1J5OB 4C8NA 3OYBA 4YR3A 4ZHRA 5CYQA 4CGHA 3FQLA 2AX1A 4FJGA 1BISA 1S1XA 1HNVA 1T05A 4MKAA 2WHOA 1JX4A 1TL3A 3DYAB 4ZP9A 3OL8A 3EY1A 4RU9A 4MKBA 4R5PA 3N6LA 3SPYA 5KFHA 3K58A 2JLEA 4IRCA 3QO9B 2ASDA 2KZMA 1C0TB 1GOAA 4NLOA 4DSEA 1JXBA 4NLYA 4CEEA 4K4UA 1BL3A 4KTWA 4OKJA 4QAGA 2XO7A 3PZPA 3MTKA 1LWFB 4WE1B 5HBMB 2GUIA 5J2QA 2YNIB 3TI0A 2Q3SA 2LSNA 3K5OA 3M8QB 4ECQA 4J9NA 3LZJA 4FK0A 2WOMB 3ZSYA 3HVAA 1RAJA 3OYLA 4O5BA 1NOYA 3NF8A 3BSNA 4DFPA 5EUHA 1BI4B 4MFBA 4IKAA 4WXWA 1TP7A 3VQQA 2IS3A 1SV5B 2R8HA 4FLTA 5KFIA 3QGIA 3KLEA 4ZP6A 2HNDB 2WRMA 4E7LA 1MU2A 5DLGA 3D45A 3VA0A 3DM2B 1VRTB 3RB4A 1NK4A 1LW0B 1N6QA 4QW9A 3ZT4A 3M8SA 3M9OB 4ECUA 3KHGA 4DTMA 3FFIB 3SUPA 3V6JA 2EC0A 4MK7A 1RBUA 4FK2A 1HRHA 5KTQA 2BRKA 3THVA 2YNFA 5HLFB 2HHXA 4CJ4A 1SKSA 1JLQA 2C2RA 3LP0A 2FBYA 3HJFA 5SWMA 3EPIA 2FLNA 1S1WA 1RDBA 5KFAA 3QEVA 4FBTA 3G6YA 5I3UA 4CIFA 1YTAA 3G0ZA 2ILZA 4IRKA 4DTOA 1A5XA 3H5UA 3Q8PB 3Q8SB 4KE5A 3KHHA 3DI6A 2W8KA 3K2PA 3DLHA 3G10A 4I2PA 2OZSA 3OVNA 4DQPA 3SCXA 4JUZA 2EHGA 5F9NA 4TSXA 4CIGA 3IG1B 2RKIA 2D3ZA 3ALYA 1RTIA 3NAEA 3SFGA 2UVRA 4K8ZA 3PUFA 3QEXA 4DQIA 1I6JA 3PW0A 2F8SA 4DSJA 2RPIA 4O3NA 4PWDB 1SL1A 3KD1E 3QZ8A 3GIIA 2XI3A 4DL6A 4BWMA 4ED1A 2NUBA 2UUTA 3TAMA 3C95A 4NZ0A 1K1QA 2WB4A 1ITGA 2UUWA 2JEIA 1D9FA 1DLOA 1QAJA 4ED0A 1HQUB 3IS9B 3NF9A 1WN7A 5CZ1A 2E6LA 3CM6A 4F4ZA 3K57A 3RAQA 2HAIA 4H4OA 1YVFA 3M8RA 3HPGA 5KFSA 5F8JA 3LAKA 3NGIA 4QWDA 3C6TB 3CJ3A 1SUQA 3BJYA 1T7PA 1JLGA 1BQMB 4TQRA 4BDZA 3QIPA 1S1UB 4C8OA 1REVB 2FC0A 2BE2A 3AO4A 2WONB 1RT5B 3M8PB 4CGJA 4KHUA 3MEGA 2XCPA 2VG7A 5KFQA 2WCXA 4CJTA 4DG1B 1S10A 2XC9A 4KBIA 3L3UA 1D8YA 4J9MA 4RUCA 1JLEA 1RT7B 4QW8A 3BQ0A 2E4LA 5L1KA 2FLPA 4B08A 5J1EB 1S9EA 4O4GA 3ZT3A 1RT6A 3DMJA 1JLAB 2ZKUA 5DMRA 4HCBA 3OYDA 1TK0A 2YNGA 2KQ2A 2KFNA 4ED2A 1KRPA 4FXDA 4DS5A 3U6FA 4URGA 1QHTA 4RNMA 3QETA 3KLHB 3AVCA 3NGYA 3T1AA 3RMDA 2IM1A 1TV6B 2RF2A 4FS1A 4J9OA 3OHBA 4JV2A 1U47A 2F8TA 4G1QA 5I42A 3F73A 1JKHA 5KFTA 4BE0A 3H40A 4O0IA 2XI2A 4HUEA 4KHQA 5J2NB 1RTDA 4FLZA 2OH2A 4PQUB 2W7OA 4TY9A 4KHWA 1U49A 2AQ4A 1RDRA 4NYFA 3QERA 3NH0A 1NK7A 4F2SA 1RBSA 4KTZA 2FVSA 3AA3A 4RW6A 1XWLA 5C5JA 1L3SA 3ZSZA 3KLFB 3GYNA 4ZP7A 3IGNA 1XI1A 4ZVEA 4AHRA 4CERA 4ELUA 2ASLA 4B9VA 4JRPA 1UAXA 2E9RX 1NK5A 4TY8A 3AV9A 2JEJA 1C1BA 1JLCA 4CF8A 3UR0A 4ECZA 4B9MA 3P1GA 1VRUA 4YP3A 3QYYA 4CHZA 4IDKB 4JLHA 4HYKA 4CF2A 1VSMA 3PO5A 1J9AA 4HVJA 3G6XA 3V81B 2GC8A 4FJ9A 3NBPA 3LP1A 4NCGA 4WFZA 5KG1A 3CYMA 5DQGA 4URSA 3VQ9A 2AWZA 4GC7A 1Q9XA 5FROA 1IKWB 1HNIB 4RW4A 3M9MB 3HM9A
chains in the Genus database with same CATH superfamily
3NS5A 3NKYA 1S6QB 2OPRA 2IIHA 2EW9A 1G99A 2KT2A 2XMAA 5K5MA 2H5IB 1J54A 4C23A 3FEZA 4FLXA 1W2IA 3KK3B 2UP1A 2R7QA 4R0EA 2E6MA 1XJWB 2V34A 4JI3K 4LH4A 1EB0A 5F2RA 1TU0B 3K5MA 2MLYA 4WCEQ 4JI0F 2ZE2A 2RNEA 4A47A 3I9V9 1ZTWA 2OTJN 1HJRA 4X4RA 4B3TJ 4B1UB 4C7QA 1EP4B 5IT9Y 5HMWA 1GXLA 4DV6K 2PAVA 5ETMA 4JV5J 3V1QA 4FW1A 3OYMA 2O8DB 2PI4A 4JNEA 1FT8A 4M5KA 2KU7A 4ZHRB 2HIYA 1W25A 1S1XB 8AT1B 3DOMB 4ZOSA 1QVFM 1SBRA 3VEXA 3GJTB 3OD2A 3C8YA 4DV4K 2E9ZA 1T0TV 1LK7A 2Z2LA 5HSPA 3I5CA 4LR9A 2NRHA 1RAFB 4JI6J 4EFHA 2MSTA 2QE5A 4YOEA 2ZVIA 4JKGA 1H72C 3FK4A 3BGRA 1VLOA 1NLKL 2OGUA 3CJCA 4OLOA 4CI0B 3QGGA 5KI6A 1F6TA 4DL4A 1LQ9A 5E7OB 4H0YB 4DSFA 4E1MA 2G8WA 3K8WA 2VBWA 4P2XA 2LQ9A 5EVZA 4ZLNA 3R6GB 4K4TA 4DR6F 5AQIA 4LF5J 1Y5LB 4MFBB 4P9SA 4I9LA 2UVUA 1UWBA 4KO0A 3I4PA 1NK6A 4KHRA 1YI2N 4L3NA 2MGZA 4DV7K 2NXUA 3KLEB 4CJQA 3R97A 3CE8A 1BY9A 2J9DE 2CNLB 2IDLA 2B7CB 2HMPA 2VGMA 3SXLA 2AEMA 3KTQA 1RDAA 2FDNA 4CZMA 4E3SA 1ACMB 4UUXA 2ZHOA 4CJPA 1CC8A 4UZBA 1NUEA 1RZMA 3MGJA 5JVHL 5K8MA 1VQON 3G8QA 2OD6A 4O44A 2A1BA 1OKJA 1JLQB 4NLBA 2FLLA 3NOCA 2B3TB 4B02A 2MY7A 3D2WA 1T03A 3H2VE 5D15A 4ILGB 5B0EA 1VQ7N 2KB2A 1GOCA 3CJQA 3NVKA 1UVMA 3RAXA 3LUYA 2CQHA 1S97A 3OW2M 5K9FA 5C10A 2ZITA 1IBKJ 3GPAA 1XN9A 4KHSA 2KO1A 4TQSA 2RKIB 3WQPA 1WKLA 2QFIA 1Z05A 1SZ2A 3UDLA 3SQGA 2FGOA 2MQNA 2E44A 1HPZA 1R8CA 3PSFA 1IXKA 3PFEA 4ECRA 1U2CA 4RZRA 2OYQA 3CC2N 3KVGA 3BY5A 1E6YB 1ZC6A 2UVWA 4LVOP 4RJVA 1M5VC 1HBUA 4DV1F 3TPQA 2RH3A 4ANEA 1SH0A 4FJMA 1DLOB 4RWWA 1N8RO 1FJEB 5BPLA 2W9CA 1FVQA 3FFKB 3QINA 5A8RA 2NYHA 1BWFO 3DOLA 4K4ZA 5F8NA 1GLJO 4ETXA 3OL7A 2K1RA 1HNXK 3D68A 4ICLB 2FJVA 5EXWA 4DQSA 3GSIA 1KC8O 3NS7B 4U95A 2V4QA 4BRPA 3QIPB 1DQAA 3A3PB 3M8ZA 1U45A 4W92B 2DRAA 3M2VB 4HR2A 3DFEA 2XSJB 4CT8A 4NB4A 5LL6d 2PA3A 2VDHA 2JJ4D 4HHJA 3WX4A 3AA2A 1BQXA 3VEOA 2CQGA 3RBZA 1DKGD 3CD0A 2NXEA 5KFPA 2Q6BA 4BY9C 4IFVA 1U25A 4B3OA 4OLAA 1MWZA 4PG6A 1FKPA 5L1LA 2QEXS 5KT5A 4RWTA 2BV3A 4EGLA 1RA6A 3MXHP 1D4XA 3D5MA 3DXKB 5AZIB 1OQ3A 3PR4A 2M8DB 2R3VA 3MAHA 2AGOA 4P71A 4G1PA 4Y2KA 3MM5A 3BSAA 5AJ3J 5A2QO 1LWXA 4OJ1A 3CMAN 2IHR1 3ZSXA 4NEZA 2BUNA 4DQRA 2A2CA 3CPWM 4MQ3A 4CHYA 4YORA 1N0UA 1HNZF 3CIMA 1XTZA 3NAHA 2QG9B 2QL7B 4F3OA 4G1QB 4N41A 5I42B 4Q43A 3LM9A 1JKHB 5H1SQ 1RILA 1BQNA 2Z1IA 2CVEA 4LF7J 2OSRA 3CC7S 4NCAA 1WSVA 3X1LB 2ASPA 1RWXB 4ZA1A 3HVTA 3OBIA 3EM1A 3ENHA 4E1JA 4KB7A 5L1JA 2HWIA 5KGXA 3I31A 1QE1A 3U7JA 3H2LA 1I3OB 2NUUG 3W2WB 4KB1A 4CHQA 2RAQA 4PG8A 2HF3A 1YRTA 4DL7A 3KNAA 1TR0A 4U67L 4TY8B 1N36K 4E8UA 4FBUA 4YDDB 1C1BB 1MG7A 5LXRA 4IQMA 4ZDNA 1OY6A 3UVJB 4P7VA 5GAGI 2KLAA 1VRUB 2YHBA 2M4MA 1TZ0A 2H5EA 2DY4A 2D9OA 4JI2K 1TK8A 2P6SA 2GVZB 4M5DB 4DU8A 2FVQA 4I2QA 4OYOA 3IMQJ 1P6TA 4DUZF 3B4MA 2ZHBA 2MKYA 3P6YC 4RW4B 4Y1DA 1KFSA 3D1OA 2YQ3A 1G3OA 1Y7PA 1CJTB 3MPYA 3MR5A 2NUHA 4D3HA 1RTJA 4ZCMA 2O8BA 1WORA 3IG1A 3ZT2A 2W2MP 1IBMF 4MDBA 4F4XA 5HVHA 1YTYA 1VHFA 2GVDA 2VA3A 4ELTA 4B1XB 2XMTA 1HR0F 3Q8QB 3Q8YA 2B5JB 2MY8A 3AO3A 4M7XA 1HBOA 5HN0A 3MK6A 1SS6A 1K8KA 2VJVA 4DWIA 4AYBD 3T6BA 4LRFA 5ITHA 1B9DA 3O08A 1PKUA 1S1VA 3U3YA 5KFXA 2V68A 2XNQA 2HF4A 4Z4CA 1IJEB 4FPRA 1RA7A 4HTJA 5H1SV 4Z2XA 3VAKA 3KWMA 4WF9L 2VC0A 2G13A 2BANB 1L5UA 1IM6A 1KOHA 5AQGA 3OYAA 4C6AA 3LZIA 2CH6A 4JI3J 2DISA 2P6TA 2HBRB 3TVKA 3M05A 3ZTQA 1GK8A 4M5MA 3CHWA 3DLEB 4H54A 3F9MA 1HMVB 3CTRA 4YB5A 3T1YK 3T1HF 3Q8UA 3U8XA 4I7FB 1VSLA 1ZBTA 3QMQA 2R8JA 4RTFD 5A8KB 1SL2A 2MZQA 2UU9F 2E7WA 2QC3A 2MKHA 1V9OA 5AR0A 1EJ7L 4AHSA 5DGBA 1RT2B 5LJWA 2J7UA 4PKIA 4DV6J 4X4PA 2K2PA 1UL3A 1VR6A 4DV2K 4CF0A 3VVTA 3QRQA 1QQOA 4GKKK 3EKSA 4NYZA 2YCHA 5CCMA 4NRTA 3KYLA 3JS9A 2I6WA 3H46O 5FDLB 4RW7B 2B8PA 4LSNA 2B4OA 1T6DA 3IFRA 2HW3A 3LP2A 1JL2A 4MTPA 5IC4B 3SSRA 2XLIA 1LWCA 1KHWA 1S49A 4DV4J 3NDKA 1RISA 5KFMA 4PUOA 4B1YB 1Q82T 4E7HA 4B3MK 3TP2A 4JB8B 3RGIA 3QRRA 3D2EA 4LF9F 2Z57B 3A13A 4WTOB 5C2GA 1LOUA 4DFMA 1N0VC 1X5OA 4QIEA 4CZJA 2P9GA 4NLWA 4CLLA 3NHGA 2ADBA 1ULRA 2NRZA 3AJ1A 2EXUA 2B4UA 2DNNA 3S6EA 1KR4A 4LRDA 1RABB 2DD8S 2LU2A 3MCSA 4IYQA 2IVOA 1S6UA 3G86A 2VG6B 2P9NA 3BZCA 4OLBA 4KKOA 2BE9B 2ABYA 1JWWA 1IM4A 4Q8FA 1GLDG 4USJC 4CJRA 3BH6B 2RQCA 3K5NA 1HNVB 4DV7J 4K4XA 3EE3A 4K4YA 4LT6A 1UVNA 4FVUA 4DR3K 4MK9A 4BR2A 1D09B 2MKKA 4UF4A 2J0XA 4FJ5A 1QSYA 2OMLA 2DFEA 1DGKN 2PFFB 3ZNUA 3RMBA 4FZVA 4YUDA 2W9BA 4CTAA 1T9VA 3C7NA 1TL5A 4OVLA 2GX9A 2NRXA 3O4WA 2CJXB 3MWPA 1KLNA 3W8GA 5IXUA 2XLJA 1Q7YO 3BR9A 4JKFA 3JAMO 4QCLA 4CK3A 3CQ8A 1XIQA 4CBUA 4NYOA 1AW0A 1CSJA 5KFYA 3UPFA 2HBJA 2HBLA 5KFUA 2XY5A 4CK2A 1NHVA 2DBBA 1GXUA 3E1YA 1X1PA 1TKZA 2AV5A 4HWIA 2LVWA 1KN6A 3TSPA 2E1AA 1ZBFA 4Y2AA 2P1JA 5FPNA 3AVJA 4JAXA 1T02A 1V3SA 4ZVOB 1DTTA 4HTLA 2W6KA 4OFZA 3GG4A 4IG3B 2B7BB 2ROEA 3NP5A 2M7SA 2JL9A 1YX2A 1NSQA 2KM8C 4N7TA 1DFDA 2OIHA 4WYWA 3H90A 3I0RA 2JC1A 4B3TF 3CCSN 1RJJA 1DAXA 2JLFA 1PG5B 1JJ2M 4ZVTB 4FWRA 4C8MA 2IGIA 2A1RA 1IKVA 2CPFA 4JV5F 1VJQA 2GAGC 3HHKA 1O1WA 1Z25A 3OR2B 3FRYA 1TL1A 4XK8C 2XNRA 4EYHB 5D6GA 1RYRA 2AJ0A 2BJ8A 4W98A 4OJHA 4BR5A 2JWNA 3CJKA 2YKNB 4LFCK 1HNXJ 3AY9A 3CCUS 3ZT1A 2C2EA 2Y1IA 3ENVA 5LMUK 5AQNA 5IM0A 2JLGA 5AQYA 3DDNA 2F8EX 1C0GA 3IRXA 3DRPB 4BE2A 2DHXA 3HHDA 3V9ZA 4ZVUB 1VFJA 5KT3A 1SQGA 1KOOA 1Y11A 4RBVA 5B0FA 3QFUA 4K42A 1TKXA 4O4RA 4A46A 1TELA 4ZVRB 2IBOA 4CRJA 2PEHA 3ZETB 3KWIA 1CLQA 3HP9A 2ADCA 3V6DB 5A8WA 4K4SA 2YHXA 4LF5F 3KK2A 3OY9A 1MN9A 4LF2A 2IBKA 5E3QA 4CLYA 1YK9A 3D28A 3WXKA 3QT7A 5H9FK 2CQIA 4J37A 4BDPA 4U96A 2MB0B 5KRTA 2XWXA 2OHDA 3BGLA 1WSEA 4ZPBA 1SJFA 3X3UA 2I38A 2P9KA 4V19J 4IEIA 4CI6A 4E7IA 4FZYA 3UR3C 2P5OA 1MNEA 1S5JA 3VAGA 3ID6A 4G3IA 5GINA 3I82A 4BGBA 2HLTA 1LAWA 2X6SA 4OZJA 3P4UB 3HTVA 3Q24A 3OSPA 2J8AA 2VFRA 2QXLA 3HHLB 2GGPA 3KKRA 3CQYA 5BYQA 2KYXA 2NLXA 1O0PA 3R6LB 2O1PA 4QIGA 4WFXA 4F0HA 4Y6IA 4OKEA 3UIQA 3W63A 4F3QA 2FY1A 5JJBA 2W2PP 3W5YA 3GJQB 3VGKA 2M0GB 1N36J 1C4CA 3ZZ0A 5K8NA 5KPRA 5CY4A 2FZGB 4DOZA 3M8QA 4CJ7A 3HCXA 2XYGB 1T8EA 4QS8A 4KAIA 2FBVA 4Y65A 4QIWD 1TKTB 4JI2J 3NG8A 2NZTA 2Z1JA 5D3GB 4KB0A 3AOBA 5CE3A 4PL7A 3RSEA 2Q43A 3NGRA 2QWLA 4GMJB 3CD6S 1SV5A 4J9LA 1KS2A 2KRRA 4OPHA 4J9SA 2D4WA 3G96A 2ZD1B 4NA3A 6AT1B 2IM0A 4OYWA 3FEYB 2QFJA 3PIOQ 1W9HA 3KUEA 1UA1A 4JV0A 4NI2A 3H5YA 4O55A 4CLZA 3PSIA 5CR4A 4OV1A 3C19A 3FFIA 4XH4A 2JRSA 3MMAB 1S57A 1SJQA 4IOAQ 2DGUA 2J0WA 1TL4A 3MD3A 2PSZA 1S99A 3U4LA 2HFZA 4BE1A 4CGGA 3HDSA 1FRMA 2OPQB 1UA0A 3VV2B 5DO2A 1QVGR 3MPVA 2VU5A 1OJ4A 4TU8A 5A2QU 2P9IA 1S0OA 4IEEA 4M41A 4V1Ak 1RDWX 3HJVA 4OYMA 3L6QA 3Q8RB 3GV8B 3OYHA 4KH4A 2MZ1A 3IGVA 3FCHA 1HNWK 4DTUA 3CCEN 4U9RA 4DFKA 2NXNA 2I5JA 3CIPA 3GCXP 3VQTA 4K0KK 3P39A 4FJHA 3DRRB 3T1YJ 2V7YA 1WLJA 5H9EK 2CPZA 3AO1A 1T9YA 3HF5A 4CW7B 4B3RF 1FKOB 5J2PB 1NM2A 3IBCB 5G4DA 3VGUA 2KFZA 2VICA 3ETMA 3BQ1A 5LMNF 2A41A 3S01A 1KCFA 5AJ3F 4DL2A 4BR7A 3T5LA 2VJUA 1VQOS 3NCPA 4DV2J 4BHQA 2A2DA 2Z2ZA 2KKZA 4GKKJ 2O8FB 3GLJA 3LANA 4ZK7M 3M2UA 1H6KX 3K8VA 4QWBA 4C1NI 3IA0A 4LF7F 4BRNA 1B7FA 3EO3A 3EX7B 1VSKA 1BXNA 1KD1O 4PG4A 2BBEA 5KG6A 3T5JA 5CH7B 1N33F 2BJ3A 2V0NA 1TGOA 3US5A 2C22A 4I1TA 4DZ6A 4NYPA 1RWPB 1DURA 3KG0A 1UVKA 4B3MJ 2DPJA 3CB4A 4KAZA 2FB0A 1V4TA 2H3EB 2O8EA 2NZ4A 2QJ3A 3MEKA 2F7TA 4CHPA 3LDPA 1NK9A 4FLYA 4DR7K 2PA8D 4L3QA 4TYAA 2N7YA 1RDCA 3CFOA 3O3LA 3CC2S 1OYEA 4KIAA 4CO4A 4HEA9 4FW2A 4DUYF 2DGSA 3Q8VA 1NAQA 1VIOA 4DN9A 3ZSOA 2CDRB 2QIFA 1VHXA 2FUG9 1B92A 1U8WA 1BIZA 2DIUA 3QAEA 3JYTB 3HL8A 2CFXA 4RL1A 2HRYA 1XR7A 2CG4A 4DR3J 1FTCA 4LF6F 4JYAK 1TV6A 4QR1A 1ASUA 3SYZA 3LO3A 2V94A 4LD0A 4BQZA 1IKXB 4DTXA 4ERDA 4OGEA 1NK8A 3A8EA 2ZUGA 3QICA 3FZLA 2PMZD 3OTDA 2BOAA 4DU7A 4CEDA 1WSJA 1GTEA 2ACYA 1C6VA 4B8AB 3OR1A 4CM0A 3OHRA 3R1LA 2OJ3A 1WSIA 1U26A 4W4MA 2R7TA 3EGVA 5EHHA 4BR9A 2GV1A 4FJLA 1JCFA 4M3YA 3SEOA 1BO5O 2W2QP 3ENBA 4JI3F 5BN8A 2YH0A 4MKYA 4Y3CA 4KH6A 3EPGA 5IV4A 4IDKA 1U48A 4FK4A 3HKZD 2H51B 3K0JA 2BM0A 1FVSA 3EGWB 3GSDA 1FDBA 3SI6A 3EZOA 3TOQA 3PJXA 1B0TA 4OYPA 2JEFA 3WQUA 3EXYA 2XGQA 5F3TA 1ZZFA 5KG2A 2B8QA 2VG5B 1RXOB 1S6QA 3R7NB 3B4DA 3U27A 3MMJA 2P9UB 4AHTA 3TARA 1QSLA 3ID8A 3W3SA 1QSSA 3PKYA 3CULA 1FCAA 2LQ8A 3QEWA 5L9XA 3KK3A 1HBNB 4JKBA 3CCTA 1S0MA 2A10A 1T9UA 4I6YA 3E8OA 4CJ5A 3KLVA 4LFCJ 2J6SA 2BMBA 5FPDA 2VB6A 4IOXA 3RW7A 4DV4F 2K3KA 4M42A 3SZ2A 1NLVA 2BM1A 5LMUJ 5AQPA 2KHCA 3I0SB 4OIXA 1ZOTA 4KY3A 4EAHD 4KI4A 2RDJA 2R7XA 3BF1A 4WFNL 3R2DJ 3PLAA 4NYNA 3MXIA 4YHHK 3CWJA 3HK2A 3CCRS 1EP4A 3BSCA 4BRIA 1NGIA 3J80O 2CQ1A 2GO9A 2QLWA 3AVLA 2W4CA 3R1XA 5KOXA 3OXGA 1K47A 1C1CB 3KZBA 1F60B 2BA9A 2O8DA 2DGQA 1J5OB 2HQFA 4ZHRA 1U6FA 3FQLA 2AX1A 1WOSA 1IN0A 2RS8A 2DCUB 4C8ZA 1S1XA 1NDPA 1CS4B 1H2UX 1B4SA 2ZJPQ 2UUAK 1X4CA 3DOMA 1JX4A 5DDPC 3JAMU 4DV7F 5H9FJ 4KH0B 3N6LA 3Q2TC 1A6LA 4C3MA 2JLEA 2E1RA 2KZMA 2VC1A 4DSEA 2NRTA 1JXBA 2KN4A 2NREA 4OKJA 3PZPA 4WE1B 4FKYA 2JOQA 2YNIB 3TI0A 2LSNA 4ECQA 2BW7A 1X5PA 2WOMB 2ZOGA 4OZLA 4JHDB 2DY9A 1RAJA 2ZFHA 4O5BA 3HFZB 3R8EA 4L6V3 1BLUA 3QFPA 4DFPA 5EUHA 2EFPA 1BI4B 4MFBA 4WXWA 5AQRA 1SQKA 3MURP 3VQQA 3EVWA 2R8HA 5BN9A 4DCOB 4B3SK 3FGVA 3KLEA 5HATA 2HNDB 1OY8A 3EE8A 2WRMA 5GAGP 2VPYB 1OY9A 2QRRA 4IDHA 1FWKA 3HBTA 2CNOB 8ATCB 3J7ZT 2HZVA 3UKRB 2D74B 1LW0B 4I64A 4UY85 1YJNS 3M8SA 2FXUA 4DTMA 1RBUA 3K9JA 1RHUB 1CJUB 2OUGA 4CJ4A 2A6AA 3O1BA 1SKSA 1JLQA 1FJGK 4QJVA 5GMDA 4CVNE 2VUGA 2Z2YB 5KFAA 2ZJRQ 2LYVA 5E26A 4KJIA 3G6YA 1ZM2A 4CIFA 4U8VA 2ILZA 3Q8PB 3CC4N 3W2VB 1FD2A 2HFUA 3P45B 3BZKA 3VETA 2OZSA 3B8AX 3SCXA 1U1NA 5F9NA 2VOPA 4CIGA 2RKIA 3ALYA 2PE8A 1IJFB 1Q8KA 4OI4A 4OYAA 1I6JA 5AZJB 2H4YB 3PW0A 2RPIA 2AZ1A 4O3NA 1U1QA 1S76D 1E6YA 2NUBA 2UUTA 3TAMA 1HNWJ 1GXTA 4F02A 3O9RA 2KH9A 1ZZNA 2RJZA 4IOCQ 2YWWA 4NASA 4K0KJ 1DLOA 3MOJB 4GKJF 1BUXA 3IS9B 2KYZA 3CDAA 2M2BA 4KGKA 4F4AA 4NWBA 5H9EJ 2WZ1A 3K57A 1BWVA 1VAZA 1QM9A 2CPHA 2HQDA 5KFSA 3VGMA 3WEEB 2CWXA 3AB2B 3C6TB 2WW8A 1RWWB 2WB1D 3BJYA 4BDZA 3QIPA 3ATUA 3M2VA 3BPDA 4K41A 2XSJA 1OVYA 2DK2A 3BYRA 1UZHA 3RZAA 2XCPA 5KFQA 4JD2B 2UUBK 1VDHA 3A3OB 5AFUA 1GLCG 1UETA 2QL9B 1S10A 3SCLE 2QLBB 3H6EA 4J9MA 2C1EB 5M1PA 4ZN1A 3DCAA 2E4LA 5L1KA 1ZM3A 4B08A 2ZOFA 1XUPO 3DXKA 3ZT3A 1JLAB 2KFNA 4ED2A 1Q8LA 1ZAVA 3MHYA 4DR7J 4DS5A 1SJRA 2KXHA 4BC9A 2E1ZA 5M1QA 1XMQK 4KYZA 4P73A 1M5KC 1SCJB 3AVCA 3T1AA 4WBFA 5FPMA 4LFBF 2BEFA 3G6ES 2RF2A 3MOZA 4FS1A 6FDRA 4J9OA 3OHBA 2HGNA 2VPWB 1QAXA 1XEZA 4G1QA 5I42A 1YHQS 1JKHA 3G71N 4O0IA 2XI2A 1T3OA 1VJWA 1UFKA 4HUEA 2J9EA 3ZEUB 2DNZA 3SSQA 2RUSA 3M6XA 4KHWA 4C98A 5TKWA 4CLPA 3M6VA 4CIOA 1FRIA 4JYAJ 4OYIA 3DAWA 1RGVA 3K89A 3GYNA 4ZP7A 3W2WA 4ZS6A 4AHRA 2VQFK 2GQ2A 2ASLA 1S4EA 4RU2A 2CPYA 4YOTA 4JRPA 4TY8A 4NL5A 2O67A 2JEJA 1C1BA 4ZKAA 4KQZA 4ECZA 5ETPA 4CH7A 4KGMA 1NDKA 2R42A 3UVJA 3CJ7A 1VRUA 3A8JA 4YP3A 2X7IA 5BXIA 4FPIA 4P52A 1J6ZA 4OYXA 4XH5A 2GMHA 4JLHA 1QQMA 4CF2A 1J9AA 4HVJA 4WKRA 4QQBA 3G6XA 1M5HA 2MZSA 2GVZA 2V9KA 3Q7BA 4M5DA 2GC8A 4EFAC 2LEBA 4NEYA 3CYMA 1AFJA 4TU7A 2EG2A 1IVZA 4RW4A 1Y64A 1CJTA 4BRHA 4F4WA 3PEHA 3ENQA 4EYIB 2OTLS 4ECVA 4IH5A 4JI0K 1SH3A 1VSEA 2RT3A 2HVHA 3VQCA 4WQ4C 3VZIA 2D0CA 5EWEA 2QWOA 3VEVA 2VASA 3MF5A 5DS7A 4O23A 2B5JA 3SUOA 2QL5B 3QESA 1ILYA 3OJUA 3QZ7A 3O3FA 1L3UA 1N5SA 2GZOA 3NF6A 2CZ9A 3E3XA 2AF6A 2GHVC 5M2RA 2F9WA 1TMJA 2HBZB 1GMUA 2Q97A 4X4OA 1ZPWX 4K4VA 1HQEB 2BANA 2A3JA 2Y1RI 3CCVS 1ZBSA 5ETSA 1IO2A 2HNZB 4AILC 4IFYB 2EC2A 3G25A 2Z2MA 2HBMA 4K8XA 2VH7A 2PMHA 2RE1A 2QA1A 5JXSA 2EFGA 3ZFVA 3EKUA 3DLBA 4XAKA 1HMVA 1ZAXA 2CQ4A 4RPFA 1ESVA 4NLSA 4I7FA 1BA1A 2W8LA 5A8KA 3KMQA 2QKKA 1T05B 1DY3A 3WIUA 2YQ0A 4YHHJ 4WQ4A 2YVSA 1TL3B 1X3MA 1O5JA 3NFAA 4EI2A 3RBXA 2BQUA 2VFUA 4R5PB 1OPIA 3KWGA 5DG7A 4DR6K 3V1OA 4N47A 1Q0NA 3KMSA 2HK3A 5EU7A 3ZSVA 3SQ0A 1K9MO 5BR8F 3UD5A 4O3OA 2XY7A 5FDLA 4RW7A 3VZHA 3OSNA 2MHNA 1RSCA 3GU0A 4KC5A 2UUAJ 5J2QB 4FJKA 1Q79A 3THTA 2AP1A 2HGLA 4C4WA 1N4LA 4DTNA 2XHWA 1B3TA 3RW6A 4DR3F 4JI1F 2DFHA 1CJKB 4U7UD 4FF2A 2QO3A 5D4PA 1T9WA 1HARA 4QYZK 5GIOA 4C0OC 3ZSQA 4CZFA 1WSGA 4W5TA 3BO4A 2C2ZB 2OZMA 1Q8IA 1OO0B 1PBUA 3TSUA 3VGLA 2WBNA 5AFUH 5BYRA 3MWTA 3RMAA 2RQ4A 2PYLA 3G9CA 4PY5A 2IMWP 2D5RA 2DR7A 1QUVA 4RLEA 1N6QB 3W65A 1WEZA 3ZX3A 5D0GA 2FC9A 2VG6A 1HWJA 4M95A 5D8HB 1WOOA 3NEKA 3AVMA 4DLGA 4Q5VA 4B3SJ 2YNFB 2ILYA 2QK9A 5JUMA 3LPTA 5IWAF 4U8YA 2XHBA 2DNQA 3HULA 4OPAA 5CZVA 5DM6L 4JK8A 3AVBA 1RWVB 2CPJA 1S1WB 1OH8A 2CJQA 1IWAA 2V8GA 2OA8A 3TANA 2DXDA 1RNHA 4KGZB 1RHRB 2YI1A 2CRLA 2E20A 4UOCA 3VHQA 4ID5A 4FP9A 3SBTA 3ZZUA 3RR7A 4WZQA 4I2PB 2AJFE 4ECTA 1RYSA 1OH6A 3F56A 4ZVHA 5LJ5Y 2F4FA 3ZTRA 1U1OA 2O5DA 4BRDA 4IJNA 1FRLA 4M3ZA 4RO0A 4IO8A 3BGOP 3J80U 3N0VA 1B9FA 3IAYA 5A2QY 4RUHA 4KTQA 3ZTSA 1RHQB 3H08A 1OWXA 2GIRA 5BREA 3V4IA 5MAOA 4LFCF 3Q83A 1RLDA 2ZDPA 3OYJA 4J8FA 3VR1A 3H5XA 1N5TA 5J1PA 2BJ9A 1D8ZA 1U0SA 4M45A 4IG3A 4YR0A 1F5AA 2CQPA 3MM9B 4DX7A 2FVPA 2FSJA 1VIXA 4J91A 4CNZA 4WZMA 4ED3A 3GB0A 4UUWA 4M94A 1ELOA 1N8RT 1JLGB 4F4KA 3SUQA 2R2TA 2GIFA 1MWQA 3AVHA 1N54B 3OR2A 1QQCA 4OYBA 3VOVA 3PKMA 1CZAN 2UUCF 1ZBLA 3HT0A 3CCZA 4NCBA 3ZO7A 2EFVA 1WSHA 5EX0A 5JS1A 2YKNA 4PHTX 3L2QA 1KC8T 1OQ6A 4OX7A 5KFFA 2W9AA 4RBUA 2RUGA 1JLEB 1ZBIA 5KT4A 2J9CA 3DRPA 1Q8BA 4PXBA 1RT6B 1ZS6A 4A57A 3MXMA 4HT7A 1GH8A 3MPUB 2ZZMA 2OCEA 1FFGB 2MEWA 1VQSA 1X31C 1TKDA 2VQEF 4CJFA 2JSXA 5D0EA 2UUBJ 3BB5A 3WNGA 2R2RA 3TRGA 4MIBA 1SKUB 1X4AA 3IN5A 3ZETA 3TWHA 5KFGA 3DLLQ 3V6DA 4J90A 2LQJA 3MZIA 3BM7A 3IRWP 1QAYA 2ASYA 1PILA 3MN5A 1BHNA 2AIRB 3OLAA 3ET6B 4H5VA 1XMQJ 3PIPQ 1VQNS 3M32B 1EARA 2X3GA 3R5CA 4YDUC 1NBEB 4YMEA 4AFFA 4FNIA 3ISND 3AD7C 1YQHA 5DG8A 1ZH5A 2DFFA 2RU9A 3LH2S 3OTOK 3ASMA 1VISA 2XTJP 1B0VA 1Y3JA 4EBCA 3QT5A 1W7WA 3JQJA 3E2EA 3QNNA 4Y00A 1YTUA 2GQCA 3E66A 2AJ1A 3VALA 3P4IA 1JCEA 1HHTP 3UD4P 3DWLA 4DTRA 4A8SA 1IBMK 3HHLA 5JVGQ 1QDUB 3TQEA 5KFRA 1HR0K 2KJWA 2VQFJ 3NBPB 3PFOA 3ILOA 2BDPA 4ZJQA 2JH3A 3QGHA 5T41A 3C94A 1AFIA 3C15B 3TQ1A 4H8KA 2E5GA 3HT3A 2PY5A 1N5QA 2D3UA 3LAMA 4CZKA 1TKTA 3UQSA 2QYCA 4NLRA 4MIAA 5D3GA 1RAHB 2DGWA 3PACA 2DTUA 2AEFA 4J2BA 3T19A 3D1HA 1EXQA 2E66A 4DPYA 4L76A 5AXKA 4YDUA 2ZD1A 1UKUA 4KREA 3HSGA 3SMSA 2ZH4A 2M8HA 2E7XA 5E33A 5EY4A 4JI0J 3VTHA 4OZ5A 3MEEB 1WG5A 3T1HK 1VSIA 1QZ6A 3E9LA 4A8QA 3MM8B 1IR0A 5JMVA 4NPOA 5KFEA 1IKYB 3P3DA 3SK3A 3MN6A 2DPIA 1HI1A 2UU9K 2V9WA 4WXOA 3MMAA 1QY7A 1F21A 3SDEB 1SIZA 1Y5NB 4I67A 1KDNA 2GMJA 1S59A 2ZEJA 3WIVA 4FJ8A 3BSOA 1QHAA 3PX0A 4B9NA 4LF1A 2F63A 2Z4PA 2OPQA 5A0YB 2DNKA 3W9HA 4NRUA 2H9ZA 3TAQA 4EO8A 1O51A 2B4JA 2NZCA 4DCHA 2WONA 4Q45A 3MUVP 2CPEA 4FWNA 1TAUA 4DLEA 3BF3A 3OBYA 1RCXB 3D6HB 4A62A 2O4GA 2DNRA 1M5SA 1KNZA 3AQOA 2K7KA 3ZNJ1 3IAS9 2QLXA 4I68A 2QM1A 3GV5B 4LF9K 4WTYA 3DRRA 1MLAA 3WQTA 4DTJA 1RWNB 1NJWA 4HH1A 5L8RC 1H2TZ 1OVQA 2PEBA 1FKOA 5J2PA 3ADAC 2HHSA 4X66F 3AFGA 2QYGA 4DMZA 2GJIA 2BRLA 3SCJE 3OVAA 2X1FA 1J53A 2YXLA 4M3RA 1KAZA 3JAMY 3F41A 4WU3A 3DXMA 3W64A 4DR6J 4UY8O 1JXEA 4MIWA 4QIFA 2O01C 3H98A 1PGZA 2O8FA 3NWGA 2COLA 1T3VA 4LH5A 4YOVA 3B6BA 3TA2A 1U0HB 4M3TA 1D1UA 3PYDA 2QEXN 5A6WA 2XULA 3Q86A 4OJ3A 2DNYA 4JI8K 4WWSA 2Q36A 4JYAF 4H4MB 3MR2A 1BA0A 4ZIVA 1K0TA 5HOOA 4FYYB 1KVIA 1TUWA 3KNGA 4PXEA 3TEGA 2Q6CA 1NGCA 4TLRA 3G2XA 3AJ2A 4IXCA 4AQYF 3H3NO 4K2XA 4J2EA 2JZ5A 3M2RB 2GO8A 2HHUA 4QS9A 5F8IA 2HRUA 4ILHA 5HRSA 1EIYB 3PO4A 4E2FB 5AQWA 3CC7N 3L2RA 2FYXA 3JYTA 3ICLA 2ASMA 2X78A 4FYWB 1RT3B 2OD4A 3W9IA 1HX1A 1BE4A 2IM3A 1YUWA 1GMWA 2YV0X 3MCMA 2BQRA 4FF1A 3DJCA 5GADP 4AHCA 1I3AA 2D0PA 1KBRA 4NXMF 1CQMA 1RBTA 3BP8A 4C8LA 2UXCK 3A3NB 3CM5A 3M8YA 1IKXA 3MTJA 3VEYA 3I4HX 3H59A 3R2CJ 3SCIE 1Q7YT 3AA5X 2NCKL 3ISZA 3WC2A 1WI8A 3A8KA 3VWSA 3MX5A 3UO0A 3BGFA 4PKGA 2Z0GA 5IT9O 2MJUA 4JI4F 4A8WA 3ILIA 2DTJA 2G8IA 1TUUA 3IAM9 5I3PA 3A8IA 3H25A 3SJJA 2XWYA 1JXLA 4BDYA 5EN1A 4RW9B 2KL8A 2ZF5O 1H73A 1VK0A 2G8FA 4BRGA 5DQIA 5D0RA 4GVBB 2FJAB 2IYGA 5LT5A 4AL7A 3OL9A 3FJ2A 3QBCA 2W2NP 4LF4K 4NLCA 1HKBA 4RW8B 2XRIA 1UWAA 3I6PA 2D0AA 2E5LF 3ZZYA 1FNXH 2AYMA 2VG5A 4PZVA 4DU4A 1R43A 1RBRA 2A3ZA 3DDKA 4MO5A 2NYIA 4UOFA 3G71S 2P9UA 1X4FA 4WYLA 4FL9A 5M2PA 4FS2A 1S77D 1KAXA 3CDBA 3U9ZA 4KGVB 2GCFA 1QQNA 4CO2A 4K2JA 5AQVA 2AD9A 3DU5A 3UN5A 2KJVA 1G4CA 3CF5Q 3TR8A 1SXLA 1HBNA 1WELA 2PMWA 1NOZA 1SAZA 5ETTA 3LDLA 1Q86O 2FHJA 1VSDA 4Z4EA 4O3SA 3RWUA 1CJVB 2XS2A 4FWOA 4OJGA 4OX9K 4HVZA 3VAFA 4FXWA 3VEWA 4USHA 4O3PA 5THWA 2QLJB 4Y1CA 1NB2A 3FZBA 2YH1A 3I0SA 5EGYA 4F04B 5HP1B 2NQPA 2YWEA 2X1BA 5A76A 4ETZA 4C1NK 2ZJQQ 4CJKA 1S1TB 3CERA 4AXJA 2WVFA 5FJ4A 4H4OB 4KHYA 5C24B 5CYMB 2A0FB 3SUNA 1OH5A 1LWEB 4USTA 1QJHA 1C1CA 1N88A 3AA8A 1VSFA 4NXNF 3NMUA 4UT4A 3FR0A 3MCNA 3HKWA 1J5OA 1EKSA 3EGZA 1KP6A 2AHOB 4O3RA 1N5VA 1CS4A 1V5IB 3ELHA 3OVBA 4CZEA 2HFSA 5GMKa 4RNFA 4B3SF 3GBTA 1WD6A 3C65A 1U24A 3OFGA 3CGIA 4MK8A 1C0MA 3L2WA 5KFKA 1DZ5A 4RKUC 3TTDA 1NEEA 2G2ZA 2AU0A 3LGMA 2W01A 4DBQA 2DRDA 5FLXO 3M4XA 3OTOJ 4ZITA 1U6BA 5FRMA 5AE2A 4WE1A 4OZ0A 2YNGB 3T6JA 2YNIA 1TVRB 4J2AA 3C46A 3HD2A 3TABA 1WTBA 4LSLB 1FJGF 1QLNA 1M90O 2WOMA 1IBMJ 2E2NA 2XLKA 4JHDA 2IJFA 1FJCA 4Q2MA 4CLKA 3A5MC 4R79A 1S48A 3OT9A 3LPEA 1HR0J 1ITPA 5F41A 4Q7AA 1F2HA 1BI4A 2HURA 3MECB 5GVQA 1HL6A 2DH8A 3R3TA 4YQWA 3CCLS 2Q66A 2HNDA 5CAAA 3BQ2A 3CJ5A 4DR4F 3MX2A 2RE2A 1QTMA 4LBPA 5IS2A 5K14B 2HVDA 3UKRA 4AM7A 4WFBQ 2BOPA 1LW0A 2JNJA 4MDAA 1IR2A 1WEYA 4L72B 5FIIA 9RUBA 1Z2ZA 1RGIA 2E5HA 3R5AA 3OJSA 1CJUA 1I94F 1MWMA 3HO1A 4OPKA 1NKEA 1UFLA 2IA6A 3J81O 3P83D 4B9TA 1DTQB 3T1HJ 1YAGA 2RMLA 2Z8QA 3NWRA 4B3RK 3KLGA 1H7WA 4X2BA 4MO4A 5F9LA 3HHLD 2VBYA 2UU9J 2X1AA 3VAIA 3Q0AA 4DR5K 3EZWA 5LMNK 3W2VA 2WFBA 1VQ8N 4CFAA 1GLLO 1SL0A 5HVFA 3VQ6A 3EZ5A 3DHXA 4LR8A 1I51B 3CJ2A 1NHKL 1MROB 4IFEA 3NVMA 2EI5A 1R89A 1UOCA 5AZJA 2OPPA 2J0SD 4QU7A 1WKJA 4HHUA 1AZSB 5EWGA 3NGSA 3OUYB 3GFYA 3FE1A 4IRDA 4RG8A 1Q4RA 1N33K 4M3XA 2CXEA 1LEOA 3TUJC 3EZUA 1PSDA 2DR9A 1EETB 3CXCR 4LF9J 4K4WA 1Y9OA 3IS9A 2MQQA 2PO4A 3SQ1A 1RADB 2PFDA 2UXBF 1Q16B 5HL7L 4DU3A 3J7Z5 3NNAA 4CM2A 3V9SA 3WEEA 1XMQF 3MMBB 1KVJA 3C6TA 5BJRA 2V2KA 1IR1A 3GE1A 3OW2R 1L3VA 3RB0A 3IWXA 4ILRA 4DUYK 2WBMA 3RJMB 3WC0A 1ZTTA 1Y4ZB 1UZDA 3M8WA 2IM2A 2EK1A 2ZBQA 4CJUA 1KVCA 2MZTA 3WZ0A 2V7ZA 3ITHB 3KKSA 1KD1T 3V6HA 3D0PA 4JD2A 2CG8A 4BLGA 4LF6K 2HVIA 1T44A 5KG3A 3GWCA 4DU1A 4ER8A 3WHIA 4JI8J 2XYHB 2VWBA 4WKYA 2HHPA 3AA9A 2V4JB 4WP9A 4FKXA 2O3DA 5C15A 1SVDA 3D6MB 1EKRA 1JLAA 3KKFA 2HHQA 1NSAA 4J9UE 2YQ1A 1WF1A 2VBZA 3EXCX 3L8BA 4M3UA 3I33A 4J9RA 1K1SA 2NPIA 1EQYA 2DR5A 2V8DA 3L7UA 1HBMB 1XR5A 2R7YA 3EE9A 4F67A 2EPIA 3IO1A 1YLXA 1HYSB 1V4SA 3TJAA 4LIRA 5AQXA 5AQMA 1WG1A 1YZ7A 3ZZOA 1XQIA 2BXJA 4PR6A 2XSFA 5EX5A 2R7OA 4U7UK 1FDAA 3ZEUA 4B8CA 4QOTA 3EN9A 2MGZB 3FBFA 2AT1B 4AHUA 2OI2A 4ZVQB 5KFOA 4Y34A 3V4MA 2UXCJ 4YOWA 4TLQA 3KXDA 2EWSA 1GQEA 3TAPA 4H5NA 3CCQS 1UVIA 2JDJA 3HPOA 2PYJA 4MAKA 3E51A 2W41A 4AL6A 3SQ4A 2IMOA 3CCMS 2DH9A 3J80Y 4M1KA 3KD5E 4GV3A 1RKJA 3D3CJ 3UD3P 3ZSRA 1R8AA 3QB0A 5GAEI 1RT1B 3QAUA 1WF2A 2CWKA 3CD6N 4FWLA 3HOTA 4X65K 1T9XA 3BREA 2J7KA 3CPWR 2ZOMA 4KH1B 3NE6A 2RN2A 2XZWA 1CXUA 3A5NC 2RDIA 2APOA 4XO0A 2SXLA 2YWKA 2EBEA 2W40A 3SIPB 4CJSA 3RMCA 2FBTA 3S8SA 1UTAA 5AQTA 2DO4A 3FMBA 2JVRA 3H4DA 3AQPA 1C0FA 3RR8A 3M7VA 4FM2A 4LF4J 1J2VA 5CCLA 4PEOA 3L3VA 1X9JA 1TUGB 3D0GE 2HZAA 1N32F 1MMDA 1HPZB 2P8IA 1UP1A 3AVFA 3RBEA 2V67A 2GIQA 3MAAB 4CEBA 2ZJQL 4RNNA 3NH2A 1TL7B 3L4QA 3ZC4A 1VMBA 4IO9L 3ONQA 2LXIA 1R0AB 4LUBA 1HQEA 3H5SA 1IWGA 5KT6A 3O9UA 2C3MA 4TXSA 3DLGB 1Z1ZA 4OX9J 2HNZA 2HLUA 4IFYA 3HPHA 4X4TA 4PA1A 4JRQA 3L2UA 2X1GA 3LDQA 5HAOA 3NMAA 4GC6A 2ZKTA 2QXFA 3WNEA 4C8NA 3OYBA 2NLWA 3QT8A 4YR3A 2FF3B 4CGHA 1P8GA 5B0BA 2HGMA 4DPOA 1S72S 1VBZA 2GUPA 5E2QA 1T05A 1G2EA 2QSFA 4K43A 4DCPB 2CPXA 2WHOA 1TL3A 3JS6A 3T9ZA 4ZP9A 3OL8A 4ISEA 1X8DA 4L74A 4R5PA 2NNWA 2CJBA 4DX8H 3SPYA 4IRCA 1MDUB 3QO9B 2K8GA 4USIA 1C0TB 2CNNB 3BO2A 1DRZA 4NLYA 4K4UA 2O8CB 4KTWA 4FF3A 2GUIA 5J2QA 3E9OA 2UV8G 4J9NA 1VHIA 4HACB 4KH5A 3RG6A 2H1YA 4DB3A 1CJKA 3ZSYA 4OZ1A 2F8MA 1NOYA 1YZ6A 4X84A 3NF8A 3BSNA 4ZLPA 2I7NA 1YITS 1TP7A 3D54A 5T7LA 1W26A 4GRSA 4A5AA 4ZP6A 2DIVA 2FJEB 4Y2IA 5B0GA 5L38A 2AJ2A 3VA0A 4OLPA 3MM7B 3ENOA 1VRTB 1K44A 1RP5A 3T41A 3ULHA 2K3IA 2LA6A 1N6QA 4PXDA 4MMOA 1X60A 3JXOA 1V5VA 1URRA 1LFWA 3SUPA 2EC0A 2F1FA 3BN4A 2BE7D 2BRKA 2YNFA 5HLFB 2A6MA 2HHXA 3LQVA 4DHYA 2C2RA 4AL5A 1JQGA 1S1WA 1RDBA 3Q2SC 3QJJA 1Q7LB 1NH8A 1SC1B 5KPTA 1Z2LA 4DTOA 2V6AA 4QIVA 3H5UA 4ZVSB 3O1WA 3VCDA 2FZCB 4KE5A 2W8KA 3DLHA 4CWBA 2IA0A 2RQKA 2F7VA 1IV0A 4I2PA 4GKJK 3IG1B 2D3ZA 3BBBA 2ZZNA 2G0IA 3SFGA 2UVRA 1R8HA 4B3RJ 3QEXA 1FF2A 5IZHA 2P9SB 4KPCA 1JJHA 3ATVA 4DR5J 5LMNJ 4PWDB 3FZKA 3QZ8A 2I2YA 2QWMA 2DKOB 2L48A 4K8RA 4FF4A 2E5IA 3O80A 3HLUA 1D9FA 3H20A 2JFDA 5EOYA 5D0HA 2RS2A 3MM9A 5AQUA 2C3YA 2EKNA 2HAIA 3M8RA 3ETOA 5F8JA 1N33J 3NGIA 1RK8A 5FLXU 3ENAA 2GWKA 1JLGA 3IWLA 4C8OA 2D3O1 1REVB 3PTWA 3FKBA 3GFXA 2XO6A 2JFKA 3M8PB 4CGJA 3WUHA 4KHUA 2BX6A 4LFBK 3HOSA 4CJTA 4DG1B 4M5JA 5C2DA 4N77A 2W4PA 2ZH8A 3FZMA 4AF1A 4DUYJ 1JLEA 5HMYA 2DNLA 3J7YI 5J1EB 4O4GA 3OTOF 3CCRN 1RT6A 1LXNA 3HI0A 4HCBA 1VBXA 1KRPA 2W6LA 3U6FA 3U02A 3P5BP 4LF6J 4LRAA 3QETA 2C42A 3HZGA 4A8KA 1Q81O 1JJ2R 4B9QA 3Q89A 1S22A 2X51A 4OV6A 1RHJB 3EDRB 1AUDA 3A12A 3S1TA 5HQMA 4WCEL 3N01A 4BE0A 3FEXB 1OMSA 4O8UA 1RWMB 3J81U 1KQFB 3FMWA 4ZCKA 3ET6A 4PQUB 3MN7A 3M32A 4WFAQ 3C6HA 1KQSR 4EHTA 1QTNB 3QERA 5F0UA 4A2BA 1RBSA 4KTZA 2FIUA 1L3SA 2HBKA 1U2VA 3IGNA 2FSNA 3EL2A 3QMLA 4HH0A 3N9UC 4P7TA 2XS5A 4PXCA 2MXYA 3KJQB 4DPUA 4B9MA 3P1GA 3R6MA 1CLFA 4FOEA 1NWKA 3RAMA 5BRFA 3QYYA 2FHOB 4OI6A 3W61A 2HIQA 1VSMA 2RILA 3U1NA 3N5FA 4PG5A 1RAEB 3V81B 3MUTP 1QZ5A 2IDEA 3HRGA 1E6VB 4DHVA 3NBPA 2CQCA 3VQ9A 2AWZA 4GC7A 1Q9XA 1IKWB 1HNIB 1DHMA 1K8AO 3HM9A 4LBHA 3J81j 2W9BB 3C15A 1FFWB 2LU1A 1MMLA 4B1ZA 3EICA 1YJNN 2ZNZA 4Q0BB 2FHMA 1RAAB 4X65J 4C48A 3T5KA 1LV5A 1F5CA 2VIHA 5M2UA 3C16B 3PYEA 4KFBB 3GR1A 5KFBA 3QLHB 1LW2B 1GLAG 3B8HA 1N5YB 4ZPWR 4ZTFA 1NNDA 4LREA 1VI7A 1TKZB 5M1KA 5KG4A 3A5OC 2OAUA 3C6UB 3MEEA 1R0BG 4CH1A 3VF0B 3S3MA 1X5SA 3MM8A 4CGIA 1WTFA 1IKYA 4W5QA 3SMZA 2ZGZA 1SC4B 3SDEA 4JS5A 1EQMA 1HI0P 3CIZA 3VAHA 5DM7Q 3BDEA 2MKSA 2KRBA 1S0NA 3KK1B 4OJRA 5A0YA 3KG4A 5LJ3Y 2MDAA 1BMQB 5KOWA 4ZJOA 5BR8K 3KJFB 2OP5A 2E1PA 4ED4A 4J9QA 3DGVA 3UNGC 5CYQB 3LF0A 3GIMA 4QR0A 2P5GA 1TTHB 3NGDA 3UCGA 4JI1K 2BKOA 2LXFA 4K7QA 5HRRA 3S7RA 5F8HA 2FGCA 1HYZA 1SJ1A 4JI8F 5BPMA 4YY3F 3TZYA 5EX3A 4HTIA 3GTYX 1DQ8A 3N28A 2NRRA 4Y2MA 2ZQBA 1CPZA 4OZ2A 4ILLA 4X4QA 1D5AA 3RRHA 3ILLA 3DNCA 5AQHA 2BR0A 2D69A 4JI5K 2P5VA 1K9MT 2VOOA 3O4QA 1VQLN 2CAJA 4ZJLA 1U0HA 2L9NA 2IJNA 4CDIA 2DGVA 3W60A 5IWAK 2UZAA 1FDDA 1UEVA 2ATQA 1U02A 2RB7A 3AB4B 4P72A 1MU2B 2CYYA 4N8OA 1VQ8S 4CBWA 4CGFA 2YPZA 1WNSA 5F0WA 4H4MA 1VQMN 3HHEA 4NO7A 5AT1B 9ATCB 3RB6A 2UXCF 2CVIA 4A2AA 1RE1B 1F2GA 3GIKA 1NJIO 4JK7A 3CMEN 3D2FB 1GLFO 3U9DA 1VQ5S 2J5AA 3G6EN 4JKAA 4WIIA 4ZMMA 3CJ4A 2LP4A 1YHQN 4LF8K 4CD1A 4CJWA 3VA3A 2FSKA 5I3UB 5SZTA 1WC0A 3HM8A 2UXDF 1X4EA 4M8LA 2ROPA 2H3GX 4M5NA 3VQ4A 1FESA 5GAGU 1RT3A 3C0BA 1ZA1B 2H65B 1CBKA 2GW8A 5T7BA 2RSQA 3QSIA 3T7ZA 1YT3A 3OS1A 1N34F 4QWCA 1RTIB 3K17A 1KTQA 4DUTA 2VPXB 2F5GA 4HI1A 3THYB 2DXFA 4LF4F 1YBUA 2B9EA 1CXQA 1WAFA 2HG4A 4CE9A 3BKTA 3UDCA 3CG7A 1FEEA 3VQSA 1X4BA 4M5IA 1FXXA 4KT0C 3O8WA 2E1MC 4ELVA 1R6YA 5CXTA 3MFIA 3V9UA 4BC3A 5AQOA 3DN9A 2QZ8A 4S0MA 3HVWA 4GKJJ 1REGX 2L08A 4PYDA 3H45C 4CJEA 2UUCK 3PHEA 2OTLN 1ASWA 2V51B 2XMKA 3PG9A 4RW9A 3S9HA 1RBVA 4BG8A 2OSQA 4GVBA 4OX9F 1M5OC 3TUIC 3L3CA 4RNOA 4RBTA 1RLCL 4ZPAA 3EMTA 4N76A 5DJBA 1XHZA 1M0SA 3I8DA 4RW8A 5JVHQ 4CF1A 5FPEA 1Y0HA 2D7SA 4UQGA 2BE2B 4CHOA 3VTIA 3IR5B 2VQEK 4KI6A 2ZC4A 1NJXA 3MEGB 1FRJA 5E3CA 3LL3A 2VG7B 1FXLA 2R7WA 1R31A 5HJXA 2AP6A 3CCVN 3ZXWA 1PC4A 2I5JB 3IXQA 5L1IA 1WDTA 3QJPA 4IBNA 3DMJB 1ICEB 2FJWA 2RQMA 1CJVA 4K25A 1NDCA 1NM1A 4C8KA 2BH1A 1UVLA 3IWNC 4O8KA 3FUYA 3CCJS 4LFBJ 4DR2K 1RFQA 3POTB 1JXVA 3GILA 5KPZA 2D9PA 2HB5A 1H38A 1N52B 5G0RB 5HP1A 2ZH3A 3CDEA 1WSFA 2G8VA 4ZCIA 5JLFA 5HVGA 3OFEA 1S1TA 1LAVA 4CFCA 2AW0A 4ES2A 2V52B 4FPAA 1H0HB 1RTDB 3O6WA 1TMMA 2FZKB 2PDAA 4CLUA 1J5EF 2CJAA 5C24A 5CYMA 1LWEA 5CD4A 3M30B 4RUBA 4W90B 4FPBA 4W5NA 3BPSP 5CZ2A 2N4DA 5TKYA 1YJVA 4HLBA 2KXFA 2R2SA 1KSPA 3MR3A 4IJAA 1UPMB 2KHDA 1WDDA 3TX8A 1SKRA 3L95X 1JLCB 1CZBA 3NMRA 2C3UA 2Q0RA 4UQTA 4M63C 4CFBA 3CVKA 3CDWA 2V8PA 4L3KA 1FX4A 4OI1A 3CJTA 1FHTA 5AQSA 3AARA 4OPJA 4DPWA 4NCGB 3R5BA 3MCAB 4FWMA 3BS9A 1E3MA 1R0CB 3MEDB 1TVRA 3ZLJA 1TAQA 4LSLA 2NRVA 3OYIA 4DS4A 4CJ3A 4OHXA 4NMXA 4BC4A 2OEJA 4QS7A 3MECA 5DDOC 2GJFA 1FXRA 5IFMA 4QZVB 4DR5F 4R8UB 1K0VA 5GAEP 1P9YA 4ES1A 2DHSA 1RUSA 1CULB 1S7HA 5K14A 5AXNA 1JB0C 3WBZA 4GY2B 2E1CA 1BGXT 2LEAA 3RB3A 3W66A 1VQ9N 1ATNA 4DR1F 2QW9A 3PRVA 5AQFA 3M5RA 1EO1A 1HA1A 3OFHA 3R1HA 4M63A 4QOZB 2RIJA 2ZH1A 1YJWS 4IR1A 4EU0A 2WUSA 3K9KA 1DTQA 4IG0B 2ZWHA 5CHIA 4J9PA 4U67Q 1JMTA 2KFYA 3A4TA 4X66K 1ATRA 3TO8A 3HXMA 4HUFA 5HI7A 3I96A 3K2YA 4CEZA 3VEZA 3B6OA 3QIDA 4BWJA 4ANCA 3JTNA 4OI3A 2RDDA 1VQ6S 2V2ZA 3OYCA 4H0OA 1XNRF 4HHHA 2WVBA 1RT7A 3U1MA 3BR8A 4MH8A 1MROA 2O4IA 2ROGA 3B82A 5BR8J 5DDRC 5JLHA 3HSTB 3VQEA 3I56S 2DT9A 4FM0A 3KLIB 1AZSA 4FNHA 3BF4A 3OUYA 4CGDA 3MI7X 2M70A 2POKA 4J2DA 2ITMA 4JI1J 1EETA 1YVUA 5EWFA 2PD1A 1QAIA 3H3OB 5U47A 5KG7A 1D3WA 3EGNA 4AQYK 1RTZA 1GX5A 2F65A 2YNHB 3HFKA 4LQ3A 4FJIA 2E5JA 2MKIA 1PJ7A 3MMBA 4DL3A 1HKGA 4J9VA 4UY8T 4WF9Q 1URNA 4F9OA 2HMIB 2HVEA 2Q2RA 4I6MB 4BRMA 2MLXA 4LFAK 4PAAA 4JI5J 4N5SA 1NKBA 1IG9A 3OS2A 1RT4B 2J6TA 2ATLA 4GNIA 3ITHA 4C3LA 4EP4A 4A4JA 1R8BA 3ZCMA 5KG0A 2CQ0A 4PPZA 5IWAJ 4KHPK 4ATNA 4NXMK 3DOKB 2UVVA 1AYEA 1FXDA 1K6YA 3HI9A 2KI2A 4FVCA 2V4JA 5B0DA 1XBWA 3V1RA 1IBLF 4TVAB 1VQNN 1KXPA 1FEHA 4LVNP 2J8SA 3WXLA 2EFQA 3O6QA 1JNRB 4QR2A 1HWKA 2B51A 1KKHA 3UE2A 1WNEA 4Z37A 2QMXA 3D6TB 3IBWA 5CD4H 4O0NA 4A5BA 1K73T 4XDDA 4WPAA 1HBMA 4JI4K 4YN3B 1Q9YA 4LF8J 3CQXA 2ZUAA 4X65F 1HYSA 4XIUA 5IC6B 2P9PB 2KVQE 1EX8A 3BV8A 1R7IA 4LR7A 3O5TB 4F4YA 1EWQA 4UOHA 3IR7B 4USUA 3P5JA 3AVAA 4LJMA 1FI4A 4BVPA 1VQ4S 2E5LK 3QIOA 2MQPA 4F0MA 1W2BM 1XERA 2DH7A 1TYQB 2GBZA 3CD5A 1HHQA 4TN2A 4XPEA 2H4WB 2YX4A 3H8YA 2ASJA 3VERA 3DLJA 4FVMA 1RBAA 3JTOA 1RT1A 4U7CA 4Q44A 3C14B 3CXCM 1NPRA 3NLCA 4H0XB 4A61A 4YDXA 5B0AA 2F8HA 2XCAA 2GEMA 4DQQA 2EKYA 1NSPA 3IP0A 2UUCJ 1RQ0A 3ZZZA 2V50A 4ED7A 2YKQA 4DPXA 3FLCO 3KUGA 4C0BA 2PFUA 3TW0A 3ZX2A 3HYFA 2AYBA 1F1BB 5FLXY 1NGAA 1S6PB 1PJ5A 1RAGB 2MKCA 1A5VA 4DEZA 2Q1NA 4DSKA 5B8HA 2YX1A 2F96A 1UJ6A 3TA1A 2VQEJ 2QA4S 3GJSB 3VPZA 2PIIA 4Z7CA 3QWPA 4I56A 4PYAA 3MAAA 3TAMB 1TL7A 4NXNK 4CFDA 4K50A 3CT9A 1IQTA 3UN3A 1Q86T 1WOQA 1R0AA 4Q2LA 4DV3F 4JKEA 3SAHA 5F8GA 3PIOL 4ECYA 3DLGA 3D0IE 1F0XA 5KRSA 3P96A 3FNNA 3FVYA 3VN5A 3NAIA 2GNKA 2VV5A 4DR2J 2D41A 5GADI 1YBAA 3UNYA 2MYFA 3EEQA 2HQ3A 3BBFA 2JX2A 4IOAL 1NNEA 2HS4A 3J7YP 1PJ6A 1RU2A 2RU3A 4X62K 2E29A 1H98A 2BJ1A 2HQGA 1O13A 3R9LA 1NGFA 4TYBA 4L73A 1XC9A 2WVCA 3J81Y 4HUGA 3DXBA 3LWMA 1HKAA 3PX4A 1EQ0A 3L4BC 2FPHX 5F8LA 3G4SS 3PX6A 6FD1A 2FLOA 3VQ8A 3IR6B 3KJNB 3QO9A 3IKMA 1VSHA 3G82B 2EX3A 4E1NA 1C0TA 2FVRA 4ZVPB 3CFPA 2EFOA 2O8CA 2IC3B 4BR0A 2I7PA 5KFZA 2BACA 4DR4K 2BQ3A 2WVEA 4FJNA 3TA0A 4BROA 1X9WA 4E19A 4HACA 1NMNA 3AAPA 4FJ7A 5K8PA 5JS2A 3CEDA 2BUPA 3PW4A 4WU2A 1HFEL 1FK9B 1WACA 1G6BA 1HW8A 2RF2B 1D9DA 2P9LB 1Z26A 4KV8B 1U1KA 2V5HG 3CDUA 3TYTA 1I94K 4WFYA 1GFWB 4ZPTR 3SBGA 1HJOA 1GTHA 3NCRA 1WC3A 1M90T 2G8UA 4NLXA 5CZXA 3GCWP 3SJHA 5DQHA 3MM7A 2FJDB 3J7AP 1VRTA 1S79A 3AHPA 5J2MB 5F1XA 1NZAA 2A18A 3HVRA 3OPKA 3VQ5A 3RU0A 1AB8A 3MFHA 3KJVB 5KFCA 5ELZA 4K5SA 5HLFA 2AX0A 3PXGa 4ICLA 3J7AN 3OA9A 2AA4A 4FO0A 4KHMA 3UCUP 4BRFA 1VQKS 1T9TA 2ACMA 5ETNA 2OPSB 2MQOA 4CESA 1KHVA 2G8KA 1DJ0A 2IVFB 2C2OB 4KGXB 4GW6A 4JKDA 2QMUB 3ZTPA 5ETRA 1S9GB 5C42B 4BRLA 1VQLS 5FD1A 3ZSWA 5SUHA 4DSLA 1FDNA 3KHLA 1VQPS 1EAYC 3SI8A 3FC9A 5M1FA 4WYBA 3P31A 2IPOB 1TFYA 2GV9A 2VFVA 5F8MA 1YIJN 1XNQK 4LRCA 4H5WA 3S3OA 5AZIA 2UXBK 2MZRA 2HHVA 2N82B 4X66J 1VQMS