2OPPA

Crystal structure of hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
542
structure length
518
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 136
structure length 518
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2oppA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oppA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oppA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oppA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2oppA05
4DL6A 3IGVA 3BSOA 2W42A 4QAGA 4ECXA 1TL1B 2YNIA 1RAJA 4JLHA 5KFCA 3MR3A 3PJWA 4KHQA 3DRSB 1BCMA 4W5OA 1SL0A 3OYAA 1IH7A 3MAQA 3KLEA 3CDEA 3C6TA 1XC9A 4NCAA 3MEGB 4ID5B 2ILYA 3V9SA 1RTHB 1EKEA 2DFEA 3OYDA 4ZHRA 3BQ0A 4CEOA 4CGHA 1TKXB 3O3FA 3MTKA 1DTTB 2AGPA 1Q9XA 4O3NA 3C95A 1TVRA 4NLQA 3H5SA 3DYAA 3L2WA 3RRGA 3HVWA 3VA0A 2IJNA 2BQ3A 4FBUA 4KFBB 2AX0A 5I3UA 3G10A 4WFYA 1L5UA 1BCOA 1QAIA 2KZZA 2IDOA 4JS4A 4DSKA 4Y2CA 4EO8A 1LWEB 3DOKA 1VSMA 4IOBA 3DLEB 2IGIA 4O3OA 4OLBA 1KFSA 3D0PA 4DS5A 3OL9A 3DLGB 2HNDA 4DQIA 2ZD1A 1CXQA 2B6AA 1X1PA 5K14B 4DL3A 2BRLA 2BRKA 3BQ2A 3JYTA 3UPFA 3VQAA 1RT3B 4PUOB 3H5XA 1CZBA 1EXQA 4FK0A 1RT5A 1RT2A 1NKEA 3FFIA 4KBIA 2DPJA 4CJQA 4MKAA 4YNQA 3N6MA 1WLJA 1HYSA 4FK4A 3CM6A 2R2TA 1JL2A 4FXDA 2BANB 3FFIB 4IQXA 5DG7A 3OYMA 3KJVA 5CY4A 3QESA 3CJ2A 3ZCMA 3QLHA 4TY8B 4LH5A 4E0DA 3CDWA 4FYDA 2YNGA 4B9NA 1VSHA 3CQ8A 2E9RX 4B9UA 3V1RA 2ETJA 3PX6A 2J6TA 3BQ1A 2YKMB 1HJRA 5F8HA 1SKRA 1N56A 5EU7A 4CE9A 1S1TB 3H59A 4W5RA 4URSA 1GX5A 1HYVA 5J2NB 5FROA 3AA4A 4BWJA 2C2RA 4KB0A 1NJZA 1WAFA 4M3XA 2XI2A 4N41A 1BQMA 2XWYA 4QPXA 4TY8A 1WAJA 5KFHA 3ZSOA 1JLQA 2D5RA 4H4MB 1S1WA 2E4LA 4K4SA 1U48A 4FW2A 2HWIA 3LP2A 5J1EA 4LSNB 1ZYQA 4CK3A 4H4OA 1S49A 4MIBA 4NLTA 3CWJA 3OSPA 3K5LA 3NFAA 4FZXC 2E9TA 3BR9A 1TV6A 3DLKB 3ICLA 5KFSA 4EZ6A 3MR6A 1Q8IA 1D5AA 3VN5A 1RT6A 1IKVB 4HUFA 1FXXA 2RDJA 4CF8A 4FS2A 2FJWA 2XCPA 4Q8FA 3NGYA 4MIAA 4YP3A 3OVNA 2HHSA 4JS5A 1KSPA 3M8PB 3Q8SB 4CF2A 1TL3A 3V81A 4NLXA 1NOZA 5EWFA 4Z4IA 1S97A 5L1LA 1WNEA 5J1EB 3PW4A 4CHZA 4EYIB 2DPIA 3AVHA 5KG2A 1KHVA 3SUOA 5KFYA 4FLXA 4ED0A 2FC0A 2DTUA 2GIRA 3LP3A 1UWBA 3AVGA 1NJYA 1BL3A 3QGIA 2R2RA 1C1BB 1IM4A 4CK1A 5FDLA 2D3ZA 4K4XA 3VA3A 3GV5B 5J2PA 4DFJA 3S3NA 4I7FB 3K57A 3BSCA 4NLOA 4HTUA 1QE1B 5T14A 1L3UA 5JUMA 4TYAA 4WXOA 4W5TA 1ZTTA 3QYYA 3OHAA 2GV9A 4B08A 2R8GA 4RG8A 1RT7B 3KMQA 4FJJA 1S9EB 1J53A 3WNFA 1VSJA 4AILC 4QOZB 3CJ0A 4ZP8A 3JYTB 1XR6A 1SV5A 3KLGB 4Q45A 4DSLA 4EYHB 4HCCA 1RTJA 5DK5A 3QIOA 2XGPA 5KT6A 4IBNA 3V1OA 2JEGA 2VG6A 3KJVB 2VWKA 4W5NA 4ED6A 4NLRA 5HBMA 4K4YA 1TK5A 4RW6B 2G8UA 3IRXB 1NK6A 1FK9B 3DYAB 3T5JA 4F50A 4OPJA 4Z4GA 2AU0A 3MFIA 3QEPA 4IR9A 3H2LA 3RAQA 4BACA 3PY8A 3N6NA 1RBTA 2C2DA 3OYGA 3H4BA 3HPGA 2RKIB 4YR3A 3RBEA 1KFDA 2CJQA 3NHGA 2IAJA 1EP4B 3VQPA 3OJSA 1QSLA 3AVJA 1VRUB 4EO6A 3DLBA 4CERA 1BQMB 1QAJA 3I5CA 2R8IA 1LAWA 4DL2A 4DTNA 5HBMB 1SUQA 3VQCA 4WZQA 4QCLA 4F8RA 4IFYB 4CGIA 4IG0A 3BREA 4DQSA 2OPRA 4KTQA 4Q44A 3OYNA 1KVAA 4CIEA 1FKOA 1REVA 4H8KA 3TI0A 2GC8A 4CFBA 4F3TA 4Z4EA 4BE2A 5KG3A 3IS9A 2AWZA 1NK5A 5KFTA 1I6JA 1IKYA 2D0BA 5E41A 4FJKA 3ZSVA 2G8KA 1KRPA 4ELUA 1QE1A 4KI4A 3GV8B 3ZT1A 4TY9A 4FJGA 4J2BA 4ECTA 4LQ3A 1SUQB 3NDKA 4DLEA 1XHXA 3PX4A 3VQBA 1NNDA 3QO9B 2JC0A 4NYNA 3OL8A 4CEZA 3A2FA 1N6QB 4JUZA 3V9UA 4PUOA 4CF0A 1S48A 1QSSA 1Z25A 1HYZA 4DTRA 3LP1B 4MK7A 1S6QA 4Q0BB 3VQ9A 2R2SA 3EZ5A 1S1VA 3QEWA 2OPSB 2Q3SA 3QEVA 3V6DA 3LP2B 3RTVA 4IG3B 4DFMA 4BE1A 3AVCA 3M9MB 3RB6A 4PA1A 1XR7A 1WSIA 4N56A 1WN7A 2YHBA 1MMLA 4DSEA 3AVBA 2HMIA 4NZ0A 2KZMA 4ZHRB 1DLOA 1QQCA 4CK2A 1N5YB 3ZSXA 2F8SA 5CYMA 3C6TB 3LPUA 2OA8A 5KG0A 2AGOA 4DU1A 5F9LA 1C0UB 4XPCA 2IM0A 4EEYA 4CGDA 1T05B 1JLFA 4E7LA 4YMEA 2IBKA 1UA1A 4BWMA 1BQNB 1S1WB 4IH7A 5KT7A 4ID1A 4F4WA 2O4IA 3RB4A 2HNYB 4M3ZA 1K1SA 3QGGA 1JIHA 2ASJA 2YNFA 3OYHA 1LW2A 1U4BA 4E7KA 2EC0A 3RRHA 4RNMA 4ECVA 3ZSZA 3NH0A 3DOKB 1MU2A 4C8LA 3HVTA 1S0MA 1RDRA 3NAIA 2B43A 5HROB 3TARA 4J9MA 4ECUA 5F8NA 1IKYB 4IH6A 4I9LA 3DLEA 2KW4A 3V4IB 1HNIB 4CGGA 2YKMA 3Q8QB 2A1RA 3T5LA 3QO9A 4CJ4A 4FBTA 3QIDA 1C0TA 1ZBIA 3PW7A 3TAMA 2P1JA 4CJFA 1QSYA 2D41A 3TAPA 3QETA 2XY8A 4KO0A 4HUGA 2BE2B 3DLRA 3K59A 2J6SA 3LALA 5KG5A 3OHBA 1RBRA 1K1QA 5L1KA 3TR8A 1NJXA 4TXSA 4DG1B 4KFBA 3RBDA 1B92A 3OLBA 2IMWP 4CIGA 1YT3A 5F8JA 1NK7A 2I5JA 4CJVA 4B9TA 5L1JA 2RF2A 2YNIB 3U3YA 1SL2A 4FZYA 1S9EA 3IN5A 3KLIA 1CXUA 1XI1A 2FVRA 2YNHA 3LWLA 2WB4A 3KHLA 2UVWA 3AVIA 4CEBA 4KO0B 2W7PA 4CCHA 4F4XA 3NKYA 1SH0A 3G0ZA 1HPZA 3D28A 4CJLA 1RDBA 5HRSA 3DDKA 1VSKA 3M8RA 5DQIA 3TVKA 4Y3CA 1T03B 2X74A 2BDPA 4IKFA 2WHOA 1IKWB 1TL1A 2EX3A 3NE6A 4DFPA 3AVLA 2FBXA 1IKXA 3NAHA 3UIQA 5KFUA 1JXLA 3M8QA 1LWCB 4ZPCA 3HVTB 4KHMA 2D0AA 3IG1A 5KFKA 1B9DA 1DLOB 4LD0A 1JLEA 1TP7A 1S10A 2W9BA 1TV6B 5C25B 2HMIB 3OSNA 2RDIA 3FQLA 4DSFA 1U49A 3SI6A 1Z4UA 3LP0B 1S1UB 4O4GB 2JC1A 3KIOA 4FCYA 4RNHA 4K4ZA 3E51A 2OPQB 2Z1IA 5J2MA 3Q8RB 3HPOA 3QEXA 1A5WA 1S9GB 3GIMA 1VSFA 1X9SA 3NBPA 3TAMB 5HRNA 3MR5A 5F8GA 1RT1A 3AVAA 3WNGA 4IR1A 1I39A 3OJUA 3L2QA 5KI6A 2WONA 2IS3A 3ISNC 4E7JA 4C8MA 5F9NA 5KG4A 1RBVA 3KTQA 1ZBFA 2HWHA 4JRQA 4O4RA 2W9BB 4NRTA 4FJ7A 5KFZA 4AHCA 3HT3A 3KLFB 1S9GA 4U6PA 1NK0A 3VQ8A 4FZZA 2E6MA 3K5OA 1Y97A 5JS2A 4J9PA 1HPZB 4HYKA 4PWDA 4F3OA 4KV8A 3SYZA 4ED1A 4M3WA 1CZ9A 2AJQA 5F8MA 4BDPA 1VSLA 1YVUA 5HRRA 1T05A 1TKZA 5HLFB 4LSLB 3LWMA 3PR4A 1JLCB 4AHSA 4KHWA 3HK2A 3RB3A 5HLFA 1UA0A 4KPYA 5FDLB 2JGUA 3KLHA 2HHQA 2VG5A 3PJXA 4NLUA 4IFVA 3HYFA 1JLAB 4W5QA 5JXSA 1JL1A 2UUWA 3SQ4A 2HHUA 4RNFA 4NCGA 1GOCA 4CGFA 4J9OA 4G3IA 1T3NA 3VQEA 3LAKA 5CYMB 4NLYA 3GIJA 2YKNB 2AX1A 1HMVB 2WK4A 4EZ9A 4TQSA 1HYSB 4B8AB 3S9HA 1EX4A 1CLQA 4NLDA 3H98A 4M94A 4URQU 4ZMMA 4NCBA 4KAIA 3ITHB 3NH1A 5CYQA 2JEJA 1NKBA 4NLVA 3KNAA 3DI6B 1RYSA 4MKBA 3HSTB 4MQ3A 3TWHA 3RWUA 2GIQA 3ZT3A 4ZPAA 1TKTA 4CEDA 2QK9A 3JSMB 3TANA 4I2QA 1S1TA 4M3TA 4GMJB 1HMVA 1TKDA 2QV6A 3I0RA 1KHWA 4J9LA 3VQ4A 2B6AB 1HNVB 4KTWA 4J9SA 1RCHA 4PQUB 4NLGA 2BGGA 2ZE2B 1HNVA 3V81B 3QIPB 1SV5B 3OY9A 4RW7B 3DMJA 4QWAA 2IJFA 4PWDB 1L3TA 3QIPA 5DGAA 3MECA 4BE0A 2UUTA 5HROA 4KRFA 1D0EA 1A5XA 3CM5A 1RTIA 3H5UA 4DTOA 2FLNA 2ZD1B 2P51A 3PVXA 4ED3A 2VG7B 4F2RA 1WSEA 3BGRA 4FJLA 2FVSA 4DMNA 1QTMA 1G15A 1N6QA 3RMCA 4ZVGA 3S3MA 4B9LA 4IRCA 4XIUA 1RTDA 4IRDA 1DTQA 3PV8A 1VSDA 3AVMA 4CJUA 4O44B 3OYKA 4O55A 4CHQA 4DQRA 5KTQA 4KKOA 4ZTFA 4O3QA 4K4TA 2VG6B 5KFEA 5KFBA 3ISND 4KHSA 1A5VA 1KLMA 5FRMA 2HW3A 3DRRB 4IDKA 1C0TB 5J2MB 3C94A 3OS2A 3T19A 1UOCA 2O4GA 5I3UB 2OZSA 1R0AA 2Y1IA 1JLGB 3ZT4A 2VG7A 4J9KA 4DTSA 1GOBA 3F73A 4JRPA 3SJJA 4CJEA 3NCIA 2XY5A 3QLHB 4TLRA 3HL8A 5C24B 1XR5A 5J2NA 4CEAA 1LWFA 3V9XA 4MH8A 1VSEA 3RB0A 4DSJA 4M3RA 4LY7A 1RT5B 1VK0A 2C22A 2QKBA 2W7OA 3ZSRA 1S1UA 4O4GA 1IKWA 3TQ1A 4FW1A 1JLQB 4Y1DA 2ILZA 2WCXA 4WYWA 4KB1A 1RT2B 4DF4A 2HNZA 4B9SA 2C28A 4TSXA 4KV8B 2QKKA 3RR7A 1YVFA 3LP1A 1D8YA 1HARA 1FK9A 4FJHA 4OKEA 1NHVA 1LWFB 4N5SA 2ITGA 3KKRA 3L2UA 2OH2A 3BDPA 1TKTB 3M9OB 5HP1A 4GVMA 4OGCA 2G8VA 4E7IA 3T1AA 3KK2A 3OYLA 1TL3B 4Y34A 3ZSWA 4DL7A 3MXJA 4YFUA 4OVLA 1YTUA 4KAZA 2IC3B 3QEIA 4ED8A 1RTJB 2R8JA 1RT4B 5KRSA 3MECB 1S1XB 3HVAA 2R7YA 2IA6A 4DTUA 4F4ZA 1RDCA 4R8UB 4J2DA 1DTTA 1SKSA 1TAQA 2E6LA 5KFMA 3ZT0A 4GC6A 1KLMB 4E89A 4KI6A 3I5BA 3DI6A 3G6VA 4FJMA 3D5MA 3FSIA 4KE5A 3CFRA 4QWDA 4E3SA 3KD5E 1HRHA 4RW9B 2X6SA 4ZPDA 2G8WA 1J54A 3P1GA 1ZETA 1S0OA 2WRMA 3UQSA 4N76A 2DY4A 3DRSA 4E1NA 4CJ5A 3KD1E 4ID5A 3NMAA 1RA7A 3I5AA 2RPIA 3FQKA 1W25A 4IKAA 5DG9A 4DLGA 1WSHA 1HQUA 5C24A 4Q8EA 1RYRA 2HNDB 4CFAA 1JLFB 4NCGB 3PO5A 1KCFA 2FJXA 3L3VA 3GQCA 3SI8A 4K8ZA 2Z1GA 4XO0A 2XCAA 5DMRA 4KSEB 1RT7A 3FRZA 1T94A 5C5JA 4EBEA 2BE2A 3DRPB 4E19A 3DRRA 4ZVHA 2V9WA 1I3AA 3OS0A 1NKCA 2XGQA 3D45A 3SFUA 3MEEB 5T7BA 2O5DA 1S4FA 4DL5A 4WZMA 3BSAA 2YNFB 2OPSA 3B6OA 3CO9A 3NL0A 4ECSA 4ICLB 1EP4A 1HNIA 3V9ZA 4IH5A 4CIFA 4MFBA 3SV3A 3PO4A 3KLHB 1BISA 1GOAA 1Z26A 4ZTJA 2UVVA 4CEFA 4MFBB 1L3SA 4BDZA 3PW0A 4ELTA 1C1CA 4HKQA 2Y1JA 4M95A 5C42A 2VA2A 4DU4A 5SZTA 2VA3A 2HNZB 3M8PA 2G8FA 3ASMA 1ASVA 3AO2A 1RTDB 4J9QA 4O3RA 3GIKA 3KK3A 4JV0A 3HHKA 3KK1B 4RW8A 4RW7A 3QINA 3TAGA 3QZ8A 4F4YA 3WNHA 4TN2A 2HHXA 3HXMA 4ECWA 3NF7A 3KKSA 1LV5A 2FVPA 4DEZA 3ZSQA 2OYQA 1SL1A 4ECZA 3UDLA 2HB5A 4CHPA 1C0MA 3Q8PB 4CGJA 3MEDB 2AQ4A 3KLGA 3K5MA 3OL6A 3LAMA 1W9HA 2W9CA 4FJIA 1RA6A 3LP0A 2W8LA 3I8DA 5KG6A 1BHLA 5K14A 2W8KA 3TAQA 5SWMA 4YR2A 3LZJA 5KFAA 3MR2A 4N47A 1WSJA 1VSIA 3DM2B 1K6YA 3IAYA 3ITHA 1S6QB 3AA5X 3C6UA 4Z4FA 4HCBA 5DLFA 2B5JB 3G86A 3SUPA 2EHGA 3U6FA 4CECA 4EP4A 3ZSYA 1VRTB 1JLGA 2R8KA 2UVUA 3MEDA 3SZ2A 2KTQA 4NYZA 1C2PA 3PUFA 3CIZA 3I0SB 1TGOA 4FVMA 5CZ2A 4B9VA 2UVRA 1RTIB 2PY5A 4CHYA 3I0SA 1O1WA 1KVBA 4U7CA 4J2EA 3PR5B 4IG3A 4RU9A 4DU3A 1KLNA 4H54A 3LPTA 4OJRA 4RUAA 2IC3A 2D7SA 3SUNA 3OYBA 2YKNA 3KLIB 5EUHA 5D3GA 4FLVA 3QNNA 4CJ3A 2OPPB 2B5JA 1JXBA 3KK3B 3IGNA 4B3OB 3KHHA 2ATQA 3O3GA 4CJSA 4CJWA 2OPRB 4B3OA 3K5NA 1UWBB 1Q9YA 1RDDA 4LSLA 2YHAA 4G1QA 3K2PA 4ZPBA 1JLBB 5KT2A 3AO4A 4G1QB 3P83D 2CKWA 4DFKA 3O4QA 1ASUA 3T5KA 3EPIA 3U3GA 2X6NA 3M8QB 4M45A 4QWEA 4PQUA 1LAVA 3V6KA 4KB7A 2XHBA 1S0NA 3I0RB 1ZBLA 3TAEA 5KFLA 1NK4A 2B4JA 3DOLB 5CZ1A 2ZE2A 4I2PA 3EPGA 1T03A 3EYZA 4CEQA 3PW5A 4Z4HA 3OYIA 1L3VA 3HVRA 1C0UA 3L2RA 4FJ8A 2HHVA 3RAXA 1JLCA 4CEEA 1D9DA 4ZP9A 4H4OB 3OLAA 2RF2B 3SCXA 4B8CA 4MK9A 4FM0A 3M9NB 4DWIA 3NBPB 5KFVA 5KFOA 4RW9A 4ECYA 3MXMA 3LANA 4ICLA 3CJ5A 2WONB 1TQLA 4WFZA 4NLWA 5I42A 4I2QB 1RBSA 3QERA 4URGA 2KFZA 3ZT2A 2XO7A 4EBCA 4FJ9A 1JXEA 4AHUA 5FRNA 3QGHA 3FDSA 3CFOA 4BDYA 2OPPA 3GILA 5KFPA 3H40A 5CYQB 2IM1A 5L1IA 4CFCA 3B6PA 4DTJA 1ASWA 2JEFA 3MF5A 3CJ3A 4EBDA 4C8KA 5KG7A 4NYFA 4WYLA 3VQ5A 1MU2B 4Q5VA 3HO1A 3MEEA 3SNNA 3T3FA 2I1RA 2BQUA 4Q0BA 4CF1A 5EWEA 2X78A 2BQRA 5F8IA 3NGDA 1TK0A 3SQ1A 4EP5A 1VRUA 4I9QA 1S6PA 3NGIA 4M3YA 4ZP6A 3QZ7A 4FJ5A 5KFWA 3P5JA 2FVCA 1WNSA 3L8BA 2FBVA 3DLGA 3OYJA 1RTHA 3VQQA 4LQ9A 1NK9A 5EWGA 1ZTWA 3KLFA 3V9WA 5KFXA 4K4VA 3M8SA 4UQGA 4KKOB 5D3GB 4ECQA 3RMDA 4NLSA 3GYNA 4OKJA 4RNOA 4FM2A 4AH9A 5JS1A 1RT4A 3AV9A 2JLEA 5KFJA 5KFIA 4O3PA 3OYCA 4H4MA 4QW8A 5DQGA 1R0AB 2R2UA 1D9FA 1KTQA 5KT4A 1IG9A 4FLWA 1RNHA 4HUEA 2PZSA 1QS4A 4RW4A 1ZBHA 4F2SA 2G8IA 4DF8A 2HVIA 1RBUA 4RW4B 2V4QA 2RN2A 1XHZA 1SH3A 1KVCA 1DTQB 4XPEA 2XRIA 3OS1A 2YNHB 3ALYA 3AO1A 1EETA 4FS1A 2DFFA 2LSNA 1S5JA 4IDKB 2OZMA 4DTPA 2R8HA 3C6UB 3RR8A 2FJVA 2OPQA 4Z4CA 5J2QB 1N48A 4RUCA 1C1CB 4IFYA 3PZPA 1TKZB 4IFVB 4LSNA 4C8OA 5F8LA 3CJ4A 3RMBA 4GC7A 3CYMA 3SQ0A 1JLEB 2F8EX 1U45A 4CJKA 5J2PB 4PY5A 3IG1B 1N5YA 3VQDA 1UAXA 3CDUA 2HHTA 2BR0A 3NH2A 3GIIA 3MXIA 1S6PB 2J6UA 4DTMA 1RILA 3F9KA 3HP9A 3HJFA 4KREA 4J2AA 4F4KA 4NRUA 3V6HA 5KT3A 5KFNA 3SFGA 5KFRA 4WFXA 4X2BA 3DMJB 2P5OA 2Z1HA 4O0IA 5C42B 4FJXA 2JEIA 2VWJA 5J2QA 3LDSA 1CSJA 1LW2B 3HKWA 1XWLA 3OYFA 2HAIA 4B9MA 3O4NA 1OS5A 4GW6A 1FKOB 3SUQA 4ELVA 3KOAA 1C1BA 3SPYA 3K58A 4RW8B 2PYJA 2D3UA 4FLUA 4OPKA 3THVA 1NHUA 2VG5B 1T7PA 3IRXA 1S1VB 3L2VA 4QWCA 3JSMA 3H08A 4CJTA 4WE1A 5KFFA 3G6XA 3OL7A 3KLEB 2C2EA 2XI3A 5DGBA 1IO2A 1WSGA 1BI4A 1NK8A 4ECRA 5I42B 3DOLA 1HQEA 4RZRA 1RT6B 4L8RB 3ULDA 4DG1A 1GX6A 3CG7A 3TAFA 3S3OA 2IM2A 4R0EA 1U04A 4TQRA 2ALZA 2YNGB 3VQ7A 4RW6A 2FBYA 3NF8A 4FLZA 2HVHA 4R5PA 2KQ2A 3VQ6A 2WOMB 4DSIA 2E9ZA 1ITGA 4IG0B 1VRTA 4WE1B 4HHTA 2BANA 1FKPB 3GV7B 2DFHA 2D0CA 4K8XA 3AVNA 2XC9A 3IS9B 2NUBA 2GUIA 4I7FA 1HQEB 3BGRB 2XY7A 5DLGA 4CHOA 1U47A 5EDWA 1TKXA 3SPZA 3TABA 3PHEA 4AHTA 4CF9A 1BI4B 5KFQA 2ASDA 3MEGA 4FK2A 2IAJB 1LW0A 1RT3A 3L3UA 1TK8A 4KTZA 4O44A 1D1UA 1JKHB 4OGEA 1BGXT 3DRPA 3LZIA 4CJPA 2V0NA 1BQNA 1S9FA 4LH4A 4IRKA 2ASLA 4QW9A 4Z0UA 3DLKA 3AA3A 1C1AA 1YTAA 2ZKUA 5KRTA 5KGXA 4ED2A 2HHWA 5KG1A 2YV0X 5HP1B 3KMSA 4CESA 1J5OA 1LWCA 3G6YA 2A1SA 1JLBA 3V6DB 1IKXB 3KLVA 1BIZA 4O0JA 3AVKA 3V4IA 1NJWA 1LW0B 1JLAA 4O5BA 3KK2B 4AHRA 5KT5A 4DTXA 4K50A 3H5YA 4DQQA 1X9WA 2RKIA 3BSNA 2F8TA 3HPHA 2AGQA 1HQUB 1TVRB 4R8UA 4J9NA 5KGWA 5KFDA 3AO5A 2WTFA 5HRPA 4JV1A 4YR0A 1U09A 1W0HA 3H4DA 3SV4A 4ZVEA 3BJYA 3VQSA 2PYLA 4KHUA 4NLPA 4CHNA 4YQWA 4J9RA 3KHRA 4AHVA 2WOMA 2IM3A 3E01A 4DL4A 2QXFA 2G8HA 3AA2A 2I5JB 1REVB 2FVQA 1JX4A 1SH2A 3RMAA 4Y2AA 3HM9A 3NAEA 4HVJA 3PX0A 2W9CB 3AO3A 2XY6A 4CJRA 4KHYA 2FLLA 4I2PB 2F96A 4QWBA 4OL8A 1QUVA 1QHTA 1J9AA 1JKHA 1IKVA 3AVFA 3DM2A 1ZBUA 2KFNA 4M3UA 2W9AA 4OKKA 4K4UA 2V4RA 4C8NA 2QE5A 4M41A 2HNYA 3HP6A 4ED7A 4DQPA 3E01B 4Q43A 4TYBA 3NF9A 2FBTA 3MFHA 3KK1A 4ZVFA 4RNNA 1C6VA 4Y1CA 1S1XA 5L9XA 3N6LA 4O3SA 3PW2A 2GBZA 4JV2A 1FKPA 1F21A 1J5OB 4KHNA 3UR0A 1NOYA 4M42A 3WNEA 1EETB 2P5GA 2IOCA 1RDAA 4DS4A 1LWEA 3O3HA 4FJNA 5C25A 3NF6A 3EY1A 3NGZA 5DG8A 2Z1JA 4FM1A 4MK8A 1N4LA 3DLHA 3SQ2A 1TAUA 4K4WA 3KHGA 1BIUA 2FLPA 5KFGA 2ATLA 4ZP7A 3OYEA 3EZUA 4CFDA 1WSFA 1RT1B 1T8EA 1SKWA 4OLAA 4E7HA 4KHRA 4WXWA 3V1QA 1B9FA 3CFPA 2ZQBA 3QNOA 4FLTA 5DQHA 4R5PB 3CVKA 4FLYA 3T5HA 1X9MA 3V6JA 4E1MA
chains in the Genus database with same CATH superfamily
5F1XA 3RYLA 2FC8A 3NGUA 2FIUA 4ECXA 1TL1B 2GHWA 2YNIA 4S0MA 3MR3A 4KHQA 1K44A 1BCMA 2M9KA 3KUGA 1SL0A 1KVIA 1K8KB 3UB5A 2MPUA 2RHQB 4RLEA 4FXWA 3CDEA 2Q1NA 3C6TA 1RAAB 1XC9A 1P1LA 3VAFA 3V9SA 2DFEA 1WEYA 3CPWM 1QQNA 3C95A 1Z2LA 5D78A 3NP5A 2ROPA 1WI8A 2Z30B 2X3GA 3LF0A 4C4WA 4J37A 3AAPA 4LF4F 3WC0A 4F0KA 2EFNA 3B8AX 3R5DA 4FBUA 3G10A 4ILJA 2VFUA 1L5UA 2HF3A 1QAIA 3BKTA 4DV2F 1BO5O 3EO3A 4K0KF 4EO8A 4IWVA 2OO4A 4DUZK 4IOBA 4KC5A 3LOUA 3MM7A 3TOQA 4QYZJ 3ZX3A 2OD6A 5ETTA 4OLBA 4OHWA 4JHDA 1GFWB 2VYPA 4J8FA 2B6AA 5K14B 4DL3A 2BRLA 3BQ2A 1XK8A 1RT3B 2CJYB 3R9PA 3NG8A 1CZBA 4FK0A 3M7VA 1RT2A 1NKEA 4CJQA 4MKAA 4FXDA 4FK4A 2R2TA 3K7RA 4CBXA 3OXGA 3W9HA 2XLIA 1E6YA 3FEZA 3EXYA 3VAKA 1XN9A 3QESA 2FSNA 3CCSS 4LH5A 2P9GA 4FYDA 5C2CA 4CZCA 4H0TB 1FDDA 2BM1A 3BM7A 3R27A 5AXKA 3O8MA 3CQ8A 2Z58B 3GCXP 3PX6A 2J6TA 5F8HA 2UXBJ 4UTGA 4DV0J 3DNCA 2UUAF 2VUGA 4B3SJ 3MN5A 1GX5A 3JS9A 4BC3A 3AB4B 4BWJA 3N28A 1EX8A 4JI5K 1WAFA 3PSFA 3TTFA 2DJWA 4N41A 3F9MA 4QPXA 4TY8A 4H4MB 4LVOP 3PIOL 2I8EA 3R6GB 4FW2A 1LKZA 4LF6K 2HWIA 4C48A 1VQ9S 2AJ2A 4XTTA 2YHXA 4CZHA 2EBEA 3K5LA 2YKOA 2E9TA 1PO6A 3DLKB 5KFSA 4CLPA 4U67L 1Q8IA 3VN5A 3FSYA 3VETA 3OR1A 1PC4A 3RVCA 3CDAA 1IKVB 2K7JA 5FD1A 4FS2A 2KHDA 1E6VB 4G1PA 3SDEA 3NCQA 1KSPA 3IRWP 2VPXB 4P6QA 1Q78A 1XNRK 3MTJA 3V81A 1N32K 4F36A 5EWFA 2DEJA 4Z4IA 4USVA 2B9WA 5L1LA 1WNEA 1HW9A 3SUOA 4CLYA 2KYXA 5KFYA 3VGMA 4ED0A 1NDLA 3C19A 2PI4A 1QD1A 3AVGA 1NJYA 2XBPA 4OHYA 5J2PA 3S3NA 3K57A 3MM7B 3P49B 3QRPA 3G2XA 1QE1B 4AUKA 4X65F 4CP5A 5JUMA 4LF9F 4DPUA 2ZZMA 1JCFA 2R8GA 1FEHA 5AQQA 3KMQA 4FJJA 1S12A 4DUYK 5L9NA 1TELA 3WNFA 2GWKA 4AILC 1MN7A 4ZP8A 2AT1B 1ACMB 2MJNA 4UY85 4KH0B 1QVFM 1CJKA 1HL6A 3QIOA 5AQIA 2XGPA 3IBFB 4FWPA 1GLDG 2OMLA 2VG6A 4OZJA 4W5NA 2ZEJA 2EC2A 4RW6B 1XMQJ 3JSBA 1NK6A 2AU0A 1RGIA 3FGUA 3QEPA 1BLUA 5E3PA 4KHPJ 1RCXB 4KH4A 4OPAA 2A6AA 2JVOA 2X1BA 3H4BA 4YR3A 3W3SA 4Q2LA 1DHMA 2RB7A 3BF3A 3PIPL 4C98A 3OJSA 2UUBJ 3VQPA 3CNQP 1VRUB 1UAWA 2K7KA 4OJHA 2J9DA 5HBMB 4QCLA 4F8RA 1DQ8A 4CIEA 4NXMF 4H8KA 3TI0A 3TO8A 4CFBA 3CCJN 1YIJN 1OSDA 3M3ZA 1NK5A 2DNZA 2HBRB 4FL9A 4ZDNA 4PG6A 3J7YI 4GO5X 3GR0A 5GIPA 2J8SA 5MLCV 1QM9A 4FJKA 3ET6B 2XMWA 4TY9A 1SUQB 3O9SA 2P9PA 2GJIA 4JNEA 3KJNB 2RRBA 2GHVC 2W41A 3GYGA 3D0IE 2Q1LA 4DX5A 2GTDA 4AM6A 1QSSA 1Z25A 4Z7YA 2ZBQA 1WEZA 1H1VA 4DTRA 3MR7A 5JVHL 4X65J 5IT9Y 4MK7A 3MCOA 1MROB 2ITMA 3VQ9A 5AE3A 2YXLA 1U7LA 1J27A 1TYQB 4FYXB 4HL9A 3EZ5A 2QT7A 3FEXB 3CUNA 2Q3SA 3V6DA 3BBBA 3THXB 4JI4K 3VEXA 3TA0A 3RB6A 2LFVA 3TJAA 2YHBA 1MMLA 2FJDB 4DSEA 3AJ1A 1ITPA 4K5SA 2MKCA 4ZHRB 3O80A 4H4KC 3M8YA 3ZXWA 4CK2A 1HNXK 4DR4J 4B3SK 3HBTA 1YI2N 2RDDA 3VTHA 2OA8A 2AGOA 3TZWA 1C0UB 4XPCA 4EEYA 1NG9A 4M5LA 4YMEA 2CGKA 4BWMA 2Y3YA 4IH7A 1HI0P 1H38A 1MNEA 4LFBF 4ES3A 5CE3A 3FLCO 3OV7A 3KZBA 1JIHA 3M30B 3VCDA 1MWZA 1AZSA 1TU0B 3FZMA 3NH0A 4IJNA 4C8LA 3ET6A 1VYAA 1WTFA 3CCUN 1WC6A 2J7WA 4I9LA 2VOPA 3DLEA 4OI0A 3M6XA 1XNQF 1RAGB 3U1LA 3Q8QB 3M6WA 4A8WA 1C0TA 5BN9A 1PBUA 4KJIA 4NMXA 3PW7A 2MKHA 3C6HA 3QETA 3GFYA 2XY8A 2FJEB 3I31A 1N32J 5KG5A 2W6LA 3AODA 2MYFA 2K3KA 1TUUA 1NJXA 4DG1B 3OLBA 1VJWA 2ZJRL 4CIGA 4I6MA 5FLXU 5F8JA 3MMBB 4ZN3A 1WDTA 5L1JA 4NLBA 1YX2A 2GHPA 3F41A 4CT9A 4DV4J 1S9EA 4FF3A 7FD1A 4DL0C 2V4JB 4OV1A 1CXUA 4Z94A 1XI1A 2YNHA 3LWLA 4MLHA 3NOGA 4CZGA 5ETVA 1SQGA 4CEBA 5A8KB 2DGVA 4KO0B 3WHIA 3BBCA 2HYIB 3NKYA 2HKEA 1RLDA 1HPZA 1RDBA 3DDKA 2EVZA 2E8AA 2A41A 2VC0A 3TVKA 4USKA 1ZBSA 3O1LA 1VK3A 2WHOA 4IO1A 3KWIA 1I94J 4OHXA 3D3CJ 1WOPA 3TW0A 4PL7A 1IKXA 3NAHA 4LC9B 3GG4A 3TX8A 2LLZA 3ZZRA 3WBZA 3M8QA 1UMJA 1VFJA 3IG1A 2W9BA 3HD2A 1I3OB 2HRYA 5AJ3F 3OSNA 2BVZA 3SI6A 1B7YB 1M1HA 1Z4UA 3IR6B 3LP0B 2HGNA 2WVCA 4O4GB 1JJHA 3KIOA 4FCYA 3E51A 2OPQB 4B1UB 3WDOA 1VR6A 3QEXA 1S9GB 3GIMA 2M5YA 1X9SA 3GJRB 4GO7X 4U7UK 3NY0A 3D54A 5F8GA 1U1LA 3WNGA 4OI2A 4IR1A 1I39A 3Q8VA 4HT5A 3ISNC 4E7JA 2IDEA 5KG4A 3R5AA 3OR1B 2IRYA 1RBVA 1SB6A 2QL9B 3KTQA 2ASOA 1ZBFA 2CPHA 3BO2A 3MMVA 4YB6A 2QWNA 3D2FB 4B1YB 1Q5YA 2GGPB 5AXLA 3VQ8A 1QLNA 1Y97A 2D9OA 1HQ2A 2YQ0A 4KR0B 5AQOA 3NGTA 2LU2A 3S7RA 2KXFA 5AQWA 1VQLS 1Q53A 3BGUA 1VSLA 2B4UA 4JV5J 1FDAA 4Y2KA 1YXQA 1TKZA 5HLFB 1VQ5N 1T02A 1K9MO 3LWMA 3PR4A 5H9EK 3ENVA 3DOMA 4KPYA 3JQJA 2HHQA 4WQ5C 5IM0A 2P9IB 3HYFA 3QGPA 1JLAB 1FESA 3DWLA 4W5QA 3LM9A 2CQBA 1JL1A 2UUWA 2CA9A 2G2ZA 1ATNA 1TFYA 4JI5F 3D1OA 4NCGA 4CGFA 3MI7X 1KNZA 1V6HA 4NOHA 3JTNA 4LSZB 4L6V3 3WZ0A 1RHQB 3J7ZO 3H98A 4ZMMA 1Q82T 4KAIA 1NGIA 3OXFA 2W6KA 5CABA 1NKBA 4D3GA 4NLVA 3S1TA 1Q95G 1HBMB 4GKKJ 2BH1A 1WHYA 4MQ3A 3HT0A 1OO0B 1DY3A 3I87A 2GIQA 3JS6A 2QA1A 4CEDA 3DXBA 1V3RA 4A62A 4JI8K 3R1HA 3CD5A 2WVBA 5HANA 3CMAN 4GMJB 4ZVOB 3TP2A 3I0RA 1EJ7L 2HBYB 4K25A 3ELHA 4J9SA 2ZE2B 1WORA 3V81B 3CD6S 1SV5B 4BCAA 4RW7B 4P9SA 4PWDB 1L3TA 3DXKB 3IXQA 1RWMB 1RU1A 3SIPB 1N5TA 1NGGA 4MO5A 5FLXO 5U47A 4PKGA 1D0EA 4LF4K 1A5XA 5KAKA 3W2WA 4DTOA 2UU9J 1S72S 1BQXA 5C2FA 4FPIA 3QAEA 3SQGA 4ED3A 5D4OA 5LM7E 4FJLA 1T6DA 2FVSA 1QTMA 4DMNA 2WTUA 3TSPA 2C2OB 4UUWA 3ULEB 2AEJA 4ZVGA 4IRCA 1WOQA 4IRDA 1DTQA 2B9EA 2DR5A 4HR2A 3MEKA 4ED5A 2B4VA 3EGWB 2FF3B 1CULB 4ZVPB 1KAYA 3QRRA 5KFBA 3VEVA 3SQOP 1C0TB 2CFXA 3T19A 5LJ5Y 2XWXA 1JLGB 2PA3A 3UVJB 2VG7A 2JJ4D 2NRHA 1M90O 3F73A 4B3MK 3AD8C 4CH1A 1FJGF 3SJJA 3HHNB 2ADCA 3NCIA 5CZVA 4FNHA 1TMMA 1XR5A 5J2NA 1NPRA 4MH8A 2YHWA 1VSEA 5J1NA 3RB0A 2WVFA 3O6QA 4AD6A 1VK0A 4OX9K 2W7OA 5JMVA 4O4GA 4IJAA 4BC9A 1JLQB 2CADA 4LFAK 1RT2B 4DF4A 2RQKA 1QVGR 1LWXA 2D1KA 3SCJE 3C6AA 1FK9A 2CXEA 2W01A 4NMLA 1NHVA 4WFNQ 2ITGA 4CD1A 1CQMA 4HACB 3BDPA 4MAKA 1HHTP 4V19J 1T3OA 3BBFA 1KOOA 3MCNA 1XMBA 2UXCJ 1X3MA 3ZSWA 3ILJA 5ETQA 1WSRA 4KAZA 1N88A 2DY9A 2O3DA 3K8VA 1RTJB 3D67A 4ANEA 2DNNA 3NLCA 4W98A 5KRSA 5SUHA 4GKJF 2NNWA 4DTUA 1RDCA 3MOZA 3RW6A 1SKSA 3DGPA 2PO4A 5CCLA 2ZH2A 1CS4B 1VQMS 5HSPA 3GOIA 5BN8A 2EG2A 4LT6A 3DI6A 3G6VA 4JV5K 3T1YJ 2PEBA 3D5MA 1KC8O 4QWDA 2DNOA 4AQYK 5JLHA 3I6PA 2NXEA 4E1NA 2VD3A 2E7XA 3KD1E 2RPIA 4CVNE 2DGSA 5BPNA 4UY8O 3FQKA 4IKAA 4DLGA 2C2ZB 2QN6B 4Q8EA 1RYRA 1QJHA 1D9AA 4HHHA 1MMNA 1FVSA 4X4PA 4LMZA 2F8HA 4XO0A 1KP6A 3N5BA 2MQQA 1T94A 2BE2A 4F67A 1W26A 1IWAA 4ZVHA 1FW6A 1GNKA 3GMGA 1U1PA 3MEEB 1UJ4A 3VVUA 2KJVA 4P72A 5E0OA 2OPSA 1VQ7S 3OR2B 3CO9A 3EVOA 2B4PA 2ZVIA 1S6OA 1HNIA 3V9ZA 2BJ3A 3GG0A 3CJKB 3L7PA 5C10A 1QY7A 1GOAA 2XB2D 2QL7B 1GH8A 2DY1A 1L3SA 4ELTA 4NE9C 1C1CA 2Y1JA 4DU4A 2HNZB 3M8PA 3ZETB 2NLXA 2V67A 2PMHA 3JXUA 1RWNB 3JSRA 3SSRA 4JV0A 2ZZTA 3HHKA 4RW8A 3IWLA 4ZVTB 4TN2A 2HHXA 3THXA 4FYVB 3QJPA 2VBWA 1M5PC 4B1ZA 4ECZA 3SMSA 4CD3A 4MJKA 4NXMJ 4H0OA 4I56A 1YRTA 3LAMA 2W9CA 4ZKAA 2JH3A 4YY3F 3HLUA 4QR0A 2VODA 4L76A 2F7TA 3TAQA 1G7CB 2M7SA 2JLFA 4GNIA 1ZXOA 2M0GB 5A0YA 1SKUB 4O5FA 4FF2A 4BQZA 3VMFB 3MM8A 2HWTA 2EHGA 2ZH9A 3MMJA 1JLGA 3MEDA 1X5PA 3SZ2A 1GLJO 2JWNA 1C2PA 3QAUA 4A48A 3I4HX 4KPCA 1KQFB 4B9VA 2OUGA 4GVLA 4NASA 2UVRA 1YLXA 3Q89A 4DZDA 1FERA 2OANA 1KVBA 4J2EA 4IG3A 4Y0FA 1GMWD 4RU9A 5F0XA 1DT9A 2DXEA 1LOTB 1KQSM 4OJRA 4RUAA 1GMVA 3QBWA 3F56A 5J1PA 3OW2M 5EUHA 4ZIWA 4AM7A 1JXBA 4K0KK 2G1DA 3D0HE 3O3GA 4CLFA 2OPRB 1FJCA 2B4OA 1Q9YA 4WFAL 3CCRS 4NLCA 3NMRA 5GAEI 1X4EA 3K2PA 2MQ8A 3AO4A 3D4JA 1N32F 4M5GA 3U1NA 3R3LA 4DFKA 3O4QA 2P9KB 1FO1A 4ZCLA 3EPIA 3NCRA 4C23A 3U3GA 3M8QB 4YHHJ 1IQTA 3CC4S 4KB7A 3C15B 1S0NA 3I0RB 1VCTA 2CQ3A 1E6YB 3TAEA 5A76A 1VQOS 3DOLB 3EPGA 1WC5A 4Z4HA 4LBIA 2HAFA 1YDLA 4AL6A 4BR9A 5BRDA 1H74A 4GVBA 3L2RA 1RCOB 2DTJA 4FJ8A 2NSBA 2HHVA 3TVZA 2Y9HA 1DQ9A 2O8DB 2ZWOA 2Z0GA 3TUPA 4Y00A 4RW9A 5T7LB 4WFZA 4NLWA 5DO2A 1SIZA 2YTCA 2LDYA 3AAWB 3P5TL 2HOEA 4HH1A 1ATRA 4USJC 3W63A 1WOOA 4UOHA 3PG9A 2XO7A 2QEXS 2XMTA 2CIMA 1JXEA 1MWKA 1HNXJ 3BDEA 3FDSA 2E5GA 2KYZA 3Q22A 1NJIO 3VF4A 2XNRA 2B7CB 2QL5B 3MM6B 3U9DA 1RLCL 4ILMA 2V5HG 1YJTA 1MU2B 1NXIA 3HO1A 2OEMA 1XC3A 3D1QA 3A3NB 2BQUA 1WUUA 1YITN 3SAHA 4QYRA 3I9ZA 1VQ8S 1TK0A 3SQ1A 2EK6A 1VRUA 4QZVB 3EICA 2F9DA 2P9LA 4OLPA 4ZP6A 3C0BA 3W8GA 2HMPA 1J5EF 2YCHA 4DV7K 3U7JA 3P5JA 2R7SA 2GJFA 3L8BA 2FBVA 3IDHA 3FZ2A 3VQQA 4NXNJ 1ZTWA 1UW9A 1J5EJ 5KFXA 3M8SA 4CZFA 3V9WA 2XYGB 2FLOA 4USUA 1IBMJ 2BZ2A 5AQGA 4DV2K 3GYNA 1UVJA 2RD5C 5DZ7A 3AV9A 1SJ1A 2G2OA 5E26A 1YSJA 3FVYA 4O3PA 4ALZA 5ETSA 1R0AB 1H2TZ 2R2UA 3QWUA 2KRRA 1D9FA 2NXUA 1IG8A 2WSCC 1QDUB 1KTQA 1IG9A 3IP0A 4HUEA 4OFZA 1S6UA 2L48A 3UNGC 4RW4A 2VL1A 4BBYA 4F2SA 4DF8A 3ENWA 1FNXH 2V4QA 1KVCA 4KH1B 1FRKA 3OS1A 2YY3A 5HL7L 3AO1A 2P9NB 1EETA 5CR4A 1RHKB 4JKGA 3CSKA 2HVZA 3CCMS 2OZMA 4DTPA 4YDDB 2R8HA 2FJVA 1IQZA 2NRVA 1N48A 3VQTA 4IFYA 1FRHA 1IJFB 4LSNA 2CJBA 2E1MC 4JI0F 2IVMA 4FPRA 2E2PA 2VZ9A 4X4QA 4BRGA 4U7UD 2BMBA 4RUBA 3T1YF 4PY5A 1I51B 1N5YA 1Q7YT 2E1AA 2DRBA 4UOCA 4ERDA 2A1BA 2BR0A 3GIIA 3G8QA 3J81j 2HHHK 4GKJJ 4DTMA 3F9KA 3HP9A 2XZTB 3HJFA 1VC0A 4KREA 4F4KA 2PFFB 3SFGA 4WFXA 1WI6A 3DMJB 4O0IA 5C42B 4DV3K 4P2MA 1U1MA 2YJFA 4JI6K 1UVIA 5J2QA 1XWLA 3HKWA 2ZC4A 4ELVA 1PYOB 3SPYA 3MPUB 4P2FA 4RW8B 2PYJA 2D3UA 4FLUA 3D2EB 2KT3A 4OPKA 4ES1A 3THVA 1BMQB 4QWCA 2EBGA 5HI7A 3JAMU 3MMAB 3KLEB 5DGBA 4YN3B 2LECA 4NYOA 3K17A 3UD4P 1BI4A 3W2VA 4A8XA 4MMOA 2NS1B 4JI1K 2ABYA 3KXDA 4L8RB 1MW7A 3TVYA 3A12A 3G6ES 4B3MF 3GL1A 2IM2A 1U04A 4TQRA 1NH7A 1X60A 1A6LA 3DN9A 2FBYA 4FLZA 2HVHA 1O51A 1YG0A 4V19S 2WOMB 2E9ZA 2VWBA 1VQKS 2B7BB 1VDHA 2QW9A 4YDUC 2P9SA 2ZJRQ 1K0VA 3AVNA 4A8SA 3KG0A 2GUIA 3GJSB 3B82A 2XY7A 4CHOA 5F3ZA 5LMNJ 1TKXA 4PRFA 3TABA 2AW0A 4CF9A 1BI4B 1BUXA 3MEGA 3CPWR 2IAJB 5BXIA 3SSQA 3L3UA 1PGZA 4K2XA 2CPFA 1REGX 1JKHB 4OGEA 2H51B 4I1TA 1BGXT 1CG2A 3ZZOA 3SMPA 3LZIA 4CJPA 4CH7A 4P10A 5DZ6A 2V0NA 1RFQA 3I9V9 1M5SA 2FZGB 4TNOA 4H4KA 2GFFA 3OD2A 4MYTA 4QW9A 2ZNZA 2OI2A 4BROA 2YV0X 4FPAA 4CESA 1VQSA 1T9YA 2P9IA 4FYYB 2H3GX 3AJ2A 3KLVA 1BIZA 4O0JA 2BJ7A 1V4TA 1KVKA 4UF4A 1NJWA 1IBKK 4DTXA 3NGSA 1C4AA 3BSNA 3HPHA 1XTZA 1Q86O 3HI9A 4R8UA 4J9NA 5HRPA 4YR0A 3CCEN 1W0HA 4KRWA 1RI7A 3VQSA 1YK9A 4X66J 4J9RA 4MT1A 1NAQA 4FOIA 3D6TB 2IVPA 1OQ3A 4LF4J 4X4SA 4C11B 1JX4A 2QA4N 3MOJB 3NAEA 4HVJA 1W2BR 1W7WA 4PKIA 1XMOJ 2BUPA 4OZ1A 2PA8D 3AVFA 2QMUB 5A0YB 1OVYA 2NYIA 3VAIA 1E4GT 4OKKA 1JQGA 2KM8B 4K4UA 4C8NA 2ZJQL 2RSQA 1RDWX 2QE5A 4C3MA 2KFYA 2V63A 1O6XA 2WFBA 2ZH5A 1DFDA 3TUZC 1VBKA 4PG4A 2QC3A 1R43A 2FBTA 4K41A 2F4VK 4RNNA 4PKDB 5AJ3K 3J81U 4CLTA 3RAMA 2D9PA 3N6LA 5L9XA 4O3SA 4DV4K 1RHRB 4JV2A 1WWHA 1F21A 1VIXA 3UR0A 4M42A 2IOCA 2ASYA 3O3HA 2QWMA 2ZOFA 1M5HA 3EY1A 1FRIA 3CQYA 4DPWA 5JICA 4MK8A 3DLHA 3FE1A 2OFGX 4CZMA 3AA8A 4ZVUB 4TU7A 3SQ2A 3IR7B 1FJ7A 3R7BB 2P8IA 4ZP7A 5LJ3Y 4AXJA 4RBVA 3OYEA 4OLAA 4WXWA 2DVIA 2CG4A 2QI2A 1SC6A 1HHQA 4R5PB 1F3FA 3CVKA 4WQ4A 4FLYA 3T5HA 3TZYA 3K2YA 5IV4A 2I9SA 2CAJA 2WAQD 3IM8A 4A2AA 2M8HA 2DGTA 1IBMK 1WKJA 3RRKA 1RAJA 5CCMA 3DRSB 3CCVS 2WBRA 4PABA 3C7NB 2QXLA 3WEEA 1VI7A 3SK3A 3MAQA 2RUGA 3IUCA 2VBZA 3M6UA 4ID5B 2ILYA 3G87A 3ENHA 5AZJB 5HMXA 3U02A 3RGIA 1SPBP 3BQ0A 2ZUAA 1SC3B 4IXCA 4B9QA 4O3NA 2CQGA 2CJKA 5EX5A 3QBXA 3O8WA 4JI3K 3RRGA 2DITA 4DKWA 1I1GA 5A6WA 2E2OA 4KFBB 2AX0A 5I3UA 4WFYA 3Q24A 1HR0K 1X4DA 1D3WA 2CWXA 1VMBA 4Y2CA 3VAJA 4JI7J 3SAGA 1VSMA 1ZA2B 1IR0A 4AQYJ 4JKBA 1R6VA 3D0PA 1R8BA 2QFIA 2IHR1 1QHAA 2QWRA 5DM7Q 3DLGB 4C1NK 2HNDA 1CXQA 1CJVA 3CD7A 1HLWA 3H5XA 1RT5A 1N36J 4L75A 2VFTA 3FFIA 1ZAWA 5H9EJ 2DPJA 3N6MA 3FBFA 1U02A 2BANB 3FFIB 4DBQA 5DG7A 2K06A 3P38A 1NEEA 2HZVA 3QLHA 3U1MA 4DN0A 1HA1A 2MEWA 2YNGA 2MZQA 3M6GA 3JAMO 3H6EA 2ETJA 4Z7CA 3CTRA 1WC0A 2YBVA 1MA9B 2Z2ZA 2ZOMA 3A8IA 3H59A 4W5RA 3GLJA 2KI2A 5FROA 3ZETA 4BR2A 1NJZA 3CJRA 5JVGQ 2I7NA 2OTLS 3J80U 2V52B 1FRLA 1JLQA 1S1WA 5EX3A 2E4LA 4BRLA 4CBWA 5E3CA 4NA3A 3ENAA 2A2CA 4ZK7M 3HZGA 1DAXA 2BJ8A 5AQJA 4H4OA 3GONA 3CWJA 4F3QA 3THWA 3OSPA 2L08A 3Q86A 1CJUB 2KG0A 3MAAB 3THPA 1M5KC 2GMJA 4NB4A 1TV6A 4JKDA 3ICLA 4MDBA 4B1WB 3LPEA 1D5AA 2IIHA 5D0GA 3POTB 2H3EB 3CCQS 1FXXA 4JKFA 4LREA 2XCPA 3RZAA 4FOEA 1N34K 1DQAA 2HHSA 3OVNA 2ACMA 1T44A 4JS5A 4HI1A 5AT1B 5DJBA 3Q8SB 3C65A 3TPQA 4CF2A 3A3OB 3FK4A 4NLXA 5LMNK 2HK3A 1S97A 3GDQA 1GLAG 2DPIA 1N8RO 2JRSA 4YOXA 1PC5A 2MZ1A 4ETXA 2FC0A 4CLKA 2GAGC 2GIRA 3SEOA 1UWBA 1IM4A 4CK1A 3ATVA 5CHIA 4KGXB 4I7FB 3BSCA 4OZNA 2VV5A 3I33A 1VRQC 4NLOA 5T14A 4ZPWR 2QYGA 2OTJN 4A47A 3KKFA 3QYYA 3R7SB 2GV9A 3IBCB 1RT7B 1X5TA 3MXHP 1S9EB 2F65A 1VLYA 1BA0A 1VBZA 1SV5A 5HMWA 4C97A 3B78A 4RX6A 2LYVA 2NPIA 1HKGA 4ATNA 5DK5A 3QWPA 5AQSA 1SXLA 1EQMA 1A9NB 3QNWB 3O9QA 4RKUC 4ED6A 1TK5A 2EG1A 1RQ0A 2VQFF 2G8UA 1FA0A 1FK9B 3DYAB 4OJ1A 3T5JA 4F50A 4OPJA 4Z4GA 4EHUA 3MFIA 1VC5A 1H7WA 5AXMA 2RU3A 2FF6A 3RAQA 4BACA 1RWXB 2CYYA 4H5VA 2CJQA 2J4RA 4CO2A 1X4GA 3D66A 4ZLNA 2MKJA 1OIAA 3AVJA 1ZZNA 2E5HA 4LF5J 2A3ZA 4JI3F 5M2RA 1BQMB 5DDPC 3I5CA 1LAWA 1FD2A 1SUQA 4LBPA 5GADU 4WP9A 1RACB 3D7SB 3PRBA 4DQSA 2VQFK 4I67A 1W2BM 5I4MA 1OY8A 1Z2ZA 2GC8A 5BYQA 3OPKA 1YGYA 1HFEL 1NM2A 2CQ0A 5KPTA 2CQDA 3PIOQ 4IOAQ 4QR1A 2RS2A 1ULRA 2DHHA 2P6TA 5E41A 1UW4A 3VF6A 3H25A 1A0OB 3MPDA 3J81Y 3GV8B 2HPUA 4DB3A 2B8PA 3ZT1A 4CZLA 1NSKL 1CQNA 4LQ3A 1PJ5A 3NDKA 2HHHF 2MZTA 4PEOA 3CD6N 2ZITA 3VQBA 1U2CA 5FLXY 4NYNA 2CZ9A 2O8CA 1C0GA 2WUSA 3A2FA 4PUOA 1X4FA 4CF0A 3ZTSA 2ZH3A 2BXJA 2FYXA 1HYZA 1N36K 2LP4A 3L4QA 2R2SA 3EGZA 4J7CA 1FTCA 2DGUA 5K5MA 4QIFA 3PYGA 3QEWA 2QYCA 3LP2B 4FP9A 3RTVA 2FZCB 2I38A 2UV8G 4LF7J 4DFMA 3AVCA 2W2NP 2Z2MA 1XR7A 3H90A 2B56A 4N56A 4CQ1A 2RH3A 2BEFA 2CGJA 1EKRA 4PXDA 3AVBA 2R7UA 3THTA 2HMIA 4NZ0A 2QTWA 2KZMA 4XDCA 2C1EB 1QQCA 4USWA 3OVAA 2AYBA 1CBKA 4OX9J 3FNNA 3LPUA 4NX9A 4FXVA 5F9LA 1LFPA 3OQ2A 2C2KB 4E7LA 4HDHA 2IBKA 4F7VA 3A13A 3OUYA 4OO1J 4DR1K 3DCAA 3O44A 4F4WA 3D6MB 2FXUA 3RB4A 1CVJA 2H65B 3BZQA 2ASJA 2V7YA 4HTJA 1LW2A 1U4BA 2I6WA 4E7KA 3RRHA 4RNMA 5CA5A 4LVNP 5ETNA 1RDRA 1WC4A 4P7VA 5HROB 3TUJC 4C3KA 3TARA 2C2MB 3CI5A 5F8NA 3W60A 1IKYB 2WBNA 2HFSA 4IH6A 2OLWA 4WK3A 2KW4A 1O13A 2YKMA 4DR1F 2E5IA 5LL6Z 3M2UB 4ZS6A 2WC9A 3T5LA 4BR0A 1Y7PA 4CJ4A 3QIDA 3IO1A 2HBJA 4YHHF 4EIAA 3AGRA 1FCAA 1X3NA 2A6MA 2D41A 3TAPA 3V4MA 4KO0A 4HUGA 4LIWA 2CJAA 3DLRA 1FDNA 1K1QA 1RBRA 2Q31A 3TR8A 4TXSA 5ETRA 8AT1B 2J76E 1B92A 3BKFA 3BZCA 3MN6A 4DV1K 4ZITA 1OVQA 1K0TA 2HG4A 1EARA 1U1OA 3ZTPA 5AQVA 3PIPQ 3EVWA 3KJQB 1HBUA 4PG5A 2YNIB 3U3YA 1SL2A 1ZM4A 3OFFA 1D09B 1SQEA 2FVRA 3PNIA 3GJTB 4WQ4C 4KBOA 1I94K 2W7PA 3UN5A 3DU5A 2Q79A 4F4XA 1FXDA 3D1HA 3IR5B 4NEZA 3E1YA 3D28A 5MAOA 3I4PA 4HWIA 3Q7CA 1M1KT 3A8YA 1ESVA 4LFCK 4GMKA 2RE2A 2DD8S 1U25A 5B0FA 6AT1B 3HKZD 3N79A 2P9SB 3BP8A 3UIQA 4BGAA 1VHFA 1WELA 1FFSB 1PIEA 2XMVA 3UFCX 3SCIE 1JLEA 2HMIB 4BC2A 2RDIA 2OAUA 4DSFA 2ZBPA 5B0EA 1R7IA 2JC1A 1B64A 1Q86T 2HBMA 2A5XA 3Q8RB 3HPOA 2FJBB 3CJCA 2KRBA 3TSQA 5AR0A 4ZPVR 4QBUA 4G65A 3S01A 3TAMB 2B51A 1R27B 5CZXA 4C7QA 4LF6J 4YOUA 3OJUA 1CJTB 5HQMA 3L2QA 2IS3A 3D2EA 2UU9F 1HJOA 5F9NA 2KB2A 1O5JA 3M1VB 2HEKA 1Q79A 2ZGZA 4JRQA 2AP6A 4CW7B 1OWXA 2E5LK 4CTAA 4AHCA 3KLFB 1VJQA 2LA4A 3KNGA 2R7VA 4U6PA 4FZZA 1RWUA 4PWDA 2JHEA 3T6BA 2CNNB 2HFUA 1XNRJ 1CZ9A 4X62K 3T1HK 5F8MA 3CC7S 5HRRA 1T05A 4LSLB 2G1HA 2QSFA 4E8UA 1JLCB 1HWUA 1IV0A 2UP1A 1P27B 1AZSB 3O5TB 2R9LA 5FDLB 3KLHA 2JFKA 1D8ZA 2VG5A 2F9TA 2DO4A 1OPIA 3F44A 3K5PA 3FZBA 2ZWPA 1YJWN 1LFWA 3TRGA 3QT5A 1S57A 4C0HA 1FJEB 2VQEF 2XMKA 2JDJA 3E3XA 4J9OA 4G3IA 1X0PA 3OHRA 1T3NA 3R7NB 2UXBK 2DPNA 2BM0A 1BC6A 4EFHA 4MTPA 3BV8A 1YZ6A 4EZ9A 1HYSB 3T7ZA 4AFFA 4HVZA 2GX8A 3MM5B 4M94A 4URQU 3ZYYX 3QMQA 3ITHB 3NH1A 3QFUA 3KNAA 3DI6B 1RYSA 4MKBA 5B0DA 3OVSA 3PYDA 3ZTQA 1OJ4A 1VLOA 2MSSA 2H5JB 4K59A 1B3TA 3TWHA 3W2WB 1RSCA 4FZVA 5BPLA 2W25A 4I2QA 1KN6A 3CO0P 4JV5F 5M1QA 3CMES 1HMVA 1TKDA 1G1XA 3UD3P 4BS2A 4J9LA 3VQ4A 4NPOA 1CJVB 3DRXA 3GFHA 4BC7A 2V50A 4OJGA 2UXBF 3DU6A 2L3MA 3CCRN 2AYGA 1U1KA 3QIPB 3TWZA 1TL5A 1MMDA 3Q0AA 2MMYA 1WOSA 3UE2A 2UUTA 2DNRA 4KRFA 2IBOA 3KG4A 3CJ8A 5IS2A 3CM5A 1V5IB 3VGLA 2FLNA 3I96A 2P51A 4QS7A 3PVXA 4DR7F 2KVIA 4F2RA 1WSEA 3BGRA 3MMAA 1GXTA 2KM8C 4XIUA 3R97A 1H98A 3PV8A 5AZJA 2XMMA 2F5GA 2ZH1A 4CJUA 3OYKA 2YHYA 5KTQA 4O3QA 4K4TA 5KFEA 3ISND 2DHXA 5A8RA 2VBYA 2AYEA 4HDGA 3DRRB 1HD0A 3MURP 4X65K 1S7IA 3NWRA 3UVJA 4IFEA 2OZSA 1R0AA 3QPIA 2HQ3A 1U2RA 3L09A 5E7OB 4J9VA 4J9KA 1T0TV 3WQPA 2VCPA 1S22A 4GKJK 1GOBA 4DR5F 2ADBA 4CJEA 1LK5A 3PCOB 2L41A 4CO3A 2XY5A 2UUCF 3JTOA 1YJRA 2GCFA 1PYTA 4DV3J 5K8MA 3AH6A 1NB2A 3GP9A 3UCUP 1J5EK 4WU2A 4B3MJ 4NI2A 4LY7A 2QKBA 4DR4K 3ZSRA 3TQ1A 1NDPA 4FW1A 3K9KA 3ZZ0A 3O9RA 2HNZA 4CJ7A 3G96A 1HWJA 1FHTA 4FDFA 1PJ6A 2HVDA 3HTVA 4KV8B 4DR6F 1RWOB 3I56N 3E2EA 4FJHA 4AE5A 3RBXA 1UL3A 4M5IA 1NGEA 4IUFA 4Y28C 4N5SA 4IO9Q 2F40A 2MB0B 1YVNA 2FHJD 2P9CA 2NZCA 5K20B 1NSQA 2PN6A 3R6MA 1EQYA 4E7IA 2YPYA 5GADP 5LXRA 1GXLA 3CJQA 4YFUA 4OVLA 1FRMA 2Q43A 4M5DB 1H2UX 2IPOB 2Q2RA 3MECB 5LY3A 3FFKB 2R7YA 3PFEA 2CGLA 2Z57B 2ZM6K 3G71N 1IM6A 2QWQA 4OYBA 4J2DA 2X1FA 4OYMA 3ZT0A 5LL6d 4KI6A 2OFHX 4FJMA 3FSIA 1HRHA 4ZPDA 2VDIA 4CZIA 3P1GA 1S0OA 1XMQK 3D9BA 2WRMA 2FZKB 2KH9A 3JB9k 4CJ5A 5D4LA 4ID5A 4WPAA 4KH5A 1ATSA 2V8HA 2R7QA 4U7BA 4JI4J 2O67A 4A57A 2LCWA 4CFAA 1JLFB 4P7TA 4NCGB 3GE9A 3PO5A 2RHKA 3SI8A 4K8ZA 2XCAA 3FRZA 5GINA 5C5JA 1NJIT 5ADXA 5D0HA 4EBEA 3CF5Q 3LL3A 3DRPB 3DRRA 2N3LA 3ENOA 3OS0A 1NKCA 2ASMA 2DR6A 3SFUA 1S4FA 3MCSA 4WZMA 2YNFB 2VDHA 4PG7A 1U1NA 2D69A 3FBEA 3B6OA 2NPFA 2D3O1 2A0FB 4ECSA 2VH7A 2B3TB 2W4PA 4IH5A 3V5RA 5IXUA 4MFBA 1FFGB 3SV3A 3MWPA 4I6AA 2DNPA 1Z26A 4ZTJA 2BACA 1N33F 4BDZA 3PW0A 3CJ1A 4U9RA 1S72N 2JWLA 1FWPA 5SZTA 2GMHA 2LQ5A 3AO2A 5CYJA 2GEMA 3KK3A 1YRUA 3PACA 3GZ7A 3QINA 5KOXA 4YS2A 3WNHA 4E2FB 3HXMA 3MDQA 2MY7A 3NEKA 4DCOB 1FEEA 5L39A 3KKSA 4DEZA 2G0IA 1S5ZA 2QFJA 4DR2K 4F25A 1SL1A 1OH5A 5AQXA 4CHPA 2FHKA 2LU1A 3Q8PB 4CGJA 2E7WA 2JVRA 1J2VA 1FT8A 1LQ9A 1VQ6N 3HSZA 1RA6A 4LRCA 3LP0A 3O9UA 2W8LA 3IM9A 4X4NA 2EFQA 1BHLA 4C8ZA 2OMOA 5K14A 2IDLA 3FJ2A 3W2VB 4C9DA 1EO1A 4V1Ak 1IN0A 4WKRA 3DM2B 3ITHA 1Q16B 1U6FA 3AD9C 3C6UA 4ZA1A 1HR0J 1CC8A 5CAAA 3H20A 5DLFA 2NXJA 3CETA 3HFVA 3SUPA 4CECA 1VRTB 2ZF5O 1JJ4A 1T9UA 2ZM6J 1U0HA 2HZCA 4NYZA 1WUAA 2VJUA 1V3SA 3PUFA 1L3KA 4OYWA 1XMQF 4BC5A 2PEHA 3J7YU 1GXUA 4DV5K 2LQBA 3POTA 4U7CA 3PEHA 5IZHA 4H54A 5L46A 5L8RC 2ZBCA 1Q1KA 3SUNA 3OYBA 2YKNA 1RWPB 4WCEL 5D3GA 3UO0A 3DAWA 4BG9A 3LDLA 3R9LA 4B3OB 3R1LA 5EX0A 2IVYA 4CJWA 3NXZA 3L0QA 1JJ2R 4B3OA 3TX0A 1RDDA 4M63C 4LSLA 2PDAA 3KK7A 1RKIA 4ZPBA 5KT2A 3BF1A 1TL7A 4G1QB 1KQKA 4QR2A 3TEGA 3P83D 3C16A 1ASUA 2CH6A 2O8BA 3U27A 1F5AA 3T5KA 2X6NA 5IC4B 4PKHA 4QWEA 4YORA 3V6KA 3B4MA 1GLBG 3VGKA 2J9EA 5KFLA 4I2PA 3HSGA 3EYZA 4CO0A 4FWLA 1DURA 4Q7AA 3LA0A 4UW2A 3RAXA 4CEEA 1D9DA 3DFEA 1RJJA 4LF2A 2RF2B 1CS4A 4DN9A 4CZEA 2VBXA 4FM0A 3M9NB 4X64J 4LFBJ 5KFVA 3HHEA 1PILA 2QIFA 3CJ5A 3QBCA 1RHMB 4I2QB 4RO0A 1QAYA 4WIIA 4URGA 2MXYA 4LF8J 5AQTA 1IXKA 4MYUA 4P71A 1WJ9A 1NGBA 1D4XA 2YX7A 4BDYA 3GILA 5AZIA 2IM1A 4ZIVA 3B6PA 4HHJA 4WP3A 5RUBA 4YDUA 2ZKTA 2JEFA 1EIYB 1UEVA 4B3SF 4C8KA 4DV0F 3VQ5A 1Q8KA 2D0OA 3BEGB 3CMAS 1YTYA 4EWTA 3N4WA 4GRSA 4XK8C 5M2UA 4LF1A 4M5MA 1NLVA 4WFBQ 1RABB 3MCMA 3D2WA 3NGIA 4FJ5A 3Q8UA 2CDQA 3P5BP 1WNSA 3PFOA 5E84A 3OYJA 3O1WA 3W3DA 5E3AA 4K4VA 3D0GE 3U4LA 3NS6A 5D3GB 4ECQA 2J0XA 2Q3PA 2RMLA 4OKJA 5IT9O 2YKPA 5LSLA 5DETA 4F4AA 2FHOB 2DHSA 4QW8A 2VKZG 1RNHA 2LMIA 1U0HB 4JYAK 3CJTA 1VQ5S 2EFVA 3AA9A 2DNQA 4OI1A 3CHWA 1DTQB 4CYUA 4OX8A 4LF5F 3WC2A 5IOLA 4CNZA 4J9UE 4FS1A 3OTEA 3O2IA 4NL5A 3LO3A 4IDKB 1PAEX 3C6UB 4NA1A 2RT3A 4DU7A 1BOTO 4KGZB 2PSZA 4RUCA 1C1CB 5A6PA 4A8QA 3PZPA 1JCEA 3EGVA 2YWGA 5IM0B 2NRRA 1OH6A 1KS2A 2A40A 3OTCA 5TKWA 1UEKA 2EWSA 2DISA 5EHHA 1JLEB 3WQUA 3T1YK 1F2HA 3X1LB 1FJGK 3DDNA 3VQDA 1IBLF 3CPEA 5E3RA 4K42A 2FTRA 2DH7A 3BKUA 4I6MB 1QQMA 3QT8A 3NNCA 4DV7F 5AQNA 2J6UA 2P9LB 5D4NA 4GV6A 1LCUA 1E6VA 3SLCA 4O8KA 3V6HA 2Z1HA 3LDSA 2HAIA 2GVDA 1YITS 2NUUG 2Q0RA 1VQPN 1OS5A 4GW6A 3RG6A 3GCWP 4FF4A 3N9UC 2RHSB 1M5OC 3MX2A 3C16B 2BKNA 5FPMA 2RS8A 1NHUA 2VG5B 5AXNA 1SBRA 2M52A 3IRXA 3H1QA 3JSMA 3CXCR 4NWBA 1KQGB 4WE1A 4PZVA 5KFFA 4BRIA 3D68A 3EZOA 5HVFA 4DR3F 2Q97A 1FXRA 3THWB 1KQSR 4FWNA 1PSDA 2AZ3A 4B3TJ 2IVNA 2XSJA 2NREA 5H1SV 2KXHA 1WG1A 4CNYA 1SJ3P 3ULDA 2YI1A 5EOYA 4WBFA 2RUSA 2FDNA 5AQLA 3TAFA 3CJSA 3S3OA 4R0EA 1N52B 5G4DA 4A8OA 1NMEB 4RW6A 5G0RA 1UFLA 3ULHA 4R5PA 4L3KA 2E1CA 2KQ2A 4CRJA 3ZZPA 1VRTA 4WE1B 2XNQA 3MUTP 4BC4A 1KDNA 1FKPB 3BH6B 3ENBA 1Q0NA 3BR8A 2J9DE 4HACA 2NUBA 3CQXA 5LJVA 1HI8A 4X66F 3BGRB 1S7HA 1WF1A 4HEA9 5DLGA 3SPZA 1X4BA 4HTLA 2ASDA 1GMUA 1V5VA 4LF9K 4YY3J 2QZ8A 1LW0A 1RT3A 5ETOA 1TK8A 1UKUA 2HIQA 5F3TA 1RAIB 1S9FA 1UP1A 1W2IA 5GAGU 2OP5A 4YOVA 3HHLD 3CF5L 2PC6A 3MPVA 2ASLA 1C1AA 2R3VA 4ED2A 3VOVA 4EGLA 3MM9A 4A5AA 3KMSA 4DR2F 1J5OA 3M2VB 4PPDA 1JCGA 1YAGA 2P9UB 4FVUA 2H4WB 4B3RF 3V4IA 1YI2S 2VB6A 1LW0B 4WFBL 1JLAA 3GIRA 3KK2B 5KT5A 3H5YA 4DX7A 2RKIA 5AFUA 2A18A 4B1XB 2HIYA 4A8MP 2F8TA 4ZCMA 3VALA 2AGQA 1WHVA 2WTFA 1RGVA 1U09A 3EJMA 4CLWA 1Q8BA 3VESA 1N33K 4Z37A 2PYLA 1XNQK 2V69A 4CHNA 2XO6A 3FGVA 1RZMA 2IM3A 3E01A 1O0PA 3SXLA 1ZM2A 4LFCF 3HI0A 2QXFA 1XMOK 4GKKF 3AA2A 1FVQA 1Y64A 1UVLA 3PYEA 4YOTA 1T6CA 5CXTA 2W9CB 3AO3A 4JYAJ 2XY6A 3EGNA 2NXCA 4KHYA 1SC4B 4ER8A 2F96A 1WKLA 4OL8A 2QA2A 2HQGA 3TQEA 5JJBA 3D3BJ 5F0WA 4ZVSB 4DPXA 1URNA 2CWKA 2KVQE 1VQKN 4UZBA 3UDVA 3D6HB 1WACA 3E01B 3NF9A 4B3TF 2EK1A 2VASA 2RAQA 3PEJA 1DARA 1HW8A 1S1XA 2D3OR 1PJ7A 2GBZA 2BTFA 3G6EN 2ZC3A 4Y6IA 4CI0B 3ETOA 1WG5A 1YWXA 2DGQA 2A42A 2DNGA 1EETB 4FF1A 5AQKA 2NZ4A 4F0MA 4FJNA 3AARA 3NF6A 3NGZA 2Z1JA 3LTOA 4FM1A 1N4LA 1F1BB 2XLKA 1TAUA 1M1GA 2VF3A 3HRGA 4XEIA 5HQ8A 5KFGA 3HHDA 4ZLPA 4QIVA 4E7HA 1NNEA 1B9FA 3AGKA 4WCEQ 3NMUA 2W2OP 1YKWA 4E98A 1MN9A 4DL6A 3H3NO 3IGVA 3BSOA 1ICEB 4QAGA 4PXCA 2ZVSA 1BU6O 3RSEA 3UKRB 4W5OA 3OYAA 2KN4A 1IH7A 2NCKL 1R0BG 5LT5A 1BWVA 3KLEA 1GLFO 3VERA 2F7VA 2EEYA 1EKEA 3OYDA 4ZHRA 4CEOA 4CGHA 1Y5NB 1DTTB 3G25A 1Q9XA 3DRYA 1K47A 3VF2A 1WHXA 2UXDF 4JYAF 1VQ4N 2IRUA 4IQMA 1ZM9A 1QQOA 4DR5J 4M7YA 3L2WA 5HK4A 4G1IA 3VA0A 3K0SA 4XH1A 2BQ3A 2J7KA 5AQPA 2VPZB 1Y0HA 3IBWA 3BGOP 1BCOA 4PWWA 4DSKA 2J0SD 1LWEB 4A5BA 2DNYA 2C2NA 3DOKA 5ETMA 3DLEB 4M5JA 1CPZA 1C0FA 3E9OA 4DS5A 3J7YP 4RWWA 2AP1A 1X1PA 1MWYA 3PLAA 3M4XA 2BRKA 4JAXA 3UPFA 3VQAA 1T9WA 1EXQA 2KL8A 3PDNA 2N82B 4YNQA 2P5VA 3CM6A 1JL2A 2PBDA 2GELA 2X1GA 3OYMA 4NEYA 1AXQA 3CJ2A 3ZCMA 2GA7A 3QDKA 4B9NA 2E9RX 4USMA 3V1RA 4BRHA 3BQ1A 2YKMB 3NOCA 5H1SQ 1IJJA 1HJRA 2YH1A 1BUPA 3A5LC 2P9UA 1S1TB 4OX7A 4DV6F 1HYVA 5J2NB 3AA4A 1APSA 2MZRA 3LGMA 3P39A 4M3XA 1HBOB 2J0WA 1U1RA 5L38A 2DRDA 2XI2A 1TFWA 5JVGL 5LMNF 1WAJA 5KFHA 3ZSOA 2BBEA 4J91A 1R8CA 1TYQA 1M90T 5LMUJ 3JSYA 2VU5A 4K4SA 3AT1B 1XBWA 3LP2A 5J1EA 4BRFA 3OT9A 1ZYQA 1TUGB 2NRXA 2OHDA 3CERA 1DZ5A 4DV5F 4MIBA 4NLTA 2OCEA 4P52A 1AFIA 3FCHA 3LW5C 3NFAA 1YJVA 4FZXC 1H6KX 3FSXA 3VF0B 3ZZYA 2RQMA 4FWSA 2EFOA 3PHTA 3MR6A 4OI6A 4H5NA 2R7TA 2XG8A 3HSJA 5EN1A 2RDJA 4CF8A 2N4CA 2FJWA 3F5TA 3NGYA 2VQEJ 1FFWB 3VZHA 5F41A 4YP3A 2MQOA 3DHWC 4JI1J 4H03B 2CH5A 2HVEA 2XM3A 1TL3A 3M05A 3CC4N 5G0RB 1R89A 4JB8B 2GAHC 1PBAA 1AROP 2ZBRA 3W5YA 3PW4A 3KG1A 4CHZA 1KHVA 4P75A 3FRYA 3L4IA 3IFRA 1R31A 3W8PA 2BA9A 1YJNN 3D7EO 1BL3A 3QGIA 2R2RA 1C1BB 2ZHBA 5FDLA 2D3ZA 4B17A 3GV5B 2X1AA 4C1NI 4DFJA 1H3DA 2AHOB 3H0PA 1L3UA 3CB4A 4TYAA 1T95A 1ZTTA 4DPYA 3EM1A 1X4CA 4RG8A 3M1FA 4I0WA 3GR1A 4QOZB 4DV7J 4BRAA 4Q45A 3DXSX 4DSLA 4HCCA 9ATCB 2BKPA 1WSVA 1RTJA 2HHHJ 3BF4A 2FGCA 4IBNA 5KT6A 1N0UA 3V1OA 3KJVB 4W90B 4K4YA 5HAOA 2QG9B 3E9PA 3IRXB 4LF6F 4JI0J 4ZVRB 1V4SA 3FR0A 5GMKa 3MCAB 4BR4A 4OPHA 5HJYA 4F9OA 4M5NA 1VAZA 3PY8A 2C2DA 2RKIB 3RBEA 5B0BA 1KFDA 5I3QA 3MPWA 4U96A 2IAJA 4KIAA 4X4VA 1QAJA 4GKKK 2R8IA 3A3PB 1NGDA 2V8GA 2I0XA 2QWLA 1FRXA 4CGIA 1EKSA 3R2CJ 5IT9U 2I7PA 2OPRA 1KWMA 5EXWA 3OYNA 1RWVB 1FKOA 2P9EA 1REVA 4P2SA 4CBUA 1RK8A 2HBZB 3GU0A 4KHPF 4BE2A 3IS9A 3C14A 2AWZA 4RWXA 5KFTA 2Q0UA 2V8VA 4OHZA 2D0BA 2VQFJ 3IWNC 3P6YC 4ELUA 5GAHU 5MLCQ 4FJGA 2MHEA 4J2BA 2E2QA 1ZA1B 4DLEA 4OZ5A 3F2KA 1IUJA 3PX4A 3J80O 2DT9A 4N77A 2XMUA 2G0JA 2ZFHA 3V9UA 1N6QB 2PD1A 4JUZA 4QS8A 1YBAA 3GYXB 4CO4A 3UWTA 3LP1B 4JKEA 1ZS6A 3CJ7A 3CD0A 3CCMN 5A2QU 1S1VA 3VAGA 4FYWB 3QEVA 3UD5A 4BE1A 3CT9A 4OI4A 2XHWA 3RUBL 5GAEU 2W4CA 2Y8YA 4L72B 3N4QA 3EE9A 4XH4A 4DR1J 1N5YB 3ZSXA 3C6TB 3ZNJ1 5KG0A 4CZKA 4EMDA 4DU1A 5CD4A 4CGDA 1T05B 3L7OA 1JLFA 3VEYA 3LGNA 2HQCA 3EUNA 3H1VX 1P6TA 5ADZA 2QMXA 1S1WB 3QJJA 3NGKA 3BGFA 5KT7A 1BA1A 4ID1A 4JI2J 3QICA 2O4IA 1CJTA 2HNYB 3MCPA 4M3ZA 1K1SA 2F8MA 4QPTA 1MSWD 3OYHA 2PMZD 3J80Y 2LXUA 2V2ZA 2EC0A 4ECVA 3CDBA 4DV5J 3HVTA 1S0MA 3SSSA 2B43A 2E44A 4ECUA 4PAAA 4JHDB 3VGVA 4DCPB 2NR0A 1NGCA 3V4IB 2CNOB 1HNIB 2R42A 3BGLA 5D6GA 4DR3K 2A1RA 3GPAA 1ZBIA 4M5DA 5GADI 3TAMA 2P1JA 3OFHA 4CJFA 4DCHA 3KYLA 2OTJS 2WB1D 2BE2B 3K59A 1NZ8A 1KD1O 3LALA 1BWEA 5L1KA 2CDRB 2VIHA 4ID8A 3CXCM 4KFBA 3RBDA 2MLXA 1YT3A 3E8OA 4WU3A 2AF6A 1P9QC 2F4FA 2FY8A 4B9TA 2PAVA 2RF2A 4W4MA 3BUZB 1GMWA 2WVEA 2OD4A 4JI7K 4LR9A 3NRBA 1U2VB 2AV5A 1SI9A 3SQGB 3KHLA 1JB0C 5CD4H 3BY5A 2C3UA 3AVIA 3O4WA 4HT7A 1N36F 1W97L 1BG3A 2MQPA 1SH0A 3G0ZA 4CJLA 4PXEA 2WBMA 2NQPA 1XIQA 4OZ0A 1VSKA 3M8RA 2IVOA 4B1VA 5DQIA 2GNKA 4Y3CA 1T03B 2X74A 2BDPA 1WG4A 4FVCA 1WKKA 2ALYB 3DC2A 2Y1RI 2EX3A 3NE6A 4RBUA 5B0GA 4JI8J 3AVLA 1S59A 4YEAA 1JXLA 4ZPCA 2UZAA 2B9XA 2YH0A 4KHMA 2RRAA 2L9NA 5KFKA 4LD0A 1S10A 3N4PA 1TV6B 5C25B 2ZH6A 3NVMA 3M2UA 4M5KA 1OMSA 3AFGA 2GW8A 1S1UB 2UXDJ 4RNHA 2Z1IA 4JI6J 1U8WA 5IT0A 4G6VB 4JKGB 1A5WA 3W64A 1VSFA 4KGMA 3AB2B 5HRNA 1RDUA 2E5JA 3MR5A 2BJ9A 5KI6A 2WONA 2UUCK 3M1VA 4PCQA 5B09A 2HRTA 1TTHB 1HX1A 2DNHA 3M32B 4JI2K 2ZH7A 3CCLS 4CI6A 3VVTA 1NSPA 4NRTA 4QJVA 3MGJA 1N34F 4FJ7A 4Q2MA 2H48B 3TNVA 4LF9J 2E6MA 3K5OA 4C3LA 3JQMA 2GO9A 4J9PA 1HPZB 4KV8A 5HL7Q 1Q81T 3KUHA 4M3WA 3ZTOA 3SBGA 3GFXA 8ATCB 3KWGA 5BPMA 1DKGD 1NZAA 4AHSA 3CGIA 5HLFA 2YVSA 1UCNA 2ZHOA 3GFZA 2XZWA 3O3LA 1T11A 1M0SA 4IOCL 3PJXA 4NLUA 4IFVA 4LJMA 4DHYA 1U6ZA 3K89A 3ULEA 5JXSA 4DI6A 4JI1F 3D2FA 3SQ4A 2HHUA 3H2VE 1N0VC 1NRKA 4FWMA 4WF9Q 3CMQA 3VQEA 2RJZA 2VHGA 5CYMB 4NLYA 1P1TA 3GIJA 2PGCA 2WK4A 3EXCX 2MQNA 4B8AB 3S9HA 1EX4A 4O23A 1CLQA 4NLDA 2AJ1A 4NCBA 3I82A 4PG8A 1XUPO 3UCZP 3FCWA 3HULA 2RRNA 2UXCK 2W4DA 4MO4A 3RWUA 3ZT3A 2KT2A 2QK9A 2HFOA 1R8PA 2QWOA 3JSMB 1QUPA 3TANA 1IBKJ 4JKAA 4P73A 3MUMP 2EFPA 4M3TA 2ZJPQ 1NMDA 5FPNA 1B0VA 4C2MA 4XAKA 4JBCA 2B6AB 1U8SA 2UYTA 3ENQA 1NU4A 4PQUB 2BJDA 4FWKA 1HNVA 4BRKA 5ETLA 4Y65A 3OY9A 5GMEA 4QWAA 4HLBA 3QIPA 3D6FB 5DGAA 3MECA 2LXFA 1JXVA 5BYRA 3CCLN 5AQYA 1YHQS 4R79A 2AA4A 3I55N 4QU6A 5HROA 4X4TA 3ZEUB 3VR1A 4IO9L 1F9FA 1RTIA 3SBTA 1U6BA 2YKQA 3JQKA 3H5UA 2ZD1B 2LEPA 4HTIA 2HQIA 2N4DA 2VG7B 3RSEB 3CJKA 3RMCA 1LEOA 1B4SA 1RTDA 2HSTA 4JD2A 5F0UA 7FDRA 4O44B 3DHXA 4DQRA 4O55A 3C8YA 4ZTFA 3EKSA 5B08A 1YIJS 2J9CA 2XYHB 3UNYA 1KLMA 1YJ9S 5FRMA 3PSIA 2B9YA 4IDKA 2AZ1A 5AJ3J 5J2MB 2ZDOA 3C94A 3OS2A 1X4AA 1WTBA 5I3UB 2Y1IA 1GQEA 3R2DJ 1IVZA 2IVFB 4MKVA 2HLUA 4DTSA 3CMEN 1ZOTA 4JRPA 2MKYA 3HL8A 4TLRA 1DGKN 2IY5B 3P31A 1GK8A 3WXLA 4CEAA 1LWFA 3V9XA 2BE7D 5I3PA 3BZKA 2CPDA 4DSJA 4M3RA 3VAMA 4ES2A 4BVOA 4KQZA 2C22A 1S1UA 1IKWA 2EKYA 1R0CB 3BH7B 4Y1DA 1YJWS 3T9NA 2WSEC 2H54B 4KB1A 1IWGA 4B9SA 4CM2A 1WD6A 3GWCA 4TSXA 2QKKA 1NU0A 4NYPA 5LXYA 3M30A 2DGOA 3AOAA 4OKEA 1OQ6A 1LWFB 3KKRA 3TZZA 1U24A 3GSIA 2O8FA 1NUEA 3M9OB 4NA2A 4PHTX 3ETMA 4V19X 4MLEA 2G8VA 1IBCB 3OW2R 2JOQA 1NB7A 3P96A 2EWHA 3G82B 4Z2XA 1NPPA 2FSKA 1X0FA 3CCZA 1JWWA 4LR8A 4ED8A 2R8JA 3BEXA 1RT4B 3HVAA 2R4FA 2AEFA 3NS7B 1XNQJ 1VGYA 1DTTA 2KKHA 2V51B 1HBNB 5BR8F 2K1RA 5KFMA 3RBZA 4U95A 4TU9A 2BJEA 3CFRA 4E3SA 1DEJA 5IWAK 3T41A 3P4UB 5C7PA 2GX9A 3AQOA 3ZX2A 3UQSA 3QFPA 2DY4A 3NMAA 2E29A 3LH2S 4ISGA 1W25A 3VGTA 4H0PA 1WSHA 2F4VF 2MLYA 2HNDB 3VPZA 4FWRA 5AQUA 1EHWA 4B3RK 2V8DA 3M8WA 1UVMA 2FJXA 3FKBA 3L3VA 3TZXA 4WK1A 2V2QA 2Z1GA 2HFVA 5DMRA 4KSEB 4DR4F 5M1NA 1AUSL 4GV9A 1RT7A 2OSQA 3L9ZA 2MTLA 3M6VA 3EX7B 4E19A 4LFCJ 2XGQA 3J7Z5 3M2RA 5T7BA 1RTZA 3CCUS 4DL5A 4DUZF 1AYEA 3UKUB 2RE1A 2XHCA 1TL7B