2OPPA

Crystal structure of hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
542
structure length
518
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 136
structure length 518
sequence length 542
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2oppA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oppA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oppA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oppA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2oppA05
1T05A 3MF5A 2GUIA 2RF2B 1C1BA 3FQKA 2W42A 2BE2A 1KLMA 3KK3A 2RPIA 4F50A 4F2RA 3ZSRA 4EP5A 3NFAA 4Q0BA 5J1EA 3VQAA 3WNFA 5CZ2A 1K1QA 4O4GA 2KZZA 5J2NB 2IBKA 4KB7A 3OYFA 1RT1B 4J9PA 3M9NB 4IDKA 3LANA 4O3RA 3SCXA 1RT5A 2RKIB 2XRIA 3DOLB 2G8UA 3PW2A 2RDIA 4DQSA 3AVMA 3KKSA 4O0JA 4Z4IA 2E6MA 5KFVA 4ZPBA 3IRXA 4CJLA 5KGWA 4WYLA 4OKJA 4BDZA 3MR6A 2IM2A 3P1GA 5KT2A 2B43A 2WB4A 3KK3B 3PHEA 4CEZA 2JC0A 1JXEA 3S9HA 4WFYA 4TN2A 4AHVA 4W5RA 5SWMA 4PY5A 1L3SA 3CWJA 4KSEB 3QIPA 4FLWA 2HMIB 1EETB 4K4UA 3THVA 2KQ2A 4B08A 1HNVA 3HT3A 5T7BA 3BSAA 5HP1B 1BL3A 4M45A 4IG3B 3DOKA 1JLBB 4J9OA 2B6AA 2X6SA 4CJ4A 2WONB 2IMWP 1SH3A 3V81B 1WN7A 4W5QA 3IRXB 3E01B 4PWDB 4CJ5A 4OLBA 4JV1A 3K2PA 1TGOA 3Q8RB 2ETJA 3KK2B 1HNIB 4F4WA 1TVRA 1L5UA 4Z4HA 3SJJA 3CJ0A 2BDPA 4CFAA 5K14A 4MIAA 4DTPA 4DQRA 1ASVA 3MTKA 4WE1B 5KFQA 1IKVA 3H5XA 3GV8B 1Q9YA 3U6FA 3SQ1A 1MU2A 3V6KA 1RYRA 4CJ3A 4ECRA 2IGIA 1TKTB 2X6NA 3FFIB 4NLYA 3T3FA 3MXMA 4QWBA 3G6YA 3MEGB 3OHBA 1U48A 3D0PA 1ITGA 4QW8A 4NCGB 2KTQA 3G0ZA 4LH5A 1WAFA 2XCAA 3L2WA 3UQSA 3D5MA 3QGGA 4H8KA 1KSPA 3VQSA 2NUBA 4CEAA 4EO6A 4ECZA 4GVMA 2W9BA 1VSMA 4OGCA 4RNOA 1KFSA 1LAWA 2R8GA 5F8HA 3EYZA 4IH5A 3MECA 5F8NA 4ELUA 1C1AA 4KHUA 4MFBA 1S5JA 3IAYA 3IG1A 2XGQA 3HKWA 1ZBFA 1KLMB 3K58A 4FW2A 4CGHA 2XY5A 2P51A 3NGZA 4H54A 4ZMMA 3QIPB 2VG5A 5HROA 1ZETA 3EZUA 3O4QA 1S6QB 1TV6A 3EZ5A 3HPHA 2WK4A 3V9ZA 3SV4A 5DG9A 3V1OA 3HO1A 1RT3B 3C6TB 4OL8A 2JEIA 2YNHB 5EUHA 3ZSWA 2ATQA 3NL0A 1NOYA 3LALA 1LW2A 3HHKA 5EU7A 3LP2B 5DQIA 4Q8EA 2W9CA 3VQ8A 1HYZA 4FJ5A 3BR9A 4M42A 1LWFA 2ALZA 3NBPA 3NGDA 3OY9A 4Q44A 1QAJA 1D0EA 2B4JA 3QO9B 2VWKA 4DS5A 2IOCA 3DYAA 4EBEA 4OKKA 3TQ1A 3I5AA 3SFUA 5J1EB 4OVLA 1D8YA 3AA3A 1BI4B 1VSLA 2IDOA 3PY8A 3DM2B 1NKBA 4KTWA 1QSYA 5KT3A 4WZMA 4BE0A 1KLNA 1JLCA 4XPCA 3RR7A 3JSMA 4E7HA 1N6QA 3IN5A 3V9UA 4R8UA 3V6DA 1QQCA 3NH0A 3JYTA 4Y3CA 4EBDA 3K5OA 4KE5A 3TARA 3V1RA 4RUCA 4DMNA 3V6JA 3O3GA 2KW4A 4AHCA 3HVAA 3UR0A 3PR4A 4K4WA 2FVQA 3NCIA 1SUQB 4FK4A 4I7FB 2FVPA 3RRHA 3VQPA 4E0DA 4KB1A 4DFJA 5I3UB 2FJVA 2LSNA 4AILC 1SH2A 3SPYA 5C42B 4O3QA 3OYAA 3ZT0A 2VG7A 4O5BA 3VQ4A 1RTJB 2FLLA 2PYJA 1JLFA 1BIUA 4QW9A 3Q8QB 4C8KA 4RW7B 1WSEA 1ZBIA 3ZT3A 3WNEA 4DTNA 2OPQB 3OJSA 4CCHA 5E41A 3H5YA 1RT6B 4OJRA 4KKOA 3AVJA 4NLPA 3WNHA 1RTJA 1NK0A 3SQ4A 2B5JB 3H5UA 3ZT2A 1KVCA 3HL8A 1S1UB 1NJWA 4TY9A 2E6LA 2UVUA 4W5TA 3DI6B 4FLUA 2OPPB 2YNHA 1JLFB 3GQCA 2HWIA 3OYBA 3KLEB 3UDLA 2A1RA 4B9UA 2RF2A 3V6DB 1MMLA 2YKMB 3BREA 4I2QA 2YNGB 1RTHB 5HLFB 1SL2A 4CHZA 3C95A 4WZQA 4FXDA 4KHWA 4OGEA 3E01A 1BIZA 2ZD1A 4Z4GA 1NNDA 1RBRA 3IS9A 4FLXA 3BJYA 3QINA 4O3NA 1R0AB 3TVKA 3PX0A 5F8LA 3I0SA 3VQDA 4CHOA 4URQU 2R8KA 1HQUB 4LD0A 4FW1A 3DRPB 3KK1A 5CZ1A 3DOLA 4E7LA 3HP9A 4CJEA 3JSMB 1I39A 4ED7A 1REVB 1CLQA 1REVA 2FLNA 1S9EA 1RTIA 1QS4A 3MXIA 2ASDA 3T19A 3OLAA 4K4XA 2J6UA 1JLQA 1W0HA 5KFUA 3CDUA 4AHRA 3MEGA 1W9HA 3BDPA 3OSPA 4RNMA 4Q8FA 3DYAB 3EPIA 2VA2A 4HYKA 3DMJA 4TXSA 3AVIA 2HNDB 1RA7A 4DF8A 3K57A 1LV5A 3AVCA 3VQBA 3V4IA 1QSSA 5KFFA 1TP7A 1CXQA 4ZP8A 2I5JB 4NLVA 2XY8A 2CJQA 4IFYA 3ITHA 2WHOA 2FJWA 4GC7A 3KLIB 2WRMA 3OL9A 4Q0BB 1BISA 2D3ZA 1NK8A 4IRDA 2OA8A 4LSNA 4K4TA 4FJIA 3DRRA 1N48A 4HHTA 3OYIA 5EDWA 3TAPA 2I1RA 4DTRA 4J2DA 1VRTB 1GOCA 2BQRA 3HK2A 2HVIA 4NYFA 1TQLA 3Q8PB 2D5RA 3QETA 4M41A 4FJHA 2HW3A 4J2EA 3TR8A 3H4DA 4CEEA 4CFCA 1UOCA 1RT2B 3NE6A 4KREA 4AHTA 1BQNB 4ICLA 3TAEA 2PYLA 1JL1A 4CESA 3PX4A 1FXXA 4H4OA 4L8RB 2RKIA 3S3NA 1S49A 4F4ZA 1LAVA 2FVCA 3KIOA 3QERA 1TK8A 1EXQA 4CJPA 4NYZA 3VA3A 3TABA 2HWHA 4NCBA 4OLAA 1XC9A 4DL4A 2QV6A 3M8PB 4J9QA 2YNFA 1Z26A 4RW4A 2UUWA 1RNHA 1S4FA 4I9QA 3A2FA 4JUZA 5D3GB 1YTUA 4IKAA 3PW0A 1VSFA 1TVRB 2WOMA 4Y1DA 4JLHA 1NHVA 1SV5B 4HTUA 1FKPB 1I3AA 3HVTB 3QEIA 3I0SB 2DFFA 3U3GA 4X2BA 1SH0A 3DM2A 2R2UA 2AGPA 4LSNB 3M8PA 2F96A 4KAZA 4NLSA 1DTTA 4EYHB 4CK2A 4F3TA 4ECVA 3VQQA 4TYAA 4CJTA 4CE9A 3D28A 3HVTA 4B9LA 3NF7A 2I5JA 4FM1A 5HROB 2HHVA 2P5OA 2EX3A 4CEBA 4JRQA 4DQIA 4IFVA 3LP1B 4DQPA 5KFXA 4NLDA 1JIHA 3H98A 2HHSA 3LP2A 1TL3A 2XI3A 2C2RA 3KKRA 1DTQB 3MR5A 5J2QA 4CJQA 2Y1IA 1GX6A 4U6PA 3NF8A 4FJKA 1T8EA 1RDCA 2B5JA 2IC3B 3T1AA 1S9EB 3TI0A 1NK9A 3LP1A 4CERA 4KHRA 1VRUB 3DLRA 4M3TA 4Z4EA 4CK3A 4M3WA 3PR5B 4QWDA 1IH7A 4R5PB 3KLGA 4CGGA 3QEVA 3FFIA 3T5HA 1LW2B 2P5GA 3BSNA 2C22A 4Z4CA 4DFKA 3H08A 2HNZA 2IS3A 3DLGA 2DPJA 2DFHA 3QZ8A 4R8UB 2G8HA 1RDBA 5KFNA 5I42B 4HVJA 3HVWA 1IKXA 4E89A 2Y1JA 4C8OA 1UA0A 4FBTA 3HJFA 1N6QB 2JEGA 1VRTA 3QNNA 3CFRA 2BRLA 4CGIA 3AA5X 5FROA 1NJZA 5KFZA 5DG7A 1B92A 4IH6A 3MXJA 1ASUA 4Q5VA 3MFHA 5HP1A 3I5CA 1IG9A 1GOBA 3G6XA 2XY6A 3N6NA 1TKXB 3LAMA 4BDYA 1RA6A 3ZSVA 1YTAA 1LWEA 3PO4A 1JXBA 3RRGA 3ZCMA 3LDSA 4IFYB 4TQRA 2YNIB 4WFXA 4IBNA 5KFYA 2Q3SA 3CM6A 3G86A 4DG1B 2V9WA 1BCMA 4FJ7A 3AO2A 4BE1A 3RAQA 3IS9B 4ZTFA 4RW6B 3S3OA 2EHGA 1NJYA 3PW7A 4RZRA 1RT3A 3ISNC 1CXUA 1XHZA 3OYCA 3LZIA 3NBPB 1YVFA 2W7PA 2J6SA 3QZ7A 4I9LA 1S1XA 4B8CA 3M9MB 4KPYA 4ECQA 4ZVGA 4IH7A 1LWEB 2ZKUA 5CYQB 1OS5A 3GV5B 3UPFA 4FZXC 4FK2A 3KK2A 1LW0A 1QUVA 2ZE2A 3HXMA 3HVRA 1F21A 5F9NA 4PUOA 5C24B 4DQQA 4NRUA 4YNQA 4FJLA 1RCHA 1SL1A 3MECB 4FVMA 2AU0A 1FKOB 2HNYB 4NLQA 2D3UA 3DLHA 2R7YA 4DTSA 4O44A 2C2DA 1VRUA 1JXLA 1RTHA 3SNNA 2IJFA 2PY5A 1BQMA 4JV2A 1S0OA 3T5LA 4YFUA 2HVHA 5JS2A 1K6YA 2F8TA 3H40A 4DFPA 5CYMA 5L1KA 5KT5A 2R2RA 3KTQA 3SI6A 3RB3A 1RAJA 3L3UA 2GV9A 4CIFA 4MKBA 4EEYA 1S10A 4FJGA 3VQ6A 1JLEB 1ZYQA 4ZP9A 3I0RB 3CG7A 4WE1A 5KG5A 3QIDA 2OYQA 1IKWB 3C6UB 4CF8A 2OZMA 1DLOA 4RG8A 1L3UA 5KFIA 4KB0A 5KT6A 2YKNB 3I5BA 4Z4FA 1Z4UA 3F73A 4DSLA 3CVKA 4EO8A 4DF4A 3CFPA 2E9RX 4B3OB 4O55A 4K4SA 1RT4A 4RW7A 1KVAA 4Z0UA 1TV6B 1JLGA 3E51A 3O3FA 2BANA 4IRKA 2IM3A 4ED3A 3D45A 2UVWA 4O44B 2HMIA 4HKQA 2FVRA 4U7CA 5KFWA 3ZSXA 3SYZA 3L3VA 4XIUA 2X78A 4LH4A 4FS1A 3NF6A 1RDDA 3CFOA 2AJQA 5F8IA 2HHXA 4ZPCA 2R8JA 3AVGA 5EWGA 1EETA 4NLGA 1S6PA 3N6MA 4F4KA 4ECUA 3ZSZA 2FVSA 3QO9A 3TAQA 4N41A 4CEDA 3NF9A 4OKEA 3DLKB 1U09A 1G15A 1S1VB 3AVAA 3EPGA 1VSHA 1S1VA 1HJRA 3H4BA 4DS4A 2HNDA 4MQ3A 3LZJA 3DRSB 2BR0A 4WFZA 2YNFB 1HYSA 4CHYA 3ZSYA 4DTOA 4LY7A 2IM1A 3TAFA 3AO3A 4CIGA 2JGUA 1IKVB 1J5OB 1S6QA 2HHWA 3OYGA 1N5YB 4MH8A 4FM2A 4ZHRB 3K5LA 3AA4A 2FC0A 3DRPA 3KK1B 1HQEA 3GIMA 4CJSA 1VSDA 1FKOA 2HNYA 4CFBA 1RT7B 4RW8B 2R2SA 2WONA 1WSHA 3IG1B 4ZP7A 4B9NA 1JX4A 1RT4B 3DLGB 2ZD1B 3NAIA 3GYNA 4F8RA 4M3RA 3QLHB 2AQ4A 1S9FA 4CGJA 1NK6A 1VSJA 4CGDA 3DLEA 4ELVA 3KLGB 1A5XA 1S1WB 5FDLA 3V9XA 1T05B 3AV9A 1HQEB 2WOMB 3V9SA 3HPGA 3HYFA 5DG8A 4CJWA 1WNSA 4J2BA 3SUOA 4QOZB 4QCLA 1LWCA 3TWHA 2D7SA 3TAMA 1J9AA 4MFBB 5EWEA 4MIBA 3KMQA 5L1IA 3M8QA 3OYDA 1RYSA 2W9AA 2E4LA 3LPUA 4ID5B 3ZSQA 4ECSA 5DGAA 1TL3B 1BQMB 5HBMB 1N5YA 3QNOA 1NHUA 5KGXA 2JEJA 2GBZA 2ASLA 5HRNA 3DLKA 4CIEA 3LP0A 4LQ3A 4DU1A 1R0AA 1S0NA 2FLPA 3MAQA 3V81A 1DTQA 4IG0B 1TKTA 4Y34A 4FJ9A 1LWCB 4KRFA 4WXOA 2DTUA 4GMJB 4DL7A 2C2EA 2XC9A 3ALYA 4CGFA 4FZYA 4NLRA 2D0CA 3P83D 4M3UA 4OPKA 2WCXA 5K14B 4JS4A 4DL2A 4NLWA 3QEWA 1RTDA 1SV5A 2R2TA 1BGXT 4E1NA 2YKMA 4WYWA 3L2RA 1S6PB 2HHUA 3O4NA 1ASWA 4CJUA 1A5WA 5KFDA 2G8VA 1NOZA 4DTMA 4CHNA 2XO7A 2E9TA 4AHUA 2QXFA 1JLGB 4HUEA 4RW4B 4RW6A 3S3MA 1JLBA 3HP6A 1D9DA 1C0MA 4E7KA 1S48A 2XGPA 1KHVA 2HHTA 3BGRB 1U45A 2XHBA 1FK9B 4DG1A 2A1SA 4NYNA 1ZTWA 1RBSA 3QEPA 1IKXB 1VSEA 5CY4A 3RWUA 3KLVA 3PX6A 1ZBHA 1TL1A 3I0RA 4R0EA 4RW9B 4O4GB 3SI8A 3NKYA 4DSJA 4M3XA 4TYBA 4G3IA 3T5KA 4CEFA 2UVVA 1Y97A 3DRSA 2G8FA 4NLTA 2KFZA 4J2AA 4CF0A 4FJ8A 1IKYA 1C0UA 1T94A 4LSLA 3PUFA 4N76A 4F4XA 1LWFB 5DQGA 4DL5A 3PW5A 2QE5A 3QGHA 3AA2A 3CJ2A 4RU9A 2YNIA 2R8IA 4I7FA 1TKZA 3PVXA 3MR2A 1EKEA 4IDKB 5F8GA 3G6VA 1KHWA 5HRPA 2V4QA 1XWLA 2W8LA 2DPIA 2AWZA 4FYDA 2B6AB 1BHLA 2O4GA 2IJNA 4E1MA 3KLFB 5C5JA 1QTMA 4DLEA 4KHSA 1FKPA 3V9WA 4DU4A 3H5SA 1IO2A 3GIJA 2VG6B 3OJUA 3RMAA 4ZHRA 1JKHB 5JXSA 4C8NA 4NRTA 5J2MA 5JUMA 4FLZA 3OSNA 5KFRA 2ITGA 4DWIA 4FJMA 2KFNA 3SZ2A 3V4IB 1DTTB 4EP4A 5T14A 3KNAA 4ECYA 5J2QB 1C1CA 4E7JA 3KD1E 4F4YA 1CSJA 2YV0X 1DLOB 1IKWA 3C6UA 3KLHA 4CEOA 5KFGA 1W25A 4NZ0A 5HBMA 5L1JA 4FJXA 3AO4A 2J6TA 5KFTA 1C1CB 1TK5A 2R8HA 3PZPA 5CYMB 3M8RA 5KRSA 4CJVA 2C28A 2OPRB 5C25B 2HB5A 3WNGA 4F3OA 3M9OB 1ZBLA 1NK5A 1UWBA 3NGYA 1TAQA 2HHQA 1VSIA 4DTUA 4O3SA 3NH2A 1ZBUA 2W9CB 3KLHB 2BQUA 2FBYA 3N6LA 4CJFA 2IAJA 1S9GB 1UAXA 3CQ8A 3IGVA 3RB0A 2VA3A 2ZE2B 3RMCA 3C6TA 1RBVA 5KG0A 3CYMA 2G8IA 3QEXA 3OS1A 2Z1GA 4DFMA 1RILA 3SQ0A 4KFBA 4RW8A 4YQWA 4DTJA 5KFBA 1EP4A 4NLXA 2OPSA 3RMDA 3KHLA 4J9KA 1L3VA 1XR7A 3OL6A 4TY8B 1NJXA 2HNZB 1JL2A 4YMEA 4EBCA 2IC3A 3CDEA 3LPTA 1RT2A 3LWLA 3DLBA 3OYHA 5KI6A 2XCPA 2YHAA 1GOAA 5FRNA 2Z1IA 3ASMA 5KFEA 3AVLA 3QESA 4JV0A 3OHAA 5KFKA 3CJ5A 2GC8A 4M3YA 3RMBA 3LAKA 1J54A 3SUQA 4I2PA 4G1QA 1HMVB 1KCFA 4BDPA 3RAXA 2BQ3A 1EP4B 1HNIA 3LP3A 5DGBA 1SKSA 4K4VA 1S1TA 4ECXA 3DRRB 1RDAA 3SQ2A 2V4RA 4DTXA 4XO0A 1X9SA 5F9LA 4ZVHA 3KMSA 3HM9A 1WSIA 4DU3A 4Y1CA 1QAIA 1NK4A 2W7OA 4CJKA 4EZ9A 4URGA 5I3UA 5L1LA 4I2QB 5HLFA 3ITHB 2OH2A 4DSIA 4KO0B 3TANA 1S0MA 2AGQA 4RUAA 3AVFA 4ID1A 4CF2A 3DDKA 3UIQA 2IAJB 2OPRA 4CF1A 4J9MA 3L2QA 4NLUA 2O5DA 2FBVA 5DQHA 4J9NA 1T7PA 4TLRA 1VK0A 2XI2A 5D3GA 1HRHA 4C8LA 3K5NA 4WXWA 1HQUA 3H59A 5KG1A 1QE1B 4ZP6A 1HYSB 2OPPA 3I8DA 2P1JA 1QSLA 3Q8SB 1C6VA 1HPZB 2RDJA 1S1UA 4FLTA 3PJXA 1JLQB 5KRTA 5KFHA 3PV8A 5KFSA 3RTVA 4G1QB 4AH9A 2JLEA 2YNGA 5KFMA 5FDLB 2VG5B 2AX0A 2QK9A 1YT3A 3M8QB 3SUNA 4PWDA 4B9SA 3G10A 4QAGA 3CM5A 1D1UA 2UVRA 3GIKA 4BWMA 3DOKB 4IR1A 4TY8A 5J2MB 1X9MA 4PQUB 1C0TA 4PA1A 5CYQA 3MFIA 1D5AA 1WSGA 3PJWA 3O3HA 1TAUA 2QKKA 2AX1A 1RBTA 3QIOA 4M95A 4MK7A 1A5VA 3KLEA 4O4RA 5L9XA 4H4MB 4IKFA 4QWCA 2W9BB 3RB4A 1MU2B 1S1TB 4KAIA 1QE1A 3QYYA 4DSFA 4DL6A 4E7IA 5KFOA 2OPSB 3OS2A 4B9TA 2O4IA 4Q45A 2KZMA 4FJNA 4CEQA 1RDRA 5C25A 1BI4A 3B6OA 1BCOA 5KT7A 4ECWA 4RNFA 1B9DA 4CFDA 4JRPA 3HPOA 3JYTB 1C2PA 3C94A 3L8BA 4GC6A 3ZSOA 4FBUA 4C8MA 3L2VA 2G8KA 3OYJA 3CJ3A 1NKEA 4B9MA 4ED1A 3KOAA 3GILA 3KLFA 3AVKA 4KHMA 2X74A 3VQCA 3VQ7A 1WLJA 5KG2A 4TQSA 1WSJA 1J53A 4IG0A 1XR6A 3MEEA 2PZSA 2YKNA 4FK0A 5KG7A 2E9ZA 4E3SA 4MK8A 3CO9A 4KV8A 4MKAA 4H4OB 4NCGA 2IM0A 1JLEA 4CF9A 2BANB 4ICLB 4GW6A 5DLFA 3SUPA 3FSIA 2UUTA 5J2PB 3OYMA 3PW4A 1KVBA 5J2PA 5DLGA 3AVNA 4TSXA 4N5SA 3TAMB 1S97A 2D0AA 5HRRA 4JS5A 1TK0A 3OYKA 4DLGA 3NH1A 4J9RA 3K5MA 4YR3A 3SV3A 2VG6A 3KHGA 5KFPA 2XWYA 4KI6A 1S1WA 1HARA 1T3NA 1WAJA 4CJRA 2WTFA 5KTQA 3K59A 4H4MA 3AO1A 3VQ9A 4HUFA 3HSTB 4KI4A 3SPZA 4NLOA 1S9GA 1RTDB 1TKZB 3ICLA 1WNEA 1CZBA 1Q9XA 3RBEA 4DSEA 4K4YA 4BWJA 3MR3A 4RNHA 4F2SA 4K50A 4N56A 4KTZA 1TKDA 5EWFA 4B3OA 1U47A 2ILZA 4W5NA 4DEZA 3TAGA 4FS2A 1JLAB 1X1PA 3RBDA 5JS1A 2VWJA 3V1QA 3BQ0A 4ED2A 1Q8IA 1NK7A 3KLIA 1B9FA 1HMVA 1T03A 4I2PB 1RTIB 3NHGA 4K8XA 1KFDA 1K1SA 1X9WA 2F8EX 3F9KA 1RT1A 1L3TA 2FJXA 3ZT1A 4IQXA 2CKWA 5F8MA 1KRPA 1JLAA 5KFAA 3V6HA 2YHBA 3QGIA 3BSCA 3VQEA 3OVNA 4ZPAA 3VN5A 2ZQBA 3H2LA 1I6JA 4N47A 2FBTA 1HNVB 2AGOA 1U49A 1O1WA 4RNNA 5KFLA 3BQ2A 4KV8B 3MEDB 2XY7A 1T03B 4NCAA 3RB6A 3M8SA 4M94A 3QLHA 3LWMA 3AO5A 3OL7A 4ED6A 4PUOB 2GIQA 1VSKA 4KTQA 4B9VA 4IG3A 1RT7A 2DFEA 3P5JA 2V0NA 3SFGA 1D9FA 3LP0B 3OL8A 4W5OA 1JKHA 2F8SA 1C1BB 1KTQA 4FLYA 4KO0A 3ULDA 1IM4A 1QHTA 3NAEA 4ZPDA 3NDKA 1U4BA 1GX5A 3KD5E 4BACA 4O3PA 4URSA 2BRKA 4CECA 4LSLB 5KG3A 1SKRA 2D0BA 1RBUA 3DMJB 2JEFA 1HPZA 3BSOA 4MK9A 1U04A 3ISND 3IGNA 3DI6A 4KBIA 1SL0A 3L2UA 5DMRA 3OYLA 4ZTJA 2QKBA 4IFVB 4ED0A 2VG7B 1YVUA 5FRMA 3KHHA 1Z25A 4FZZA 1IKYB 1C0UB 2D41A 3B6PA 1BQNA 2ASJA 1J5OA 3AVHA 5J2NA 1FK9A 3GIIA 3ZT4A 2OPQA 2GIRA 3PO5A 3KJVA 3NAHA 4M3ZA 4FLVA 5C24A 4AHSA 4ZVEA 4YP3A 4QWAA 1TL1B 4DL3A 3EY1A 4ELTA 3T5JA 5C42A 4YR2A 3RR8A 3BGRA 3AVBA 1JLCB 5I42A 1S1XB 4EYIB 4OPJA 2BGGA 1N4LA 3DLEB 3CIZA 4HCCA 2EC0A 4HCBA 1XHXA 4E19A 4ECTA 4CHQA 4YR0A 4BE2A 5KFCA 1N56A 3FRZA 1LW0B 2DY4A 4UQGA 4B8AB 3NGIA 3CJ4A 4CHPA 3VA0A 4IRCA 5DK5A 4J9LA 5F8JA 4HUGA 4IOBA 4Y2CA 5SZTA 2Z1HA 2ILYA 4KHNA 4QWEA 4K4ZA 4K8ZA 5KG6A 4ZVFA 2W8KA 1NKCA 1RT5B 3NMAA 1ZTTA 4IR9A 1UWBB 4KKOB 1RT6A 4ID5A 3OS0A 1CZ9A 5KFJA 3OYEA 1EX4A 1UA1A 4KHYA 3KJVB 2G8WA 2OZSA 4O3OA 5HRSA 3U3YA 3FDSA 4LQ9A 4RW9A 4CK1A 1XR5A 2RN2A 4FJJA 2BE2B 3OLBA 2JC1A 4EZ6A 4KHQA 2Z1JA 2IA6A 2FBXA 4QPXA 1C0TB 4PQUA 1WSFA 4Q43A 1HYVA 1TKXA 4ED8A 4FCYA 4O0IA 2HAIA 3VQ5A 1SUQA 4KFBB 4J9SA 3KHRA 5KG4A 3MEEB 4Y2AA 1XI1A 3CDWA 3OYNA 4XPEA 3GV7B 2ATLA 4DSKA 3BQ1A 3FQLA 1SKWA 4FM0A 5KT4A 3MEDA 4R5PA
chains in the Genus database with same CATH superfamily
2Y1RI 2EPIA 4MKYA 5EVZA 4N8NA 1E6YA 3OBIA 4BS2A 4JI8K 3T6BA 2WBNA 5C2GA 5DDRC 3HT0A 2MQNA 3CERA 4F50A 4M5DA 1GAOA 1WOOA 4F2RA 1JCGA 4F67A 3N4PA 4Q0BA 5J1EA 2UP1A 4JK8A 5J2NB 2IBKA 3OYFA 4F02A 3OBWA 5FPEA 4IDKA 3LANA 4PL7A 3I33A 3SCXA 4A8WA 5CE3A 2XRIA 2VGMA 3N9UC 3CCSN 4ZN3A 2RDIA 3AGRA 2DR6A 4YB1P 1F60B 1ACMB 3D68A 4PAAA 3RRKA 3QT6A 4I64A 1Y0HA 1U24A 1WD6A 1JXEA 1BHNA 3EVOA 4W5RA 4KH0B 5SWMA 1CQMA 4P72A 4FOEA 2DXFA 4E98A 2KQ2A 5T7BA 3BSAA 1BL3A 4OJ3A 1RE1B 3DOKA 2IDLA 3QWPA 2WB1D 4CJ4A 2WONB 1RFQA 2IMWP 4YDDB 1IQZA 2O8CA 3OT9A 4OLBA 4JV1A 4A2BA 1TGOA 3Q8RB 2ETJA 4PG8A 2RHKA 4JI4K 1ICEB 4WQ4A 4Z4HA 1H2UX 2RD5C 1IBMJ 4M5MA 1JK9B 2EWHA 2N3LA 2E5LF 4U67Q 2HHHF 5K14A 4MIAA 5E7OB 3K0SA 1RWKB 4DTPA 5GADI 2QWNA 5KFQA 1XK8A 1VQ4S 4LC9B 3SQ1A 2EFGA 1MU2A 1RYRA 2HBMA 1Y10A 1HNWK 1S22A 3MEGB 1U48A 2V8DA 2U1AA 2XZWA 4QW8A 2KTQA 2HBYB 3GB0A 2L48A 2LU2A 1SS6A 2CJ9A 2GQQA 2XCAA 4C4WA 2P9LB 2O3DA 2GO9A 1D8ZA 4UQTA 1H73A 4FYYB 3VAGA 4ILGB 4RNOA 5CXTA 2B4VA 2R8GA 4P7VA 2RIJA 5GAEI 5F8NA 2HK3A 4ELUA 1JNZB 3M8ZA 3IAYA 1UEVA 1D4XA 3KDOA 3PYFA 1KLMB 2XY5A 2O8EA 1QVGR 3MCSA 2P9NA 4X64F 3NGZA 3D67A 3O1WA 1VC0A 5A2QO 2HVEA 5EOYA 4EGLA 3OV7A 3AAWB 5CQGA 1O51A 4H0TB 2HHHJ 3IBWA 2WK4A 1VQMN 3SV4A 1XN9A 3HO1A 1RT3B 4YY3J 4I1TA 2MYFA 1NOYA 3LUYA 1YJWN 1VQ8N 3HHKA 5EU7A 5DQIA 1FJGK 2KH9A 2A6OA 2W9CA 3VQ8A 2HAFA 4FJ5A 1LWFA 4HLBA 2OSQA 4JI3F 4N77A 2ALZA 5ETSA 2EFOA 3A3PB 1UEUA 5DJBA 4Q44A 1QAJA 5B09A 4JD2B 3ZFVA 1FI4A 2R7XA 3TQ1A 5J1EB 4OVLA 3MCMA 4UW2A 3ZXWA 2KM8B 4AE5A 1D8YA 3THPA 3G96A 2IDOA 2WSFC 4OYAA 4BRPA 2RT3A 3CCMS 1QSYA 3MZIA 1JLCA 4XPCA 4U7UK 4R79A 3PLAA 4B3TK 4USUA 3R7SB 1UFLA 4JP8A 3K5OA 4I6MA 2FJEB 4KE5A 2R42A 4DMNA 2FSJA 4A8QA 2KW4A 2OEKA 3UR0A 1X3NA 3NCIA 1SUQB 3FRYA 4FK4A 3RRHA 4DFJA 2DISA 2CZVC 1ZAVA 3HHLB 1NLVA 2EKNA 1NZAA 2VG7A 2AEMA 4DR1F 3TU5A 4CTAA 3CCLS 4QW9A 1N8RO 1A6LA 1XQSC 2OEMA 1UVKA 4ZVOB 2JJ4D 1I94K 2X7IA 2CPZA 4OJRA 4KKOA 1RUSA 3ZNUA 3AVJA 3MM9A 4NLPA 1N52B 4OHVA 3SQ4A 3H2UB 1I94F 1F2HA 2B5JB 2MY7A 2MPUA 4NZ6A 1WWHA 2GGPA 3DI6B 2DVIA 2JWLA 4FLUA 3FCHA 2YNHA 2CJBA 3GQCA 3NVMA 3KLEB 1JJHA 5D4LA 1M1KT 5AQIA 1VOMA 1ZZFA 5AQMA 1J2VA 2FY1A 2J76E 4A8FA 1Y7PA 3W64A 3QICA 1KC8T 1S7HA 2KKZA 5HMWA 1GMWD 3VCDA 5IXUA 3E01A 1BIZA 5BPNA 3FCVA 1NNDA 1CG2A 2HBQB 2JSXA 3BJYA 1QHAA 3HSJA 9RUBA 2F9DA 3TVKA 4LF8J 2GW8A 1B7FA 1NGHA 1CJVA 1WDTA 2QMWA 3NNAA 3R9LA 3HP9A 4CJEA 3JSMB 5AFUA 1FD8A 4B3RJ 3WUHA 3FEZA 1QS4A 3PIOL 5KFUA 1ZBTA 4AHRA 3HKZD 4DPUA 2KXHA 3CIPA 3DNCA 2BZ2A 2HNDB 4TXSA 4DF8A 3K57A 3G8QA 3V4IA 4Q2MA 1FJEB 1TP7A 2ZEJA 1P6TA 2RHSB 2I5JB 4NLVA 2XY8A 1WC6A 2CJQA 4QYZJ 1IBKK 4X4VA 2HVZA 2GAGC 3QATA 2WHOA 1P8ZA 4ID8A 4GC7A 3O8MA 1VMBA 3OL9A 2RQMA 1CZAN 3TA0A 3H6EA 3ZZZA 4B3MF 2MZTA 2UXCF 2KG1A 1R8PA 3WXMB 3OYIA 1TYQB 1BWVA 3TAPA 2DNKA 1MROA 3KWGA 3FGUA 2HVIA 2CGLA 3CC7S 3A8KA 4NYFA 3GP9A 3SSSA 3R6LB 3Q8PB 3AY9A 2EI5A 2ACMA 4M41A 2HW3A 3RSEB 4J2EA 2QMXA 3TR8A 3G6ES 2NXUA 5GAHP 1T3OA 2LXIA 3HSDA 4AHTA 1VJQA 1XMQJ 4NI2B 1JL1A 4CESA 1N32K 4L8RB 4KHPF 4LF4J 1Q81O 1R31A 4YS2A 3MR7A 5IT9U 3QERA 2CQPA 2VQFF 4ZVUB 4X62F 1TK8A 3VA3A 4OI2A 4BR0A 2HWHA 4OLAA 4USKA 1U7LA 2QWRA 3C46A 3CXCM 4I9QA 3A2FA 5D3GB 1RZMA 1GLJO 1JJ4A 2AKWB 4DV0J 4LFCK 4KC5A 2WOMA 4JLHA 1FKPB 5LXYA 1NAQA 3QEIA 3C66A 3I0SB 4LFCF 5LL6d 4UT4A 3U3GA 4X2BA 5HL7Q 5AQQA 1I1GA 4WBFA 5D77A 1DTTA 2DNHA 1SC3B 2V9KA 1FW6A 2YX6A 2V8GA 5F3ZA 1YBTA 1VBYA 4CE9A 4LBIA 2QA2A 5ETVA 4ZVQB 2BKOA 5IM0A 3ELHA 4PYDA 3H98A 3NNCA 3NNHA 2V51B 4DU7A 1WSRA 4LRDA 3P49B 3CUNA 3KHYA 4CJQA 1S77D 1UFWA 3RSEA 3I55S 2ZWPA 2X3DA 1Y3JA 1DT9A 2IC3B 3T1AA 4BBYA 1UEKA 4CERA 2ZH2A 4TU7A 4M3TA 4Z4EA 1NGCA 3CW2C 4JYAF 4N8OA 4R5PB 4CGGA 2Z2YB 2P6TA 1NEEA 2E7VA 2W41A 2P5GA 3BSNA 5LMNJ 3TW0A 4DFKA 3H08A 1R8BA 2DT9A 3MAHA 1ZM9A 4AQYJ 2OUGA 2DPJA 1GK8A 3A0IX 3OHRA 3QSYB 5B0AA 3HVWA 4C8OA 4FBTA 2VBYA 3HJFA 1NM1A 4GO5X 3G4SN 3KG4A 1VRTA 3RGIA 3QNNA 3TRGA 4IO8A 4PG6A 3AA5X 3QMLA 1TZ0A 5BYRA 1B92A 3TO8A 5E3CA 3A8YA 4WJBA 2Q97A 4DV6J 3N6NA 2F7VA 2J9EA 4DZDA 4HTLA 2CIMA 1RA6A 3I96A 2PI5A 2BOAA 3HDSA 2V8PA 1Q79A 1JXBA 1CC8A 4TQRA 4NXMF 4IBNA 4WFBL 4ETZA 3FK4A 1QY7A 3DHXA 2IVYA 4DG1B 4IJAA 4K2JA 4RJVA 2O66A 4NWBA 3LL3A 5B0CA 1VBZA 3S3OA 4BG9A 4B3TJ 1NJYA 3PW7A 4RZRA 3MUTP 4USIA 1YVFA 5A6WA 4I4BA 2IVFB 2J6SA 1G7CB 1W26A 1RJJA 4ECQA 4IH7A 1OS5A 3O1BA 3UPFA 1CEZA 3KK2A 1R8CA 3GOIA 4OYZA 4X4PA 2ZE2A 5M2RA 2MKSA 5A8RB 5C24B 3CCRN 4CLPA 2XMKA 4GKJF 4NRUA 4YNQA 3DGPA 4FVMA 4KQZA 2AU0A 5JJBA 1RAHB 3CQYA 4U96A 2QT7A 3DLLL 4X62K 4O44A 2C2DA 3SCIE 3C2PA 4I6WA 2PY5A 2JFDA 1TUGB 2GWJA 2HVHA 1K6YA 4EMDA 3H40A 4DFPA 5CYMA 2DH9A 4WWSA 3BUZB 5KT5A 3PDNA 3KFWX 2JDJA 3R5AA 1RWVB 4CIFA 4MKBA 4EEYA 2VQEF 4DX5A 3VQ6A 2A0FB 1RSCA 3I0RB 5ETPA 5KG5A 2WUSA 2YPYA 4K5SA 2MZSA 4JI2J 2GX8A 5B0GA 4Z37A 3AOCA 1L3UA 2FUG9 5KFIA 5KT6A 3CCLN 1KVKA 4Z4FA 4ED4A 2DR7A 3M2RB 3AAQA 3CFPA 1Q82T 4B3OB 3OTOK 2D0OA 4O55A 4K4SA 2MJNA 4RW7A 1KVAA 1S6OA 2ADCA 3VVUA 1JXVA 3O3FA 1RLCL 4ED3A 4H03B 3EXYA 2HMIA 3UVJB 1K8KB 1R43A 5KFWA 3SYZA 3L3VA 2X78A 4NMLA 1TYQA 2JX2A 4FS1A 3NF6A 2AJQA 3CCWA 3QSIA 5I3QA 2G1DA 1KQGB 1EETA 1S6PA 3N6MA 2FVSA 2YWHA 3NF9A 3DLKB 3X3UA 1U09A 4Y2IA 2QM1A 1Y9OA 4M63C 4DS4A 2HEKA 1ATNA 3A5OC 2BR0A 4WFZA 5HVHA 2YJFA 1H0HB 2IM1A 5LJ3Y 3AO3A 4CIGA 3CGIA 1J5OB 2IYGA 3M2VB 1VQ5S 5IT9O 2HHWA 3N28A 1N5YB 2GTDA 3K5LA 2FC0A 3AA4A 1NGAA 4JKGA 1TUWA 2PGCA 3OFHA 2ZH3A 2PDAA 1RAEB 2E7WA 4M5GA 2R2SA 4ZP7A 4MJKA 1LCUA 3NAIA 2KXNB 4X4UA 4OQJA 1H38A 1S9FA 2HHPA 4CGJA 3H7HB 2E66A 3NWRA 1HQEB 2A5XA 2P9GA 5T7LA 2LECA 4OV6A 1WNSA 1LFWA 3J7Z5 3EGWB 2POKA 4A8KA 4FL9A 3EEQA 4QCLA 4BR2A 2DGWA 2FZCB 3TUJC 1J9AA 4HI2A 4MFBB 5E3AA 3I56N 4PYAA 3R3TA 3LDOA 5LSLA 3K5PA 3LPUA 3ZX2A 4ECSA 2E1AA 5DGAA 4JI7F 5BR8K 1NHUA 4RUHA 2GBZA 1Y5LB 3DLKA 3DXMB 4CIEA 1E3MA 2C3YA 2HBRB 3MAQA 3V81A 5FLXU 2MJUA 3CC2S 4Y34A 4YB6A 1LWCB 2VYPA 2C2EA 2XC9A 4TKTA 4FZYA 3QPIA 2D0CA 4M3UA 4OFZA 4Y00A 2VFSA 2WCXA 4C0HA 4DR6F 2IHR1 1OY6A 3J80O 2IY5B 2BJ1A 3OR2B 3G82A 2OI2A 2ROEA 4NLWA 3QEWA 4LIWA 4E1NA 2YKMA 4WYWA 2HHUA 1Y3KA 4X62J 4QR2A 2G8VA 1FVSA 1SIZA 4RW4B 1JLBA 3IDHA 3SLCA 1YK9A 4F36A 3GWCA 1FCAA 3ZETB 2RSQA 3BGRB 4X65F 2X1GA 3D6RA 1P27B 2V50A 5CY4A 1M1KO 4YORA 3DGVA 3PX6A 1ZBHA 2OTJS 3O2IA 3I0RA 1EQMA 4R0EA 2Z58B 4EHUA 4FYVB 4M3XA 2JH3A 4TYBA 2HF3A 2EK6A 3WXLA 1U8SA 1Y97A 3DRSA 2G8FA 4CT9A 4GVBA 2KFZA 1VHIA 3M32A 4LSLA 1G2EA 4F4XA 3PW5A 2KL8A 1K0VA 3CE8A 3AA2A 3QGHA 4O5FA 3TSPA 3DU6A 2AMCB 4UY85 3MR2A 5F8GA 1KHWA 5HRPA 1U2VB 2DHAA 4JYAJ 1N8RT 3DKDA 2E1YA 1E6VB 1UJ4A 2AWZA 4J91A 1O6XA 2CA9A 3CD7A 3T1HJ 3GCXP 5C5JA 4DLEA 2KB2A 1M1HA 3V9WA 4DU4A 1IO2A 4C3MA 3RW6A 4ZHRA 1JKHB 2CGJA 4NRTA 3T9NA 2GNKA 4FLZA 2ASMA 3DGPB 4K25A 3MMAA 1S0VA 9ATCB 5KPZA 4YOYA 1HWUA 4OIXA 1OH5A 3KNAA 1HL6A 1BC6A 2RDDA 5HQMA 3M6WA 2YV0X 3CNQP 3MUVP 1PG5B 1IKWA 4G1PA 5E33A 4CEOA 5KFGA 3BH6B 3C65A 4CJ7A 5GAEU 4ZIWA 3OTBA 2U2FA 4FJXA 5IC4B 3EO3A 5KFTA 4PWUA 3TR5A 3AAPA 4OZNA 3JTPA 2V52B 3R1XA 3M8RA 3S8SA 2C28A 3AXMA 4CLSA 1LWXA 4WTYA 1VSIA 3CETA 2WBRA 1XMBA 2W9CB 2WW8A 4C6AA 4IEIA 5M1NA 2IAJA 3CQ8A 3IGVA 3RB0A 2HSEB 1WHYA 1RBVA 3CYMA 1OSCA 4M5LA 1HBOA 2BUNA 3CIMA 4CM0A 2Z1GA 1RILA 3SQ0A 1CLFA 2DNRA 5JVGQ 3SAGA 1WORA 3K8VA 1M5HA 3WX8A 2P9NB 2AF6A 3GLJA 5GMKa 1XR7A 3OL6A 3CDEA 2ZC4A 2V5HG 3QFPA 2DH7A 2Z1IA 5KFEA 5RUBA 2RQKA 4DHYA 4K7QA 1J54A 3SUQA 4G1QA 5ETNA 4XH4A 1FKAF 1FFSB 1HNIA 4UF4A 1SKSA 4K4VA 1FRXA 2LVWA 1NRKA 3DRRB 1RK8A 1RDAA 3SQ2A 4DTXA 4XO0A 1R89A 4LR9A 1VQKN 1WSIA 4YHHK 4DU3A 1HR0K 3SCLE 2VPYB 1MWZA 4CD1A 5HI7A 2W7OA 2AYGA 5CR4A 4I2QB 4BR5A 1FX2A 4RWWA 1S0MA 5BRHA 1RABB 2AGQA 3VQTA 3J7AP 3F44A 4CF2A 2OSRA 5FJ4A 5M1OA 3NGTA 4P6QA 5D0EA 2ZFHA 4Y2KA 2AJFE 2QI2A 4CF1A 1CS4A 3GJSB 1UJ6A 4J9NA 4ANCA 3MMVA 3SBMA 5AQUA 2UXBK 2XI2A 5D3GA 1HRHA 3SBGA 5C10A 2FF6A 4PXDA 1QE1B 1GXTA 4M5NA 4GVBB 4ZP6A 2VU5A 3GL1A 5GADU 2VDIA 1C6VA 2UXDK 3J81U 4FLTA 4X4NA 4C8ZA 3BO2A 3A3OB 4UZBA 1X4DA 2AJ1A 1VQKS 4LREA 3QBCA 4NASA 3SUNA 2HVDA 3NEKA 4PWDA 4X4RA 2D3O1 2C2NA 3GG4A 4OI6A 4YOTA 1NH7A 4TY8A 2O8BB 4LR8A 5CYQA 4LF9K 1D5AA 3G71N 3MPVA 3HHLC 2QKKA 4MYUA 1VQSA 4M95A 4GKJJ 3KLEA 4W4MA 3AD8C 4GVLA 5L9XA 5AT1B 3AA8A 4QS8A 1KOHA 4QWCA 3QNWB 4C0OC 4HEA9 4IOAQ 3TWZA 4LFBF 3EXCX 3JTOA 1SKUB 3AHPA 4LBPA 4E7IA 4JKAA 5E84A 4B9TA 3OS2A 1RHUB 2K1RA 4FJNA 3VZHA 1EQ0A 3SJHA 5ETKA 1KN6A 1WHXA 5C25A 3B6OA 2RUSA 1BCOA 5GAEP 4CFDA 5KPRA 2CVIA 4FPBA 1C2PA 2CXEA 3ZSOA 4FBUA 5THWA 3L2VA 5C15A 1FRJA 1Z2ZA 4DV3F 2V7YA 4OZJA 4B9MA 3RW7A 2GELA 4WFAQ 4ED1A 2VHGA 3BDEA 3GILA 2X74A 3VQCA 4EI2A 4Z2XA 4JK9A 1WLJA 2R9LA 1WSJA 5D0RA 2ZBQA 1J53A 1XR6A 3MEEA 5KG7A 2XEXA 1CBKA 4KGKA 2XWXA 3W8PA 1YJWS 1VQ8S 4H4OB 4H0YB 2E2QA 3C7NA 1PYSB 2I7PA 1JLEA 4RTFD 3BYPA 1HNWJ 4AM7A 4GW6A 4X4TA 1SBRA 5T41A 5DLFA 1OWXA 3TX8A 2UUTA 5J2PB 3OFFA 3PM9A 3OYMA 1IR2A 3AVNA 5LY3A 1GXLA 3TAMB 2D0AA 5LMUK 4CTAB 5DDQC 3M6GA 2DIVA 3UDCA 3OW2M 3EE9A 2CQ0A 5ETOA 3KHGA 5KFPA 3BO4A 3OFEA 2RVJA 1S1WA 2QA1A 4DU8A 5LOQA 1HARA 3R7BB 1T3NA 3CCEN 4IO9L 1E6VA 2BM0A 2ZZTA 1XMQF 4CZJA 3HSTB 2L9WA 4A46A 4KI4A 3SPZA 3AA9A 1VQ6S 4NLOA 2UUCF 1CZBA 2PC6A 5D4NA 1RWXB 4DSEA 2HG4A 3CCJS 4K50A 2WZ1A 4KTZA 1FRMA 5HK4A 4FF1A 4W5NA 1RISA 3OTOF 1UTAA 2VWJA 3BQ0A 2M8HA 3M2RA 2UUAJ 4PXCA 1Y00A 4AL6A 1B9FA 1ESVA 3NHGA 1UVMA 1K9MO 3MPUB 2Z56B 2PMHA 3CT9A 1D3WA 2JWKA 2GA7A 1RT1A 3MMBA 1L3TA 1KOOA 4IQXA 2B0GA 3KUGA 3AQPA 4DCHA 4A4JA 1KRPA 2VPZB 2EG2A 5KFAA 3D7EO 3QGIA 3OVNA 4ZPAA 1I6JA 3SDEB 2N7YA 4MLHA 2AGOA 1LXNA 2KU7A 4CYUA 4KV8B 3OQ2A 1WEZA 4LF5K 2YH0A 4HACA 2ZJQL 4J8FA 1WC4A 1T03B 4NCAA 3POTB 2J9DA 5SUHA 3J8AA 2XMTA 3LWMA 1KTVA 4OPAA 4ED6A 3H3OB 1DAXA 5AE2A 3GG0A 3GFYA 4B9VA 4KTQA 4XK8C 3QFWA 3SFGA 3QJJA 2Y3YA 4W5OA 1KEKA 4ED5A 3JSYA 4CZHA 4KO0A 3ULDA 2O8EB 1GTHA 1YJNN 3NAEA 1LQ9A 3CCVN 3NDKA 2AIRB 2E5LK 5M1KA 4O3PA 1NPPA 2W2MP 5KG3A 2DGTA 4HHJA 3DMJB 1SL0A 4X66K 3W9HA 3OYLA 2QKBA 2VWBA 1SB6A 1HKBA 3VAFA 4WTOB 3UKUB 4JB8B 4JI1F 3B6PA 3T1YJ 2D1CA 4Y0FA 3W3DA 1WC0A 3GR1A 2BE9B 3VVTA 1WHWA 4LFCJ 3UR3C 4GRSA 2DJWA 3QFUA 1SJ1A 5AXKA 3EDQB 3KJVA 3NAHA 2B9YA 3H1QA 2BKNA 4YP3A 1YBUA 2XMMA 3EY1A 4BY9C 3BBBA 4ELTA 3PCOB 4EU0A 1MNEA 2R7SA 4DPWA 3AVBA 4ZIVA 1S1XB 4OPJA 2M2BA 3CIZA 4HDHA 5E3PA 4FSVA 4HCCA 4IXCA 5B0BA 4ECTA 1O5JA 2VCPA 4NYPA 1N56A 3JS9A 1RAIB 3TA2A 3FRZA 4QIGA 4AL5A 1URRA 3CJ4A 2F3JA 4P2XA 3EKSA 4J9LA 2FIUA 3MMCA 5SZTA 3DXMA 4FWOA 2Z1HA 4DZ6A 1ZA2B 1S4EA 2W6KA 4QWEA 3D0IE 4K8ZA 3O44A 1NKCA 3NMAA 1ZTTA 2FHJA 4IR9A 2E1CA 4ID5A 2ALYB 3C6AA 2BW2A 4GV9A 2DEIA 2HFNA 4O3OA 4CH7A 1BOTO 2MGZB 4GKJK 1XERA 1ZBSA 4U8YA 4A5AA 3OLBA 4KHQA 3W5YA 4GV6A 5HJXA 2FBXA 2P9PA 5AQNA 2Y9HA 3ZO7A 1HYVA 4CBWA 2G2ZA 3VGMA 3VGVA 4KH6A 4UTGA 3KHRA 4BREA 5ETMA 4DI6A 3BEGB 5FD1A 3GV7B 2ATLA 2CDRB 2ABYA 3D2WA 1SKWA 3PIOQ 1IR0A 5KT4A 2YVSA 1T05A 2YY3A 1C1BA 3FQKA 3GFZA 4CLZA 1RAFB 1VS3A 4IZ9A 3THYB 3KK3A 2RPIA 3SSQA 1FTRA 1VJWA 1FD2A 4JAXA 4WIQA 4EP5A 4QBUA 3VQAA 2GJ2A 5CCLA 3PKYA 3WNFA 2KZZA 1IBMF 1F9HA 5AQWA 2C3OA 4K2XA 2DIUA 4O3RA 3UNGC 2RUGA 2RKIB 2J0WA 3NRBA 2K2PA 4DQSA 1JCFA 2P9IA 4ZPBA 2BH1A 4CJLA 5KGWA 4X65K 4OKJA 5KT2A 3GU0A 3KK3B 3PHEA 4ZLLA 3S9HA 3C7NB 3MPDA 1RTZA 4PY5A 2G0IA 1L3SA 3CWJA 1UVJA 4FN5A 2DO0A 3QIPA 2N3OA 4FLWA 2HMIB 1EETB 1NGFA 3THVA 3HT3A 1HNVA 4JKEA 1VDHA 3BP8A 2AW0A 4CLYA 2B6AA 2X6SA 4USHA 2V94A 4CBXA 4W5QA 3IRXB 4PWDB 5J1NA 3K2PA 4QR0A 1KAXA 1HNIB 3VAKA 3P39A 2K7KA 2YJEA 3SJJA 5HQ8A 1CULB 2FHJD 4JI5J 1LOUA 1PO6A 1HLUA 4DQRA 1ASVA 3MURP 3K17A 3H5XA 4QZVB 5HJYA 3J7YI 8RUCA 2R7UA 3U6FA 3R5DA 4ECRA 2IGIA 2X6NA 3KG0A 4KBOA 3T3FA 3MXMA 3W2WB 1IWGA 2HQFA 3D0PA 3UB5A 2KDOA 2O8FB 3CCQS 4X64J 4YOWA 1OY9A 3G8TA 3WQTA 2PIIA 3QRQA 3D5MA 1FWKA 3T1YK 1KSPA 2NUBA 4WCEL 2XSJB 4ECZA 3K8WA 2C2OB 3IO1A 1KFSA 5F8HA 3MECA 1C1AA 4MFBA 4QIFA 1YJRA 1S5JA 3OXGA 1BMQB 3HKWA 1B0TA 2V69A 1HNXF 4FW2A 2J5AA 1QDUB 3P6YC 2P51A 1ZA1B 3QIPB 1YI2S 3E9LA 2HQDA 1HHSA 2RAQA 2CQ2A 1ZETA 4DR4K 5LT5A 2H5IB 2D9OA 3HPHA 4FPAA 1SC6A 1XNRJ 1YIJN 3VAHA 4ZPVR 3C6TB 4IOXA 2CPDA 3U27A 1DBDA 3NL0A 3LALA 2ZJPQ 2P9IB 4Q8EA 3BR9A 1KAZA 3T69A 2F4VF 3C14A 3CJ8A 2C1EB 3WQUA 3DU5A 4KIAA 1KKHA 2HFUA 4DS5A 2VWKA 1U25A 1YRXA 3DYAA 4EBEA 4B1XB 3MM6B 3I5AA 2UU9F 3VAMA 3KZBA 1BXNA 3N4WA 2PI4A 3ZNJ1 4E1JA 2DR8A 1VSLA 4EAHD 2DGOA 1DZ5A 3DM2B 4EUVA 2MQOA 4KTWA 2K1RB 5C2DA 4BE0A 2RHQB 4LF8F 3AJ2A 3EICA 1KDNA 5LSRA 1IBKF 3JYTA 4Y3CA 4EBDA 2NZ4A 3MK6A 5GVQA 3TARA 4RUCA 2DPNA 1RHMB 4PWWA 3O5TB 3DRYA 1XMQK 1I51B 3HVAA 4A8OA 4K4WA 2FVQA 2RU3A 5I3UB 2LSNA 3W5ZA 3OYAA 4O3QA 4LFAK 3VQ4A 1VQ6N 1RTJB 2B4UA 1JLFA 3Q8QB 3MM7B 4RW7B 5D8HB 2NUUG 3ZT3A 3EX7B 2KI2A 4ZDNA 4YOEA 5CH7B 2DGUA 3A3NB 3H5YA 1VBXA 2BJ7A 2ZJPL 5A8KB 3WNHA 1RTJA 3LM2A 3H0PA 3AOAA 3Q7BA 4NEZA 1AA1B 3VF4A 1T11A 3IWLA 2UVUA 2ASPA 4W5TA 3FNNA 4DUZF 4K8RA 3HOTA 4A48A 3OVBA 2IPOB 3C0BA 4BR9A 3ILIA 2QLBB 2EBEA 3V6DB 2YKMB 5D78A 2A18A 1SJFA 3HSCA 5HLFB 2YNGB 1RTHB 1SL2A 1QVFM 4CHZA 3T1YF 3CJ7A 2YQ0A 4Y0WA 1NZ8A 4WZQA 4OI4A 4Z7YA 4OGEA 4YDUC 2HRTA 2VQFJ 1R0AB 5F0WA 4UY8O 2LEPA 4URQU 4BR4A 3WX4A 4LD0A 4K5RA 3OUYA 4FW1A 3DRPB 3KK1A 4M8LA 4E7LA 2DRAA 1I39A 1CLQA 1PILA 4X84A 1R6YA 2EFPA 4LFAF 3T19A 2ASDA 2YWFA 2J6UA 3CTRA 3A4TA 3MEGA 4B3MJ 1BUPA 3L7PA 3BDPA 3OSPA 3AARA 2FC9A 4HYKA 4B3SK 3DMJA 1IUJA 2QEXN 2A3ZA 3AVCA 2Z4PA 5KFFA 3MMBB 2FLOA 4ZP8A 1CPZA 4MDAA 2UXDF 4NXMJ 3ITHA 3W2VA 3SAFA 2V8HA 2VICA 3HFZB 2WVFA 2D74B 3VV2B 2QXLA 2WRMA 4Q0BB 2UYTA 2D3ZA 2MB0B 3I31A 4M5DB 4HHTA 4P2MA 4C1NK 1RB0A 1DJ0A 4EIAA 4DTRA 1VISA 1VRTB 2CQDA 4LF7K 2LMIA 1U0HA 2BABA 4CH0S 3PSIA 1HBMB 3GDQA 3QETA 4WP9A 3BF1A 3W9JA 3PNIA 4CFCA 1RT2B 1VBKA 2MQLA 1NHKL 4FWSA 2ZWOA 2PYLA 3ET6B 3WBZA 3PFOA 3K89A 4YHHF 1VQLS 4XDDA 2FJDB 2QWMA 2GVDA 3VGSA 4F4ZA 1LAVA 2FVCA 1R3NA 1DARA 1N34K 4CJPA 1WJ9A 1NSKL 1XC9A 3H2VE 1HNXK 3M8PB 4J9QA 2LP4A 4DCOB 4RW4A 3D1HA 2EFNA 4BHQA 4IKAA 2RILA 3CSKA 4OZLA 4KH1B 2UV8A 4RWTA 3LGNA 1SV5B 2CPIA 3HZEA 4P2SA 5HMZA 1X5TA 3HVTB 1FVQA 1LNQA 1VIXA 2ZH6A 3VGKA 4LSNB 2CJYB 1HA1A 3CJKA 1BWEA 1N5SA 3CCUS 3IAM9 1YWXA 1B0PA 3UD4P 2APOA 3M2UA 1RAOA 4JI5F 4CJTA 5JICA 3D28A 3BF3A 4OYXA 2I5JA 2HHVA 4F0KA 3PRDA 4JRQA 4DQIA 4DR5F 4NLDA 2QA4S 2HHSA 1TL3A 1S5ZA 1WG1A 1N54B 1DTQB 3KKRA 1OYDA 2MQMA 2W4PA 2B5JA 5ETLA 3TI0A 3LP1A 1VRUB 3QDKA 3SMZA 1T6DA 2VQEK 2ATCB 1MG7A 4OO1J 3PR5B 3FZKA 2HGMA 1JJ2M 1BE4A 3KLGA 1WC3A 4ATNA 2DITA 3IRWP 1OYEA 1MW7A 2Q36A 1NPKA 1RHKB 2J0QD 4R8UB 5KFNA 4HVJA 1IKXA 3FZFA 1DY3A 1X7VA 1UA0A 4CM2A 1N6QB 4JKGB 3BH7B 4BLGA 3DC2A 3CFRA 2BRLA 4AL7A 3M2VA 3LOUA 5FROA 2LEBA 4YY3F 5MLCQ 5KFZA 4WP3A 1HD1A 3KNGA 3R3LA 2X51A 4Q5VA 3MXJA 3MFHA 3UD3P 2XY6A 4DUYK 3ADAC 3MWTA 4JKHA 4JI0F 4QYZK 3PO4A 3RRGA 2QZ8A 4H5NA 4V19J 2YNIB 4WFXA 5KFYA 2Q3SA 3CM6A 2V2VA 1EX8A 2XMUA 2V9WA 4LMZA 1BCMA 4CZLA 1QVGM 1YXQA 1IBLF 2CPJA 3OXLA 1WF2A 2VOPA 1CJUB 1NGGA 1XHZA 2OIHA 2YX7A 1U2RA 4B8CA 3M9MB 5FLXO 5IOLA 2QEXS 1YITN 2ZKUA 5CYQB 4M7YA 1LW0A 1EB0A 1F21A 2D1KA 4PUOA 4DQQA 1SL1A 4I56A 2QIFA 4ZN1A 2DGVA 3TTDA 2VH7A 4ILJA 2DNOA 3QAUA 3IA0A 2IJFA 3MM8A 3CC4S 1J5EF 2CFXA 3O08A 1NU0A 2DEJA 4LSZB 5L1KA 3TSUA 1SZ2A 1RAJA 2GV9A 3DFEA 5K8NA 4X65J 2CQ1A 4FJGA 1WI6A 1ZYQA 3AODA 3ZZ0A 2R4FA 1CJKA 4B3SF 1IKWB 2OP5A 1X4EA 2F7TA 1DLOA 4RG8A 4DOZA 5EXWA 3F5TA 1FDAA 2KVIA 2IMOA 1YZ6A 4C48A 3S01A 4DSLA 2KT5A 3CVKA 1WEYA 4EO8A 4DF4A 5LXRA 1U1OA 4JKFA 1JJCB 1GMUA 1JLGA 5DM6Q 3Q22A 4IRKA 2UVWA 4DMZA 4DV3J 4HKQA 2F4FA 3HHLA 3U9DA 2FVRA 3H25A 3G6EN 4JHDB 2OGUA 4DPYA 2B4PA 2YI1A 1RHJB 2RJZA 4ZPCA 3WC2A 2NZCA 2ZUGA 1DEJA 5AZIB 5IT4A 5EWGA 4ZPWR 4NLGA 3MDFA 1R8HA 5ETRA 4A57A 3QO9A 1X4FA 3TAQA 4QYRA 3OFGA 5EX5A 4CEDA 1ZH5A 1YQHA 4BC9A 5A0YA 1N36J 4Y6IA 4MQ3A 3DRSB 2YNFB 5AZIA 2VFUA 1HYSA 4CHYA 1K8AO 2OD4A 4WK1A 4WIIA 2Y1LB 4DTOA 2WFBA 1IKVB 2E1RA 2WSEC 3CMES 2DHGA 3DXKA 3MN7A 5TKYA 4FM2A 1ZZNA 1ULRA 1R59O 4LFAJ 4CJSA 1VSDA 4CFBA 2ZH7A 2AHOB 3EL2A 5BR8J 2WONA 4B9NA 1FNXH 1JX4A 2UXCJ 2RQ4A 2E1MC 3KKFA 3CCMN 1IJJA 2AJ2A 1NK6A 1Z2LA 4CGDA 3DLEA 2F40A 2V6AA 1A5XA 5AQRA 1S1WB 2GO8A 2P9SA 1BU6O 4DR6K 3LH2S 8ATCB 3V9SA 5ADXA 5DG8A 4CJWA 3US5A 4FP9A 3SUOA 3QAEA 1LWCA 1N33J 3W2WA 2PE8A 4BCAA 4C9DA 1Q86O 4O8KA 3SCJE 1RU2A 1XMOJ 5F2RA 3CCRS 2IJRA 1E4GT 3KMQA 3QBXA 2E88A 3OXFA 4QS7A 3FEXB 1VQLN 3CD6N 1BA1A 1NH8A 2YCHA 5AE1A 3OTCA 3QNOA 1K73O 1Q81T 4DKWA 4DN9A 2GWKA 3LP0A 4LQ3A 2HZCA 3B82A 4USTA 3Q86A 3FLCO 2WTUA 5C0YA 4LF6F 4IG0B 1OH8A 1UZHA 4C2MA 4FJ9A 2VPWB 3DLLQ 1CQNA 2DTUA 5AQTA 3I4PA 2KJVA 5H9EJ 2DNNA 3CCZA 3OR2A 4CLKA 4EFAC 2ZH4A 2MZQA 3FBFA 3L2RA 2Z2LA 3D54A 1A5WA 2ZNYA 4PG5A 1NOZA 4AXJA 4CHNA 2QXFA 1JLGB 4W90B 4RKUC 3S3MA 3MHYA 4G65A 4H0OA 4BRHA 5HL7L 2P9KB 2XGPA 2HHTA 1V5VA 2NZTA 2XHBA 1T9VA 4P73A 2FSNA 3QEPA 3T6JA 3RWUA 4Y2MA 1VLOA 3KLVA 4DV5J 5AQFA 1TL1A 3GFHA 2UXBF 2LLZA 4O4GB 3Q7CA 2YTCA 4I69A 4DSJA 4HHHA 2EBGA 2R7WA 4H5RA 1KQSR 2DHXA 2W6LA 4NLTA 4LF7J 1TELA 5F1XA 4J2AA 4CF0A 4FJ8A 4DV3K 4FVUA 2CDQA 2VC1A 2XNRA 2OHDA 3TVYA 2QE5A 5T7LB 2LYVA 2YNIA 4NI2A 3IR7B 4CLLA 4I7FA 2CQIA 3PVXA 1VQPS 3WXKA 1H2TZ 4DV2F 3B8AX 1MROB 1QAYA 2G9OA 2QYGA 1GFWB 2QJ3A 3CJKB 1HR0F 2A42A 2YPZA 2B6AB 2VBZA 5J1PA 1UPPA 3R97A 4NXMK 5FIIA 1QTMA 4L3QA 4W92B 4O23A 3GIJA 3BKTA 3VETA 2A3JA 3UCUP 5JXSA 4NX9A 4C8NA 3M30B 2HFVA 5F3TA 5LJWA 3OSNA 5KFRA 2KFNA 5JMVA 3SZ2A 4DV4J 3V4IB 4EP4A 4OZ1A 4CP5A 5BRFA 4E7JA 3KD1E 4KJIA 4F4YA 3AQOA 4IWVA 4EHTA 2ZH5A 3C6UA 1KR4A 3KLHA 4JI4F 4ISGA 3R8EA 2KYXA 2DK2A 3IBFB 4NZ0A 5AE3A 5HBMA 1Q53A 5L1JA 1DQAA 2GJFA 2NLXA 2CQGA 1WHVA 4JI0K 2BMBA 3NGRA 2YX1A 3ULEB 4U95A 3N5FA 3MEKA 1AYEA 5KRSA 3ENWA 5EGYA 3FKBA 5LSOA 4CZIA 3KUEA 2HB5A 3WNGA 1ZBLA 1UWBA 3NGYA 1TAQA 2HHQA 1U0SA 2HS4A 2KYZA 4K59A 3QT5A 3KLHB 3FSXA 3O3LA 3N6LA 1UETA 1HFEL 3CMEN 4CJFA 3AY0A 5A2QU 1UAXA 2FF3B 2FHKA 5BJRA 5CCMA 2VOOA 3NGKA 2MKYA 4DFMA 3TA1A 2OFGX 4KFBA 2M70A 4DTJA 3H20A 5TKWA 4JI3J 2H4YB 1Q18A 1L3VA 3THWA 3VHQA 5L38A 4DCPB 4F0HA 4YMEA 4EBCA 1X4GA 1TU0B 3DLBA 1Y4ZB 4LBHA 1FEEA 2CJAA 3C15B 5FRNA 3AVLA 3R5GA 3OHAA 3SIPB 5AJ3K 4TLQA 2GC8A 2Z8QA 3RMBA 4I2PA 3T9ZA 1HMVB 4BDPA 1KCFA 1J5EJ 3IAS9 2BQ3A 2YWKA 1XMOK 2ZH8A 2HFSA 4RWXA 2F8MA 4ECXA 2O8DA 5HVGA 1F5BA 2QSWA 3CCSS 1X9SA 4ZVHA 3V5RA 3KMSA 3HM9A 3O6QA 2VQEJ 1N32F 5FLXY 2A2CA 1QAIA 5ETQA 3HMJG 1NK4A 1X0FA 4URGA 1UW9A 2RRNA 3ITHB 1W2BM 1N88A 3CULA 1LKZA 5CYJA 3HRGA 2O8BA 1HWKA 2NRHA 2EKYA 1MMNA 2XZDB 2MLYA 4A62A 2XG8A 2FBVA 5DQHA 2OJ3A 3HI0A 3JQKA 2ERRA 1T7PA 1XNRK 2OTJN 3CO0P 4WU3A 3TJ8A 4KHPK 1HQUA 4CO5A 2YQ3A 1RBOB 2EFQA 4RLEA 1ZPVA 4HI1A 3JQJA 3MM7A 1JNRB 2Q0UA 1JLQB 1TR0A 1FEHA 1E6YB 2ZHBA 1T9XA 2YNGA 1IBMK 2VG5B 1ZC6A 2MMYA 1YT3A 2CQCA 2DNMA 2LQ5A 1MDUB 3T7ZA 5BPMA 4QAGA 1U1KA 4M7XA 2UVRA 5C2CA 3GIKA 1YJNS 2V63A 3DOKB 4JI8F 4IR1A 2UXCK 4BQZA 5DM7Q 1X9MA 1RAGB 1RACB 1C0TA 3IMQJ 4PA1A 3MFIA 3LGMA 2KFYA 1FRLA 3PJWA 2LQJA 1RBTA 3D3CJ 1RBAA 1F6TA 1VC5A 1FRKA 3TEHB 5IV4A 3FSYA 4O4RA 4H4MB 5KQ8A 2W9BB 3RB4A 4F26A 2DHSA 1MU2B 3D6MB 3MAAA 1VGYA 3I4HX 4KAIA 2PBDA 3A8EA 1U2FA 3OBYA 4GKKJ 2VODA 2O4IA 3B4MA 1AROP 1X60A 2QWOA 1W7AA 2RQCA 1RDRA 5HQLA 1IBKJ 2QL7B 4DV1K 1U6ZA 1BI4A 2W2QP 4ECWA 4RNFA 1B9DA 2O8CB 3WIUA 4HTIA 4JRPA 3JYTB 3H90A 3LQVA 3C94A 4JI8J 2JZ5A 3MM5A 4GC6A 1T9WA 4JI1J 3L8BA 1D09B 2MLZA 7FDRA 1BA0A 3OYJA 4BRGA 4DR6J 4J5OA 4G6VB 1RKJA 3R2CJ 3KLFA 2LDIA 2VC0A 3FFKB 2F63A 4TU8A 2H3EB 5KG2A 4GV3A 5IFMA 4OX9F 3HOSA 4C23A 1R0CB 4FK0A 1U1LA 4E3SA 3CO9A 2CPYA 2UUCK 1UCNA 2LXFA 2RS8A 3CPWM 3MN6A 1OH7A 1RDUA 2GVZA 1M90O 1TTHB 3FSIA 1HHTP 5J2PA 1W2BR 4N5SA 2NSCA 1N36K 1ITPA 3DDNA 3UNYA 4IDHA 3D2EA 4IYQA 5HRRA 1YJ9N 1N36F 1HI0P 5IWAK 3OYKA 4UY8T 4NA1A 2KHCA 2M4MA 4QJVA 3F2KA 3TZYA 4OHYA 4CJRA 3K59A 4O0NA 4JV5K 3TSQA 2VJVA 2B51A 1S9GA 3GTYX 2WAQD 1RTDB 4WFNL 3ICLA 4JHDA 1WNEA 1MA9B 3RBEA 1SCJB 3UKRB 4CBUA 2HOEA 3P5BP 2FB0A 3MR3A 4RNHA 1RKIA 5EWFA 2FGOA 2HRYA 3VGLA 2ILZA 4OZ5A 5ELZA 2PEBA 4DPTA 3TAGA 1JLAB 1X1PA 3P3DA 3C16A 5JS1A 3V1QA 3L6QA 1NK7A 4JI4J 2VF3A 1T03A 1RTIB 4K8XA 1K1SA 3BEXA 2F8EX 3MM9B 3IP0A 5HSPA 2HS0A 4DR7F 2FJXA 2F4VK 1CJVB 3EE3A 2MSSA 1B64A 4B1UB 5F8MA 1Y5IB 1B0VA 3VQEA 2NR0A 4RCHA 3VN5A 3H2LA 1FA0A 5HN0A 2QX0A 3D2FB 2MSTA 4IFEA 4H0PA 3THWB 1U02A 3BQ2A 1QLNA 2C2KB 4L72B 3DOMB 2BM1A 3ZZTA 3MEDB 1UFKA 1S59A 2W24A 4OYWA 5I4MA 5FPNA 3M8SA 4M94A 2XHCA 1WG4A 1Q7YT 2HPUA 1VSKA 5BREA 1OKJA 3VAIA 4L74A 2W2PP 3EWGA 2JRSA 3LP0B 3OL8A 5CHIA 4LF8K 2MDAA 3R1LA 4WFNQ 3I8BA 4FWKA 1QHTA 1U1MA 2CNOB 3BY5A 3GR0A 4CECA 1GMWA 2PMWA 1SKRA 4AD6A 3BGOP 2D0BA 4WF9Q 4L6V3 4AQYF 1HPZA 3H1VX 1U04A 1VK3A 3EGVA 4LFBJ 5DMRA 3HZGA 5IT0A 4ZA1A 1NMEB 4M5IA 4ZVSB 3LDNA 2W2NP 1BQNA 5AZJA 1RCXB 4HH1A 1J5OA 2XHWA 3AVHA 4JNEA 3HHLD 4K43A 1Q8LA 3HHDA 3ZT4A 1DQ8A 1MN9A 3PO5A 4L3KA 4FLVA 4AHSA 4PG4A 2G13A 4KR0B 3DJCA 4X64K 4ER8A 1QQOA 3T5JA 4YDXA 2P9PB 2Z0GA 3RR8A 4DV1J 1JLCB 1M1GA 5I42A 2GQ2A 4AXIA 2GHWA 2XLKA 2BGGA 4UOFA 3TOQA 1QTNB 3SMSA 2WW4A 5KPTA 4BE2A 3CC4N 1NGDA 1A7GE 2CVEA 4CZMA 1NDCA 2E5JA 2AZ3A 1J6ZA 3TJ9A 4RBTA 4CLUA 4C8YA 4LVNP 5F8JA 1SJQA 3W62A 2PSZA 4B02A 4HUGA 4Y2CA 2PFUA 2I0XA 4DV4F 2PAVA 4DR5K 4K4ZA 2W8KA 1HNWF 2HQ3A 3OS0A 1S72S 3E66A 1UA1A 4KHYA 1WKKA 2OZSA 1DRZA 3U3YA 4RW9A 3VTIA 3N5BA 3M6XA 2W40A 2RN2A 2Z1JA 2IA6A 5CD4A 4QPXA 2QA4G 1WSFA 1C0TB 4Q43A 1OVQA 2V2QA 3DLJA 2BACA 4YOXA 3VQ5A 1SUQA 4J9SA 3ETMA 4F04B 4MIWA 2X1BA 1XI1A 4WK3A 3CDWA 4FPIA 4XPEA 2DD8S 4LVOP 4RO0A 2VKRA 5AQVA 4R5PA 4IO1A 3RBZA 5AQLA 2P6SA 2CG4A 4HHUA 4USVA 2IVNA 2RF2B 2IFXA 3Q2SC 4DR2J 1KLMA 3ENQA 1NGBA 6FD1A 4KGMA 2KM8C 1IBLJ 3U1MA 3BGLA 3M7VA 3VWSA 3NFAA 4KYZA 2IIRA 5CZ2A 3PFEA 2IYIA 1RT1B 3M9NB 2K3IA 2P2CB 1RT5A 1KD1T 2G8UA 3IBCB 4CZEA 5BN8A 2HBKA 4PHTX 3S1TA 1XUPO 4MYTA 2M7SA 1F5AA 4F3QA 4Z4IA 2E6MA 5KFVA 2G1HA 3MR6A 2LQBA 3P1GA 4DDFA 2B43A 2WB4A 4CEZA 1YZ7A 4WFYA 3MN5A 3UE5A 4TN2A 2GMJA 3L95X 1V4SA 4BRCA 1U1QA 1BQXA 2FZKB 4HTJA 1BDGA 5IZHA 4KSEB 3FZ2A 2DY9A 1EJ7L 4K4UA 1FXLA 4M45A 4IG3B 4I0WA 4AM6A 4J9OA 2DRDA 4LF1A 3V81B 1WN7A 4OX9J 3DWLA 1X8DA 3P45B 3VEXA 3KK2B 4CVNE 4A5BA 1KC8O 3CJAA 1H72C 4M5JA 1L3KA 3MM5B 5G0RB 6AT1B 4ZCIA 5AQJA 1IKVA 3GV8B 1PAEX 2G4BA 3RZAA 1Q9YA 2ITMA 4E2FB 4J90A 2FTRA 3V6KA 4FWRA 4CJ3A 4JI6K 4NLYA 2V7ZA 3OHBA 1ITGA 3OTEA 2O67A 3CEDA 2IRYA 4P71A 4KGZB 2NXNA 2XYPB 4WF9L 2B4OA 2CPXA 3VQSA 2ZH9A 2W9BA 3R1HA 1MSWD 3ZZYA 1VSMA 4OI3A 4OGCA 4R25A 1LAWA 2BJDA 2VQFK 1XBWA 3EYZA 4KHUA 1HPMA 2FDNA 1NU4A 4MDBA 1ZBFA 3D3BJ 3K58A 3N0VA 1ZOTA 3AT1B 5AQXA 4NB4A 4H54A 4ZMMA 2VG5A 4DV2K 3ATUA 1O13A 3PKMA 2MKHA 3EZUA 5GMEA 3ZYYX 1S6QB 4Q2LA 4YB5A 4YN3B 2M52A 2PFDA 3V9ZA 1HKCA 3V1OA 2EVZA 4OL8A 2JEIA 5EUHA 3MM6A 1PYOB 2BEFA 2ATQA 2HRUA 1LW2A 3EDRB 2DNZA 3PRVA 3GBTA 4ZCKA 4P52A 5GADP 4USWA 2FY8A 3IR6B 3W8GA 3OY9A 2HGLA 2I9SA 4JKBA 3CC2N 2B4JA 2IOCA 1V5IB 4MAKA 1OPZA 3VMFB 1GTEA 3SFUA 4V19S 4HR2A 1BI4B 2HIQA 2LFVA 7FD1A 2XO6A 3PY8A 2CPFA 5KT3A 4WZMA 1U1PA 3JSMA 3GFXA 3KWIA 3ENAA 4EFHA 1N6QA 3MGJA 4CD3A 1MLAA 1NDPA 3IN5A 5B7WA 2XQCA 3MAAB 4R8UA 1N33F 1WEXA 4JI7K 2ZH1A 4U7UD 2E2PA 3V1RA 4WYBA 2ZJQQ 3O3GA 1H74A 4AHCA 2V8VA 1GMVA 2R7VA 2UU9K 3CCES 4I7FB 3VQPA 2Q1LA 4KB1A 2Z57B 1NGIA 1SH2A 1X5PA 3WEEB 4P75A 3SPYA 3ZT0A 3HHEA 5C12A 4DV0K 2PYJA 2HQGA 1HNZK 3ILJA 4C8KA 1APSA 1H1VA 2DTJA 1ZBIA 1ZM4A 1RCOB 2JL9A 1QQMA 1IVZA 5E41A 1RT6B 2IVMA 2E1PA 3GIRA 1H3DA 7AT1B 2I2YA 1NK0A 5D6GA 4J7CA 3M6VA 2XLJA 4CW7B 2KG0A 3CD6S 1KVCA 1KBRA 3HL8A 1S1UB 5DM6L 1NJWA 2BVZA 4TY9A 4ZVPB 2E2OA 5IQQA 1T9UA 2OPPB 2A40A 3GG1A 4Q7AA 2CRLA 3EVMA 2AYBA 2A1RA 4FXVA 3CCQN 1IXKA 3BREA 1WUUA 3IKMA 4I2QA 3TUIC 3C95A 3MD3A 2MQ8A 3TVZA 4J37A 4DV7J 4FXDA 4FKYA 4KHWA 1FRHA 1ROFA 2RB7A 1YTYA 2UXBJ 2RMLA 4Z4GA 1RBRA 4FLXA 5LL6Z 2YH1A 4O3NA 1YF5L 4CHOA 5G4DA 4UOHA 1WDDA 4PG7A 5CZ1A 3DOLA 2XM3A 3NOCA 5L9NA 3IM9A 1REVB 1VI7A 3HD1A 5I9EB 2FLNA 1S9EA 1IN0A 1RTIA 3NG8A 1RWNB 3OLAA 4DV2J 1ZPWX 1W0HA 5BN9A 4Q8FA 4ZS6A 3E1YA 4JI6F 2VA2A 3AVIA 5L39A 2GVDB 4IQMA 1UAWA 1LV5A 3VQBA 4NLCA 1QSSA 2E44A 1DURA 1CXQA 3IC1A 3PSFA 2P9SB 2FJWA 1OPIA 3KLIB 5KOXA 2VPXB 2ZKTA 4WFAL 3C8YA 3UFCX 1NK8A 2OA8A 1HWIA 4C97A 3ZZPA 4LSNA 4K4TA 4FJIA 3DRRA 1N48A 4RL1A 2Q1NA 5EDWA 3M30A 4J2DA 2FYXA 3R8YA 4NZ7A 4CNZA 4IOCL 3HK2A 2K8GA 2CPEA 3GPAA 1PIEA 2P9LA 2D5RA 2NRTA 1QJHA 2V2KA 1B4SA 4Z7CA 2VFVA 1HNZJ 4JV5J 2ZM6F 3R5BA 3H4DA 4CEEA 4BVPA 3TJAA 1UOCA 2B9WA 2R7RA 4KREA 4L73A 2GMHA 4ICLA 5A6PA 2D4WA 1FFGB 4FWLA 1FJGJ 3HTVA 2RKIA 1HJOA 3S3NA 2A6MA 1S49A 5EY4A 4I68A 4P74A 4NYZA 2H48B 4NCBA 3D7SB 1P90A 4DL4A 2QV6A 1SQEA 1Z26A 2UUWA 1U8WA 1YTUA 3QQCD 4CO4A 3Q89A 1VQYA 2L9NA 4Z94A 4AFFA 4Y1DA 4HTUA 3BKFA 3DM2A 1S57A 2HFOA 3W63A 5AQGA 1V9OA 4ILHA 2F96A 4KAZA 1XQIA 4OZ0A 3G4SS 3I9ZA 2DY1A 4MTPA 1NPRA 5CABA 5HO4A 4ECVA 2AZ1A 3VF6A 3PIPL 3HVTA 1KS2A 3NF7A 4FM1A 2P5OA 1QZ6A 1SJ3P 2EX3A 4IOCQ 4IFVA 4DQPA 4OHXA 2JVRA 3M1FA 3LP2A 3H45C 2GJIA 3MR5A 2DNLA 5J2QA 2VDHA 2YBVA 2Y1IA 4U6PA 2HFZA 1RDCA 4DR3J 4CZFA 5ETTA 3MM8B 2XYGB 4GKKK 4KHRA 1KXPA 3DLRA 4P9SA 4JYAK 1RQ0A 2J8AA 4M3WA 4MKVA 3VTHA 1IH7A 1Q86T 4ZVTB 3T5HA 1LW2B 5JVHQ 1B3TA 4Z4CA 3P4IA 1UVLA 2HNZA 2IS3A 3J80U 4H4KC 4QOTA 3FEYB 3DLGA 4KY3A 1NGJA 3ZLJA 3QZ8A 3D1OA 2G8HA 4X4OA 4K42A 2Y1JA 5E0OA 1S6UA 2NRRA 2QLXA 2JEGA 2VJUA 3JTNA 3QWUA 1VCTA 4G9ZA 3D66A 2GEMA 1N0UA 4CGIA 1B99A 1IJFB 2CNKB 5DG7A 1ASUA 3S7RA 1IG9A 2G2OA 1HW8A 3G6XA 3D0GE 1YIJS 1DFDA 2R7OA 3LAMA 4BDYA 4B17A 3ZSVA 3IR5B 1NSPA 1Q78A 4JI7J 3ZCMA 3LDSA 4IFYB 1HWLA 1PJ6A 2KN4A 3G86A 4CNYA 2Q2RA 4H0VB 4FJ7A 3M8WA 2NCKL 5AXMA 5BXIA 3AO2A 3IXQA 4CO2A 1WTBA 3RAQA 3NS7B 1FESA 4ZTFA 4RW6B 4USMA 4ISFA 3OYCA 3NBPB 1DKGD 3QZ7A 3IWNC 4I9LA 2MZ1A 3GONA 2ZBIA 1OMSA 4F9OA 3KJNB 3GV5B 4JI2K 4FZXC 5HVFA 4FK2A 3LA0A 4XDCA 3CJQA 4YOUA 3MTJA 3HXMA 4L76A 1FE0A 5F9NA 2XS5A 4CZKA 3F9MA 1RCHA 3MECB 1NB7A 1UPMB 4NLQA 2QLFB 4QS9A 3CJSA 3B6BA 3MCOA 2H1YA 4DTSA 2M3DA 4A8MP 4LF5J 1FNMA 1VRUA 1JXLA 1RTHA 5LM7E 4CYUB 1X9JA 3W9IA 3T5LA 4IOAL 3ILOA 3M32B 4YFUA 4LF4F 5JS2A 3D6FB 1Q0NA 4CT8A 3SI6A 1WOPA 3L3UA 3C6HA 1SPBP 3WXIA 2BYCA 4OLPA 1M5KC 1JLEB 1G3OA 4WE1A 4DV0F 3QIDA 1IM6A 2BJ3A 3ZC4A 2OYQA 3C6UB 4KHPJ 3JXUA 2XB2D 2ZOGA 3P96A 2YKNB 4F25A 2PEHA 3F73A 1HI1A 3RVCA 2E9RX 4Z0UA 2N4CA 1TV6B 3E51A 1O0PA 2P9EA 2BANA 2VONA 3D45A 3SK3A 5K8OA 1HWJA 1T95A 2ZUAA 1X0PA 4U7CA 3ZSXA 4XIUA 3HI9A 3AGKA 4LH4A 2EC2A 2XYHB 4OHWA 1Z1ZA 2AYEA 3CFOA 3MMJA 3P4UB 2MHNA 3D2FA 1FRIA 2HHXA 3WDOA 5GAHI 1EIYB 4FVCA 3ZSZA 2DNGA 4N41A 2W4DA 4OKEA 1G15A 4FWMA 3EPGA 4XH1A 3VEOA 1HJRA 3H4BA 3N01A 4WQ5A 1H6KX 3FBCA 5H9FK 2HNDA 3CCJN 2R3VA 4TU9A 3MPYA 3NVKA 4MO5A 3ZZRA 1ZM2A 2Z2ZA 4LY7A 1HIYA 3PYEA 4M5KA 1UVIA 2MEWA 1S6QA 1BLUA 1WKJA 2Y8WA 2QFJA 3OYGA 1OY8A 4MH8A 4DX7A 4XEIA 1WBBA 1TFYA 2ZF5O 2EXUA 1HQEA 3GIMA 1OQ3A 4RW8B 1WSHA 1EO1A 4DXLA 3I6PA 3GYNA 4U7BA 3QLHB 1FJCA 2MY8A 3EZWA 4ETXA 1VLYA 3FZBA 4ELVA 1EZZB 2CADA 3KLGB 6FDRA 3V9XA 3FZHA 1T05B 3A5LC 3AV9A 3LTOA 3UKUA 3HPGA 3HYFA 2V34A 4YHHJ 5H9EK 2DNPA 3QBWA 3DRXA 4UUWA 2AV5A 5IS2A 2J9DE 4QOZB 3ATVA 4GMKA 3U4LA 3MPWA 3NS6A 2DKOB 3UN5A 4B3TF 3L09A 3M8QA 2L41A 1R7IA 3I56S 1RYSA 1KAYA 4ID5B 1TL3B 5HBMB 1N5YA 5KGXA 2JEJA 2ASLA 2DCLA 3HLUA 4NXNF 1P8GA 1U6BA 2HBLA 4DU1A 1N5TA 1R0AA 3GSIA 1EWRA 1DTQA 1TKTA 3WXJA 3I55N 2ROPA 3HX9A 4H5VA 1KNZA 5FPDA 3I9V9 4S0MA 3KVGA 1KVIA 3ALYA 4IUFA 3P83D 4OPKA 1FJGF 5LMUF 4DL2A 2ZZNA 2R7TA 5GINA 2F1FA 1NJIT 2YKOA 1XNQJ 1RTDA 1SV5A 2R2TA 2YWGA 4UZCA 3VENA 1S6PB 1U6FA 1NJIO 3LF0A 3O4NA 2QWQA 4DR5J 3TUPA 1HBOB 5KFDA 4PXBA 3C16B 4DTMA 1SIWB 1HR0J 2XO7A 1TMJA 4ES1A 3KJQB 4C3LA 4HUEA 4OJGA 4RW6A 1N32J 1ATSA 1S48A 4ZOSA 3LDQA 4DG1A 4NMXA 2A1SA 4NYNA 3CCVS 1YSJA 1RBSA 1IKXB 1REGX 3D2EB 3MWBA 4V19X 4EK2A 5M2PA 2ZITA 2WVBA 1JQGA 2X3GA 3NKYA 3T5KA 2VIHA 3JSBA 3CJRA 4DR3F 4CRJA 1MMDA 2YXLA 1WC1A 2H54B 3D4JA 5B0FA 3Q83A 1IKYA 3FC9A 3UWTA 3PUFA 4N76A 1WUAA 1LWFB 4DL5A 2M5YA 5DQGA 4OYBA 3CJ2A 2FZGB 1B70B 2E29A 4JI2F 4BROA 4W98A 2R8IA 5B8HA 5AQPA 3ENBA 4BRAA 4B1ZA 4G1IA