2OPPB

Crystal structure of hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
427
structure length
403
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWEPPFLWYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 111
structure length 403
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2oppB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oppB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oppB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oppB03
3GIMA 3CDEA 3BQ0A 3H2LA 2W8LA 1LWFB 5HP1A 4RW7B 5KFYA 4O4RA 4EEYA 1REVA 1LW0B 4ED7A 1LWCB 1RT5B 3KHHA 4H4MA 5EWFA 2WHOA 3GV8B 1DTQA 1JLEB 3HVTA 3NAHA 4KE5A 4YR2A 3LP0B 2XCPA 1W25A 5KT6A 4FBUA 2VG6B 4MK7A 2RKIA 4O3OA 4XPCA 1S10A 4J9SA 2UVWA 3JSMB 3LAMA 1JLGB 1ZTWA 2OH2A 3KNAA 4J9LA 5I42B 4WYWA 4NCGB 3NL0A 4J9KA 4ZVFA 2YKNB 3GQCA 4U7CA 2YKMA 3RB6A 1EETB 4PQUB 3QIDA 4DL6A 3M8QA 3DLEB 4ECUA 2JEFA 4DL4A 4K4VA 3DRSB 3KMSA 4RW8A 1T05A 1RTJA 5EWEA 5KFQA 2JLEA 1N6QA 3NBPB 1SH0A 4JV2A 1JKHB 3QIPA 4ZPDA 1U09A 3PVXA 1RT7A 5HLFA 1RTDA 1S9EA 1SUQB 1QUVA 5F9NA 3HVWA 4Q44A 4TQRA 2HNDA 4ED6A 2ASDA 2BANB 2OPQA 1KHVA 3FDSA 4MK8A 5JXSA 3MR6A 5K14A 2W9BA 3T5HA 2FVRA 3V6KA 1RYRA 3MEEB 4XO0A 2IMWP 4MKAA 2E9RX 1UWBA 2ZKUA 5T14A 3LP2A 3M8PB 2IC3A 4XPEA 3H5UA 1N48A 2C28A 5F8NA 3GYNA 2D3UA 3BREA 4IFYB 3MECB 3Q8SB 3KLFB 4GC7A 1IKWB 3KMQA 5C42B 1FKPB 4JV0A 1T3NA 3PR4A 1ZETA 4NLTA 4F50A 4RZRA 3DM2B 2R2RA 3KK3B 3MEGB 3HVAA 4PWDB 2IM2A 2AGOA 1IKXA 4DG1B 3FQKA 4NRUA 2I5JB 5C24B 4ZP8A 4ZVGA 3UPFA 2R8GA 1HQEB 4ECXA 3DOKB 4Y2AA 5KFWA 2EC0A 2R8IA 2HMIA 3OLBA 4B3OA 3T19A 5HBMB 1RTHB 2JEIA 5HROB 3IG1A 3KLHB 3KK1A 5J2MB 3MR5A 4QWEA 4NRTA 1RA6A 1HPZA 2B6AA 3HHKA 5F8IA 2E9ZA 5I3UB 4QWBA 3DI6A 1QE1A 5DG8A 3BR9A 2R2SA 3KK2A 3Q8PB 4G3IA 2YNFA 4M95A 4IR9A 1S6QB 2B5JB 1T94A 4NLYA 3IN5A 3M9NB 1JXLA 2XC9A 3DLKA 1RT2B 1HNIB 2D7SA 3EZUA 4LSNB 1RT1B 2R8KA 3V6DB 4R8UA 2FLLA 4IG0A 1HQUA 1LW2B 3BSAA 3I0RA 1S9FA 2YNGA 4QWDA 2IBKA 3QLHA 4ZMMA 3KLGA 1TVRA 3Q8RB 5CYQA 1K1SA 1LWEA 1XR5A 4O3NA 5KG0A 2WTFA 3FSIA 4TXSA 4ECYA 3DOLA 4KKOB 3E51A 3NAIA 1C1CB 4ICLB 2HAIA 4IFVB 2WCXA 4ZVHA 3V81B 2D3ZA 4EBDA 4WZMA 4KBIA 2FJXA 4KFBB 1C1BA 4LSLB 1N5YA 3IGNA 4WFZA 3EPIA 5KFAA 1TQLA 3RB4A 5JUMA 4FBTA 3D5MA 3G86A 1DLOA 2V0NA 4I2QA 3JYTB 4TY8A 3H40A 3MTKA 2RDIA 4H4OB 4R5PB 3DRRA 1C2PA 5DQHA 4TQSA 1S1TA 3QZ8A 5KFKA 4I2PA 3V4IA 4KV8A 1MMLA 3FFIA 1FK9B 3LAKA 1EP4B 1SH3A 2JC1A 4EO6A 4MK9A 2WONB 3ITHB 4YR0A 2V4RA 2YNIA 4TYBA 1HNVA 2C2RA 2BQ3A 2VG5A 2XGPA 3PJWA 3E01B 3SFUA 2C22A 4TLRA 4PUOA 4J9QA 1BQNB 4RW9A 4O4GA 2FLNA 4H54A 4X2BA 2OPRA 1C0TA 4IG3A 4Q0BB 4NLSA 3BSOA 1J5OA 2AWZA 1TL1A 4F4YA 4WE1B 5DQIA 1JLFA 2ZD1A 2J6TA 1Z4UA 5KG2A 2ASLA 2OPSA 1DTTB 4RW4A 3UQSA 2FJWA 2C2EA 5KFEA 2AGPA 1WNEA 1NHUA 3QGIA 1FKOA 2YNHA 1HYSA 5HP1B 3PW0A 4MIAA 4RW6A 1JLBA 3I0SA 4EBCA 2J6SA 1REVB 4Q43A 5KFTA 5KT4A 2R8JA 5KG6A 3BSCA 2IJFA 3KOAA 1DTQB 3I5BA 3HVTB 5KT7A 1VRTA 1TKTA 5DG7A 3PJXA 2OPPA 3UDLA 3M9OB 2RKIB 4NLDA 4G1QA 2VA3A 2IJNA 4RNHA 3C6TA 5KFBA 4EBEA 5CYMA 1TL3A 3LP1A 1HMVB 2ALZA 3IRXA 2BRKA 1JLEA 2I1RA 3LP0A 1T03B 4J9RA 3OHAA 5KG5A 3M8QB 1CSJA 5KT3A 3GIJA 4KB7A 1S6PB 1RT3B 2WOMA 3H4BA 5I42A 1JX4A 4RW8B 1T05B 1RTJB 5KFUA 4ECZA 1N6QB 5J2QA 2V9WA 5FDLA 3QIPB 3CDWA 5L1KA 5HLFB 3RB0A 1RTDB 3D28A 1S9EB 3DLEA 5L9XA 3OSNA 4K4TA 1KLMA 1TKZA 4KHRA 5L1IA 2B43A 2QV6A 5KG4A 4FS1A 4DL2A 4ID5A 2BQUA 3N6LA 1YVFA 2OPQB 2IM1A 5F8MA 4YQWA 2DPJA 4ECVA 5K14B 2W9BB 1UWBB 5KFNA 3LP2B 3KLEB 1ZTTA 4ZVEA 3BQ2A 3DRPA 5KFOA 5C5JA 2BR0A 3ICLA 1S1UA 1JLAA 4IKAA 1RT6A 4IDKA 3GV5B 2UVVA 1S1XB 3PW7A 2AX1A 4GC6A 1N4LA 4NLWA 2W8KA 4QPXA 4JV1A 3MEEA 4WXOA 5F8LA 5DLFA 4K4ZA 4R0EA 2UVRA 1VRUA 3G6VA 4EYHB 4MFBA 3CJ5A 3BJYA 1TV6B 3T5JA 2UVUA 1RT4A 4DEZA 5J2NB 5DGAA 5F8JA 4NLQA 3KLIA 4TN2A 2IAJA 4QW8A 3CDUA 1D0EA 3RAQA 3T5LA 3KJVA 2O5DA 3IS9A 5DQGA 1S9GA 3KHRA 3KK3A 5J2PA 1RA7A 2RF2A 2BE2A 3FQLA 2HMIB 3FRZA 4IH7A 3OL7A 4URSA 4K50A 4B3OB 1C0UA 4Y2CA 1GX5A 3QO9A 5KG1A 3IG1B 3M9MB 3KK1B 4ED2A 3OSPA 1S1WA 5L1JA 1OS5A 2HNZA 1HPZB 2B6AB 1K1QA 4KAIA 3DI6B 1QE1B 2YNFB 3SFGA 5KFJA 4NLOA 4YMEA 5EWGA 2ZE2B 1S0OA 4NYZA 3DLKB 4OL8A 4ECRA 5KFLA 3GIKA 5KFSA 2JEGA 4R8UB 1KHWA 4LQ9A 4ED8A 1IKVA 4IG0B 1HQUB 2FVCA 5I3UA 3CJ0A 3TQ1A 1S0MA 3I0RB 2YNGB 2IM0A 2W7PA 3QLHB 3KLGB 1TVRB 3DYAA 2HNYA 4WFYA 5CYQB 3NKYA 1LWEB 1JLQA 3DOLB 5KG3A 2WB4A 2AQ4A 2VG7A 2W9CB 3T1AA 1SV5B 4ZHRA 3CIZA 1XR7A 5DG9A 3GV7B 3IGVA 1C1BB 1N5YB 5KG7A 1QAJA 1S1VB 1S97A 3H4DA 4O44A 1DLOB 3PR5B 4I2QB 4TY8B 4ECSA 3CVKA 2DPIA 1JLCA 3PW5A 3DRRB 1R0AA 4KO0A 4QW9A 5F9LA 1S1TB 1MU2A 3ISND 3V4IB 4KV8B 3OL8A 3FFIB 3CJ2A 3DMJA 1S0NA 1BQMA 3C6UA 5J1EA 4RUCA 1HARA 2YNIB 1HNVB 5D3GA 3OHBA 4I7FA 3GILA 2VA2A 3LANA 4EO8A 3BGRA 3TAMA 2VG5B 4Q45A 4H4OA 5KFXA 1SH2A 1JIHA 3TVKA 3KLVA 4PUOB 3DDKA 3HKWA 3UR0A 4K4XA 2ASJA 2C2DA 4RNFA 4U6PA 4DL3A 3MEDA 4O4GB 2OPRB 1C0TB 4IG3B 4ED3A 1J5OB 2FVSA 1TL1B 3QGHA 4WZQA 1RTIB 5C25A 4O3PA 1I6JA 2E9TA 4ZPCA 1IKYA 1JLFB 2HWIA 2ZD1B 1QAIA 3CJ4A 5KFRA 3MFIA 3PW2A 3NGDA 4NLGA 3MF5A 4RW4B 3CWJA 4ZP9A 3GIIA 3T5KA 1TKXA 5KFDA 3DLGA 3KHGA 3I5AA 1FKOB 4DL5A 2XWYA 2YNHB 1HYSB 4H4MB 3MFHA 4RW6B 4RNNA 3MR3A 5KFHA 4ECTA 1JLBB 2FLPA 1LWFA 5KT5A 3KHLA 3QZ7A 4WXWA 3OL6A 2R8HA 4RW7A 3MR2A 4NLPA 3LALA 1LW0A 4ZP6A 1VRTB 1TKTB 4WFXA 4Y3CA 3RB3A 3PW4A 1LWCA 1RT5A 2OPPB 4WYLA 3NMAA 4M94A 2YKMB 4G1QB 2ILZA 5KFZA 4IH5A 5F8GA 3C6TB 4MKBA 2VG6A 5DLGA 5CYMB 4K4WA 1TL3B 3LP1B 3JSMA 3IRXB 1JLGA 4J9MA 2WK4A 4NLXA 3RBDA 1TP7A 4URQU 4IH6A 4NCGA 2FVQA 3H59A 2YKNA 3RAXA 4K4YA 2WOMB 2AX0A 1EETA 2GIRA 4PQUA 1RT7B 2GIQA 5F8HA 5EUHA 1HMVA 3PHEA 5J2QB 2XCAA 3DRSA 4RUAA 4J9NA 2HNDB 5FDLB 1T03A 3NBPA 2J6UA 1JKHA 1S6PA 1TKZB 1RT3A 1KLMB 5KFPA 2W7OA 4O3RA 3QYYA 2BRLA 4ID5B 4TYAA 1SUQA 2IC3B 4URGA 4Q8FA 3H5XA 2BANA 3V6HA 2XI2A 3BQ1A 3N6MA 4FS2A 3DRPB 5KFGA 2AU0A 1S1UB 1JLAB 1RT6B 4IDKB 3OLAA 3M8PA 3PZPA 4IFYA 3MECA 1IKXB 3KLFA 1VRUB 1IKWA 3KLEA 5C42A 4MFBB 1FKPA 2UUTA 4ECQA 4QWAA 2JC0A 4RNMA 1RT4B 1S1XA 5L1LA 4KSEB 1N56A 3DM2A 1IM4A 1XR6A 3MEGA 2RDJA 4JUZA 3KLIB 4PWDA 3N6NA 2IAJB 4DG1A 2I5JA 5C24A 3KJVB 3IS9B 1GX6A 1HQEA 1S9GB 1TV6A 2V4QA 4ECWA 5J2PB 4KHMA 4DL7A 2RF2B 2BE2B 4IRCA 4EYIB 3BSNA 3V6JA 2FJVA 5J2NA 1C0UB 3DOKA 2IM3A 3QO9B 4NZ0A 3KK2B 4O3SA 1S1WB 2JEJA 4IQXA 5HBMA 2HNZB 1RTHA 2GC8A 3KLHA 5HROA 2XI3A 2IA6A 5J2MA 4LQ3A 5KFMA 3RBEA 1NNDA 2R2UA 2HWHA 3ISNC 4NLRA 1S6QA 3CJ3A 2B5JA 4F4ZA 5KFFA 4IRKA 1IKVB 1RT2A 1HNIA 5KFVA 2BQRA 3H5YA 4LSNA 1RT1A 3V6DA 5EDWA 2FVPA 4IOBA 2ZE2A 1LW2A 2HNYB 3DYAB 4ED0A 1RAJA 2CKWA 1JLQB 2ILYA 4F4XA 5DGBA 4RNOA 2VG7B 4IR1A 5KFCA 2W9AA 4KKOA 4ZHRB 1S48A 1S49A 1C1CA 4RU9A 4QWCA 4NLVA 4ICLA 3OL9A 4IFVA 3EPGA 4Y34A 3V81A 4YP3A 4ZP7A 3G6YA 4KFBA 4O44B 4ZPBA 4LSLA 2W9CA 4I2PB 1D1UA 4F4WA 1SV5A 1JLCB 4HYKA 1R0AB 3JYTA 4KO0B 3H98A 1S1VA 1MU2B 5KFIA 4MH8A 4R5PA 3DMJB 4K4UA 4HKQA 1BQMB 3C6UB 5J1EB 4Q8EA 5D3GB 1RYSA 4I7FB 1FK9A 2UUWA 1EP4A 4RW9B 3BGRB 3TAMB 1RDRA 2WONA 3ITHA 4O3QA 5KT2A 2XGQA 3I5CA 3CO9A 3Q8QB 3G6XA 2D41A 1NHVA 3E01A 2AGQA 3MEDB 2ATLA 4YR3A 4IRDA 2WRMA 2OPSB 2QE5A 1BQNA 4TY9A 4ZPAA 3VQSA 4J9PA 5C25B 3H5SA 2R2TA 4Q0BA 1IKYB 2F8EX 3SI8A 4K4SA 4WE1A 4NLUA 2CJQA 1TKXB 4ED1A 4J9OA 3I0SB 3DLGB 3QGGA 1DTTA 4MIBA 1RTIA 1S4FA
chains in the Genus database with same CATH superfamily
1HBUB 3CJTA 2BDPA 3OVAA 2QYGA 1HKAA 4CLPA 2P9EA 4O4RA 2V94A 5EWFA 4B3MJ 1NM2A 3F56A 4ANEA 4BHQA 2CNLB 5I42B 4F3MA 5AE1A 2AJ4A 4RBUA 4F04B 3FVYA 1WC1A 2DTJA 1D8YA 4B3MF 4WPAA 4MK8A 3EUNA 3T5HA 4MKAA 2L9DA 2YKPA 5FIIA 4B08A 3EWGA 3O5TB 2MQ8A 5F0UA 1H7XA 4WK1A 1PSDA 5EX3A 4F3OA 2Q3PA 4B3SJ 1HHSA 9RUBA 2BXJA 1S6UA 3DDNA 4DX7A 3HHLA 5HROB 5J2MB 4RU2A 1UKUA 3M1VB 4NRTA 3HHKA 2R4FA 5ETNA 1NKEA 1S6QB 2CJ9A 2ERRA 1NB7A 1HBMA 2R7RA 3OFFA 3S8SA 4B3SF 4CO2A 2LQ9A 3EVWA 3QLHA 1K1SA 2MGZB 4JI7J 4ICLB 3UDEA 4ZVHA 1N5YA 2PI4A 1RKJA 4V19J 2HZCA 3SQGB 3CC7S 1MW7A 3BGOP 2WONB 2V4RA 4E8UA 2KYZA 1URRA 1UJ6A 1XMBA 4GKJJ 4FP9A 5LM7E 4JI7F 4J9QA 5U47A 4LFAF 1A7GE 4AL7A 3J81Y 1C0TA 1YLXA 3W61A 1E6YB 3OBIA 1M1HA 1ZYQA 5KG2A 4XDCA 1SJ3P 2VASA 3UQSA 3KTQA 1DQ8A 2G4BA 1VQOS 2LQ8A 4M5HA 1ZA1B 5KFTA 5LJ3Y 3HHLD 3PJXA 4LRDA 4DWIA 3C6TA 2CQBA 4FXWA 2KFNA 1T03B 3CCVS 2WSEC 4FN5A 5KG5A 1N34F 4LMZA 5KT3A 3H4BA 3DLJA 4RW8B 3R6GB 1SL1A 5L1KA 5DDOC 3DLEA 2MZRA 5L1IA 2B43A 1UFLA 5K14B 1VYAA 2RE1A 2X3GA 3LP2B 2H1YA 4NI2A 1JB0C 4O0NA 2Z2YB 1TV6B 4N41A 4UY8T 4FPRA 3BDEA 2RF2A 1WHXA 5CQGA 3KK1B 4ED2A 5B0EA 1ELOA 1DQ9A 2IA0A 3BF4A 4YMEA 2MKYA 4NYZA 1I1GA 5KFSA 2BW2A 3UVJA 3QT7A 1GTHA 4KJIA 2IM0A 1VGYA 4OJ3A 2HHHJ 4WK3A 2XLJA 3RR7A 3GV7B 2IHR1 3HM9A 1U6FA 2VV5A 2YTCA 4ECSA 3CVKA 1EHWA 2XSJA 2RS8A 1BQMA 3L7PA 2KJWA 2HHUA 1YITS 2HHHF 5DZ6A 5B0CA 4IG3B 1TL1B 3QGHA 2ZH4A 1DQAA 2PDAA 4B9VA 3MAHA 4ECTA 3KHLA 2VPWB 2BYCA 3UFCX 2DRAA 4DV0J 2K3IA 2XNRA 1V5IB 4ZVOB 5DLGA 4RUHA 2YKNA 3GJRB 2G2ZA 2GIRA 3M8WA 3IBCB 2QLBB 4DR1F 1B64A 4UF4A 2HNDB 2J7UA 2VBYA 1WG1A 5B0FA 1TKZB 2VODA 4ID5B 3TX8A 1VQMS 4KYZA 1IBKJ 4N7TA 3BPSP 1WEXA 2R3VA 3I4PA 3F41A 1FT8A 2RDJA 3CCJS 2XQCA 2CQHA 3KJVB 4G65A 4NMLA 3MOJB 3QO9B 4LQ3A 2FHOB 2DEIA 4USMA 5LMNJ 3TX0A 3CNQP 4CM2A 5KFFA 2AJ0A 1X4EA 2P5VA 3D54A 3DYAB 4B9UA 1PG5B 2KDOA 1DRZA 1C1CA 4RU9A 1LK5A 2IBOA 2ZFHA 2Q6BA 3NCPA 2B9EA 1YRXA 3JYTA 1KOOA 1XBWA 3QRRA 4ID8A 2Y3YA 3HHEA 2QE5A 2RAQA 1RLDA 2XS7A 3HLUA 2R7SA 4YOEA 2IRYA 2AZ3A 4C11B 3CJ8A 4LR7A 4C8ZA 1RWVB 5HQLA 1MG7A 1RT5B 3WQPA 3LP0B 3TAQA 3N01A 3VZIA 2QFIA 3HX9A 4DR5F 1G3OA 3H7HB 4MT1A 2KG0A 2AKWB 3HO1A 1RTJA 2W4DA 2EBGA 5IM0A 3MHYA 3CGIA 1X4BA 3AA8A 2IC3A 4YFUA 1RAOA 2YKOA 1GMUA 1KVIA 4U8VA 2R7VA 5K8PA 4D3GA 3MEGB 4DG1B 3RRKA 4NRUA 2DNGA 2DGTA 2DNYA 4Y2AA 1MLAA 1WELA 4EMDA 4F7VA 1NRKA 3KLHB 4QWEA 4CWBA 3BGFA 1RA6A 3QT5A 1QE1A 3BR9A 2R2SA 2YNFA 3RR8A 3IN5A 5LL6d 3EZUA 2LXIA 1RT1B 3MPVA 2R8KA 3TQEA 4IG0A 1U2FA 2NLWA 3DDIA 2XLIA 4Y2MA 3C14B 4KKOB 5ADZA 4EBDA 3NMRA 4IUFA 1S12A 3US5A 3IGNA 2HQDA 3H40A 3VVTA 4DI6A 3V4IA 4KV8A 1EP4B 3NNCA 2XGPA 3AB4B 5EHHA 2V8VA 2LCWA 1Q8IA 1R43A 1DTTB 4DL0C 4DSJA 2BOPA 2MZSA 3HP6A 4GMKA 3EVMA 2M2BA 3GJTB 1S0VA 3UO0A 2FC9A 5CYMA 4OHVA 3LP1A 3C19A 3NRBA 1NPKA 2CPEA 1RT3B 2DO4A 1NSAA 3W64A 2DNKA 3CDWA 4QIFA 4ALZA 1T9VA 4LF6F 3G82A 3QJJA 2BR0A 2LU2A 4WU3A 1RT6A 4NLWA 1XN9A 2KH9A 4JV1A 4WXOA 4USVA 2EG1A 3CJ5A 4EFAC 2Q1LA 2FDNA 1FEEA 1PBAA 3KK3A 4NXMJ 3W60A 4ZN3A 3HHLB 1F3VA 2QSWA 1OJ4A 1RUSA 4WP8A 4OYIA 1U4BA 4F2SA 1WSRA 1TL7A 4KHPJ 3BKTA 1HBMB 3RRHA 4OL8A 3G2XA 4AYBD 1SPBP 1Z2ZA 2W7PA 3QLHB 1UP1A 4FKXA 2L08A 1NKBA 2KG1A 2HRYA 2FHMA 1N5YB 1UVIA 3K89A 4KHPF 3H4DA 3VAHA 5BYQA 5ETKA 3M4XA 2DCUB 2VONA 2ZOFA 1SH2A 3FZ2A 2DK2A 4RNFA 1X0PA 3EICA 3KXDA 1C0TB 4HEA9 4L73A 1FWPA 2FZGB 3BBCA 1V3RA 2HWIA 2BVZA 1QAIA 4X4VA 4V1Ak 3PX0A 3AA9A 2AD9A 5AXLA 2G2YA 2W7AA 5KFHA 5E5NA 1L3VA 1UW4A 1NK8A 3MR2A 3LALA 4WFXA 2VKZG 1FE4A 4AL5A 2ILZA 3CDBA 2F3JA 2LXUA 1YIJS 3C6TB 1MN7A 1PC4A 2IYGA 4YB7A 2BZ2A 4B02A 2VOOA 3SQOP 3BH6B 3VGVA 3T1HJ 4DS4A 4DQIA 4O3RA 1YRTA 2ZH2A 2HRUA 4L74A 2ZJQQ 4NCAA 1F1BB 2N3OA 3TEHB 1KD1T 2ZBCA 4IFYA 5G0RA 1IKXB 3M32A 4LIRA 2DR9A 4LF7F 4JUZA 2P8IA 4HH0A 2FJEB 2V4QA 2RF2B 4USJC 3OQ2A 1VQ4S 2H65B 4IQXA 4FNIA 4CLWA 5HQMA 3UVJB 3SCJE 2YWEA 4X4OA 1IUJA 4DJBA 1H7WA 1X9MA 2EC2A 1KWMA 3G8QA 5ETTA 4ZP7A 2DGQA 2YQ0A 4LSLA 1NSPA 3QT8A 4CT8A 2DO0A 2XSJB 3W9HA 1BQMB 2LEAA 4WP3A 1TKDA 1FX4A 2HGMA 2RQKA 2GFFA 1MWQA 1F5CA 2CIMA 4Q2MA 1KQFB 5CXTA 2DRDA 4O0IA 2ZUGA 2EG2A 3RG6A 4NLUA 1Y9OA 3FMWA 3ZZRA 1RHRB 3A8IA 1BGXT 2V34A 1NMEB 3S7RA 5E33A 1HWKA 2C3YA 5CD4A 3NNHA 3QNWB 4FBUA 2XCPA 3ZZPA 3ZNUA 3EZOA 5GMEA 1Y4ZB 2YKNB 1BE4A 4X4TA 5DRKA 4C0OC 2HW3A 1JNZB 4KY3A 1SH0A 4LRCA 2LA4A 1QSSA 2ROEA 3D0IE 4YB5A 3D67A 4KPCA 1JJ2R 2Z30B 3OFHA 4EI2A 5E2QA 3BREA 3DRYA 4GC7A 3OTOJ 1P9YA 4YB1P 5ETMA 1BY9A 2A1BA 4WTOB 1T0TV 2VIHA 3OLBA 2Z57B 1NH8A 2AYEA 3NCRA 1URNA 1LXJA 1N8RT 2OTJS 1HA1A 1R89A 3OTOF 1L5UA 3OJSA 5FD1A 2VDHA 2F8HA 1KONA 4ZMMA 3Q8RB 1LWEA 4G1PA 4OI4A 2I8EA 1C1CB 2RSQA 1HBOA 2FJXA 2FGCA 1WWHA 1LOUA 1MN9A 2FY1A 3JYTB 2UUAJ 4A8QA 2CUYA 2U1AA 2OO4A 1RHUB 1IBLF 1AUSL 4EU0A 2R7WA 4ZVPB 2FLNA 3M8RA 3GR1A 2X1AA 2J6TA 3Q8YA 2HRTA 1YWXA 2LDYA 3PW0A 5E3QA 4IQMA 1FDNA 3BPDA 3CCZA 1B7YB 4NOHA 3W8PA 1UFWA 3L95X 3HSZA 3GIJA 4NE9C 1HNWJ 1RTJB 1UEUA 3ZZYA 1KFDA 4NPOA 3QQCD 5IM0B 1KLMA 1RGVA 4ECVA 3OUYA 2JLFA 2E5IA 3LPEA 3ICLA 1S1XB 3MEEA 1HNWF 2PD1A 3EM1A 1ZA2B 1IM6A 5D8HB 4J9UE 4TN2A 3EZ5A 2WSFC 5E3CA 2VBWA 3KHRA 3TQ1A 1UCNA 4EZ6A 4K50A 2KU7A 4Y2CA 2MLZA 3ULHA 5GAGI 2VQFJ 3FUYA 1QE1B 1T9WA 4NWBA 2YNFB 3ISZA 4DLEA 1IKVA 4IG0B 1TL5A 2MQLA 2ZVSA 2CQDA 1S0MA 3AH6A 4OZ3A 2HNYA 3D1QA 2WB4A 1QDUB 4PG6A 1MROA 3MMCA 3CIZA 3TAPA 5KG7A 4FVCA 2NCKL 1T95A 4BC7A 2VFSA 1JLCA 3T9ZA 4W92B 3W62A 4U67Q 2KHCA 3V4IB 3BDPA 4KV8B 1S0NA 3BN4A 3OHBA 3TAMA 5D0HA 3AQOA 3UR0A 4HVZA 1RJJA 1VR6A 2PFFB 4HTJA 3EJMA 4NCBA 4WZQA 3DFEA 5C25A 3OD2A 1S99A 3NS6A 3EXYA 2DXFA 1K9MT 4HDHA 1RHQB 4C4WA 1PKUA 3BZQA 4KGKA 4Y3CA 3RB3A 4OYAA 2B9YA 2EXUA 2CZVC 4CH1A 4USIA 5CYMB 3LP1B 1CJKA 4K4YA 2A0FB 2AJQA 2HQIA 1GK8A 2DNNA 2GIQA 2I38A 2KRBA 1HMVA 1KVJA 3QGPA 1IN0A 4BC9A 1FTRA 3N9UC 4URGA 2VD3A 1U1MA 1U1KA 3G82B 3V6HA 4KR0B 4KGXB 1RT6B 2KFZA 2CQ3A 2JDJA 1T3OA 4L76A 3R1LA 1Q7LB 5AXMA 3DM2A 2JRSA 2DISA 3ILIA 3DOKA 1FWKA 3KK2B 2VJVA 2G9OA 2KTQA 1B0VA 3R97A 1TL7B 2W2NP 3CD0A 5IZHA 3QSIA 3CB4A 5LXYA 2RRNA 3ISNC 1BHNA 3FEXB 5LMUJ 6AT1B 1R8AA 1OWXA 2RU3A 4ENOA 4RNOA 1PBUA 4QYZJ 2J0WA 2VJUA 3MM6A 3D6FB 1B0TA 1XNRJ 2YBVA 4MH8A 3M7VA 4R5PA 2MKCA 4X4PA 1ZZFA 2XGQA 1ROFA 4EK2A 3G6XA 1OYDA 4AE5A 2WVEA 3D6HB 2ATLA 4IRDA 4CLZA 3J7YU 2LP4A 2M8HA 2R2TA 4Q0BA 3CCWA 1PYOB 1REGX 3C15A 3IXQA 3VV2B 5IV4A 4UTGA 1RU2A 1VC0A 3ZTSA 3H2LA 9ATCB 4DR2J 1YI2S 3MPYA 5HP1A 3QFHA 1YQHA 2C42A 1H6KX 2ZHOA 4KE5A 5HATA 1U48A 4YY3J 1C4CA 2ZM6J 3M8QA 2ROGA 3O44A 4OIXA 4OZLA 4DR2F 1BUXA 3A8JA 1RTDA 2KT2A 4Q44A 1OY6A 4XO0A 3PHTA 3EX7B 4G1IA 3BS9A 4OYPA 3TO8A 4IFYB 5G0RB 2ZM6F 3Q8SB 3M32B 3SXLA 3Q2TC 4ZS6A 5A8WA 4NASA 3EGVA 2DJWA 5D0EA 2J0QD 5E7OB 3MCNA 2WAQD 1WDDA 1YBTA 1QUPA 2VB6A 4DSFA 4MYTA 4P2SA 2GHWA 3I0RA 3IWXA 4AFFA 3OJUA 2F9JA 2WTFA 2GO8A 4KBIA 4LSLB 2HVHA 3WX8A 2V0NA 3LUYA 4TY8A 3MTKA 3FBBA 3LAKA 4EO6A 2XM3A 2DRBA 2BQ3A 1FNOA 3PJWA 3SFUA 5HQ8A 3J7AN 4O4GA 2CVEA 2RS2A 2XO7A 1QAXA 5C2GA 4NX9A 2PC6A 4UOHA 1NJZA 4PZVA 1E6VA 4CO1A 3OFGA 4NL5A 2MLYA 2XEXA 1LWXA 4ZLNA 2IJFA 3THPA 3I5BA 3LQVA 1TKTA 2XYGB 4G1QA 1JNRB 4CRJA 5BYRA 2ALZA 1VQPS 2XULA 2HHWA 3D28A 4K4TA 2BQUA 5F8MA 4YQWA 3HSGA 1AW0A 1RWOB 4QYRA 2XWXA 2ZJRQ 1VQSA 2V2KA 3B78A 2W8KA 3GIRA 4ZIWA 4QU6A 3PRVA 4WU2A 2VPYB 5GAGU 3BJYA 3TA1A 2QEXS 1RT4A 1IBCB 1KS2A 2GAHC 3KLIA 3RAMA 5HO4A 3JQMA 3FQLA 3PIOQ 1RAIB 3OSPA 2HZVA 2DNPA 3CJKA 5I3PA 5D6GA 1TTHB 2NYIA 2BMBA 1U0HA 1Q86T 1GTEA 5DDQC 1LWEB 2MKKA 2CJYB 1FDBA 1HBOB 2F9DA 4I4BA 1S97A 2ZH3A 1WF0A 4WFAQ 2IIHA 4HDGA 3C6UA 3OXFA 3L7UA 4Q45A 3QATA 3O1LA 1Q95G 2ASJA 3MM5A 2WBRA 2VQEJ 1TFWA 3JQJA 1J27A 4ANCA 1N33J 2LU1A 2XWYA 1D9DA 3MFHA 3FRYA 3I6PA 2R8HA 1Q78A 4NLPA 5L38A 1FI4A 2ALYB 4URQU 3MMBA 1N33F 3B4DA 2HEKA 5HJXA 3VHQA 1JKHA 1KLMB 2J76E 2PMHA 1SUQA 5HMYA 4OV6A 3OUYB 1Q0NA 3UD3P 3DU5A 2N4DA 1FXDA 3M8PA 2COLA 2LEBA 4QR0A 1P27B 2UUTA 1Z2LA 4QWAA 5L8RC 4ETXA 2KL8A 2W2MP 2UV8G 1GX6A 1P6TA 1HR0F 3R9LA 4USUA 1RAFB 2HBZB 2GC8A 1EB0A 2BKOA 4DUZF 3ZTOA 3J7Z5 1XQIA 4FXDA 1IKVB 1RT2A 1F2GA 2XS5A 3RTVA 2HNYB 4ED0A 4NXNJ 2MQPA 2B4PA 1W7WA 1RQ0A 4ILLA 2RVJA 1KN6A 1MROB 3MMCB 1S5ZA 2BJ7A 4WIIA 1VQ8S 3DLBA 1L3UA 3KJNB 2Y8YA 3PNIA 1JLCB 4WKRA 1WC4A 5K8MA 5KFIA 2D9PA 2OSRA 2UV8A 4U96A 4RW9B 3TAMB 2LQJA 2NUHA 2AT1B 4B9TA 4YR3A 2CPDA 3VQSA 2CG4A 5C25B 1U25A 1UAWA 2XSFA 1LXNA 2RRAA 3Q89A 3R2CJ 5LSRA 1S4FA 2KM8B 4KC5A 4DOZA 1SKWA 2MLXA 4LJMA 4JI5F 4Z7YA 4K5RA 2VC1A 1FRXA 4K8RA 2YKMA 1FJEB 1F0XA 1HI8A 2FLOA 1XIQA 2JLEA 3NGTA 5LT5A 1X4GA 2CG8A 3A8KA 2QT7A 5LOQA 3DGPA 3FDSA 3UN5A 1UWBA 2PA3A 4CLTA 4DCOB 3GYNA 3KMQA 1T3NA 3SZ2A 4F50A 3DM2B 5L9NA 1VQ5S 2R8GA 2Z2ZA 3DOKB 5KFWA 1PAUB 2PGCA 3H2VE 2R42A 1WF2A 4F4KA 2FLLA 1VQ9S 1UPMB 3AJ2A 3CC4S 3MM6B 4OHWA 4WFZA 2A2CA 1TQLA 3NOCA 5HMWA 4XDDA 4R5PB 4TQSA 2H5JB 1R0BG 4TYBA 2HGLA 1F9EB 1SKRA 4CDIA 3W9JA 2C22A 4DPXA 4DU8A 4Q0BB 2JLGA 3C15B 3CD6S 2ASLA 2OEJA 1UETA 2JNJA 4LBHA 4EGLA 2FJWA 4UOGA 2JL9A 1FKOA 4ELTA 2YNHA 5T7LA 5HP1B 4PEOA 2B56A 3I0SA 4FF1A 5KG6A 5AJ3J 2LVWA 2LECA 2GGPA 4LF9J 4EBEA 3M8QB 1CSJA 1R31A 3PKYA 4OI6A 5FDLA 2KKHA 2CNKB 1RTDB 3MGJA 4ZVUB 4YHHJ 5AJ3F 3EVOA 2F4FA 2VFUA 3N6LA 3UCZP 4OX8A 5KFNA 1HW8A 4FVMA 2RRBA 1RCXB 2VU5A 4AQYJ 2QO3A 5DLFA 1VRUA 4DHVA 4OX7A 1RAEB 2F4VF 4QW8A 5J2PA 3FRZA 1F5AA 1O51A 1GX5A 5KOXA 1K0VA 2A3JA 4AQYF 3HJFA 2K7JA 5CYJA 5I3UA 1WKKA 3SDEA 3I0RB 2R7UA 1S79A 2RT3A 2VG7A 2DBBA 1NH7A 5DG9A 5ITHA 3CTRA 1WOSA 3PFOA 2JX2A 4TY8B 1PIEA 5A8RB 3PY8A 2K06A 1EX8A 5B0GA 3AD7C 5B0AA 4O4GB 1WTBA 5KFRA 3W66A 3MFIA 2ZC3A 5GADI 2QSFA 5LXRA 1E6VB 3SCLE 2W2QP 2A10A 1VC5A 3QZ7A 1LW0A 1TKTB 3BM7A 4G1QB 1JLGA 2AX0A 3HI9A 4FYXB 4LF5F 3NBPA 2W7OA 1S6PA 2GHPA 2MZTA 4NMXA 4Y2KA 1TUVA 2XI2A 3I96A 2AU0A 2ATCB 2KI2A 3R7SB 3IWNC 4ELVA 1DHMA 1UPPA 2JHEA 2E66A 3DOMA 1RT4B 2CPZA 3KLIB 2EFNA 3K58A 2HK2A 2IJRA 5E3AA 2M8DB 2FHKA 1FKAF 3PJ9A 4DPYA 4CCHA 4O3SA 4DFJA 1I94J 5KFMA 4F25A 3RBEA 3CJKB 3CJSA 3PDNA 4OX9J 4DR7J 4IRKA 1U0HB 3H5YA 1ZAWA 2J9DE 1LW2A 3KUEA 2ILYA 3H90A 2UZAA 4DV5J 1TK0A 1U2RA 4HYKA 1SJFA 3VAGA 1SC6A 2ZZNA 3C6UB 3AAWB 2UUWA 3Q8QB 3IR6B 3MM5B 2SXLA 4DV5F 1TK8A 1P1TA 2F8EX 1KTVA 3MR7A 3EYZA 2ZKTA 4K4SA 3FBFA 5FJ4A 2IVFB 4DPUA 3HZEA 5CZXA 2CPFA 2AJ2A 2WHOA 2AJFE 2NSBA 1M5OC 3H25A 3ZTPA 3LAMA 1KLNA 3E3XA 5CA5A 3MMBB 1FHTA 3QIDA 1H3DA 4DL6A 3L09A 2C2ZB 3R8YA 2UUCJ 3D68A 1JKHB 4ZPDA 1SUQB 4WP9A 2VPZB 1U1NA 3H2UB 2B9XA 2FVRA 3M8PB 2RDDA 1H72C 2ROPA 3HPOA 4DV1J 1KOHA 4JV0A 2NUUG 3TJ8A 2UUCF 4C8LA 2BJ3A 3K2YA 3SCKE 2OSQA 4DV1F 2CPYA 1HWIA 2E9ZA 3VAMA 4M1KA 1CJTB 1RT2B 3GU0A 3HFVA 3HK2A 3CD5A 2P9GA 2ABYA 3FEYB 4UOCA 1GFWB 4C8MA 3TW0A 3FSIA 1V3SA 2BOAA 2Z58B 3DHXA 4WZMA 4OQJA 2A18A 4FBTA 3D5MA 1U6BA 4A8MP 3LW5C 2YNIA 3HHNB 2DCLA 3PKMA 3PEJA 4P10A 2K8GA 2AWZA 1Y3JA 3QT6A 2Z0GA 4RW4A 4ELUA 4HR2A 2OEKA 3AOBA 3K5OA 4F8RA 5JMNA 4P6QA 2VA3A 2IJNA 2VOPA 2CDRB 4RUBA 1A6LA 5I42A 2CQ2A 3GYXB 4I64A 3IRWP 2XMVA 4DL2A 2QV6A 2QLXA 3DGPB 3R7BB 5B0DA 5IWAJ 1UWBB 4JV5J 3D1OA 1S1UA 1KRPA 3PO5A 5IFMA 4OZNA 4Y0FA 1H2UX 5DDRC 1Z1ZA 3B82A 5B08A 2EFVA 1OPZA 3EMTA 1HI1A 4DCJB 8ATCB 5IWAF 4X66J 1FTCA 2G2OA 2L9WA 4JV5F 2EFPA 1S1WA 4U7UD 4KAIA 4A46A 1NSKL 1RISA 4B9NA 5KFLA 4ED8A 2WB1D 4B9LA 4GO5X 4X66F 2W9CB 3R5JB 4O44A 3RUBL 4C8YA 2DPIA 1FEHA 1UJ4A 2FZCB 1ZZNA 1WC0A 2AYMA 3HT3A 3SQGA 3TVKA 2YKQA 4ED3A 3GMGA 1RTIB 1I6JA 4ZPCA 3UNYA 3DLGA 5A76A 1FKOB 2YNHB 2V4JA 4OJHA 5T7LB 5HVGA 4DV6F 2HHQA 3E8OA 1HW9A 1UVKA 4ZP6A 4EZ9A 1LWCA 3KDNA 2GGPB 3OTEA 4K4WA 1GT8A 2WK4A 3MAQA 1FCAA 3H59A 5I4MA 5DJBA 1EETA 4OZ2A 5F8HA 4GKKJ 4H4KC 2Y9HA 5FDLB 2HQCA 1T03A 2BKNA 1QVFR 4PXBA 2M5YA 1EZZB 4N8OA 1PYSB 2PO4A 3O8WA 3AJDA 2MKHA 1OY8A 4GKKF 1VRUB 1B0PA 1FKPA 2W4PA 2XG8A 1PILA 2XMJA 3CIMA 2HQ3A 4ECWA 1TV6A 5J2PB 4DL7A 1NK7A 1CVJA 2DH7A 5D78A 5HBMA 2B4VA 4B17A 4UQGA 2R2UA 3K5PA 3CJ3A 5A0YA 3SDEB 1UZDA 2D69A 5ETRA 1FD8A 5A2QY 2VG7B 4JI1J 2QFJA 2QX0A 1TAQA 2GJFA 3R3TA 1D1UA 2CPIA 3GCXP 1RZMA 2XMAA 2CNOB 4HKQA 1HWUA 4C0HA 3SSQA 4O3QA 3CO9A 1ZAVA 2ZHBA 3E01A 3CC2S 1NLKL 2Q66A 2OPSB 3CCUS 4ZPAA 3ENVA 1LKZA 1MWYA 1U1PA 2QYCA 3PCOB 1U2CA 5RUBA 3NXZA 5IC4B 2KB2A 1LW0B 2E5GA 3GV8B 3HVTA 1MNEA 5KT6A 4FF3A 1S10A 1JLGB 2L9NA 3QBCA 3P5TL 2QIFA 3TVZA 3LWLA 1RKIA 2C2KB 4WWSA 4OFZA 1XMQJ 2MB0B 3GSDA 3NBPB 3IO1A 4I1TA 2MKJA 1OSDA 5HLFA 5IV3A 1TL4A 2HNDA 1DARA 4A8XA 1KHVA 3SIPB 2IDEA 3R7NB 2IMWP 2O3DA 3SEOA 1U0SA 3W5ZA 3TJ9A 3OR2A 3TARA 1HHTP 3DOMB 2E29A 1FRHA 3PV8A 4OI3A 4DXLA 4RZRA 3I31A 1SJ1A 4F26A 4ECXA 4B3OA 4MYUA 3CMES 3MR5A 2FD2A 2KO1A 3IBFB 1I3OB 4NLYA 5D4NA 1UW9A 3AXMA 1LW2B 1TK5A 1S9FA 2DGWA 2G0IA 5CYQA 4ECYA 4TXSA 3DOLA 3UDVA 3E51A 2KVIA 4UUXA 4OYOA 3A12A 4I2QA 4ZPWR 3A3OB 4KH1B 3GG0A 1EAYC 1MMLA 3SV4A 4MK9A 3WHIA 5D0RA 3GB0A 1BWVA 2V69A 2BACA 1DFDA 2GQQA 2ZD1A 2Y1JA 2GVDA 5HI7A 5A2QU 3N0VA 1UWAA 3GP9A 3QJPA 4UUWA 5KT4A 2ZUAA 1VRTA 2YX4A 3UW1A 4DFPA 3LP0A 2E1PA 3UDCA 1NO8A 1WEYA 2W4CA 2AZ1A 2NXEA 2FY8A 1Y11A 4RLEA 5ETSA 3RB0A 3WIVA 4DDFA 4FF4A 4LF4J 4IDKA 4C7QA 2DY1A 3Q2SC 5F8LA 1ZPVA 5GVQA 4MFBA 2ZH6A 3K7RA 5J2NB 2NSCA 4C97A 1MMNA 3OVBA 2DY9A 1HIYA 3T9NA 2E44A 5KG1A 3J7ZT 1H74A 3K5LA 5C7PA 4ZCLA 1WD6A 5KFJA 4NLOA 5EWGA 2ZE2B 3HZGA 1NPPA 1K73T 3FK4A 3RRGA 4X84A 2R7OA 4WFYA 4PXDA 2H5EA 1EQMA 3IGVA 1RBAA 3HVRA 3CCES 1QJHA 1U24A 5CHCB 2DYAA 2YNIB 1VQKS 4EO8A 1BLUA 2N4CA 2DIVA 1G4CA 2K3KA 2AYBA 4RW4B 4RO0A 1TKXA 3DKDA 4P72A 2DHHA 2FLPA 2H48B 2GJ2A 4QIEA 2C3MA 2BE7D 2ZBPA 2QA2A 4WYLA 4X4RA 3N5FA 2FC8A 4LF1A 2OHDA 3JAMY 3MCMA 4PQUA 3MMJA 2AJ1A 4X62J 1FE0A 1RT3A 1Q5VA 2ASYA 1X4CA 1LFPA 1Y5NB 1S1UB 3MECA 3M2RA 1HHQA 4USTA 1I51B 1UMJA 1UFKA 2XMWA 4PYDA 1RWKB 1UL3A 3TZYA 1JJHA 4EYIB 1FDDA 1S1WB 4Z7CA 2XI3A 1X4AA 4HACA 3ENWA 1F9HA 4KTQA 2NXNA 2KT3A 1R8HA 3N4WA 4EWTA 2HFZA 3P49B 2YXLA 2XB2D 2HKEA 4IFVA 4O44B 3D2WA 1R0CB 1S76D 4F4WA 2Y1LB 5IOLA 1JXVA 4Q7AA 3ITHA 2DB1A 3J7A1 4B3TJ 1VS3A 2WRMA 4J9PA 3H5SA 2UUBJ 3DLGB 1DBDA 2V4JB 3GIMA 3U02A 1X5OA 4QQBA 3NWRA 3L4BC 5KFYA 4B3TF 3TEGA 1LWCB 3KHHA 1DTQA 3NAHA 4J37A 4GKJF 2KZZA 4MK7A 2UVWA 3DLHA 3BGLA 4F36A 3GQCA 3TUPA 2UUBF 1M5VC 1EETB 4DR3J 4ECUA 4CO3A 2DITA 1ZH5A 4MJKA 1HBNB 2OD4A 2CQIA 3OPKA 4JI3J 1QLNA 7AT1B 5MLCV 2GV1A 2L41A 1RWPB 2J7KA 1CLFA 2Q79A 4M5DA 1RI7A 3MOZA 1VBZA 3MUMP 3ET6A 2KJVA 3T6JA 2D3UA 4DR3F 2PT0A 5E41A 1FKPB 2YWKA 4L3NA 3BYRA 4J91A 4NLTA 4JI3F 3IA0A 1SVDA 1IKXA 4QZVB 4UY85 1Q53A 1XMOJ 4JI8J 3JAMU 3S1TA 5HBMB 3IR7B 2VFRA 4CTAA 3Q8PB 4IR9A 5A0YB 1X5PA 1ZM3A 1XMOF 4JI8F 2HWTA 2H4YB 2V8PA 4DBQA 1C1BA 2OIHA 2YVSA 1ZPWX 3GR0A 1UEKA 6FDRA 4FDFA 4PG5A 1RLCL 1O8BA 2C2RA 3E01B 3I82A 4FF2A 4F4YA 4BLGA 3AFGA 3HD1A 1CG2A 2IFXA 1N5SA 4EBCA 2CQ0A 3HVTB 3HXMA 3LPYA 1FNMA 3MMAA 3PYEA 3JSBA 1YZ7A 2AMCB 2DNHA 1NDPA 1H38A 4ECZA 5HLFB 4KHRA 4FS1A 1Y10A 2IRXA 3MTJA 1S72S 4DV0F 5HVFA 2R7TA 3OR2B 4R0EA 3L3CA 1XWLA 2IDLA 1WOPA 5F8JA 3NOGA 3RAQA 4P71A 3T5LA 3CO0P 4ZN1A 1RA7A 3OL7A 4DUYJ 4P9SA 4URSA 4B3OB 4Y28C 5ETPA 3F44A 1SQFA 1IBKF 4F3QA 1YJ7A 4DPWA 1XK8A 1KHWA 4RBVA 4C2MA 2QJ3A 1CEZA 3DXSX 5CYQB 2HVIA 2HVEA 3DOLB 3PO4A 1TMMA 4ANDA 4ZHRA 1XR7A 1RHKB 2RUSA 2OUGA 4I2QB 4OYWA 5LMNF 2IY5B 3FCWA 3GSIA 1HARA 2ADBA 5A6PA 1Q4RA 4TU8A 3VVUA 2JZ5A 3LH2S 3SYZA 2ZD1B 2GVDB 4ZP9A 3GIIA 2CWXA 1FRJA 1FERA 5HL7Q 3EGWB 1SI9A 4AD6A 4FPIA 4RNNA 4OYZA 2EPIA 2B3TB 1VRTB 3IAS9 1LEOA 2OI2A 2RILA 1PJ5A 2XZDB 3CCQS 1S6OA 3VAKA 2M3DA 3TWZA 1VIOA 1J5EJ 2MQOA 3F0NA 2QL9B 4DMZA 3M8SA 4J9NA 3RZAA 2RQ4A 3GWCA 2J6UA 4JI2J 3NS7B 4TYAA 2HURA 3G71S 4CO4A 4IDKB 2PA8D 5AXKA 5GMKa 4BS2A 2RHQB 4ZIVA 1UA0A 4MFBB 1YBUA 2EKYA 1S1XA 3VTIA 1XR6A 4DF8A 4JI2F 3HT0A 2XBPA 3V2UC 4UQTA 1NDCA 3TOQA 2FJVA 4OZ1A 2O01C 3ZC4A 2JEJA 4PWWA 3W5YA 1CJVA 3KJQB 4P52A 1NNDA 2ACMA 1T8EA 4HI2A 5T41A 2J7WA 3V6DA 1MMDA 2ZDPA 4OZ5A 2XY5A 1PC5A 3GONA 3KFWX 1UTAA 3CD7A 3BYPA 4ZPBA 8AT1B 5A8KA 2DHSA 3D0HE 4OYBA 5JVHQ 3G96A 1X31C 4OMFG 1FK9A 3D0GE 1RDRA 2GIFA 2NXUA 2D41A 3KNGA 3NNAA 4I68A 2VBXA 3T41A 4LT6A 2VHGA 1TKXB 4PR6A 2L3MA 2XZWA 3FBCA 3BQ0A 3H42A 3VGSA 2Z4PA 3P3DA 1JLEB 4YR2A 4L72B 3CJQA 2F5GA 2FZKB 1HNXJ 4PCQA 4PQUB 3PYGA 3CULA 3UD5A 3KMSA 2Y1IA 1OMSA 2OTLS 2HAFA 5ETLA 3TI0A 2JVRA 1RSCA 3LF0A 1SKUB 4JI4J 1KFSA 3MECB 1WORA 2ZNZA 2XMMA 1TELA 3PG9A 3SV3A 3M2RB 1ZM9A 2HBYB 4M63A 4ZP8A 3DNCA 2WVFA 1OPIA 4HACB 1HPZA 2B6AA 3MXHP 3KK2A 4HT7A 1D8ZA 3M9NB 4LIWA 1F3FA 5KTQA 1HI0P 2P6SA 3K8WA 4QWDA 5HMZA 4K59A 1MWZA 2JJ4D 3LTOA 1OSCA 2HAIA 2YWHA 4IFVB 3BO3A 4NXMF 2HSEB 4K0KJ 3CCLS 1YK9A 3GZ7A 4H4OB 3DRRA 2A6MA 4A8YA 2EEYA 3QZ8A 5HSPA 5AXNA 2UXDJ 3ITHB 1HNVA 2G13A 4DR6J 1LFWA 2LEPA 2RH3A 2MZJA 1T9TA 4NLSA 4K0KF 2H5IB 1VQ7S 2KRRA 2JWNA 5K9FA 1FD2A 4NA3A 1AT1B 1WG5A 4QIGA 5KFEA 1NHUA 2RJZA 2UXDF 4MIAA 4DR6F 3GJQB 1R8CA 3HD2A 1LQ9A 1DTQB 2BM0A 4FKYA 3K17A 4J9RA 3S01A 4Z2XA 1LV5A 1V5VA 1T9UA 3UN3A 4DU7A 1AZSB 4NYOA 4RR5A 5H1SV 5L9XA 3R5DA 5KG4A 2DVIA 2IM1A 1U49A 4M5DB 3D9BA 3ET6B 4XTTA 1XERA 2AX1A 1N4LA 4DPTA 4PABA 2IAJA 3T1HF 2O5DA 3Q8UA 3OW2R 2JOQA 2UP1A 2QG9B 4CTAB 1QTMA 3SFGA 3ZNJ1 1S0OA 3VAJA 3H8YA 2X1BA 2JEGA 3W5XA 1SL2A 1JLQA 2H3EB 4PG8A 1VFJA 1SV5B 1Y5LB 3KUGA 5D77A 1C1BB 3VCDA 1QAJA 1S1VB 1RK8A 2EI5A 2VFVA 3OL8A 3TUJC 5D3GA 1KQGB 3GILA 4L75A 2DHGA 4J9VA 4ZDNA 3IMQJ 3AB2B 2OMLA 2YQ1A 3ZZ0A 1ITPA 2E9TA 1R6YA 3NGDA 2QC3A 3T5KA 1CQMA 3KHGA 1YX2A 2B8PA 4QU7A 2A6OA 3PW4A 1FO1A 3X3UA 5KFZA 3MMAB 1SJ4P 1D9FA 3T3FA 1JJCB 3VAFA 3F73A 3RBDA 1RHJB 4IH6A 5K8NA 3HSJA 2LA6A 1RT7B 4NYPA 4M5KA 2V8GA 1WTFA 2VZ9A 5KFPA 2WBMA 4ZVTB 1IBMJ 3OLAA 2E1MC 2KVQE 5AT1B 4PKDB 1WDTA 1VLOA 3POTA 4CO0A 4RNMA 4YB6A 2RU9A 3PX4A 2IMOA 1F2HA 4KHMA 4NZ0A 2AW0A 2KT5A 5IQ6A 8RUCA 2GMJA 2MMYA 1UVLA 2PFDA 1D3WA 1T02A 4LSNA 1NCLA 4KIAA 4IOBA 4ZJLA 1J2VA 3M8ZA 2UXCJ 1IJFB 2W9AA 4ZHRB 5BR8J 2K1RA 2ZBQA 4KH0B 4I2PB 2FHJD 3ZZOA 1VJQA 4O23A 4C3KA 2E5HA 2Y8WA 4CZCA 5FLXY 1RP5A 1KKHA 3O6QA 5BR8F 2AGQA 1TZ0A 2ZH8A 3MAAA 3HMJG 4ZOSA 4E98A 4LR9A 4PYAA 2UUAF 2C1EB 2ZH9A 3Q86A 3TJAA 1WHYA 4EEYA 4ILRA 3TUIC 2G1HA 1IWGA 3ZO7A 1UJ5A 4DN0A 4F0KA 2LKZA 3EGZA 1DJ0A 4TQRA 1RWUA 2ASDA 5IS2A 1WSVA 2NPIA 5JXSA 3RU0A 5H9EK 2ZBRA 2HVDA 1WF1A 4I6AA 1VHIA 2UXBJ 2GMHA 2GA7A 1EKRA 3KG1A 1LNQA 1F60B 2J9EA 2IM2A 2DR6A 2AV5A 2R8IA 3FC9A 2HPUA 1CJVB 1VOMA 3DI6A 1GXTA 4MKYA 2K7KA 3V6DB 5ETQA 1SJQA 3P96A 2DNZA 5A8KB 3PRBA 3RB4A 3QJLA 1RBLA 2ZOGA 3N28A 1FRLA 2MY8A 2VQFF 1TMJA 4OJGA 1NB2A 1SH3A 1FK9B 1QD1A 1YJUA 1N54B 2BABA 4RW9A 5HK4A 4X2BA 2OPRA 3BSOA 3R5BA 2N7CA 1RHMB 4TKTA 1N5VA 1Q1KA 1Z4UA 2LXFA 2KZMA 1T11A 4XIUA 1TU0B 4M5GA 4M5JA 4Q43A 2DEJA 1OY9A 4C6AA 1SXLA 1M1KT 4P2FA 3M9OB 3OV7A 4KB7A 3S6EA 2WOMA 5FLXU 3GYGA 1WACA 5KFUA 1MSWD 5G4DA 3DHWC 4N47A 2KYXA 4L6V3 4YUDA 1CJUA 5MAOA 1FFGB 4ZVEA 1T9XA 2DNRA 4GC6A 4CLSA 1B7FA 2DT9A 3P4UB 3G6VA 3T5JA 1WHWA 2UVUA 1NPRA 2ZOMA 3R27A 1D0EA 2GQ2A 3H20A 1FRIA 1C0UA 2OAUA 1HPZB 2B6AB 6FD1A 2D3OR 3C16A 2IVMA 3X1LB 4ZLJA 3NKYA 4LFAJ 2EVZA 3ZZZA 1SC4B 2AQ4A 2F7VA 4M5NA 2QL5B 3EXCX 3H0PA 3G8TA 1CPZA 2MKSA 3IFEA 3DRRB 4DV3J 1SL0A 2B0GA 1MU2A 3ISND 3FKBA 4I67A 3DMJA 4KPYA 4RUCA 3P8BB 1HNVB 3BGRA 5LMUF 5KFXA 1SIZA 3MD1A 3HHLC 4FYYB 4K4XA 1FVQA 4DL3A 3PFEA 1N34J 4O3PA 2HHTA 3JTPA 2QGFB 4NLGA 4QR2A 5B09A 4DV3F 3I5AA 3RBZA 2QMWA 4H4MB 1XNRF 2KXFA 3MCOA 3MUVP 2RHSB 2VF3A 4U7UK 4C8OA 3TZWA 1P9QC 2LDIA 4KRWA 2J9DA 3QYYA 2OD6A 3CPWR 4HT5A 3N6MA 2XMTA 2GVZA 4ED4A 3KLFA 1NEEA 4YY3F 3HHDA 3D66A 5L1LA 4KSEB 4W4MA 4PWDA 1KNZA 2IAJB 3WX4A 4PRFA 2Z8QA 2NXJA 3BSNA 3J80Y 3WDOA 3M30A 2FJDB 2IA6A 3D4JA 3E2EA 4KGZB 4DQQA 2BQRA 5KAKA 2K2PA 1FRKA 1JLQB 2IYIA 3AD9C 1OO0B 4ZCKA 2B4OA 2HFSA 2HYIB 1X8DA 2ZDOA 1YHQS 4ES2A 5D3GB 2W01A 3CF5Q 5A8RA 2ZJPQ 5ETOA 2OP5A 1BQNA 3R6LB 4WE1A 1RWMB 4DR1J 4ED1A 5F3TA 2DKOB 2APOA 3CE8A 2Y0BB 2VC0A 4X4NA 4LUBA 2ZWOA 4J9SA 3PX6A 4J9LA 2OLWA 2CADA 2PN6A 4LR8A 4C3MA 4DL4A 2RMLA 1U8SA 2U2FA 3J81U 1T05A 5KFQA 2X1GA 2CQ4A 1S9EA 1BXNA 2QLFB 1RYRA 5DDPC 5F8NA 4E0DA 1U02A 1WUUA 2O1PA 3POTB 2QMXA 3CCMS 4JI0J 2AGOA 2KXHA 4ZKAA 2HK3A 3AT1B 2M88A 4G3IA 4WIQA 2DR7A 4LSNB 3ETMA 4JI0F 3OR1A 3P5BP 2F63A 1WHVA 1TVRA 5IXUA 2I9SA 2DHXA 2WCXA 2K1RB 1GH8A 5D4LA 4C8KA 2D74B 1S1TA 3FFIA 4YR0A 4JP8A 3CCRS 3J80U 1KQKA 5LJ5Y 2VG5A 1U1QA 3MAAB 4UOFA 2V68A 4DR5J 4PQAA 2VFTA 2MKIA 1FXRA 5DQIA 2C2EA 5THWA 3TANA 3FMBA 1GQEA 1KC8T 3ZXWA 1VCTA 4IYQA 2BEFA 4KQZA 3IRXA 2VQEF 3OHAA 4I69A 1KVKA 1BC6A 5J2QA 3KWMA 1NJIT 1SIWB 2MZQA 3OSNA 2R7QA 3U7JA 1X5TA 1AFJA 4M5IA 1N0UA 2J9CA 2Y0SD 4PWUA 2DR5A 4P74A 3KLEB 5C5JA 1VQNS 2CQPA 3OTCA 5L39A 4P73A 2CA9A 3GLJA 3ZFVA 4I56A 3HULA 4DEZA 4Q2LA 3CDUA 1IWAA 5D15A 2BE2A 3LOUA 2W25A 1HD0A 4CP5A 2BA9A 3DI6B 1H2TZ 2M9KA 2FQQB 3MD3A 3W2VA 4CH0S 2HQGA 3TYTA 2ZH1A 4U95A 4LVOP 1CJTA 3UD4P 4PG7A 2QMUB 2WW4A 3GCWP 4NA2A 2V2ZA 1U1LA 3TR5A 1APSA 2AHOB 5AE3A 3DU6A 1M5KC 2XZTB 4HTIA 2J8SA 3BBFA 3HSDA 3G8SA 1RTZA 2VA2A 4ZPTR 4LF2A 2MYFA 5IT4A 4DFMA 4U6PA 4NXNF 3CT9A 2OPRB 1K0TA 5CABA 4GVBA 1IKYA 4XAKA 3I9V9 3CWJA 5CCMA 5KFDA 4HHUA 2OMOA 3TP2A 2EFOA 4WXWA 3OL6A 4LF6J 4RW7A 3EDRB 2JFKA 1P8GA 3VWSA 4OJ1A 3M8YA 4WTYA 4WKYA 1CC8A 1U6ZA 2JH3A 1YKWA 4OYMA 3JSMA 2HQFA 3THTA 7FDRA 4N5SA 1RADB 2DH8A 2WOMB 4DF4A 5DO2A 5EUHA 2BJDA 4MKVA 4RWXA 1R8BA 1CJUB 2ZZMA 4F2RA 3H5XA 3PIPQ 1A9NB 2BM1A 2V8DA 4WF9Q 4ZVQB 2DNMA 4F67A 1IKWA 3RW6A 1HWLA 2G0CA 3N6NA 2I5JA 2H51B 4QJVA 5EN1A 1C0UB 4B9MA 4UZBA 3DC2A 2FJAB 2ADCA 1U1RA 2HWHA 3C16B 4NLRA 5J1PA 1M5PC 2QA4G 5EDWA 2MQQA 4RBTA 4HH1A 1S49A 2QTWA 4RKUC 4NLVA 1PYTA 3EPGA 5K20B 2W9CA 3I4HX 5K8OA 4F0MA 2FB0A 1MU2B 4FZVA 4AT1B 3DMJB 3BGRB 3VAIA 3FCVA 5E3RA 2BJ9A 1AUDA 1N88A 1ZM4A 3VZHA 4UZCA 2W1BA 3A3PB 4TU7A 1RTIA 1OYEA 1FJCA 2A2DA 2KHDA 3BGUA 2PI5A 2GW8A 1H73A 2RKIA 3QWPA 4WYWA 5M2PA 4U7CA 4YDXA 1Q81T 3DLEB 4LF7J 3SMZA 4B3RJ 4IO9Q 2RIJA 4C8NA 3PVXA 3AY0A 1VHFA 4OLOA 2C3OA 2FPHX 2OPQA 1FA0A 1NK6A 3TA0A 2W9BA 4IOCQ 4NI2B 1YDLA 2GVZB 4XPEA 3OXGA 1M1GA 2PMZD 2VH7A 2YY3A 3KLFB 1WKLA 4ES1A 4LF9F 4GO7X 2HFVA 2KXNB 1KR4A 4B3RF 1WI6A 1SJRA 1VJWA 4DCPB 4BWMA 4PWDB 3UPFA 4C98A 3EGNA 1S77D 3OXLA 4AL6A 4YHHF 3M30B 5HN0A 2XTJP 2QL7B 1TFYA 1N5TA 2N82B 3DLKA 4R8UA 1HQUA 5BXIA 2YNGA 4WJBA 4DLGA 3VQTA 3NAIA 4HLBA 4A47A 4TU9A 1X9SA 2WVDA 1NJXA 1HLWA 2E7WA 1FWLA 2RDIA 5CAAA 1AB8A 2JC1A 4M5MA 5F41A 4DZ6A 2OJ3A 5HAOA 1UEVA 4HHHA 1BQNB 1J5OA 4WE1B 5DZ7A 1JLFA 2J5AA 2V9KA 2OPSA 3UWTA 3J7YI 3QRQA 3GE9A 2KFYA 1HYSA 1PJ6A 1H2VZ 3UDLA 4NLDA 1B4SA 2MEWA 2R7XA 1IQTA 2I1RA 4GRSA 2V6AA 3CCTA 5BJRA 4WFNQ 1T05B 4CNYA 2Z2MA 4X65J 1S9EB 2ZZTA 1S4EA 2IPOB 4UT4A 3WBZA 3GFZA 1IJEB 1DZ5A 4Z37A 1JMTA 1Q82T 4QPXA 1FX2A 2E1RA 4EYHB 4HI1A 1UA1A 4N76A 4PXCA 2I0XA 1FNXH 4X65F 2E1CA 4W90B 2YPYA 1AROP 4F0HA 1S9GA 1HWJA 3RGIA 1L3SA 2VPXB 4CM0A 2RB7A 2ZHAA 1OS5A 3M6WA 3CUNA 2V50A 2GMLA 1YJWS 1SQEA 2EFGA 2CAJA 1IBLJ 3GIKA 2IRUA 4LQ9A 3OR1B 4YEAA 4DV4J 2OELA 1TVRB 3CW2C 4OHXA 5E0OA 1B3TA 1QY7A 3VALA 4NZ6A 3PR5B 1TR0A 1I94F 4P7TA 4KO0A 1S1TB 3FFIB 4OX9F 4DR7F 4DV4F 3FZBA 3MEKA 3LANA 2J0XA 2VG5B 1FFWB 1M90T 5JVGQ 3DDKA 3W3SA 3MEDA 2NQPA 1JQGA 3K59A 3CJ4A 1F5BA 3QPIA 4DL5A 2P6TA 4LRAA 1ZOTA 1R8PA 3TZXA 2CDQA 1Q16B 2GCFA 4MKBA 1UVNA 3IRXB 1TP7A 4RX6A 1H98A 3IC1A 5J2QB 3UI3A 1U1OA 4ZA1A 2IC3B 2E7VA 2ZBIA 4ZLPA 1EKSA 3PZPA 1YRUA 1EIYB 4ITSA 3K0JA 2NPFA 2HS3A 3UCGA 3WZ0A 4ZVSB 2DGVA 2R9LA 3OVSA 2BE2B 5J2NA 3JSRA 3W2WA 1RTHA 4OHYA 3D7SB 3T6BA 4F4AA 3UCUP 2O66A 3L7OA 1CULA 2CYYA 3W2VB 4ETZA 2FVPA 1S59A 3R2DJ 1VQYA 2ZE2A 4WFBQ 4R25A 4TVAB 1RAJA 2J8AA 1Q7YT 5DGBA 1IXKA 3U1MA 4ILMA 3G6YA 3KG0A 5HJYA 2MSSA 2ZITA 2VKRA 3ENQA 4N77A 2C3UA 5B7WA 3FBEA 3OFEA 2FTRA 1GMVA 2EK6A 3A3NB 3B6BA 4GVBB 1IKYB 3AHPA 3NG8A 2HS0A 1G2EA 1EQ0A 1PGZA 3FJ2A 1AA1B 2CVIA 1PAEX 3KJFB 4RW7B 2HFUA 2N7YA 4ED7A 1O5JA 5E3PA 2XS2A 3JSMB 1ZTWA 2FUG9 3KNAA 4C9DA 2CPJA 4CLYA 1VBKA 4P2XA 3W7BA 1U47A 2ZC4A 1U26A 3OT9A 2X3DA 3QIPA 1FF2A 2Z56B 4A8KA 4A8OA 4XK8C 5GAHI 3JQKA 1VRQC 2D9OA 1FXLA 2ZKUA 5M2UA 3TVYA 2C28A 1HQ2A 1IKWB 2KM8C 2YH1A 3NWGA 3PR4A 1ZETA 4ZCIA 3KK3B 2I5JB 3G6ES 3GPAA 2Q43A 2CWKA 3UR3C 2EC0A 2NR0A 3T19A 3IG1A 3N5BA 1G7CB 4QWBA 2BJ8A 2XC9A 4MMOA 1ZBTA 1JWWA 2EBEA 2HVZA 4O3NA 3MURP 2D3ZA 2ZVIA 1O0PA 3G4SS 1N0VC 1DURA 3IM9A 1F6TA 2DGUA 1JXEA 5A6WA 3M6XA 4H4KA 4Q8FA 1IR1A 1U8WA 5GMDA 3N79A 1SB6A 5M2RA 5GADU 4H54A 2Y1RI 2CJAA 3I9ZA 2XLKA 1FDAA 1Y00A 2HGNA 2BKPA 1BD6A 1VMBA 4ZPVR 2AGPA 3QGIA 4PG4A 4RW6A 1IVZA 2XYHB 4WCEQ 4OX6A 3WC0A 2YWWA 4DQRA 2OPPA 2RKIB 4Q5VA 1JJ4A 4JYAJ 2BW7A 3DLLQ 1HD1A 3QAUA 5H9FK 1HBNA 2OPQB 2DPJA 1XJWB 2W9BB 4AUKA 1PO6A 1WJ9A 4R0JA 2J0SD 5C2CA 3R5GA 3C8YA 4JYAF 1ZS6A 4K4ZA 4USHA 3BO2A 5H9EJ 3WC2A 2LLZA 4NLQA 1WC3A 3BB5A 3IS9A 4IH7A 3Q23A 1EJ7L 2RQCA 3D3CJ 1X60A 1K1QA 4M5LA 4TLQA 3MDFA 3HKZD 2BUNA 3DLKB 1Q8BA 2V8HA 3PTWA 4R8UB 1HQUB 5I3QA 5D4OA 4USKA 2YNGB 4V19X 1A0OB 2CJXB 1UVJA 3Q0AA 3SSRA 3U27A 2PEBA 1R3NA 3CJRA 3IWLA 3SBMA 1R0AA 1S57A 1GMWA 5J1EA 2MQNA 2V5HG 4F02A 4CIOA 4I7FA 1HNZJ 1VI7A 2MHNA 2C2DA 4OLPA 2HHPA 2MTLA 1J5OB 2O67A 1RABB 7FD1A 1NK9A 4JI1F 1JLFB 3PM9A 2KN4A 4GVLA 3DCAA 2FGOA 3D6MB 1HYSB 5EX0A 4CLUA 4OHZA 1HNZF 1RBOB 4RJVA 3OTBA 1RXOB 3TA2A 4DZDA 3IP0A 2BJEA 2NS1B 4QPTA 1YJ9S 3BR8A 2VG6A 2HS4A 4OYXA 4J9MA 4I6YA 2FVQA 3PXGa 4ES3A 3DRSA 2C2OB 4RUAA 3UN2A 2XY7A 4CLFA 3WIUA 1W2BR 2BRLA 2QA4S 1V3ZA 2LFVA 2YKAA 2G1DA 2BANA 3KDOA 3K57A 4FS2A 2FJBB 4FYWB 1ACMB 1M0SA 2AP6A 5C42A 1GMWD 4LBPA 2HG4A 4ZITA 2DR8A 3I55S 2V67A 1XMQF 5D4PA 2V2VA 1HQEA 1S9GB 4IRCA 5IT0A 4AXJA 3DRXA 5SZTA 4BDPA 3A13A 1NJYA 1R6VA 1NK0A 2W24A 1SQGA 2C3PA 4A8SA 1T7PA 5KFVA 1L3KA 4YS2A 4NA1A 1ZM2A 2DH9A 4DSEA 2EWHA 3V81A 4KFBA 1CC7A 2M52A 4KO0B 4K4UA 4Q8EA 5LSOA 1RYSA 4AXIA 2E5LJ 5GAEI 3CMQA 1KTQA 3MEDB 3MWBA 3PACA 2F8MA 1RE1B 3IAM9 5CZVA 3SI8A 4DN9A 1TAUA 4A48A 4B9SA 3B4MA 1OQ3A 2MQMA 2E5LF 3MM7A 1REVA 4FYVB 1RWXB 4NEYA 4DV2J 1WI8A 4BWJA 4DSLA 1W25A 1HL6A 4XPCA 2IVYA 4J5OA 1YJNS 4LSZB 3C3LA 3RB6A 5GAHU 4DR4J 1OQ6A 2P9CA 4G6VB 2X1FA 2E7XA 2OFGX 1N6QA 2GHVC 1HR0J 1WC6A 3JB9k 4DV2F 1QUVA 2CJBA 3HVWA 2AEFA 4RWWA 2QRRA 3UNGC 4CH7A 3MR6A 2PE8A 3JTOA 3MEEB 5T14A 4DUZJ 3H5UA 2B9WA 1VLYA 5B0BA 4LVNP 4DR4F 2XHCA 1QTNB 3FQKA 4ZVGA 5ETVA 2E1AA 3VR1A 3W2WB 1RTHB 2JEIA 4LF4F 3V5RA 3BEGB 1CULB 2CPXA 2MZ1A 4M95A 1IR2A 2D7SA 1P1LA 2M7SA 2F1FA 1VIXA 1NUEA 3KLGA 1XR5A 5KG0A 2CZ9A 1KSPA 4CO5A 3MPWA 1NK4A 2L48A 5JUMA 2DGOA 1DLOA 2MY7A 1CQNA 1C2PA 3HJVA 1KBRA 4JI5J 3AODA 1Q8LA 3CMAS 1F9FA 4PUOA 5J1NA 3G9CA 3A1YG 3GFHA 3QMQA 4QBUA 2HHVA 1WNEA 1JLBA 2J6SA 1SC3B 5KT7A 5DG7A 2HFNA 1X4HA 5CH7B 1CJKB 2XNQA 1BWEA 2I2YA 1TL3A 1HMVB 1JLEA 3R5AA 4Y00A 4M8LA 4ED5A 2HBQB 3M05A 2M0GB 2V9WA 1PCAA 3O2IA 3QIPB 1X9WA 2B4UA 1NZ8A 3BQ2A 3DRPA 1D9AA 1JLAA 3GV5B 2ZEJA 2CZ4A 3CCSS 2YWGA 2WVBA 5F3ZA 3GFYA 4X62F 1NSQA 1KP6A 1KQSR 2ACYA 3M9MB 3IG1B 4P75A 2HNZA 3GJSB 1SBRA 3HDSA 3ZZUA 1RB0A 1RACB 2RUGA 3I56S 1ICEB 2DNQA 2FVCA 1RAAB 3CJ0A 1VK3A 3Q8VA 3IR5B 4NZ7A 2GO9A 2MJNA 3EE3A 3MM8A 4TNOA 1WKJA 1YSJA 2HHXA 2CQ1A 4ER8A 2NZ4A 1VQ6S 3MPDA 5F9LA 3Q24A 4WBFA 4H4OA 1JIHA 4DX5A 2QN6B 2FVSA 1NXIA 3AQPA 2HIYA 3PW2A 5HVHA 2CRLA 3PRDA 2AEMA 3NY0A 4DSIA 4RW6B 1LWFA 1GXUA 2NXCA 2OPPB 2CFXA 4LRFA 3NMAA 4M94A 1WOOA 4Y6IA 4NLXA 4NCGA 1YGYA 4N8NA 1VBXA 1WEZA 5EGYA 1CS4A 3PHEA 2XCAA 2CJKA 2F4VJ 3NCQA 2LYVA 2QLWA 2DGXA 3SCIE 4HL9A 1NK5A 1AZSA 1K44A 1OIAA 2XO6A 5F0WA 5KFGA 4QIVA 2F40A 3U1NA 5A8WB 2B51A 3D1HA 4U8YA 2GS8A 4ECQA 3A4TA 3C66A 1FFSB 1PJ7A 5C24A 3IS9B 2IM3A 2BBEA 4OZ0A 3R1HA 1NDLA 2AYGA 2B5JA 4DX6A 1W26A 3ETOA 1HNIA 2MJUA 3JXOA 3ONQA 2GNKA 2CQGA 4F4XA 3I32A 2WZ1A 1B70B 4IR1A 1R7IA 1S48A 3OL9A 4FNHA 3GFXA 4Y34A 3JTNA 4K5SA 5DS7A 5GAEU 2D3O1 1SV5A 3EDQB 3DN9A 1R0AB 1S1VA 4ZCMA 1Q79A 3ZTQA 3ILOA 5J1EB 1JK9B 1QSYA 4I7FB 2BV3A 3R5CA 1D09B 2YX1A 2ZH7A 3U1LA 1VC6A 3TRGA 3B8HA 4CYUA 4LF5J 2DXEA 3QGGA 4MIBA 3IBWA 3CDEA 2W8LA 1XC9A 2JVOA 1U7LA 3GG1A 5IT9Y 1Q5YA 2HLUA 2EFQA 2VG6B 4O3OA 3NL0A 4ZVFA 2YWFA 3JS9A 3DRSB 5EWEA 3VGTA 1FJGJ 3M2VA 4JV2A 1U09A 1RT7A 1QSLA 5F9NA 4ED6A 2BANB 4K2XA 4DQPA 2XMKA 1N48A 2AIRB 4E2FB 4DPOA 5C42B 2EW9A 4J90A 3L9ZA 3BO4A 1FJGF 2CXEA 3I87A 1SCJB 3TNVA 1HQEB 1NBEB 4LRBA 2HMIA 4CLKA 3DXBA 1NDKA 3LGHA 5F8IA 2P2CB 5DG8A 3CDAA 1T94A 4DQSA 3NP5A 3BSAA 2IBKA 1C4AA 1DAXA 4MIWA 3KKFA 4OI0A 3V81B 4DUYF 4KFBB 3M6UA 4QOTA 1GNKA 1QAYA 2HHSA 5KFKA 4I2PA 5BYSA 2PIIA 2YH0A 1YG0A 4TLRA 2GQCA 4ZVRB 4YN3B 2HFOA 4KGMA 1K47A 1Y7PA 1T9YA 4NEZA 1NZAA 1LK7A 1X7VA 3MM7B 3K5MA 4CNZA 1REVB 2PMWA 3W1YC 4IO1A 3JSYA 4X4UA 3Q22A 4RNHA 1N5QA 5KFBA 3BKFA 1UZHA 1Y3KA 2V2QA 3W8GA 1X0FA 2HZAA 1RCOB 2PSZA 1JX4A 1N6QB 3FGVA 4ZK7M 3LWMA 1N36J 3NEKA 3W9IA 2CPHA 5SUHA 2VBZA 2QZ8A 1AFIA 1V6HA 2UVVA 2I6WA 2UVRA 2JFDA 1O6XA 1J5EF 3KUHA 1YJTA 1TUGB 3NGSA 1N36F 5IC6B 5IT9U 5DGAA 1RU1A 3J81j 1RWWB 3G87A 4I0WA 5DQGA 1S7IA 2FIUA 1EARA 1VDHA 3FCHA 3VGUA 4A4JA 4LREA 2W2PP 2RD5C 4FYDA 1L3TA 1G1XA 1YJRA 3KLGB 4PPZA 2GAGC 3AJ1A 3BH7B 2B7CB 2LQ5A 3T1AA 1ULRA 4ZLLA 5D0GA 3PYDA 1DLOB 3ELHA 2V63A 4QW9A 1NJWA 3CJ2A 4QIWD 2OGUA 3MM9A 4DS5A 5JJBA 2XYPB 2H4WB 2MSTA 4PUOB 3HKWA 3M2UA 5KOWA 2B8QA 3V4MA 3MUTP 4D3HA 2CQCA 2GZOA 1HBUA 1JLBB 3UE2A 2EK1A 1BMQB 2AEJA 1N32J 1YBAA 2YKMB 1YTYA 3AD8C 3QRPA 1TL3B 2N3LA 3O3LA 4CI0B 4W98A 2UU9J 3VF0B 4RL1A 3ILJA 4LBIA 4K2JA 3RJMB 2VDIA 4DFKA 1X4FA 1N32F 2LQBA 1KDNA 3K8VA 3DRPB 1JLAB 3MZIA 1W2IA 2UU9F 1X4DA 4J7CA 3ZZTA 1HNXF 3NGRA 1N56A 1IM4A 2DIUA 2ZWPA 1YJVA 3AOCA 2M4MA 3T1YJ 1IR0A 2HNZB 5HROA 5J2MA 2Q6CA 3M1VA 4ZJOA 4JI4F 4U9RA 1S6QA 4S0MA 3KYLA 4UW2A 4JOUA 3RBXA 2X7IA 2CKWA 2OEMA 3T1YF 3NGKA 2MGZA 1SC1B 3MM8B 4QWCA 3ZTRA 4ICLA 3PYFA 2HBRB 2POKA 4PPDA 3C2PA 4DV6J 3H98A 3NS5A 1DY3A 3BV8A 2DXDA 5KT2A 2WONA 3GTYX 3P45B 1NHVA 4L3KA 4YDDB 2PEHA 4TY9A 1ZAXA 3C46A 1E6YA 2CJQA 4J9OA 3I0SB 2HIQA 1LWFB 3IM8A 3FNNA 4H4MA 3B54A 4OI1A 5DM6Q 4PXEA 3D3BJ 2OH2A 3LGMA 2F65A 4NCGB 4J9KA 4BBYA 1Y5IB 3HF5A 1CS4B 2JEFA 4K4VA 4RW8A 4ATNA 2WW8A 1UVMA 2XMUA 3SSSA 1FRMA 2MPUA 2OKQA 1QVGR 2RQMA 1WG4A 5K14A 3V6KA 2E9RX 2BE9B 1XEZA 4JI6J 3LP2A 2X51A 1N52B 2EKNA 4LFCJ 3QSYB 1H0HB 2R2RA 1NU4A 3HVAA 3MCSA 5C24B 1Q8KA 3MPUB 2BJ1A 2YQ3A 2JSXA 2DNLA 3LO3A 3LGNA 1GAOA 1WC5A 4JI6F 3KK1A 2B7BB 4C3LA 1QM9A 4LFCF 1TUWA 1M5HA 5I3UB 1Y0HA 2B5JB 2WSCC 2YPZA 1JXLA 5HMXA 1HNIB 2YX7A 2MHEA 3DGVA 4C48A 3EPIA 5KFAA 5K5MA 3A8EA 3CEDA 3G86A 1I5OB 5IQQA 5DQHA 1M5SA 3FSYA 1VK8A 3BN7A 4Y2IA 4IG3A 3CXCR 4DSKA 1TL1A 3W65A 5AE2A 4CYUB 4ERDA 5CD4H 3BKUA 3AXKA 2R8JA 4CT9A 3BSCA 4CQ1A 3KOAA 5DETA 3FEZA 4JBCA 3HFKA 5L46A 4A8FA 3NGUA 2RNEA 2H9ZA 4BCAA 2BRKA 3BBBA 2VICA 5HANA 2XHWA 1S6PB 1VISA 3QFWA 1AYEA 2NZCA 3M2VB 4C0BA 4ZJQA 2FHJA 2OFHX 1TKZA 4ID5A 2HLTA 1YZ6A 1YVFA 2CNNB 4I6WA 1R27B 1ZTTA 1RAHB 4P2MA 2QLJB 5KFOA 1BQXA 4IKAA 1SKSA 3PW7A 3HCXA 3PEHA 3TZZA 3W63A 2G0JA 2DD8S 2BX6A 2NREA 2W2OP 3Q83A 3D6TB 1FVSA 3KJVA 2HMIB 3QO9A 5L1JA 4MTPA 1GEHA 1IBMF 2VUGA 2AF6A 4EUVA 4RPFA 4ECRA 1KEKA 1B99A 3TUZC 4QYZK 5CCLA 3DYAA 2FYXA 5KG3A 2XY6A 1VBYA 4CLLA 4KGVB 3RYLA 3PW5A 4JB8B 4A8WA 4PAAA 1CBKA 3OTDA 1FJ7A 2DGSA 3KLVA 4P7VA 2UXCF 1NAQA 2E5JA 3MI7X 2M70A 3MF5A 4MAKA 4X4QA 5DM7Q 4DUTA 4LF8J 4KT0C 3MR3A 5KT5A 4OZJA 1GXLA 4C11A 2MDAA 2WVCA 1RT5A 1RWNB 4IH5A 1AXQA 3RW7A 5F8GA 1K8AT 2Z2LA 3M6VA 2C2NA 4FXVA 3RAXA 3ENAA 1NKCA 3QWUA 3K5NA 4K7QA 2GJIA 3LA0A 4LF8F 3HFZB 3P6YC 3NLCA 3ADAC 4OI2A 2DHAA 5H9FJ 3CSKA 3BQ1A 4IOAQ 1X5SA 3AOAA 1HFEL 4DV7J 2LMIA 1XTZA 3KLEA 2JC0A 1FESA 3MEGA 4X4SA 4DG1A 1VQLS 3FSXA 2ZNYA 4Y65A 3V6JA 4X64J 3KLHA 1XNQJ 2DNOA 2H54B 4DV7F 2UXBF 4F4ZA 2NYHA 3THVA 1RT1A 1G6BA 4HHJA 4N56A 4USWA 4LFBJ 5KFCA 4X64F 3C14A 4KKOA 1XNQF 2QA1A 4YP3A 4QCLA 1NHKL 4QR1A 1U45A 4OV1A 2VL1A 2MXYA 2D1CA 5LSLA 2ZH5A 1IQZA 3MM9B 2C2MB 2GX8A 1EP4A 3QAEA 4DX8H 3I5CA 3ILLA 4LFBF 1V9OA 3M2UB 1RAGB 1DTTA 1S7HA 3KG4A
chains in the Genus database with same CATH topology
1HBUB 3FJ2A 2KM8B 3BQ0A 3OVAA 2BDPA 2Z4PA 4KC5A 2CVIA 4RW7B 3P3DA 2P9EA 4O4RA 4DOZA 1SKWA 2V94A 2N7YA 4ED7A 5EWFA 1JLEB 4YR2A 1O5JA 4LJMA 4JI5F 5E3PA 3F56A 4K5RA 4BHQA 4L72B 2VC1A 2XS2A 3JSMB 1ZTWA 1FRXA 2FUG9 3KNAA 4C9DA 5I42B 2CPJA 4F3MA 4PCQA 2YKMA 1FJEB 1F0XA 3W7BA 4PQUB 1U47A 5AE1A 3CULA 2AJ4A 2ZC4A 4RBUA 3KMSA 2Y1IA 1U26A 1HI8A 2FLOA 2JLEA 5LT5A 3FVYA 3QIPA 1X4GA 2OTLS 1FF2A 2DTJA 1D8YA 4A8KA 4B3MF 4A8OA 2QT7A 3DGPA 4XK8C 3TI0A 3FDSA 4MK8A 2JVRA 3EUNA 5GAHI 3T5HA 2D9OA 3LF0A 4MKAA 1FXLA 1UWBA 2ZKUA 5M2UA 2PA3A 3TVYA 1KFSA 2C28A 2L9DA 2YKPA 3GYNA 5FIIA 3MECB 2ZNZA 2XMMA 1IKWB 3KMQA 4B08A 2KM8C 2YH1A 3SV3A 3O5TB 3NWGA 3M2RB 3PR4A 1ZETA 1T3NA 3SZ2A 5F0UA 4F50A 1H7XA 4ZCIA 4WK1A 3DM2B 1PSDA 3KK3B 1ZM9A 5EX3A 5L9NA 4M63A 1VQ5S 4ZP8A 2I5JB 4F3OA 3G6ES 2R8GA 2Q3PA 3DNCA 1HHSA 2Q43A 2BXJA 3DOKB 5KFWA 3UR3C 2EC0A 2NR0A 1S6UA 3DDNA 3HHLA 3T19A 2PGCA 5HROB 3IG1A 1OPIA 5J2MB 4RU2A 1UKUA 3H2VE 3M1VB 4NRTA 1HPZA 2B6AA 3HHKA 2R4FA 3N5BA 1G7CB 3MXHP 4QWBA 1WF2A 1NKEA 3KK2A 4F4KA 4HT7A 1S6QB 1D8ZA 2CJ9A 2ERRA 3M9NB 1HBMA 2XC9A 4LIWA 2R7RA 1NB7A 4MMOA 3OFFA 5KTQA 1HI0P 2FLLA 2P6SA 3S8SA 1VQ9S 1ZBTA 3K8WA 4B3SF 1JWWA 4CO2A 2LQ9A 4QWDA 5HMZA 3QLHA 2EBEA 2HVZA 4K59A 1K1SA 2MGZB 4O3NA 3AJ2A 1MWZA 3CC4S 2JJ4D 4ICLB 1OSCA 2HAIA 4IFVB 2YWHA 3MM6B 3MURP 3BO3A 4ZVHA 2D3ZA 4NXMF 1N5YA 4OHWA 4WFZA 1O0PA 1TQLA 2A2CA 3CCLS 3G4SS 2PI4A 1N0VC 1DURA 5HMWA 4XDDA 1RKJA 4V19J 2HZCA 3GZ7A 4H4OB 4R5PB 3DRRA 4A8YA 5A6WA 2DGUA 1JXEA 3SQGB 4TQSA 3QZ8A 3M6XA 3CC7S 4H4KA 4Q8FA 1MW7A 5AXNA 2WONB 3ITHB 2V4RA 4E8UA 2KYZA 1HNVA 1URRA 2G13A 1LFWA 1UJ6A 2HGLA 4TYBA 2LEPA 1SKRA 1XMBA 3N79A 2RH3A 4FP9A 2MZJA 2C22A 1SB6A 4JI7F 5M2RA 4J9QA 5GADU 5U47A 4LFAF 1A7GE 4AL7A 3J81Y 4H54A 1C0TA 4Q0BB 2Y1RI 4NLSA 2JLGA 4K0KF 2CJAA 3I9ZA 2XLKA 1VQ7S 2KRRA 2JWNA 1E6YB 1FDAA 1Y00A 2HGNA 3OBIA 5K9FA 3CD6S