2OPPB

Crystal structure of hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
427
structure length
403
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWEPPFLWYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 111
structure length 403
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2oppB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oppB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oppB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oppB03
1JLEA 3PR4A 4ED8A 4EYHB 4XPEA 3DLKB 3BJYA 1T03B 4NLVA 2ILYA 1R0AB 3CWJA 3CJ3A 1HQEB 3KLVA 2JC0A 4FBTA 2OPSB 1S1TB 1RA7A 2HNZA 5C24A 2IM0A 1S0OA 4IH6A 1JLGB 1IKWA 5DLGA 2W9BB 3BGRA 4NYZA 3UQSA 5KG3A 4RW9B 1TKXB 1VRTB 3SFUA 1RTHA 5J2MB 3KJVA 4QWAA 2BR0A 1S6PB 1JLQA 3CJ0A 1JIHA 4MFBA 4KB7A 1W25A 5KFEA 4KFBA 5K14B 3PJWA 4DG1A 2WTFA 4M94A 3QZ8A 1T3NA 3GQCA 4JV0A 5FDLB 1RT4A 2RDJA 3BSNA 1QE1A 1RAJA 3DDKA 4NLXA 4ZVHA 4ZVGA 3GIJA 3V6KA 2BQ3A 4J9QA 5F8NA 4I7FB 4IG3B 1NHVA 1TVRB 3IGVA 1S9FA 1S49A 4HKQA 5F8HA 3T5HA 2ZD1A 3NAIA 4YR0A 3G86A 4NLRA 1N48A 5KFAA 3GIIA 5KFVA 4KKOB 2OPQA 4DL3A 2IBKA 1T03A 4WFYA 3QLHB 4G1QB 3V81B 1HQEA 3CDEA 2IM2A 2OPSA 3MFHA 4K4WA 1JLGA 4R8UB 2W9BA 3NAHA 1S6QB 2VG6B 4WYWA 1VRUA 3KHHA 4ZHRB 3GV8B 2WOMB 4RW9A 5KFKA 4IKAA 3KHLA 1TKXA 1HYSB 1VRTA 5J2MA 1SUQB 4G3IA 3CJ4A 1S6PA 4QWBA 1RT1B 4F4WA 2D3ZA 3BQ0A 1SH0A 1RT5B 4O3RA 5KFPA 4ZP6A 2JC1A 1LWEB 3NL0A 4NLOA 5FDLA 3KHRA 1C1BB 3DOKA 3KLFA 4YR2A 4H4MB 5DG7A 4I7FA 4IG3A 2D3UA 4RZRA 4KHRA 4PWDA 2RF2B 1S48A 3CJ5A 1TKTB 4NRTA 4KKOA 5DQIA 2R2TA 5C5JA 2OH2A 2FLNA 1HNVB 4B3OB 3RAXA 2C2RA 4J9MA 4IG0B 4NCGA 3QLHA 4G1QA 5C42B 3V81A 4QPXA 5F8IA 4ECTA 4Y3CA 2FLPA 4K4VA 1EP4B 1RDRA 4KHMA 3IS9B 2VG7B 2BRKA 4R8UA 5KFTA 1S6QA 3RAQA 4ZHRA 5F8JA 4ECYA 4ECUA 1S9EB 3HKWA 4NLQA 3FSIA 4EEYA 4RUCA 1JKHA 1TL3B 4Q8EA 5F8GA 5EUHA 5DLFA 4URSA 4WFZA 1QAIA 2QV6A 4ECZA 5KT3A 4TXSA 3GV5B 4Y2AA 1RT1A 3JSMB 3MFIA 4O3NA 3BREA 1C0UB 2IAJB 3OSPA 1WNEA 2R8JA 1RT5A 2WONB 4IR9A 1LWEA 4ZPAA 2DPJA 3C6TB 3VQSA 5JXSA 4FS2A 1K1QA 2AX0A 3M8QA 5CYMB 2ZE2A 4O4RA 4HYKA 3CJ2A 4H4MA 3CDUA 1U09A 3KHGA 4IRKA 4NLDA 2RF2A 4DL7A 4ED6A 1NNDA 3BR9A 2ASLA 4PQUB 3Q8RB 2UVWA 3GILA 3H4DA 1HNVA 4B3OA 4IG0A 3KMSA 1N5YB 3QIDA 1EP4A 3N6NA 5HROB 4J9PA 3BSOA 1FKPB 1IM4A 5F9NA 2XI2A 1S9EA 2BANA 5KG0A 4U7CA 2GIQA 2C28A 1JLFB 1S1UA 1TL3A 3IRXB 5HLFA 2O5DA 4EBEA 2C2DA 3MEEB 3H2LA 4IFVB 4ZP8A 4F4XA 1JLCB 5KFMA 3JSMA 1DTQA 2IJNA 2IAJA 5DQGA 5D3GB 2WONA 4ZMMA 1S1XA 4ECSA 2FVPA 4WZQA 4O3PA 1KHVA 1I6JA 2V9WA 5L1LA 5J2QB 5CYMA 2WHOA 4TLRA 2B5JB 3FRZA 5KG6A 3V4IB 4EO6A 5KFDA 3I5AA 2W8LA 5KT5A 2HWHA 4PQUA 5EWFA 1XR7A 5EDWA 4RW8B 4R5PB 4QW8A 1RT2B 2VG5A 1EETB 2AWZA 2YKMB 4NLTA 3KLGB 4JV2A 4NLGA 1N5YA 4YP3A 3KK2B 3LP0B 4I2QB 3C6UB 5HROA 3RBEA 1FKPA 1N6QB 1JXLA 4ZP7A 1S4FA 1YVFA 2JEGA 1JLFA 3IRXA 3KLIB 2R8KA 4IR1A 2VA3A 5DQHA 4IFVA 5HP1B 5KG1A 1LWCB 3H5UA 3M8PB 4IFYB 4H54A 3DOLB 5EWGA 4NZ0A 3DRPA 1HQUA 4DL5A 3DLGB 1HMVA 3T19A 1TQLA 5D3GA 4RU9A 4RNOA 2FVQA 5L1IA 2CJQA 4O3SA 1J5OB 1LW0B 3I5CA 5KFGA 2R8IA 3QGIA 2HNDB 3ISND 3OL8A 3KK1B 4IRCA 5KFHA 3V4IA 5F8LA 4OL8A 1C2PA 2XCPA 3KK3B 2YNHB 3DLKA 1BQMB 2QE5A 5KFBA 4RW8A 1R0AA 4R5PA 2V4QA 1RT2A 3CDWA 4O3OA 5J2PB 1S1TA 2YKMA 2UUTA 3NBPB 3KK2A 3NKYA 4URGA 1IKYB 3C6UA 3PW4A 3JYTB 1N6QA 5CYQB 3FQLA 3RB3A 3PW0A 4KV8B 5I3UB 3KLIA 4X2BA 4YQWA 1FKOB 4IDKB 4QWEA 4F4ZA 3PHEA 5HP1A 3HVWA 4KO0B 5K14A 2YNGB 1C1CB 2B43A 4ZPDA 1LWCA 3OHAA 3M8PA 4IFYA 2D7SA 3DOLA 3PW2A 2HAIA 5KFOA 2YKNB 2FVSA 3DLGA 5L9XA 4ZPCA 2AGPA 4ED1A 3GYNA 3DMJB 4TYBA 4IH5A 5EWEA 1J5OA 1LW0A 2WK4A 3D5MA 2XGQA 1TVRA 1KLMB 2HNDA 3DLEB 3ITHB 4MKAA 3KK1A 3OSNA 3BQ1A 3PVXA 2FJVA 2E9TA 3LAMA 4PUOB 2IA6A 1REVB 1RT3B 3KK3A 3CO9A 4TYAA 2HNYB 4TN2A 1MMLA 1BQMA 1RA6A 4LSNB 3MR6A 4ECRA 2UVUA 2JEFA 4DL6A 5J2PA 4WE1B 3MEDB 3EPIA 3GIMA 3NBPA 1HARA 2VG6A 4I2PB 2FJWA 4KAIA 5I42B 1S9GB 4NLWA 1IKYA 2WOMA 3DI6B 1JLAB 3KLEB 2UUWA 1ZETA 3JYTA 5CYQA 1HYSA 2YNIB 1S0NA 2XCAA 1SUQA 1JX4A 2WB4A 5I3UA 2J6TA 4LQ3A 5KFRA 4DEZA 1FKOA 1S1VB 4IDKA 1SH2A 5KFCA 1C0TB 5KG4A 3I0RB 4KO0A 2YNGA 1C1CA 3QYYA 3RB6A 4ECVA 2IM1A 4Q43A 4ZVEA 4FBUA 2YKNA 3CIZA 3FDSA 5KT2A 3DM2B 5T14A 1C1BA 1UWBB 3DMJA 2JEJA 3ICLA 3T5LA 4ICLB 1KLMA 2EC0A 4TY9A 3RB4A 3DLEA 2R2SA 5L1JA 4R0EA 2W8KA 1LW2B 4Y34A 3EZUA 1TKTA 1FK9B 1REVA 2IC3B 1OS5A 2WRMA 2IMWP 2HNYA 5KFNA 4LSNA 3OHBA 4KBIA 3H5XA 4TY8B 3LANA 2DPIA 3T1AA 5C42A 4WZMA 2W9CB 1BQNB 2ATLA 4WE1A 3IS9A 2VG7A 3MEDA 2XI3A 4I2PA 3KLHB 3MR2A 5I42A 3DI6A 3DRSB 3MTKA 1JLAA 3KLEA 4K4SA 4MK9A 5C25B 2YNIA 3OLBA 3KOAA 2FVRA 4ECXA 2BQUA 1N4LA 4O4GB 4ED0A 4NLYA 2V4RA 2ASJA 1C0TA 3I0RA 3QIPB 1C0UA 4WXOA 4DL4A 4ECQA 3UR0A 3C6TA 2XWYA 2R2RA 5J2NB 3DM2A 4O44B 3M9NB 4GC6A 4Q8FA 2BQRA 4MK8A 5KFQA 4J9OA 1TV6B 4J9KA 4KSEB 1LW2A 4K4XA 4LSLB 4EBDA 4H4OB 4RW6B 1FK9A 2IC3A 3HVTB 4KFBB 3N6MA 4NLPA 2OPRB 4DG1B 4TY8A 2BRLA 1LWFB 3OL9A 4Q45A 2W9CA 3NMAA 1BQNA 2XGPA 1QAJA 1GX6A 1TKZB 3DRRB 4O3QA 5KFUA 3KLHA 1RT7B 1D0EA 3DRSA 3OLAA 1SH3A 3MR5A 3Q8QB 1CSJA 3QGHA 5C25A 3MEEA 3IN5A 3PW7A 3D28A 4MK7A 1RTIB 3QGGA 4YMEA 4Y2CA 4RUAA 3LALA 1JLCA 4O4GA 4RW7B 5KT7A 3I0SB 3EPGA 1SV5B 3SFGA 2XC9A 3QIPA 2AQ4A 2E9ZA 5DG9A 3TQ1A 2OPQB 1RTJB 1IKVB 5J2NA 1T05B 2I1RA 2J6SA 2AU0A 5J2QA 3PJXA 2ASDA 4RW4B 5KT4A 2B5JA 4IQXA 4K50A 4O44A 3GIKA 4F50A 3DYAB 1VRUB 3FQKA 3M9MB 4NLSA 4NRUA 2J6UA 1S0MA 3M9OB 1MU2B 4RNHA 1TV6A 3H98A 4LSLA 3E51A 4H4OA 3LAKA 4RW6A 1GX5A 2W7PA 2FJXA 3MEGB 5KT6A 3HVTA 1EETA 3TAMB 4MH8A 2OPRA 3IGNA 3GV7B 3KLGA 3CVKA 1LWFA 3ISNC 3LP0A 4I2QA 5KG7A 5F9LA 2I5JB 1TKZA 3DRRA 1TL1B 1RT7A 4K4TA 3I5BA 5KFSA 3DOKB 2OPPB 3FFIB 3KLFB 2D41A 5DGAA 3UPFA 3LP2B 4PWDB 4QWCA 1HNIB 4GC7A 1RTIA 4ID5B 2W7OA 4RW7A 3T5KA 2ALZA 3I0SA 1SV5A 3LP1B 2IJFA 3V6DB 1RTJA 1IKVA 2B6AB 4NCGB 2RDIA 1T05A 1TP7A 3MECB 4RW4A 3N6LA 3DYAA 3T5JA 4F4YA 4ED3A 3SI8A 4J9SA 3RBDA 1MU2A 1JKHB 4DL2A 1RYSA 2YNHA 3PR5B 4XPCA 4KE5A 5DGBA 3QZ7A 3UDLA 4JUZA 5J1EB 3MEGA 3HHKA 4ZVFA 5KFFA 3Q8PB 2C2EA 3NGDA 3KNAA 3TAMA 2ZKUA 4RNFA 3OL6A 2C22A 3G6VA 2YNFB 4MIAA 3H5SA 5HBMB 3BQ2A 1RT6B 3IG1B 2I5JA 2ILZA 3TVKA 1TL1A 3M8QB 3QO9B 2ZE2B 5KG2A 2IM3A 2OPPA 3FFIA 4KV8A 1S97A 4J9NA 3LP2A 4EBCA 1HNIA 2UVVA 4ID5A 1S1WB 4WYLA 1T94A 4ZPBA 3LP1A 1S10A 2VA2A 2HWIA 3V6DA 5KFZA 4ECWA 4ED7A 3E01B 1JLBB 2B6AA 4QWDA 2R8GA 1RTDB 4LQ9A 3BSCA 3MECA 2CKWA 4ZP9A 5KFXA 4QW9A 2RKIB 3H4BA 3ITHA 4FS1A 2AX1A 2E9RX 4TQRA 2BANB 3OL7A 1S1UB 4PUOA 5HLFB 1RT3A 2R8HA 3H40A 4MKBA 5KFJA 3G6YA 3BSAA 4IRDA 4WXWA 4MIBA 4JV1A 5J1EA 1DLOB 1DTQB 5KFWA 2FLLA 2AGQA 1RYRA 1DTTB 1S1XB 2YNFA 4IH7A 1S9GA 5HBMA 2JLEA 2JEIA 4RNNA 1RT6A 1IKXB 2BE2B 3IG1A 1ZTTA 5KFYA 1QUVA 5KG5A 3QO9A 4XO0A 2HMIB 4Q0BB 1HPZB 1XR6A 4IOBA 1Z4UA 5KFLA 3Q8SB 3V6JA 4K4ZA 3H5YA 4ED2A 4WFXA 1JLEB 1S1VA 3PW5A 1S1WA 1KHWA 4RNMA 4YR3A 1K1SA 4Q44A 1XR5A 2VG5B 4J9RA 3HVAA 4EYIB 2HNZB 3E01A 1JLBA 1UWBA 5C24B 2F8EX 1IKWB 1RTDA 2FVCA 2WCXA 3V6HA 4K4UA 4ICLA 3BGRB 5DG8A 2R2UA 2RKIA 4EO8A 3G6XA 1N56A 1RTHB 3KJVB 4M95A 3KMQA 2GC8A 3RB0A 4K4YA 1JLQB 4MFBB 1D1UA 4URQU 5JUMA 3MR3A 4NLUA 5KFIA 5F8MA 4U6PA 1DLOA 3DRPB 1HQUB 1HMVB 3PZPA 4TQSA 1RT4B 1DTTA 2AGOA 1NHUA 1QE1B 2W9AA 2BE2A 1IKXA 2V0NA 4J9LA 3MF5A 4Q0BA 2HMIA 2GIRA 1HPZA 5L1KA 2UVRA 2ZD1B 3H59A 1ZTWA
chains in the Genus database with same CATH superfamily
2MY8A 3PR4A 3R6GB 3KLVA 1HR0F 5C24A 2XYPB 4L76A 5E3PA 4RW9B 2H4WB 3VGVA 3I6PA 4PXBA 3L09A 4FNHA 4ALZA 5E2QA 3G9CA 4RBTA 4K2JA 3M1VB 4G1QB 2FZCB 3KHHA 4ZHRB 1TKXA 2MHEA 2D3ZA 2IVMA 3SMZA 5D6GA 1MNEA 4HVZA 2ZBPA 3GE9A 3PYFA 4NRTA 3E3XA 3QLHA 1KOHA 4Y3CA 1T9YA 3UO0A 2QV6A 3SCJE 1GMVA 5FJ4A 1GXTA 3WC0A 3EGNA 1VQNS 2CPZA 3NG8A 3GYXB 3KHGA 1NNDA 4DR1J 5AE3A 3CCUS 2EPIA 1FO1A 1K0VA 4IG0A 3MAQA 1OQ6A 1R8CA 4CLFA 4ILLA 2AT1B 1CPZA 1RK8A 3HFVA 1R8PA 4ECSA 3M2VB 1D8YA 3HHDA 5CYMA 2QIFA 4YDXA 2GMHA 1Q79A 3V4IB 1VJQA 1L3KA 5EWFA 5D4NA 4R5PB 2N3OA 4J90A 2BKOA 1Y3JA 3RJMB 2QN6B 4B3TJ 2RQMA 1LKZA 1AA1B 1JLFA 4P2FA 3GFXA 5KG1A 1UFWA 3AA9A 3R5GA 1HQUA 3DLGB 2J8SA 2RU3A 1BQXA 5L1IA 4X66F 1M5VC 3HHEA 3KK1B 5KFHA 3GZ7A 3WIUA 3EZ5A 2VIHA 1R0AA 4MYUA 2QJ3A 3PXGa 4CLTA 4I0WA 3ZO7A 3SCLE 2FY8A 3I82A 4F4ZA 4DV6J 3HVWA 4ZPDA 4HHJA 4K5SA 2WK4A 3D5MA 2GO8A 2HNDA 3NLCA 4EFAC 5ETNA 3OR2B 3J7AN 2G2YA 4DL6A 4QIWD 2CJAA 2WOMA 4S0MA 2YNIB 4DV2F 3F44A 5KFRA 4EUVA 4DFPA 5C2CA 5D0GA 3D6TB 5KT2A 1C1BA 4ICLB 2RE1A 4TY9A 2W8KA 2AJ0A 5K8PA 3QT7A 4ES2A 2WSFC 2HNYA 5KFNA 4P74A 4PRFA 2ATLA 3VAMA 3QNWB 3L3CA 1NK8A 4KC5A 5IT4A 4Q7AA 4GVBB 3W60A 2ZWPA 1FEEA 1Q5YA 2M8DB 1FXRA 3DRSA 2NXNA 3TVZA 1H7WA 3FVYA 5L38A 1T05B 5A76A 2AU0A 5KT4A 4F50A 5JVGQ 4LSZB 1HWIA 1FTRA 4RBUA 4MH8A 4KPCA 2NZCA 5DGAA 4DV3F 1EIYB 3F41A 3LWMA 3TJAA 3RRGA 3P3DA 1TP7A 3MECB 4AXJA 3JSBA 4M5MA 1P27B 4XPCA 3N4WA 3Q8PB 3MEGA 2G1HA 3UNYA 3PV8A 2NSBA 4L75A 1FERA 2FJDB 3TVKA 1IVZA 1K73T 1QLNA 4O23A 2HWIA 1QDUB 3PYEA 1GMWA 2V5HG 2ZITA 2I0XA 1R27B 2HHHF 1DRZA 4RWXA 5DM6Q 2JWNA 1YKWA 3D68A 3OXLA 3QZ8A 1T3NA 3IG1A 4XK8C 1ZTTA 2UXBJ 5KFLA 3H5YA 2AEFA 4WFXA 2KM8B 1HHQA 1FTCA 1EZZB 2HS3A 4X4RA 4YR3A 2E1MC 2HK3A 1QSYA 1QD1A 3KG1A 4FXDA 3CT9A 3R97A 3KMQA 3HM9A 1YZ6A 4YN3B 2VFVA 2OD4A 1HQUB 1YBUA 1XMQJ 2DNKA 4DSFA 3N01A 3BKUA 2UVRA 3T1HF 4CLUA 4ED8A 4A8MP 1R0AB 3GJTB 3R5DA 5DLGA 1P9QC 4CTAA 3NCQA 2QL7B 1APSA 4X4QA 4GRSA 4JV0A 3GJRB 4OX7A 5HQMA 3W61A 3QJJA 3ZZ0A 5KFVA 2MZTA 3CCTA 4DCJB 1FRMA 5KAKA 2VICA 1HI1A 2WOMB 2UUCJ 1UJ6A 1IBLF 4G3IA 2IJRA 1S6PA 1ZBTA 4O3RA 2Q66A 4OJ3A 1NO8A 2KH9A 1C1BB 3K2YA 5DG7A 3DKDA 1NUEA 3M6WA 4B3MJ 5C5JA 1T9UA 4K8RA 4ZPTR 4B3OB 3DCAA 2FHJD 4X65J 2X1GA 3FKBA 4PYDA 5F8GA 2L41A 5KT3A 1X9WA 1UFKA 2QSFA 2HW3A 1CBKA 5JXSA 4AD6A 3M8QA 4USIA 3AOCA 4H4MA 1U09A 2H1YA 1N33F 2WB1D 3M6UA 2EG2A 2X1BA 3BR9A 1VGYA 4B3SJ 4CIOA 1LK7A 3N5BA 1IM4A 1HW9A 4WKYA 1TUVA 3WBZA 2FHMA 1VLOA 1YITS 4X4PA 2HFOA 3R5CA 5D3GB 3IM8A 1L3VA 3US5A 1U1MA 3C14A 1KFDA 3I5AA 3JQKA 1J27A 2CVEA 2UU9J 1FKPA 5HN0A 2C2KB 2VPYB 4PAAA 2O3DA 4FYWB 4IFYB 4OLOA 2UUBF 4USUA 4RL1A 1V6HA 1PC5A 3L7UA 5C7PA 1DQAA 3GCXP 4ZCMA 3IR7B 1VK8A 3KK2A 3I4PA 4UY85 1IKYB 3PW4A 2DHHA 1Y5IB 4X2BA 3PHEA 2LU1A 3OR1A 5K14A 3OHAA 1NJXA 2L08A 2DXFA 3IWXA 4OYZA 3AJ1A 3PO5A 2DR5A 1ZA1B 3IAS9 1UFLA 4X64F 5I42B 4A8KA 3GFHA 2QYCA 3JYTA 4N7TA 4M5DA 4USMA 2W4CA 1B0TA 3RUBL 5F0UA 3LGNA 2YX1A 3DMJA 1E6YA 2QLWA 2GHPA 2DJWA 1OS5A 1IBMF 5AXLA 2PSZA 1NPRA 4LSNA 4UQTA 2KVIA 2W9CB 4WIIA 3IR5B 1N4LA 2V4RA 1M1KT 1YJ7A 5IT9U 3C6TA 2PI4A 4DZDA 4DFKA 4CTAB 3IA0A 4J9KA 2XMWA 4KSEB 2H65B 2RS2A 1U47A 4DR5F 3CEDA 1Q95G 1GX6A 1TKZB 2CZ9A 4NA2A 3I0SB 4PXDA 3AD8C 2AQ4A 2HVZA 3AY0A 3W64A 1FEHA 1PYTA 4PCQA 1RAAB 2B5JA 4LUBA 3PO4A 4LSLA 3BS9A 3QFWA 1R8HA 3HVTA 1XEZA 4W90B 3DRRA 1RT7A 1F5AA 3TZYA 1Q16B 1SV5A 3BF4A 2ZJPQ 4JI6F 5F3TA 3DYAA 4F4YA 1Q82T 5ETMA 5RUBA 1R89A 1XJWB 2HBYB 2RNEA 1RHQB 3G6VA 3M8QB 1Q7YT 3B54A 3FFIA 4X4VA 4CO5A 1S1WB 3EVOA 1N5TA 3FEZA 2RKIB 1FRLA 2YWKA 4ELVA 2ZH7A 3BSAA 1CLFA 1DURA 4AL5A 1RYRA 2VQFJ 1WD6A 4Q0BB 1XR6A 4ED2A 1EHWA 1VR6A 3C19A 2GGPA 1MWYA 2ASYA 4NXNJ 5B0EA 1X4CA 3BYRA 1VQ4S 2AHOB 4U67Q 4TQSA 3OVBA 2W9AA 3OD2A 3D1QA 1WKJA 3LGHA 3MM9B 1GXUA 4ES1A 1REGX 1RQ0A 3PX0A 3PKMA 2HYIB 2ILYA 1NU4A 3S6EA 5FIIA 5A6WA 3KJVA 1YIJS 1JIHA 4DV7J 5K14B 3PRVA 3OTBA 2Y1JA 1ZM3A 1RP5A 4NLRA 2KYXA 5KFAA 2GQ2A 1QTMA 1W2BR 2N4DA 3NAHA 1KOOA 2FPHX 3HI9A 2VPXB 1OJ4A 5GAGI 2E5LJ 2BJ8A 2VH7A 2XBPA 5KFPA 1WOOA 4EMDA 4J5OA 2ZUGA 2HVEA 1YRUA 3CJ5A 4NA3A 4KKOA 2R2TA 5ETSA 2OH2A 3VAJA 1HR0J 4OQJA 4ECTA 2MZRA 2BRKA 1VIXA 3VALA 2DNQA 4EEYA 3HKWA 2MKJA 4URSA 4NX9A 4M8LA 2RMLA 3C6TB 1KWMA 4FS2A 2GVDB 1SQEA 1WF1A 2L3MA 1RI7A 4ZKAA 1KQFB 2MQQA 1A0OB 1S59A 3KMSA 3QT5A 1JK9B 1EP4A 4N47A 1N8RT 3EXCX 1WI8A 3JSMA 4DR6J 2FY1A 3MCOA 2B5JB 3FRZA 2DRAA 4GKKF 1SXLA 1VK3A 2Y3YA 5EDWA 4QW8A 4JV2A 3PIPQ 3D1OA 1I94F 1VIOA 2JEGA 1RHRB 2H48B 1MLAA 3DRPA 3SSRA 1LW0B 1H2VZ 1X9SA 3ILIA 1C2PA 2QA4S 3MMBB 5KFBA 1X4DA 5J2PB 1K9MT 1NKCA 1T0TV 5GADI 3Q86A 2JHEA 3VWSA 2WVEA 2NS1B 2P6TA 1ZAXA 2I9SA 2JOQA 3LAMA 5AJ3J 1REVB 4A48A 2UVUA 4P2XA 3MEDB 3EPIA 1ZETA 1RHJB 4EZ6A 4QIGA 2EKNA 1UMJA 2ZJQQ 3MCSA 5IT9Y 1S76D 1HLWA 4X66J 4P75A 4DR7F 3W2VB 3FC9A 3M8WA 3PRDA 5EX0A 2D69A 2ZWOA 2ZM6F 5C42A 4QR1A 2KXHA 2ACMA 5HI7A 1HIYA 1FDAA 1R0CB 4C0HA 4OX6A 2I38A 4LF5F 1NSKL 4WK1A 3BN4A 2QTWA 1FWLA 4Q45A 4B9TA 1QAJA 4DV2J 3LF0A 2XB2D 4YMEA 4RUAA 5CD4H 3EGWB 2BOPA 1HBMB 2MSSA 2KJWA 2J6UA 1WG4A 4K2XA 2BKPA 4RW6A 2M3DA 4DXLA 3CVKA 4AE5A 2VBYA 4BCAA 2D41A 4ID5B 3VGUA 1GNKA 4ERDA 2RH3A 4TLQA 5SZTA 1YLXA 1JWWA 3UI3A 2GQCA 1PAUB 3KWMA 3T5JA 4JBCA 3N28A 5JMNA 4QZVB 3FCVA 4DL2A 3ZTRA 4PG8A 2BE9B 2COLA 4NPOA 1VC5A 4BS2A 4YHHF 3KJNB 3KUHA 2AKWB 4P7VA 5KG2A 1QVGR 3ZFVA 4JYAF 3G82A 1SJRA 1JLBB 3BSCA 1RAFB 3ZTOA 2NSCA 2HFSA 5KFWA 4B08A 4PABA 2XMUA 3VHQA 5HBMA 1PGZA 3NWGA 3MD1A 4DV3J 3PW5A 3HFKA 4EU0A 2J9DA 3HVAA 3AJ2A 3MMCA 3MOJB 1GEHA 5DRKA 1PKUA 4OZ3A 1JLQB 2ZBRA 4U6PA 3DRPB 1VFJA 1RT4B 2V0NA 3QT8A 2CQ3A 3I56S 1ZTWA 1FJEB 5DZ7A 2HHHJ 4Q8EA 1DY3A 2HHTA 3P6YC 3QAEA 3SFUA 1ACMB 4K59A 1B70B 3Q8YA 1D3WA 5ETKA 3SZ2A 3MHYA 2R4FA 2ZNZA 4OYIA 2YPYA 3V6KA 4F7VA 3HSDA 5F8HA 4ATNA 2JZ5A 2MZJA 4DL3A 1S6UA 2C42A 2G9OA 4WYWA 2L9DA 5HQLA 3FBBA 4CT8A 1WOSA 1U1NA 3MI7X 2KZMA 4OZJA 1X0PA 2C3UA 5HK4A 1RT5B 3CCMS 2Y1LB 1R0BG 2B8QA 4F04B 2E5HA 3T1HJ 3W8GA 3Q8UA 1KR4A 4AQYF 1WORA 4OZ5A 3MM6B 2FLNA 2V67A 3AB4B 3M8RA 5C42B 3I32A 2XY7A 1TK0A 3RAQA 5I3QA 4LF9F 4F25A 3PM9A 4NI2B 3UNGC 3NGUA 3MFIA 3OSPA 3D9BA 2WONB 2ZC4A 1HD0A 1K1QA 5A6PA 1V3RA 1Q5VA 3HULA 3MMJA 5F9NA 5KG0A 4OYWA 1K47A 1SC4B 2IAJA 2RAQA 4NXMF 5CH7B 2WHOA 2UV8A 5HAOA 5KFDA 2W4PA 4OX9F 1PSDA 4LRAA 3PEJA 6FDRA 2VG5A 2ZFHA 2VF3A 4YP3A 2FC8A 2G2OA 4ZP7A 3Q23A 2YKQA 5K8NA 2J7WA 4K0KF 2V50A 2HVDA 2LYVA 5HSPA 4RU9A 3C16B 3HP6A 4P7TA 5ETOA 3O6QA 3X3UA 2XMMA 1N33J 3ISND 2CNOB 3I4HX 5E41A 4C48A 2N82B 3C6UA 1N6QA 2A6OA 2LA4A 3PW0A 4FYYB 3M8PA 4K5RA 2AGPA 3EVWA 4IH5A 5CXTA 3W9HA 1OYEA 3C46A 4DFJA 4G6VB 3CO9A 2YKAA 4ECRA 2JEFA 4MIWA 2VG6A 3M9NB 4WJBA 1P1LA 4KGZB 4KO0A 2WAQD 1HBOA 3DM2B 2UUBJ 1YTYA 3ICLA 4WU3A 1WC6A 4F0KA 1CQMA 3RB4A 2BDPA 3N9UC 2QT7A 1TKTA 4MYTA 2VUGA 2AEJA 4USTA 1BQNB 1P1TA 4I2PA 3KLHB 4GVLA 3VV2B 3P5TL 4PPZA 3UR0A 2C2NA 2HQCA 2JSXA 2IA0A 1K0TA 5JVHQ 5B08A 3PX6A 1I5OB 2OI2A 1PG5B 1QM9A 4CO2A 4TY8A 2YWWA 1H7XA 5G0RB 1NH7A 3IN5A 3PW7A 2V6AA 2GZOA 4WP3A 4RW7B 2KHDA 3CUNA 1FFGB 2I1RA 3PJXA 2RUSA 1IBMJ 4G1IA 1S4EA 5J1NA 4JI3J 4DR2F 2KG1A 3VAHA 3ISNC 1G4CA 2DD8S 1RHMB 5CYJA 4GC7A 1QAXA 2YQ1A 2W7OA 3LP1B 3GJQB 4W98A 2KZZA 2XMVA 2NUHA 1B64A 4DR5J 3MD3A 4DPYA 5A8WA 4TU9A 1TL1A 5D8HB 1HBNA 1S97A 1ROFA 3TR5A 2HQGA 5IV3A 3TW0A 1Z1ZA 2G0IA 5KFXA 1VLYA 2AX1A 3H0PA 2WSCC 1NAQA 1DLOB 1VBKA 2AGQA 1RLCL 2E1RA 4CH7A 3P96A 1IKXB 3TNVA 2IHR1 4NYOA 1JLEB 3D6FB 4ZPWR 4AYBD 1XR5A 4JI6J 2VG5B 2HNZB 2YX4A 1TELA 1N52B 3BGFA 1HNZJ 4MFBB 3IWLA 4OIXA 3W5ZA 3PZPA 3M2UB 4NMLA 3EE3A 5DETA 2J0QD 1HPZA 5L1KA 3PTWA 2ZD1B 3H59A 1NJWA 2NZ4A 4YB5A 4WF9Q 1UAWA 4A46A 1S0OA 2EBGA 2P9EA 5KG3A 1KN6A 1RTHA 2XHCA 1W25A 3EYZA 3JSRA 2KO1A 1RAJA 4ZVHA 5HATA 3MM8A 4OYAA 5H9FJ 1SC1B 3HHLD 4CLKA 2HK2A 4Y2MA 2HIQA 3MFHA 2GVZA 3EM1A 2VG6B 5SUHA 5JJBA 1VRTA 2QEXS 2V94A 2B8PA 1SH0A 2QA2A 4PYAA 2OELA 2BUNA 2AJ4A 1S48A 3B8HA 1TKTB 1VYAA 2W4DA 1TL5A 1VQSA 3V81A 3PACA 4KHMA 1PO6A 1NK9A 1S6QA 1CJVA 4RX6A 3FSIA 1I51B 3GV5B 3D0GE 1RT1A 2BKNA 2J7UA 4CNZA 2ZH9A 1M5SA 4I6WA 3TZWA 4BBYA 1NH8A 2CPFA 4PPDA 3N6NA 1S9EA 1S1UA 3IRXB 5HLFA 4L74A 4IFVB 5KFMA 2IJNA 1S1XA 2FVPA 1P8GA 1I6JA 5L1LA 2QGFB 3BO3A 2DRBA 4DV1F 2BOAA 2FYXA 1IWAA 1X4HA 3I9V9 1S57A 3VAKA 1KS2A 3B4DA 2X3DA 3RBEA 1S4FA 3ENAA 3KLIB 2FTRA 3MM7A 2F4VF 2XLJA 4ZJOA 1U0SA 1N32F 3SV4A 3R27A 4UOCA 2Q6BA 1BQMB 1GMWD 2RIJA 3CDWA 2GJFA 3Q89A 1G7CB 4C0OC 3NKYA 1UKUA 5HMZA 1RWPB 3GR0A 3W63A 3HHLC 1BWEA 4DV4F 4IDKB 4DF4A 2CQ1A 4L3KA 3IFEA 5KFOA 2FVSA 6AT1B 2R7WA 1X60A 3TZZA 1FJ7A 3SV3A 4FYXB 2V8DA 1MMLA 4UTGA 4RJVA 2DK2A 4WE1B 3GIMA 4NLWA 1I94J 1JLAB 2V8PA 1B0PA 1FKOA 4ECVA 4ZVEA 5T14A 3CTRA 2C2ZB 2YX7A 1SJ3P 4USVA 4KBIA 2KI2A 2HS0A 3IS9A 3KLEA 4CWBA 5C25B 5GVQA 1RWMB 4DV5F 1C0UA 4DMZA 2EG1A 1TZ0A 2BMBA 2H4YB 2H9ZA 2Q43A 3D54A 5DDQC 4J9OA 1TV6B 3RZAA 3QGPA 3G8QA 2ZHBA 4U8YA 5KFUA 1SH3A 3MR5A 2LLZA 3QGHA 4Q2LA 2CQGA 4O4GA 2OO4A 3QIPA 1UP1A 1O0PA 5LSLA 4QR0A 5J2NA 1SJ4P 4DR7J 3BM7A 1IJEB 3SDEA 3M9OB 4A8WA 1AT1B 2ZM6J 4H4KA 3TAMB 4FXWA 3GV7B 3NGSA 5FLXY 2OPPB 7FD1A 2OTLS 2IIHA 2MDAA 5LSRA 1EARA 4ZVRB 3TWZA 5A0YB 3V6DB 2J9DE 2HHXA 4Y0FA 4ZJQA 4OYXA 1CJVB 4QU6A 5AXKA 3ZXWA 2C2EA 1S72S 4NEZA 4MTPA 4B17A 1U2CA 2ILZA 3AAWB 4EBCA 1T9XA 5HL7Q 2ZUAA 5EGYA 4W92B 2CPJA 1FXDA 4B3TF 1FVSA 1S1UB 4PUOA 2CADA 5HLFB 3TUJC 1RUSA 4I4BA 1NSAA 2MQNA 3ZZYA 1FX4A 2MHNA 1S1XB 2XZTB 2DHSA 2J6SA 4OV6A 1N88A 1K1SA 2XO7A 4LFBJ 1WUUA 4HHHA 5DG8A 2R2UA 5B0FA 2GC8A 2DNHA 3CCJS 4YHHJ 4LRDA 4DQRA 4JYAJ 2HHWA 4ZN1A 5MAOA 1F6TA 4L3NA 1T03B 1NLKL 1YSJA 3CJ3A 3FSYA 1CJUA 3UQSA 2B51A 3NWRA 3BKFA 4UZCA 1WF2A 2CG4A 1V3SA 4KY3A 3QJPA 1WOPA 5M2RA 4XTTA 4I7FB 4IG3B 3DOMB 3JTOA 4FKYA 1L3UA 2OPSA 2VFSA 3EMTA 3MOZA 2DIVA 3W9IA 1LNQA 3H2VE 1CULA 1JNRB 1XNQF 3MPYA 1WKLA 4ELUA 3G8TA 3DOKA 1MW7A 1Y3KA 1KP6A 2KFZA 1NK6A 3HT3A 5LSOA 2BR0A 4QPXA 5M2PA 3KFWX 1ZPWX 3IS9B 5LL6d 3HXMA 1NK7A 1ZS6A 3PFOA 2Y9HA 1C0UB 1NDLA 2HRTA 1LWEA 2U2FA 3BO4A 4DZ6A 1S0VA 1BMQB 4NLDA 2RF2A 3ZZPA 1YJVA 2HZVA 3BZQA 2PA3A 3Q8RB 4C8OA 2MKSA 2JX2A 5D15A 3DGPA 3BSOA 2EWHA 2ZOMA 3ZZOA 1UZDA 5BYRA 2AYGA 3WX4A 3FGVA 3MM5B 1R6YA 2VJUA 2DHGA 1KVKA 1YRTA 4C0BA 3QATA 1WF0A 1WI6A 4AQYJ 1BGXT 2VC0A 2OSQA 4PQUA 1H3DA 2HSEB 4LF9J 4KIAA 1ZM9A 1SVDA 4IR1A 5HP1B 3DOLB 3DLHA 3I55S 3H8YA 1J5OB 1NZAA 2BW2A 1VBYA 1O8BA 4NA1A 4KPYA 2CPIA 2V63A 3EGZA 4MKVA 1RT2A 2B4VA 5K8MA 2KFYA 1LFWA 3HDSA 3NBPB 2AJ1A 3RGIA 5E3RA 1WG1A 1D8ZA 3FQLA 4HLBA 3UN2A 1VQYA 1Q81T 2R7XA 1RTZA 4NXMJ 4Z2XA 1IM6A 2DISA 3UDCA 1TVRA 4CYUA 4MKAA 4OX9J 2H5EA 4OZLA 4PUOB 3KK3A 2MKHA 2KT2A 3MWBA 4NEYA 1RBOB 1JX4A 3BN7A 4C4WA 4K0KJ 4Q43A 5IZHA 2YKNA 1K8AT 1KRPA 5B7WA 2Z8QA 3ISZA 3DLEA 1UVIA 1LW2B 1RWVB 2ZKTA 4QQBA 1WKKA 4ES3A 2DPIA 1FF2A 3VF0B 1RHKB 3T6JA 4A8YA 3BDPA 5BXIA 4MK9A 1KKHA 3GLJA 2ZHAA 1NDKA 3GJSB 4ZITA 2ASJA 2P5VA 4AT1B 3HFZB 2DKOB 1RCXB 2HQIA 2CJ9A 4H4OB 2UUCF 2HFVA 2IC3A 4M5NA 2RHSB 4NLPA 4C8ZA 1BY9A 4DPUA 4LFCJ 4F36A 4DR4J 1JLCA 2OLWA 3N0VA 3EX7B 4CO3A 2AIRB 1LWXA 5J2QA 4DUYF 1S0MA 2M7SA 3H98A 1FFSB 3T9NA 4FYDA 1GX5A 2A1BA 1MMNA 3IGNA 3M30A 1Q8BA 5F9LA 1ZM2A 3RR8A 3DOKB 2YWHA 3QWPA 2RQKA 2R7QA 1QVFR 1RTJA 2MZ1A 1X5SA 4YS2A 4NE9C 4C8LA 1WACA 1LFPA 3PY8A 2JRSA 2VFTA 2MGZB 3P5BP 5KFFA 2VKZG 3KNAA 4BWMA 2ZKUA 4GO5X 2IDLA 3FUYA 1M5KC 3DC2A 2YNFB 4C9DA 5B0BA 1FD2A 4WYLA 1Q0NA 2RB7A 2Z4PA 1H98A 1UEKA 2NR0A 2E29A 4QWDA 2XHWA 3ITHA 4X4NA 2AV5A 2MY7A 4DR2J 2APOA 4MIBA 2DO0A 8ATCB 3PNIA 1HL6A 4YOEA 2BE2B 2R3VA 4DX5A 1JXVA 4A4JA 4QOTA 4RNMA 1H74A 3K7RA 4J9RA 3TA0A 3A12A 3IXQA 4EO8A 1F2HA 4LR8A 5KFIA 1SIZA 1UPPA 4HR2A 3NNCA 5IC6B 3W9JA 3W5YA 2G13A 3UN5A 4J9LA 1YJWS 3MF5A 2N3LA 4ID8A 3SEOA 9ATCB 3VAIA 4HL9A 1HQEB 2X3GA 1IKWA 2W9BB 5T7LB 4KB7A 2VHGA 2BXJA 1GK8A 4B9LA 1UVNA 2GIFA 5F8NA 3DDKA 3MR7A 3R5AA 1TVRB 4CYUB 3CE8A 3RBZA 3OTCA 1B0VA 2IBKA 3CDEA 2AF6A 3JB9k 1YHQS 1FDBA 4R8UB 1RBAA 5AT1B 3GV8B 4RW9A 2ZZMA 2NQPA 3M05A 3PJ9A 4QIEA 2CJYB 5ETLA 1XQIA 2M5YA 1KDNA 4HH0A 3P4UB 1GQEA 5B0AA 5CCMA 2E7XA 5E3AA 1YDLA 1OY9A 2FGCA 1HNVB 3M1VA 1FVQA 4Z7CA 1PJ7A 4NCGA 4G1QA 2R7RA 1YWXA 4ZHRA 1M1GA 1JKHA 2G2ZA 5DLFA 2F4FA 1XC9A 3NNHA 4EZ9A 3BREA 1D9FA 3TARA 1GTEA 1CG2A 1V9OA 3IO1A 2U1AA 2DH7A 2J0WA 4IRKA 3MCMA 4DL7A 4U8VA 4JI8F 1N5YB 3LTOA 1KQGB 4F26A 3ZNJ1 3H2LA 1JLCB 3LPYA 3HZEA 2J5AA 4O3PA 2V9WA 5J2QB 2C2OB 4F4KA 4G65A 2F9DA 4LF7F 2BJ7A 3KKFA 1NM2A 1FESA 2QG9B 1HD1A 1PAEX 4ANEA 4MJKA 2AWZA 5H9EJ 2YKMB 4PG4A 1HW8A 4UOHA 5DO2A 3I87A 2QA4G 1VQOS 1RKJA 4X62J 1H38A 3M2VA 1X0FA 2XYHB 3UD3P 1FWKA 3V4IA 4OL8A 2XCPA 3DU5A 1WSRA 2JLGA 1DZ5A 4R5PA 1UVJA 2MPUA 2J7KA 5CYQB 1N5SA 2W1BA 2AD9A 3RB3A 1KBRA 4QWEA 2YNGB 5DM7Q 3DLGA 3BB5A 3BBFA 3D1HA 4ED1A 3AD7C 4NASA 1N5VA 5K5MA 3RTVA 4DV1J 4NXNF 3ITHB 3KK1A 2MYFA 2AW0A 3LO3A 2GCFA 1F9HA 3K58A 2BACA 4JP8A 3TUZC 4IUFA 1D9AA 4LJMA 3VQSA 5GADU 1X5OA 4FZVA 2J6TA 3K5MA 4DEZA 1C0TB 3I0RB 2IM1A 3W65A 4I67A 1N32J 1GXLA 2VJVA 2EC0A 1KSPA 2NLWA 3MPVA 4WTOB 3OR2A 1EQ0A 4TU7A 3H5XA 3NS5A 1SPBP 3CCQS 4FF3A 4DV4J 2YNIA 3HJVA 3KOAA 4ED0A 4DL4A 4DLEA 1UL3A 3ET6B 3OXGA 2ADCA 4Q8FA 2BE7D 4P52A 4FP9A 3FK4A 3J81Y 3OLAA 2W2NP 2ZHOA 4PKDB 3TEHB 1RTIB 4Y2CA 3EPGA 5K9FA 2UXCJ 4GVBA 1RHUB 2E9ZA 4F2SA 1IKVB 3TZXA 4OI4A 3VVTA 1F3VA 2QO3A 1Y00A 1YJRA 4F0MA 4B02A 1RU1A 2OD6A 4NCBA 4DSJA 3F0NA 2HQDA 2FZGB 3LPEA 2K1RB 1SC6A 3LP2B 4DV5J 5K8OA 2NYIA 2E7WA 4HHUA 1U1LA 4I64A 4NCGB 1T05A 2AEMA 4BC7A 3C66A 4UOGA 3N6LA 1ZOTA 1JKHB 2ATCB 2DNNA 2FIUA 3QZ7A 5J1EB 3HHKA 3QBCA 5LOQA 2PFFB 1YK9A 1RT6B 4DR6F 2WVCA 1VHFA 1YJUA 4X4SA 4ZLNA 2F65A 3FMBA 4NOHA 4ECWA 4IO1A 2R8GA 2PE8A 3MECA 3DLLQ 3ADAC 5C2GA 3G6YA 4WXWA 4JV1A 3GTYX 4E2FB 1Y4ZB 5KFYA 4HI2A 4B3RF 3PFEA 4QIVA 3Q8SB 3V6JA 1S1VA 3BEGB 4UY8T 4P6QA 3KJQB 4HTJA 2DTJA 4ED5A 3FSXA 2FHJA 2HWTA 3UR3C 2AGOA 4OI2A 4WK3A 3CC4S 4ZJLA 2Y8WA 4OJHA 1WHWA 5D0EA 5IXUA 5AJ3F 2QA1A 3LW5C 2M52A 1T11A 2CPHA 4KH1B 3MURP 1WC1A 1VISA 4QWAA 3M32B 3TI0A 1ZYQA 2F1FA 4CLPA 4DCOB 2RDJA 3KG4A 2O1PA 1EQMA 3ENQA 2LDIA 2FGOA 4ZCKA 2A2DA 2ZC3A 1UWAA 4WFYA 1P6TA 3QJLA 1R43A 2ABYA 3BGOP 2V9KA 3AXKA 1VBZA 2M88A 3A8IA 3BV8A 4NLOA 4TNOA 1DBDA 4F3MA 1TMJA 3MGJA 2QMXA 2H5IB 4CLZA 1WJ9A 1QAIA 3JS9A 3EJMA 4ZPAA 2DPJA 2ZVIA 2CJXB 2F8MA 3BBBA 3CJ2A 3CDUA 4PWWA 2ERRA 3BBCA 7AT1B 2BABA 5IT0A 4B3OA 3UN3A 5GAHI 2LCWA 4I56A 3W5XA 2GIQA 2C28A 1ZH5A 1NZ8A 2EC2A 2DNZA 3CCRS 4DS5A 3CJ8A 1KD1T 1XNQJ 5K20B 1DTQA 2HKEA 3MAHA 2LEBA 5DS7A 4PXCA 4DBQA 3RW7A 1YQHA 4ZS6A 4DJBA 3TX0A 2KHCA 1TK5A 4NLGA 2PA8D 2EKYA 2PMWA 2EI5A 2GMLA 4Y28C 3T19A 4QYZK 5D3GA 4BC9A 4DPTA 4QR2A 2A2CA 2FD2A 4LFAF 2JFKA 3OBIA 4ELTA 1S1TA 1TL7A 3G87A 2R7SA 1T9VA 5HANA 1QUPA 1C1CB 4IFYA 2D7SA 4WPAA 2XGQA 4OI0A 5EWEA 3CC2S 1KLMB 1RACB 3IMQJ 2ZH8A 2IDEA 4QBUA 1X4EA 4TYAA 1NMEB 3I31A 1IKYA 4I6YA 4LQ3A 1S1VB 1SL1A 3TX8A 1NK4A 1SJQA 2C2MB 4OYOA 2QSWA 5B0GA 3Q24A 3QWUA 1TMMA 2BA9A 2IMWP 1FA0A 3D67A 2HHSA 2OEMA 3HD1A 5I42A 1HWKA 4CLWA 4RUHA 4OYPA 3OLBA 2LXIA 4LBHA 4E8UA 4O44B 2KL8A 2BQRA 4F0HA 5T41A 5LJ3Y 3W1YC 4LF1A 2OPRB 2BRLA 2AYMA 2W9CA 3BGUA 3VZIA 2QZ8A 4C6AA 4ZVTB 1ZZFA 2IMOA 4I1TA 3ZC4A 1GT8A 2BJDA 3CO0P 3ILJA 2D3OR 1NB7A 4RW4B 3GIKA 2IY5B 4NLSA 4NRUA 4OX8A 1N34J 1MU2B 4RNHA 1Q1KA 2GAGC 3LP0A 1TKZA 3NGKA 4DU8A 5EX3A 1U0HA 4OJ1A 3UPFA 3UCUP 3I0SA 2NUUG 4DI6A 1VC0A 4PZVA 4ED3A 3SI8A 3ENVA 3TVYA 3DRXA 2B7BB 3B6BA 1U1QA 3NEKA 1FRKA 5D4LA 1EAYC 4WU2A 4CO0A 1YRXA 3WC2A 4YEAA 3ZNUA 4J9NA 3L9ZA 2YTCA 1H0HB 3T3FA 2HVIA 2DCLA 3SCIE 4DUYJ 1XNRF 3OTDA 5FD1A 1DQ8A 5CHCB 2WVFA 4F8RA 2FJAB 4MKBA 5IOLA 1S5ZA 2QYGA 2Z2LA 1DTQB 1DTTB 5HMYA 2HPUA 4LR7A 3JTNA 2Q79A 1Z4UA 1R31A 1W2IA 1S1WA 1KHWA 1PJ6A 4ITSA 1UVLA 2IRYA 4OHXA 4OHVA 2RKIA 1IQZA 3X1LB 1D9DA 4F3OA 4URQU 3EDRB 4CP5A 4DOZA 5EN1A 2HRYA 2DB1A 1KC8T 3KNGA 3R1LA 2MKKA 4Q0BA 3LH2S 2YPZA 3K5LA 3OUYB 1URRA 2V4JB 1S1TB 1RA7A 1TL7B 3CF5Q 4IO9Q 2B7CB 5J2MB 5KFEA 5FDLB 3BSNA 3K89A 1S9FA 1ZZNA 1Y7PA 3MM9A 1N5QA 3G86A 4YR0A 1N48A 2XYGB 3HD2A 2HBRB 4YB1P 4ZLJA 4FF1A 2MKYA 2IM2A 1B3TA 1EB0A 5CAAA 1WELA 1OPIA 1RZMA 4ZP6A 3OV7A 3NL0A 4C3KA 3KLFA 4AL7A 5DQIA 4QPTA 4N77A 2XMJA 3T41A 2A18A 1AB8A 4Y6IA 4ECYA 4QYZJ 4NLQA 4U9RA 1TL3B 3VTIA 2QC3A 1JNZB 3HPOA 1F3FA 3D66A 4FVCA 1AUSL 4NYPA 4M5HA 1JXEA 2DY1A 2HQ3A 5LMNF 1NCLA 4JI3F 3BR8A 3QSIA 5HROB 1VI7A 3EUNA 2OTJS 3DGVA 4DPXA 1XMOJ 4QJVA 5ETQA 1UVKA 5DQGA 4WZQA 4JI5J 4IOAQ 1DARA 5HJXA 2GVDA 2XNRA 1PBAA 2DGVA 2FDNA 2JNJA 5B09A 1ZM4A 4RW8B 4J91A 3LP0B 2Q6CA 5A8RB 2ZJRQ 1LXJA 2KXFA 1JXLA 1U6ZA 1U0HB 3UDVA 2RSQA 2YKOA 2DGQA 4H54A 1L3TA 1HMVA 4RNOA 1FCAA 4O3SA 1Y10A 1B99A 3OFHA 4ZPVR 3MMAB 2XEXA 2PMZD 2PMHA 2XS7A 4JI8J 2RRBA 2K3KA 1OYDA 1FRJA 4WFNQ 2UUTA 2VODA 2J9EA 2YY3A 4YFUA 1ELOA 1WHVA 2E1PA 5F3ZA 3K5NA 2VPWB 4A8QA 2B43A 1EX8A 1T9TA 2PT0A 2HURA 2J76E 1LW0A 4LF7J 1SKRA 4DPWA 2KN4A 4DDFA 1HNZF 2IA6A 3EICA 3MMBA 5J2PA 1IR1A 5ADZA 1AFIA 1CJKB 3DI6B 1N36F 2K3IA 3SSQA 3U1NA 1A9NB 2E5JA 2QLXA 5KFCA 3GG1A 3FDSA 4ZIWA 1FE4A 3CIMA 2R2SA 2JVOA 4PG7A 1FK9B 1REVA 4L6V3 2GS8A 3TUIC 3OHBA 2M8HA 1ZAVA 1TAUA 2VG7A 3MEDA 3TO8A 1VQPS 1H6KX 3O1LA 1UEUA 5A2QU 1WEZA 3QFHA 2ZH5A 4I69A 3SQOP 4H4KC 2CAJA 3W2VA 4C7QA 1SKSA 4LIRA 4LF6J 3CD5A 3GFYA 4OZ0A 2FUG9 4DN0A 1D0EA 1DFDA 1U45A 1VC6A 8AT1B 1ZAWA 3Q0AA 2F9JA 3ENWA 4IRCA 3LALA 1FDDA 1H2TZ 2GW8A 2MZQA 2OAUA 5KT6A 1FFWB 4I2QA 1KEKA 2I5JB 1YBAA 3SXLA 4K4TA 3I5BA 3KLFB 4KR0B 3J80U 2N7CA 3NOGA 2NYHA 2YWGA 2OEJA 2B6AB 3WZ0A 1HBMA 3OTEA 3JQMA 2DO4A 2MLXA 1CVJA 1FRHA 2RD5C 4QIFA 5I3PA 2EK6A 3FCHA 1JJCB 1NDCA 3QO9B 2CPEA 3HLUA 2OUGA 4ID5A 2YQ0A 2CQHA 1UJ5A 3AB2B 4M5LA 3N5FA 4CI0B 4JI0J 2V2VA 2E9RX 3OL7A 3H40A 5KFJA 1FNOA 4RNNA 2HMIB 2OJ3A 3QMQA 1JLBA 2F8EX 4F3QA 2CQ2A 3BGRB 2OSRA 2XNQA 4N8NA 3DHWC 4K4YA 3MR3A 3V5RA 3J7A1 4DQQA 1HMVB 2VFRA 1NHUA 1QE1B 4HI1A 3HVRA 3U7JA 1CQNA 2ADBA 4EYHB 3KDOA 3TAPA 2IVYA 4QU7A 2JC0A 1JLGB 3M2RB 4R0JA 2EFNA 1FDNA 1JLQA 4USJC 3EDQB 2WTFA 4M94A 3GQCA 1N0VC 1RT4A 4B3RJ 4ZVGA 3OJSA 1PYOB 1PC4A 3IGVA 2DR9A 2DVIA 3T5HA 4A8FA 4EI2A 2EVZA 3IP0A 2OPQA 4G1PA 2KT5A 3K8WA 3D3CJ 3E8OA 1XIQA 4QYRA 3KHLA 3JAMU 2EBEA 3W62A 2DNGA 2Y1RI 4ZVQB 1WC4A 3BQ0A 4Q5VA 2XS2A 3OFGA 2IYGA 2CZ4A 3TRGA 2L48A 1PILA 4USHA 4UF4A 4ZVOB 3THTA 3D6MB 3RAXA 3CJKB 2EFOA 5F8IA 1VOMA 2VG7B 2JVRA 2K8GA 1CS4A 4WFZA 1H73A 1WNEA 1RT5A 1RGVA 3U02A 1H2UX 3CNQP 3BDEA 2F3JA 1K44A 2DITA 2ZVSA 5ETPA 3MM6A 2K7KA 1AZSB 1WC3A 3QIDA 4LBPA 3FBFA 2HVHA 4DX8H 2M0GB 1X4GA 4KTQA 4NI2A 3FJ2A 4ZP8A 3S01A 3D2WA 2A6MA 3NS7B 2VOPA 2Y1IA 1T95A 5IQ6A 2WONA 1VQLS 1R7IA 1VMBA 3M6XA 2W8LA 4CM0A 3PG9A 4V19X 5KT5A 1XR7A 3HSZA 1C4CA 2VFUA 4I2QB 5LXYA 4RO0A 1J2VA 1BE4A 1YVFA 2HQFA 2L9NA 1FRXA 1Q4RA 2M9KA 1I3OB 1LWCB 3VAFA 2PO4A 2MZSA 2AYBA 4NZ0A 4CQ1A 2GAHC 4HACB 3HO1A 5KFGA 5BYQA 3TA2A 3CJQA 2ZBCA 3HZGA 4O3OA 1F1BB 4TVAB 1Q8KA 2XZDB 1PYSB 5I3UB 3IBFB 1RABB 3C16A 4LFBF 2AZ1A 4WP8A 3AFGA 3OSNA 1OMSA 1X31C 1U1PA 1Y9OA 1FRIA 2YXLA 1X5TA 4YUDA 2FJWA 2CPYA 2GMJA 2ALYB 5A2QY 4ANDA 3ILLA 3G8SA 2YKPA 3MAAB 1U25A 3M4XA 4LFAJ 5L1JA 2DGWA 2LEAA 4DR3J 1FKAF 4Y34A 3S8SA 3EZUA 1KONA 4EGLA 1WC5A 3MPDA 2FVRA 4J37A 3QRPA 3JQJA 1X7VA 2CDRB 4ECQA 3R6LB 3R7NB 1HBUB 3DM2A 4GC6A 3NGTA 2MQMA 2VB6A 4K4XA 3D3BJ 4HDHA 3SCKE 2CVIA 1LWFB 1OSCA 1BQNA 3DXSX 1WTBA 3KLHA 3J80Y 1VQ5S 1VQ7S 1S79A 4U7UK 4UQGA 2XC9A 2PD1A 2GHVC 2OPQB 1U4BA 3IC1A 3VZHA 4DU7A 3P45B 8RUCA 2BM1A 1NDPA 4KHPF 1X4BA 2LQJA 5AXNA 4FF2A 3HF5A 1MWQA 5G0RA 2YH1A 1HNIB 2V8VA 3THPA 4RW7A 3Q83A 4ZVSB 3LGMA 2UXDF 1NJYA 4CT9A 2E1CA 1HA1A 1CS4B 5HJYA 3FEYB 4KE5A 4N5SA 4ZVFA 4GKJF 4MIAA 2CXEA 2PI5A 2ZBQA 4UW2A 2FHKA 3FCWA 2W2QP 3LP1A 3HHLA 5KOWA 4ED7A 3E01B 1RTDB 3V2UC 3AOAA 3ETMA 2HGMA 4IRDA 3R2CJ 2LP4A 2F5GA 2L9WA 4U7UD 3PYGA 4AXIA 3PX4A 4XIUA 5C24B 2FVCA 3KXDA 1N56A 4WFAQ 3ZZTA 3PIOQ 5JUMA 3C15A 1O51A 1DLOA 2DH8A 1SKWA 2LU2A 1IKXA 2MQ8A 3M6VA 2LFVA 1JLEA 4E98A 3A4TA 3CWJA 1Q86T 2C1EB 2HNZA 4IH6A 1XNRJ 2BM0A 3JAMY 1TKXB 1UETA 5HVGA 2AJQA 1KLNA 1HQ2A 1RBLA 4MFBA 4TKTA 1NJZA 4PXEA 4CLSA 1EKRA 1W7WA 3M2UA 1X4FA 3GIJA 2J8AA 4P10A 3K57A 4HKQA 2ZD1A 3PKYA 2ZZTA 2ZH3A 1TR0A 1NK5A 1U02A 3QLHB 2IPOB 3HX9A 2DH9A 1UZHA 2HHUA 4KQZA 1OSDA 3CJ4A 4QWBA 3EWGA 3GR1A 3PYDA 2KU7A 4YR2A 4DCPB 2QX0A 4JI4F 1TFWA 4AFFA 2LQBA 4IG0B 1SJ1A 4K4VA 3GCWP 1RDRA 4JV5F 4N76A 3UE2A 4LFCF 4Y2AA 1MMDA 4O3NA 3VCDA 4DR4F 3DLBA 3FZBA 5M2UA 1YX2A 5CYMB 1QTNB 2CYYA 2VD3A 2VDIA 3NRBA 1GH8A 2DGXA 1UPMB 1DAXA 2WBMA 3P8BB 4F2RA 2N7YA 2LQ9A 1SQGA 2BANA 4U7CA 1JLFB 1RAHB 1NJIT 1FXLA 3DXBA 4YDDB 3A8JA 4DV0J 3B78A 1URNA 2B4UA 2NCKL 4C11A 1I1GA 3WX8A 2EFVA 2W7AA 1XMBA 2Z57B 3IRXA 2DNOA 4BLGA 5DQHA 4IFVA 1MN7A 1QSLA 3SIPB 1XERA 2NPFA 4AL6A 2HNDB 3OL8A 4N56A 1KVIA 4OZ2A 5LMNJ 4DQIA 2EFQA 4XDCA 4URGA 3GG0A 3KLIA 3L7PA 2OFGX 3HHLB 4KT0C 3KHRA 3TP2A 4JI7F 3IR6B 3OVSA 2LA6A 5E33A 2HNYB 1BQMA 3A13A 3OW2R 2HHPA 3S1TA 4MKYA 4CH0S 4NL5A 5B0CA 2XCAA 1O5JA 3M8SA 4IDKA 3G4SS 3RB6A 2DR6A 2X51A 4FBUA 2W2MP 2JEJA 3PDNA 4X4UA 1KTVA 1FWPA 1FJGF 4A8SA 3T1AA 3C15B 1SJFA 4WE1A 1ZPVA 3DRSB 1JLAA 2F7VA 2KB2A 2MTLA 3DDNA 3A3OB 1FI4A 1J5EF 7FDRA 3KG0A 2B0GA 3QT6A 4Y65A 4JOUA 4FNIA 2RILA 3CDBA 1N36J 2HIYA 3TA1A 1HFEL 5C25A 2CQCA 4ZCLA 3SFGA 1UVMA 4DX7A 5DG9A 3TQ1A 2BJEA 4C98A 2NXUA 3VAGA 2VASA 1TV6A 3RW6A 3KDNA 2RVJA 3MEGB 2B3TB 5KFSA 2XMAA 3THVA 2ROPA 3GONA 5G4DA 4LRFA 1T7PA 2RDIA 1F2GA 3KTQA 2A3JA 2CQBA 1RYSA 5B0DA 3NGDA 3TAMA 3R1HA 1M1HA 2C22A 3CDAA 3IG1B 2OPPA 4Z7YA 1YGYA 1X8DA 2CJBA 3RU0A 2Z58B 5A0YA 3V6DA 4ZP9A 3HSJA 2I2YA 2BANB 2KDOA 2PEHA 1G6BA 5DDRC 1M5PC 4WWSA 5I4MA 3CCLS 1SCJB 2KM8C 1PCAA 1S9GA 2JLEA 1SKUB 5KG5A 4X62F 1HNXF 3SSSA 1HNWF 3LA0A 4C11B 1DHMA 2GA7A 2BJ3A 1SB6A 2QLJB 3KJFB 2P2CB 3H42A 4YY3F 1UJ4A 1UA1A 1WEYA 1KNZA 3JXOA 3N79A 3NP5A 3BPSP 2VDHA 1S77D 3TUPA 2MQPA 1IWGA 2CG8A 4FN5A 1AXQA 3C3LA 4NLVA 3L4BC 4DQSA 2IM0A 3GYGA 3IBCB 1AW0A 2XY5A 4CLLA 4KGKA 4M1KA 4JI1F 4DN9A 2DNRA 1S6PB 3R2DJ 3VGSA 2OFHX 4NLXA 3NCRA 4C97A 2O66A 2BQ3A 2VQEF 1UTAA 5IWAF 1S49A 1AROP 2DGOA 3AJDA 3GIIA 4P2MA 4C8YA 1T03A 1RWWB 1TK8A 4CO1A 4X4OA 2CFXA 5KFKA 3LUYA 2Z2MA 3O3LA 1XBWA 2QFJA 2JC1A 1RWNB 1CEZA 4H4MB 4I7FA 4IG3A 4KHRA 3DOMA 3DHXA 1U26A 3CJSA 2GV1A 3L95X 4CM2A 1ITPA 4ECUA 3R5BA 2R7UA 4RUCA 4W4MA 3QQCD 2WZ1A 2MEWA 3R9LA 2KVQE 2PN6A 3EXYA 1H72C 2UXCF 2CPDA 1UA0A 2VC1A 1O6XA 1CJTA 1U6FA 1VRQC 3GPAA 4RWWA 3C14B 1IBKF 2DY9A 1AUDA 4NWBA 3GILA 2V2QA 2G4BA 3IWNC 4L73A 1FKPB 3GIRA 5EHHA 4EBEA 2O5DA 2RU9A 1T9WA 2G1DA 5CA5A 3D6HB 1LQ9A 3CJTA 5GAEI 2HLTA 3CMES 3JSYA 1RU2A 4ZA1A 1FT8A 5GAHU 5A8KA 1Y11A 3KK2B 4M5IA 2ZEJA 2VBWA 3OR1B 1WWHA 4DL5A 3MM5A 2CQIA 3DLKA 2RJZA 4LT6A 3JYTB 3FNNA 3UW1A 4HT5A 4M5DB 2QL9B 5HP1A 3POTA 3DOLA 3TYTA 4C8KA 3DMJB 1J5OA 1HHSA 2KRRA 1E6YB 2C3PA 3A8KA 2DGTA 1RA6A 4LSNB 3DLJA 3ZZRA 1WSVA 4WP9A 3NBPA 1S9GB 4M5JA 4EWTA 1RADB 2WB4A 1TAQA 2F8HA 3ILOA 2YVSA 4QCLA 3H20A 2WRMA 5ETTA 1TU0B 2OP5A 1X9MA 1NKBA 4ECXA 1NSPA 3K8VA 4FYVB 2YWEA 4X4TA 2V69A 4HDGA 4FKXA 2AYEA 2V34A 5KFQA 1LW2A 4LSLB 5ITHA 2IYIA 3HVTB 3MDFA 3R3TA 3DRRB 1RT7B 2WW8A 2BX6A 3D28A 1SV5B 4M5GA 2VV5A 3W2WA 3DYAB 4RUBA 2W2OP 4H4OA 1Q78A 2HRUA 1RWOB 1NBEB 2W7PA 3KUGA 4D3GA 3HHNB 3FFIB 2G0CA 4QWCA 3RAMA 3E2EA 1X5PA 2IJFA 2C3MA 2GJIA 5D78A 3J81j 1RLDA 3AODA 1F5CA 2XLKA 3RBDA 1Q53A 3J7YI 3PR5B 3CC7S 2RDDA 5J1PA 3BQ2A 1CJTB 2V68A 3BPDA 4KV8A 5AE1A 4ZVPB 2UVVA 3CCWA 4ZLLA 5E3QA 4I68A 2GGPB 2LQ8A 3ZZUA 2V2KA 4LQ9A 2W01A 4QW9A 2XTJP 3UD4P 4OZ1A 4FS1A 4KHPJ 2MGZA 2MLZA 5H1SV 3MEKA 2C3OA 4P9SA 1Y5NB 1BC6A 2YNFA 1QUVA 2PFDA 2DT9A 2DNPA 4OYMA 2UXDJ 4EYIB 3CB4A 3OQ2A 1UWBA 5A8KB 2HHVA 4Q2MA 3G6XA 3KJVB 1F0XA 1V5VA 3B82A 4NLUA 4GKJJ 1KFSA 5D77A 2ZBIA 3MUVP 2IFXA 1FNXH 2BE2A 2DR7A 3HJFA 4IQMA 1ZA2B 3A1YG 2J0XA 2WW4A 3DLKB 2BV3A 4NMXA 4DSKA 3SQGA 1WDTA 3POTB 1F9FA 1RAIB 1OWXA 2V8HA 3J7ZT 2VZ9A 2MQOA 4N41A 2HG4A 4KKOB 3G71S 1HQEA 2G0JA 2W9BA 5T7LA 4Z37A 2CNLB 5LT5A 1MROA 1HI0P 4F4WA 3QAUA 3PRBA 2DYAA 1VHIA 1YJ9S 2DHXA 2VU5A 4J9MA 1EP4B 4R8UA 3RBXA 5KFTA 4RPFA 2B9EA 4ECZA 3RRKA 3JSMB 5BJRA 4OLPA 2R8JA 4DSEA 4J9UE 5CD4A 3TANA 2HAFA 3KUEA 3DNCA 2GFFA 3AH6A 3MUMP 1N34F 1S12A 2NXCA 2UVWA 1M5HA 1HNVA 1AFJA 4FF4A 4HEA9 2D74B 2XI2A 2O01C 1RJJA 4LMZA 4FPRA 1G1XA 3CD0A 4ZMMA 1R6VA 1XTZA 1KHVA 3W2WB 2VBZA 1X4AA 4JI4J 4EO6A 3O2IA 4O0NA 1U24A 3CCES 1BUXA 1KQKA 3RR7A 4JV5J 1N5YA 3UDEA 2ZDPA 3AQOA 3MCNA 3CW2C 3AD9C 4FPIA 2VA3A 1VDHA 1A6LA 2VPZB 5CABA 2FVQA 5LMUF 3I5CA 3ELHA 2BVZA 2PGCA 4GMKA 2KXNB 2NPIA 4PG6A 1PIEA 2YKMA 4WTYA 3ZZZA 4B9NA 5IM0A 4KV8B 2AP6A 4YQWA 1SQFA 1GTHA 5BR8F 2HFUA 2E9TA 5U47A 2C3YA 4P72A 4BHQA 1RAOA 4KAIA 1HARA 1NK0A 1BHNA 4JB8B 4OMFG 5CYQA 2MKCA 1SUQA 2QMWA 3I9ZA 2YNGA 5DJBA 3CIZA 3F56A 2DNMA 1UWBB 3HK2A 3GMGA 1YZ7A 3SYZA 4R0EA 3RRHA 4ETZA 1UW9A 4C3MA 1G2EA 2FLOA 5H9FK 1FNMA 4LF4F 1IBLJ 3G96A 2BQUA 1PBUA 1C0TA 3I0RA 3I96A 3CCVS 3TJ9A 1TL4A 3T9ZA 2OGUA 4JI7J 5L39A 3EZOA 1F5BA 4PQAA 2UZAA 4RW6B 2DGSA 3Q8VA 3SQGB 3N6MA 3U1LA 5HO4A 1HWJA 2ACYA 1HKAA 3Q8QB 1CSJA 3MEEA 1Z2LA 2CNKB 5KT7A 1HWUA 2AMCB 3V4MA 3GFZA 4DWIA 4RKUC 2QL5B 4K50A 3ET6A 2XSFA 4P2SA 1MROB 3LAKA 5CCLA 2EFPA 1FJGJ 5E0OA 1EETA 4ZIVA 3A3NB 4DFMA 2X1AA 1GMUA 1RTIA 3GSDA 1J5EJ 2DRDA 4IYQA 3G82B 1GAOA 1IKVA 2KYZA 1JJHA 1NHKL 4F4AA 3G2XA 1FJCA 2A0FB 3TEGA 5DGBA 1XMOF 4OYBA 2MXYA 5HMWA 2VOOA 4U96A 5HBMB 5F41A 4JI5F 1QJHA 2K1RA 1NSQA 3LP2A 3K5PA 4RU2A 1T94A 1S10A 2PC6A 3MMCB 4JI2F 3OTOF 1E6VA 1JQGA 1GFWB 5GAGU 1RT3A 2A10A 1RCOB 4V1Ak 5J1EA 2ZOGA 5CQGA 1LXNA 2FLLA 2P6SA 4DUZF 1RT6A 1BLUA 2HBQB 1BXNA 5IFMA 2FZKB 4OV1A 1M5OC 2V2ZA 2Y8YA 1QAYA 4ANCA 4K4UA 2ZOFA 2HFNA 4XAKA 2MJNA 4DQPA 1S99A 2OIHA 1RKIA 4BDPA 4X64J 1LOUA 2XMTA 2GIRA 5DDPC 3HCXA 5HMXA 4J7CA 3BJYA 2H5JB 2ROGA 5MLCV 2H3EB 1WTFA 2B9XA 5IM0B 3CJ0A 2M2BA 2CA9A 3MPUB 2NREA 3PJWA 2XM3A 3D7SB 2QLFB 5E5NA 1HNXJ 4J9QA 2N4CA 1HNWJ 4LIWA 1WEXA 1HWLA 1MG7A 4YY3J 2P9CA 2O67A 4LBIA 1VRUA 4LREA 3EGVA 1YG0A 3T6BA 2QMUB 1SUQB 3M32A 2GJ2A 2XMKA 2D9OA 2HFZA 5FLXU 3M8YA 4Y2KA 1VJWA 2Y0BB 1YJTA 4RZRA 4PWDA 2VKRA 2WBRA 2UUAF 5KTQA 2BJ9A 1R3NA 4LF6F 2FJEB 2BBEA 4ENOA 4JI1J 5F8JA 2FB0A 2RQ4A 4FVMA 5DDOC 5GMKa 2JFDA 3CD7A 1U48A 2IAJB 2KT3A 2K06A 5HVHA 2VQEJ 4HYKA 2AX0A 1CC7A 2Y0SD 3PCOB 5IWAJ 1C4AA 4WFBQ 1RAGB 3A3PB 3J7Z5 1OPZA 3ULHA 1JJ2R 3W3SA 2RQCA 4J9PA 4KYZA 1SL2A 4ZCIA 4E0DA 3MEEB 5BYSA 4K7QA 3GB0A 2H51B 4B9VA 4OI6A 2HWHA 1EETB 5IV4A 1JB0C 4A8OA 3C6UB 4USKA 1WDDA 1N6QB 1VQ9S 4C8MA 3FMWA 3U27A 4DSIA 2XLIA 2X1FA 3M8PB 3MTJA 3C2PA 5LJ5Y 2CJQA 2D9PA 2JL9A 2GX8A 1RB0A 2W2PP 1IBKJ 1N54B 4JI0F 3FEXB 4B9UA 2V4QA 1JJ4A 3DDIA 3OT9A 2JH3A 4F67A 5HQ8A 4UOFA 1VBXA 3TAQA 2XSJA 4KO0B 3PW2A 2HAIA 1HBOB 2SXLA 2QLBB 4WBFA 2H54B 1E6VB 1RT3B 2QFIA 2HLUA 2HGNA 4MAKA 2CPXA 4DF8A 4LF8F 1Y0HA 3D0IE 2CUYA 4I2PB 3DN9A 2WSEC 4C2MA 1S0NA 5DZ6A 3UVJA 1C1CA 1LV5A 2DHAA 4HTIA 1KLMA 1U1OA 4HH1A 1KQSR 4ILRA 4TY8B 3LANA 2B56A 2XI3A 3MTKA 1MWZA 1XWLA 2MLYA 4NLYA 1TTHB 2R2RA 2DEIA 5CZXA 5GMDA 1IR2A 1U6BA 3HT0A 2KJVA 2R9LA 1MN9A 3CD6S 3OL9A 2XGPA 5CZVA 3MPWA 2GNKA 2HHQA 1SBRA 3T1YF 3Q2SC 4WKRA 2VBXA 2AJFE 1LK5A 2ASDA 2CQDA 2F40A 4O44A 4D3HA 1VRUB 1V3ZA 3U1MA 1R8AA 3H90A 2OPRA 1IUJA 5A8WB 1NB2A 1TL1B 1HBNB 3KYLA 4PWDB 2E1AA 1D09B 1UW4A 3CCSS 5AXMA 3D0HE 3K5OA 4EK2A 1RE1B 4RW4A 1S6OA 4GKKJ 3FZ2A 1MU2A 4ZK7M 9RUBA 2YNHA 1QSSA 1L5UA 4JUZA 3W7BA 3WQPA 1B7FA 2NXJA 2RHQB 1MSWD 2POKA 4UT4A 3QRQA 1RWUA 2EK1A 2IRUA 4ZPBA 4ER8A 3Q22A 4LRBA 5KFZA 4FDFA 3NCPA 2P9GA 4TQRA 1XK8A 3LWLA 2R42A 1RAEB 1YBTA 3DU6A 1IN0A 4Y2IA 4IOBA 1HPZB 4K4ZA 4Q44A 4B9SA 3VQTA 2W25A 1TKDA 4USWA 2DEJA 4ZN3A 5IC4B 1RTHB 4M95A 2KTQA 4MMOA 2UP1A 5F8MA 2KFNA 2M4MA 3O5TB 3OXFA 5D0HA 4NCAA 1DTTA 3GSIA 3NMRA 2XULA 2E5GA 4PR6A 4O0IA 3NOCA 3UCZP 2LXUA 3MM8B 4XPEA 3CJRA 4CDIA 4FBTA 2GVZB 2J0SD 4PG5A 1VRTB 2XSJB 3UWTA 4KFBA 1S7HA 4DG1A 2LDYA 2HS4A 3UD5A 2K2PA 1Q8IA 2PDAA 3NAIA 4DR3F 1NPKA 4DR1F 3OUYA 4LF5J 3V81B 1OY6A 2V4JA 2IVFB 1S6QB 3CXCR 5J2MA 1V5IB 3UVJB 1RT1B 2B9YA 4CNYA 3OFFA 4B9MA 5FDLA 3H2UB 2I8EA 4Y00A 2D3UA 4KH0B 2XY6A 1S7IA 1Q7LB 2PIIA 1S9EB 3BH7B 5GMEA 5EUHA 1NPPA 2YBVA 4TXSA 4ETXA 4IR9A 1QY7A 4O4RA 2ZE2A 2LECA 3LQVA 2WVDA 4WCEQ 2XQCA 4ED6A 1W26A 4OHWA 5E3CA 4OFZA 2ASLA 1RWXB 3CGIA 3H4DA 1IJFB 1TL3A 4PWUA 1HHTP 3MM7B 4F4XA 1NRKA 2K7JA 4DV6F 3K59A 2ZH1A 4TLRA 2B4PA 5KG6A 1NXIA 4CLYA 3TJ8A 4CCHA 3TQEA 4NLTA 1KVJA 5HROA 2CWXA 3CPWR 2R8KA 2DIUA 2I6WA 5EWGA 4U95A 1TQLA 4DL0C 4FXVA 4A47A 4UZBA 3QGIA 5ETRA 4P73A 2YNHB 3BYPA 2QE5A 4HT7A 4RW8A 2E44A 2GHWA 2Q3PA 1Z2ZA 5A8RA 3NNAA 2Q1LA 1UCNA 2PEBA 3WDOA 1FKOB 5D4OA 3UFCX 3AXMA 2ZZNA 4ILMA 3HKZD 4OI3A 3MMAA 2Z56B 1BWVA 4BWJA 3MR6A 4NZ7A 3NY0A 3KLEB 2EEYA 2NXEA 1HYSA 3D4JA 1SH2A 5KG4A 3CSKA 3F73A 5LMUJ 4C3LA 2RS8A 3LOUA 1DJ0A 4V19J 2BYCA 4X84A 2YQ3A 1CJKA 3MR2A 3DI6A 3AT1B 3ZTQA 4O4GB 3AQPA 3QIPB 4WXOA 4LVNP 2KG0A 4NZ6A 1VQKS 2EFGA 4F02A 5J2NB 3QPIA 3R5JB 5BR8J 1WG5A 2JDJA 3SDEB 4MK8A 2MB0B 4EBDA 3VVUA 4A8XA 3MXHP 1FK9A 2DNYA 4KFBB 4DG1B 3OVAA 1AYEA 4O3QA 3HMJG 1IQTA 1YJNS 1TUGB 1VQMS 2DCUB 4MK7A 2CQ0A 2HBZB 4J9VA 2MJUA 5ETVA 2D3O1 3M9MB 2R7OA 3E51A 2XG8A 2CJKA 3KLGA 1M90T 3FBEA 4IOCQ 3IRWP 3L7OA 4LF4J 4DUTA 2OKQA 2UXBF 2P8IA 3QRRA 3T5KA 1R8BA 3ONQA 2LMIA 4CRJA 1VQ8S 3PEHA 4J9SA 4R25A 4CZCA 1XN9A 3UDLA 1N0UA 3EVMA 3OL6A 2ZH4A 3H5SA 3CMAS 4DV0F 1XMQF 2I5JA 2ZE2B 3TOQA 2IM3A 5H9EK 1YI2S 3H25A 2VA2A 2RT3A 2FC9A 2B6AA 1VCTA 3H4BA 3FBCA 2BZ2A 3ZTPA 2R8HA 3BKTA 2JLFA 4IH7A 4CH1A 3NGRA 2JEIA 1SL0A 3QO9A 4XO0A 1FE0A 1ULRA 2CQ4A 2Z2ZA 2GQQA 3UCGA 3MZIA 2AZ3A 5E7OB 1U49A 2WCXA 3V6HA 1CJUB 4L72B 2HGLA 1U8SA 2OMOA 2FQQB 2HZCA 2YH0A 1T8EA 2HMIA 2EW9A 4OZNA 4ZPCA 4YB6A 3OFEA 4ED4A 4B3MF 2ZH2A 1A7GE 2YWFA 2OPSB 4JI2J 3OTOJ 3BGRA 4NYZA 4LRCA 5IS2A 4X65F 3IM9A 4I6AA 5THWA 5L9NA 1U1KA 1CULB 1DQ9A 5L46A 4DUZJ 1QE1A 3J81U 1NHVA 1IXKA 3M8ZA 3A8EA 4UUWA 3C8YA 4KGMA 4B3SF 4K4WA 1G3OA 1WC0A 1JLGA 2X7IA 3M2RA 2DR8A 4IKAA 2RUGA 1HYSB 2HEKA 2CIMA 2ROEA 1LWEB 5LM7E 3OJUA 2GO9A 4ZLPA 2RF2B 2V8GA 1RSCA 4RLEA 4LF2A 5IQQA 2C2RA 4LVOP 2RRAA 2FLPA 3DGPB 2RRNA 3IAM9 2W24A 4UUXA 4DPOA 1TUWA 2CZVC 2UU9F 2Z0GA 2CNNB 2Z2YB 4P71A 3DFEA 1FD8A 4CO4A 1PJ5A 1OY8A 3GU0A 3VGTA 1BD6A 1FX2A 4PQUB 3GP9A 2LVWA 3CJKA 2DXDA 2BEFA 2DBBA 3R8YA 2JJ4D 2HZAA 4PEOA 2C2DA 1Q8LA 3JTPA 4DSLA 5KOXA 2DXEA 4M63A 1U2FA 1VS3A 3WIVA 1WHXA 1OO0B 4DLGA 3IBWA 2VONA 4KGXB 1EKSA 2UUAJ 1Y5LB 1U7LA 3W66A 1RT2B 1AZSA 2XWXA 3KLGB 4N8OA 2CDQA 3OPKA 3AOBA 4RR5A 3CCZA 3H5UA 2IRXA 5GAEU 2LQ5A 4OHYA 2R8IA 1UEVA 2E7VA 1RXOB 5F8LA 3KK3B 2BJ1A 1F60B 2D1CA 1TFYA 3ZTSA 4OI1A 4ZOSA 3R7SB 3DRYA 5D0RA 3HSGA 3CMQA 1LWCA 3PHTA 3Q2TC 2YKNB 4HACA 5L9XA 3GYNA 4TYBA 4GO7X 5D4PA 3NXZA 3BQ1A 3DLEB 3PVXA 2FJVA 4LR9A 3MUTP 1T02A 1LEOA 4TN2A 2LXFA 2CWKA 1U8WA 3W8PA 1IBCB 1WHYA 2UUWA 3CULA 4DS4A 5I3UA 3QYYA 1SI9A 3T5LA 5HVFA 3BO2A 2OMLA 3AA8A 2XZWA 2IC3B 2E5IA 1B7YB 1NKEA 4WZMA 3VR1A 3B4MA 4K4SA 3NS6A 2ZNYA 6FD1A 2MQLA 2B9WA 1EJ7L 3MAAA 2XWYA 2QRRA 1OIAA 4MT1A 1L3SA 2MMYA 2DNLA 3RYLA 2KRBA 2EXUA 4LF8J 4DX6A 1CC8A 2KKHA 3QSYB 3M30B 3NMAA 4KRWA 3M7VA 4RBVA 2LKZA 1RISA 3QGGA 3WHIA 3G6ES 1RTJB 3BGLA 1HBUA 4IQXA 3FRYA 5AE2A 2J9CA 3FQKA 1P9YA 2MSTA 4YB7A 4ZDNA 3K17A 4ZVUB 2FJXA 2CQPA 1LWFA 3P49B 5KG7A 2IBOA 2OEKA 2VQFF 5L8RC 2UV8G 2R7VA 2ALZA 2XS5A 2B4OA 1HI8A 4OHZA 2CRLA 4KJIA 2Z30B 2FHOB 2E66A 2DGUA 2FJBB 3S7RA 2ZH6A 4RNFA 3RG6A 1SC3B 2R7TA 4C8NA 4DHVA 2F4VJ 1VQ6S 1M0SA 3O44A 1U2RA 2OHDA 2MKIA 1HNIA 3T1YJ 4WIQA 2BW7A 1JMTA 3SBMA 1F9EB 1ICEB 3H7HB 2CKWA 4AUKA 3J7YU 2M70A 2ZDOA 4XDDA 5LXRA 1OQ3A 1RWKB 3GWCA 1KTQA 4DV7F 3R7BB 3ETOA 2WVBA 4M5KA 3RB0A 2VL1A 1B4SA 3BH6B 2AJ2A 1IR0A 3K0JA 2LEPA 1NEEA 1T3OA 2XO6A 3E01A 1IKWB 1RTDA 4ICLA 1U1RA 1SIWB 4KGVB 4OJGA 1FHTA 1D1UA 2E5LF 5F0WA 3AHPA 3O8WA 4TU8A 2F63A
chains in the Genus database with same CATH topology
2MY8A 3A1YG 1NJWA 3PR4A 3K5LA 2J0XA 2NZ4A 3DLKB 3OUYB 4YB5A 4WF9Q 1UAWA 1URRA 2V4JB 4A46A 2BV3A 3KLVA 1S0OA 1S1TB 1RA7A 5C24A 1HR0F 2EBGA 3CF5Q 5E3PA 2P9EA 4RW9B 5KG3A 1KN6A 4IO9Q 1RTHA 5J2MB 2B7CB 3I6PA 4PXBA 4DSKA 1W25A 5KFEA 3SQGA 3L09A 3POTB 1F9FA 3EYZA 1OWXA 3JSRA 5FDLB 2V8HA 4FNHA 3J7ZT 2KO1A 3BSNA 1RAJA 4ZVHA 4ALZA 2VZ9A 2MQOA 1S9FA 5E2QA 1ZZNA 1Y7PA 3MM9A 1N5QA 3G86A 3MM8A 2HG4A 4RBTA 4YR0A 5H9FJ 1N48A 4KKOB 3HHLD 3M1VB 4Y2MA 4YB1P 4G1QB 2HIQA 1HQEA 3G71S 2IM2A 4FF1A 3MFHA 2W9BA 2VG6B 3KHHA 4ZHRB 5T7LA 5SUHA 5JJBA 1TKXA 1VRTA 1OPIA 1WELA 4Z37A 5LT5A 1MROA 2QEXS 1HI0P 2MHEA 4F4WA 2D3ZA 2V94A 2IVMA 3SMZA 1SH0A 2QA2A 4ZP6A 1MNEA 5D6GA 3OV7A 3QAUA 3NL0A 3PRBA 4HVZA 4C3KA 3KLFA 2BUNA 4AL7A 2AJ4A 1S48A 3GE9A 3B8HA 1TKTB 4NRTA 5DQIA 1YJ9S 2DHXA 2W4DA 1TL5A 1VQSA 3E3XA 4J9MA 3QLHA 1KOHA 3V81A 4QPTA 4Y3CA 4N77A 1EP4B 3PACA 4KHMA 1PO6A 1NK9A 4R8UA 5KFTA 2XMJA 1S6QA 2A18A 4Y6IA 4RX6A 4ECYA 4NLQA 4QYZJ 4U9RA 3FSIA 1TL3B 3VTIA 2QV6A 4ECZA 3SCJE 3GV5B 3D0GE 1RT1A 3RRKA 3JSMB 2J7UA 4OLPA 4CNZA 5BJRA 1JNZB 5FJ4A 2R8JA 4DSEA 2ZH9A 3HPOA 1GXTA 3WC0A 1M5SA 3EGNA 1VQNS 2CPZA 4I6WA 3NG8A 3TANA 3GYXB 3KHGA 3DNCA 2GFFA 3AH6A 4FVCA 3MUMP 1NNDA 1N34F 4NYPA 1JXEA 5AE3A 3CCUS 2EPIA 2UVWA 2HQ3A 1FO1A 1M5HA 5LMNF 4BBYA 1HNVA 1K0VA 1NH8A 4IG0A 4JI3F 1AFJA 2CPFA 3MAQA 1OQ6A 4PPDA 3BR8A 4FF4A 3N6NA 5HROB 1R8CA 4HEA9 1VI7A 2D74B 2XI2A 2O01C 3EUNA 1S9EA 4ILLA 2OTJS 1RJJA 1S1UA 3IRXB 5HLFA 1CPZA 1RK8A 4LMZA 4IFVB 1R8PA 4QJVA 5KFMA 4FPRA 1G1XA 1UVKA 2IJNA 5DQGA 3CD0A 4ECSA 4ZMMA 1S1XA 4WZQA 2FVPA 3M2VB 1D8YA 1XTZA 4IOAQ 1P8GA 3HHDA 1DARA 1KHVA 1I6JA 3W2WB 5L1LA 5CYMA 2QIFA 3BO3A 2VBZA 2GMHA 4YDXA 1X4AA 2DRBA 4DV1F 1Q79A 2XNRA 3V4IB 4EO6A 2DGVA 3O2IA 1L3KA 2FDNA 1U24A 5EWFA 1X4HA 3CCES 5B09A 1ZM4A 4RW8B 5D4NA 4R5PB 3I9V9 1KQKA 3VAKA 2N3OA 3RR7A 1N5YA 1KS2A 1Y3JA 3LP0B 2Q6CA