2OPQA

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
534
structure length
515
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 146
structure length 515
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2opqA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opqA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opqA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opqA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2opqA05
4AHVA 3HVTA 3OJSA 3AVFA 4CEDA 2J6UA 4B9MA 2R8GA 4FLWA 4E7LA 3NAHA 3TAFA 1XI1A 1CZBA 4KHQA 1LAWA 4JRQA 3RR7A 3THVA 1FKOA 3KTQA 3OY9A 4DEZA 3QIOA 4J9PA 4B8CA 1IM4A 1KLMA 1ZBLA 2VG7B 3V9WA 1TKZA 3KLIB 1KHVA 4ED8A 1L5UA 5DGBA 4DMNA 4WE1A 2AWZA 4IOBA 4O3RA 5KFTA 5HLFA 1D0EA 4H4MB 2AGQA 3ICLA 3JYTB 5KFCA 3ZSXA 2R2UA 3K5MA 4C8OA 3AVMA 3UQSA 1HPZB 3I5AA 5CZ1A 3LAMA 4PQUA 2YNIA 3T3FA 3HPGA 1QE1B 4TQRA 5KFSA 3AV9A 3KLVA 1RDDA 3L3VA 3D5MA 2HW3A 4F4YA 4FK0A 5DK5A 2R8KA 3SQ2A 1TK8A 5CYQA 5KG4A 4DLGA 3GV8B 5KFUA 3AVNA 2XRIA 3O4QA 4IH7A 4CIGA 4J2AA 1ZTTA 4EP4A 3TABA 2D3UA 3OYIA 1JKHB 3G6YA 4CGHA 2JEFA 2R2SA 3VQ5A 1RT2B 3HVWA 2QXFA 3LP0B 4O44A 3L2QA 4CCHA 3DRSB 3TAMA 4MIAA 2A1SA 4Q0BB 1KSPA 5J1EB 2V9WA 4O4GB 2B5JA 1ASUA 4F4KA 4DSIA 1KCFA 2OPRB 1U04A 1JLCB 1HMVB 3JSMA 5EUHA 3TI0A 4KI4A 3MEEA 3LWMA 3KK1B 2XY5A 3CDWA 4F2SA 2VA2A 4U6PA 3VQ8A 4CGGA 3UR0A 3FFIB 4NRUA 4ZPAA 4RNFA 1U49A 1BGXT 4K4YA 3AVKA 2IBKA 3QESA 3TR8A 3RRHA 4WZMA 2HB5A 4DU1A 4CESA 1EKEA 3QGIA 1I39A 3V6JA 3V1QA 5J2QB 5F9LA 3E01B 3OYLA 4HCCA 1UA1A 4UQGA 1YVFA 2WTFA 2VG7A 1T8EA 4ED6A 4CF9A 3NH2A 1W25A 4YR0A 3KLIA 4Q44A 4BDPA 2QE5A 1VSKA 3NF8A 4ED3A 4CEQA 1RBTA 4HYKA 2HHVA 1UAXA 3LPTA 4H4MA 4FJXA 1WSJA 3M9MB 1BIUA 2W8KA 3JYTA 2RDJA 1BL3A 3MEGB 1DTTB 4YQWA 1NK9A 3SZ2A 1HPZA 1IKVB 1QE1A 4CJLA 4FJKA 3DRRB 2UVVA 3QZ8A 5DLFA 4FLTA 2EC0A 1J5OB 3KHGA 4ZTJA 2OZSA 2BANB 4DQRA 5T7BA 4CF2A 4CGDA 1EXQA 4HHTA 2W9AA 3DLRA 3OL8A 1D9FA 4LSNB 5KFQA 4ZPCA 1TL1B 5J2MB 4AHRA 3VQ7A 3U6FA 1JKHA 4W5RA 2Y1JA 4CJSA 1Y97A 3QNNA 4KREA 1RT2A 3AA3A 3LDSA 1IO2A 4QW8A 4J9QA 5T14A 3DLEB 4DFJA 3LP0A 3V6DB 4LH4A 3DRSA 4CJWA 4K4SA 3AVAA 1C6VA 5J2NB 4NLSA 3QEWA 2C2EA 1CZ9A 4Q0BA 1C2PA 5J1EA 4O4GA 3OYKA 4RW8B 2WB4A 2OPRA 3KHLA 4X2BA 4C8NA 4IH6A 2VG6B 3MR5A 3RB3A 1JLCA 1HMVA 2D0BA 3V9ZA 3ALYA 3RAXA 1RA6A 3HP9A 3LWLA 3KK1A 1RAJA 1HYVA 1BCMA 4BE1A 4O4RA 3KLHB 4ECQA 3NGYA 3BSCA 3I5CA 4I9LA 3PO4A 3T1AA 5KRSA 4DQIA 3VQCA 1LV5A 3M8PB 4IFYB 4CEZA 3TAEA 1S5JA 4LY7A 4QWEA 2BQUA 3M9NB 4F4XA 3EZ5A 4CFAA 5KFZA 2AJQA 4DQQA 3I0SB 3HK2A 2HWHA 5J2QA 1KRPA 2X74A 3E01A 4FS1A 1VSMA 3V9SA 3EY1A 5FDLB 1Z26A 5L9XA 1MMLA 3CJ5A 4CJVA 3ISND 1WSHA 3BSAA 4RU9A 4HUEA 1NHVA 3SUOA 4MKBA 2DFFA 4F3TA 4CHNA 1XHZA 1RT1B 1KHWA 5KFOA 4AHUA 1TGOA 3MEGA 1DTTA 2IOCA 3PHEA 3MXMA 1IKVA 1ASWA 4HTUA 4RW9B 4N47A 3HPHA 4Z4CA 3DRRA 4NYNA 2YV0X 5KFAA 4DS4A 1GX5A 4CGIA 1JLEB 5FRMA 1J5OA 3NDKA 5F8GA 3PUFA 3T5JA 1JLBB 1KVAA 4FJNA 2BANA 1TP7A 4FBTA 1N56A 4OKJA 2KZMA 3F9KA 1NK8A 3I5BA 3CO9A 2R7YA 1JL2A 4YR2A 4FW1A 1HQUB 2WRMA 3OJUA 4LSNA 2KW4A 3KD1E 1FK9B 4BDZA 1TL1A 5J2MA 2R2RA 3IGNA 5KFXA 4FLUA 4DTNA 3NF9A 3FDSA 5CYMB 1JIHA 2AU0A 3KLGB 2X6NA 2D0AA 4CJ4A 3DLEA 3V6DA 3D45A 4Z4FA 1C0MA 1G15A 3MTKA 5J2NA 4Y2AA 2Z1GA 3OS1A 3BSOA 1RTHB 2W7OA 4FJLA 4RW8A 1N5YB 2VG6A 2E6LA 4FLVA 1U4BA 1NNDA 4WYWA 4JUZA 3K58A 4K4ZA 4CEAA 4Y3CA 1S0NA 3EZUA 4Z4IA 3TVKA 2O4IA 3MXIA 3KLHA 4IKFA 3H4DA 4KBIA 1JXLA 1SL0A 2HVHA 5KFBA 3V1RA 4C8LA 1RT5B 3CM6A 2ETJA 3M8PA 4IFYA 3G0ZA 2B6AB 1Z4UA 4DQPA 1XR7A 5KG0A 3OSPA 2ZQBA 4CIEA 1ZBHA 4M42A 5FROA 4KHRA 3DDKA 3DMJB 3I0SA 4NLPA 1VK0A 4KI6A 2UVRA 1GX6A 1ZBIA 1IKXB 1MU2B 5HRPA 5FDLA 1RNHA 2JEGA 3RR8A 1DTQB 3BDPA 1VSHA 3HT3A 1QTMA 2VA3A 2DFEA 2IGIA 2FBTA 2W7PA 3VQ4A 4JRPA 2A1RA 4ECZA 4N41A 5L1IA 1RT1A 4EYHB 4RW4B 4W5QA 2ZE2B 3AO3A 4XIUA 4FJ9A 2D0CA 2D3ZA 2XGPA 4RW9A 3I0RB 4KPYA 4EZ6A 3GQCA 4MFBB 5KFNA 1T94A 2E4LA 2I1RA 5CYQB 1JLEA 5KG3A 2YHAA 3T19A 4LH5A 3L2WA 2EX3A 1JLBA 4IDKB 2WCXA 4DG1B 1JXBA 4DS5A 5KT7A 4H4OB 2OPSB 3VA0A 1DLOB 4EZ9A 3EYZA 1HQUA 4M94A 4M3ZA 1C0TB 4K8XA 5I3UB 2D41A 1FK9A 4JV2A 4ED7A 4DSLA 3BSNA 3NKYA 1J54A 1S49A 5CYMA 3TWHA 3PJWA 4Y1DA 1WLJA 3DM2B 3OL7A 3KLGA 1VRTB 1YVUA 4RNOA 3Q8PB 2ILYA 5DG8A 1B92A 4DU4A 2DTUA 1RTHA 1KVCA 1N5YA 1KLNA 2IA6A 3DLKB 1SV5B 3ZSQA 3IS9B 2B4JA 3C95A 5DQIA 3OLAA 3HL8A 4R5PB 5HRNA 3S9HA 5K14B 2LSNA 4O0IA 3GV7B 1X1PA 2IJFA 4O3NA 1BISA 2QKBA 2HWIA 2YNHB 3NL0A 3LAKA 4BDYA 4E1MA 4ICLB 3TAGA 4TY8B 4KTWA 1C1AA 1ZBUA 4E7IA 1RT5A 5KFIA 2B6AA 4EYIB 3CVKA 4NLDA 1NOZA 3PV8A 2PY5A 3QEXA 1VRUB 1TL3B 3CJ3A 4AHSA 3QGHA 3ZT0A 1JX4A 1JXEA 3DMJA 4IR9A 4NLOA 3ZSYA 3TANA 1LW0B 2HVIA 4KO0B 4RNMA 1IKXA 1MU2A 2KQ2A 5KT3A 1S1TB 4EBDA 3ZT2A 1WN7A 1DTQA 1D8YA 4KV8B 3CJ4A 1NJYA 4F2RA 4H8KA 4PUOB 4FS2A 1SKSA 3AA4A 4URGA 2FLNA 4HVJA 3LPUA 3MR2A 3DLHA 4JV0A 4RW4A 5L1JA 1Z25A 2ZE2A 1T03B 4W5OA 3V9XA 4E19A 1JLFB 1XR5A 4GVMA 1S1UB 3I0RA 2W42A 1TVRB 4KSEB 4MFBA 4FBUA 4ELVA 3TQ1A 3SQ1A 3L2VA 1BI4B 1L3UA 3S3OA 3G6VA 2ILZA 4KHWA 2F96A 4K4WA 2JLEA 4IDKA 2FVRA 2G8WA 3CJ0A 4DG1A 1U45A 4CF8A 1S10A 4H4OA 2OPSA 5KTQA 1DLOA 3BR9A 4ECWA 3AVBA 1O1WA 4URSA 4RW6B 1C0TA 5I3UA 4OKKA 5SZTA 5J2PB 3ZSZA 2F8EX 2GV9A 1K1SA 4NLWA 4NYFA 3DM2A 1S9GB 1SUQB 2HHQA 1VRTA 4I7FB 1T05B 3SI6A 4F3OA 3SI8A 2EHGA 3H5SA 4QWAA 4R8UB 3NH0A 1X9MA 3PR5B 3RBDA 4OVLA 4DTOA 4ZTFA 1J53A 4IR1A 4PA1A 4TY9A 2ZD1B 3N6MA 5FRNA 3DI6B 3DLKA 4FJMA 1SV5A 4DTXA 3IS9A 4TXSA 3PR4A 3K57A 2C28A 2FC0A 3AVJA 4R5PA 4OGEA 2OPQB 4HCBA 5K14A 1RT3A 4Z4GA 3AO5A 4IRDA 4CJFA 4KB1A 2YNHA 1R0AB 5C24B 1HNIA 2VWJA 4Z0UA 2OH2A 4CJTA 4ICLA 4TY8A 3PO5A 2ATQA 2YKNB 2AX0A 4M3YA 4CGFA 1RYRA 3AVHA 1C0UA 1VRUA 3SPZA 3K59A 1TL3A 4QW9A 2AQ4A 3BJYA 4J9MA 1QAJA 4CJRA 4DLEA 2FVQA 2HNDB 3RMAA 1LW0A 1T7PA 1TAUA 4KO0A 2BRLA 3KLEB 3Q8RB 3H59A 3OYHA 1S1TA 3LP1B 4E0DA 4ED2A 3HJFA 3SFUA 4KV8A 4RZRA 2WOMB 1KVBA 3MAQA 4NLRA 4IBNA 1NHUA 4PUOA 1S9FA 4J9RA 3S3NA 2I5JB 3G10A 2FBVA 4CEEA 1C1BB 1JL1A 3AVIA 4FJIA 2P51A 4F4WA 3HPOA 4CK1A 2OZMA 4KB0A 1KTQA 1ZYQA 1T03A 5KG6A 3OYDA 3D0PA 1JLFA 3DLBA 4CE9A 1S1UA 1CXUA 1TVRA 5JUMA 2RPIA 5KFJA 4FVMA 4E89A 1BI4A 3QEPA 2FVCA 4FJJA 3NH1A 4NLGA 2OYQA 1TKXB 4MH8A 3BQ0A 4NLQA 4QWDA 1QUVA 4IRKA 4ZMMA 3O3HA 1HYSB 3VQEA 2C2RA 1YT3A 2P5OA 4W5TA 4CHZA 3LP2B 4KAIA 1VSLA 4B9LA 4RW6A 4NCGB 2BQRA 4ZVHA 4OLAA 5J2PA 4CK3A 5KGXA 2QKKA 1S4FA 1L3VA 4FLYA 1QHTA 1S9GA 4K4XA 4FJHA 1BHLA 3PVXA 1SUQA 2BRKA 4DWIA 4I7FA 1T05A 4IG3B 5EDWA 4R8UA 1Q8IA 4M3UA 3NGZA 1SKRA 1RT6B 2ZD1A 3HVAA 2R8JA 2FVPA 4QPXA 3DI6A 5KFGA 3PW7A 2HHXA 3VQSA 4M3RA 4BACA 5C42B 5EWGA 5KFPA 4QWBA 2G8HA 4ID5B 2OPQA 1S0MA 3H5YA 4QAGA 4OJRA 3AVCA 1UWBB 4FZZA 4J9SA 4I9QA 2XY8A 4CHYA 3QEIA 1R0AA 5C24A 1QS4A 3RMCA 2RN2A 4KHYA 4CJUA 1ZBFA 4Q43A 2YKNA 4K4TA 1Q9XA 3ZSRA 4ELTA 4CGJA 4M41A 3KHHA 4LSLB 3AO1A 4JS5A 1NJWA 4QCLA 3NE6A 3CDEA 4ZVGA 3KOAA 4KHSA 4OPJA 2HNDA 5KFLA 1T3NA 2WONB 3KLEA 4Q8EA 3NF6A 3LP1A 5KT6A 4ZPDA 3AVGA 4KB7A 4NZ0A 4CFDA 4AILC 2KFZA 2WOMA 4FLZA 4TN2A 5L1LA 3OYEA 4BE0A 2I5JA 4CERA 5E41A 4IKAA 4PWDB 3PJXA 1C1BA 2IMWP 4RNHA 1BIZA 3OYAA 4NYZA 5HBMB 2HMIB 5D3GB 2FBYA 3PZPA 2GBZA 1B9FA 3OVNA 1BQMA 3QYYA 3C94A 1D9DA 3OL9A 3OYBA 3OYFA 4KHMA 3VQBA 3RB6A 3ISNC 3OYMA 1TKXA 1S1VB 4RUAA 1LAVA 3ZSOA 1TKDA 1TAQA 4DL2A 1B9DA 1HYSA 4EO8A 4DSEA 1TK0A 2W8LA 3A2FA 1HRHA 3KIOA 4I2QB 3UDLA 2JEIA 3LP2A 4CEFA 4NCGA 4JV1A 1XWLA 3QERA 4KAZA 2KFNA 4DFKA 5DG7A 2X78A 3KKSA 2R8IA 1SH0A 4BWMA 1S6PB 2IC3B 3H2LA 4EBEA 1CXQA 1RBVA 1LWFA 1IH7A 4IG3A 1S6QB 5KG7A 4FXDA 3TAPA 5F8IA 4DTSA 4NCAA 4CJ3A 3SQ0A 4ECVA 4URQU 1RT6A 4DTRA 1A5XA 1W9HA 4L8RB 5HROB 5KGWA 1XR6A 5C42A 1NK7A 4IH5A 4IRCA 2XI2A 3NAIA 3PY8A 4ID5A 3RRGA 2IM3A 3GV5B 4WFYA 1UWBA 2XCAA 5C25B 2G8UA 1U48A 4RUCA 1GOBA 1VSJA 3QLHB 1BQNB 4B9UA 1N4LA 5JS2A 3PX4A 3V6HA 4B8AB 3VQAA 4LSLA 3O3FA 4CJPA 4H54A 4XO0A 2YHBA 2XY7A 1NK0A 2DY4A 4ECYA 5KFHA 1S97A 1LWCB 1OS5A 4CJ5A 3HP6A 2WONA 1TV6B 2CJQA 3WNGA 3GYNA 5HRSA 4DL4A 4CK2A 3ULDA 1NOYA 2BE2B 2UUTA 3SV4A 1LW2B 4FZXC 4CJKA 3L3UA 3TAQA 4PWDA 4WZQA 4NLVA 2E9ZA 3WNFA 4CECA 4CEBA 5KFVA 5HBMA 2HMIA 5D3GA 2W9BB 4BE2A 4Y2CA 2IS3A 4CF0A 4Z4HA 4CIFA 4MIBA 2JC1A 2GIRA 4YMEA 4FJ8A 1S1WB 3MF5A 1S1VA 2XCPA 1LWEB 4BWJA 2Z1JA 4R0EA 1RTIB 4ZP8A 1HQEB 4DU3A 3BGRB 1WNEA 2Z1HA 4HUFA 4NRTA 4I2QA 1ITGA 3SPYA 1YTUA 2CKWA 4K4UA 4F8RA 4EBCA 4ZVEA 1WSGA 4DFPA 3H4BA 1S6PA 2IC3A 3H40A 3CJ2A 3VQ6A 2DPIA 3B6PA 3CFOA 2IM0A 4YFUA 1RDAA 4NCBA 4QWCA 1S6QA 1VSIA 3OSNA 3ZT1A 3H08A 3PW2A 3KLFB 2G8FA 2XO7A 4M3WA 1JLGB 1HARA 5F8JA 3SJJA 2J6SA 2HNZB 3N6LA 3VA3A 4FK2A 4N5SA 3OYJA 4Q5VA 1RT3B 3KD5E 2QK9A 3CM5A 4DTMA 4HUGA 4M95A 1I3AA 5HROA 1RT4B 4TQSA 1QSSA 4NLUA 3ZT3A 3MR3A 4E1NA 1HNIB 3KJVB 3NGDA 3GILA 5KFKA 1RTJB 3T5KA 5C25A 1XC9A 3MEDB 3QEVA 3QLHA 4Y1CA 4FLXA 1C0UB 2BQ3A 1L3SA 1BQNA 3QIPB 3N6NA 1KFSA 4KFBB 3M8SA 4B3OB 3KK3B 4N76A 3GIJA 2O5DA 2HNYB 3H5XA 3WNEA 5KG2A 2OA8A 3BQ1A 4AHTA 4FJ5A 1LWCA 1JLAB 3FQKA 1J9AA 4ZP6A 3FRZA 1IKYB 4XPCA 4G3IA 1CLQA 1C1CB 4LQ3A 1TV6A 4J2EA 4FYDA 4B9SA 3SCXA 3M8QB 4WYLA 2J6TA 5F8NA 3CFPA 2BE2A 4E7KA 1LW2A 2V0NA 1TQLA 3C6TB 4KHNA 4KTZA 1WSFA 4FJGA 4J9NA 3QO9B 3PW4A 5CY4A 4GW6A 2W9BA 2JEJA 1SL2A 1RTDB 4E7JA 4NLYA 3DOLB 4KKOB 5EU7A 1NKCA 3SUPA 3OYNA 4ZP9A 4WFZA 3QIDA 1RILA 2HHUA 3NMAA 4QOZB 3P5JA 1S1WA 4OLBA 1WSIA 2PYLA 1LWEA 1RTIA 1HQEA 3BGRA 2XHBA 4B9TA 1A5WA 1RBUA 3DRPB 1SH3A 1IKWB 1SL1A 3IN5A 2YKMB 4B08A 4CFCA 1EX4A 3CG7A 3LZJA 1UOCA 2R2TA 2E9RX 4G1QB 5KFYA 3HXMA 4HKQA 1KFDA 1N6QB 2G8VA 2AX1A 3KNAA 2F8TA 4DL3A 2Z1IA 3UIQA 4ECSA 1WAFA 5EWEA 2WHOA 3DYAB 3KLFA 1JLGA 3T5LA 1QSYA 2HNZA 3KMSA 3K2PA 3CDUA 2ASDA 5DLGA 3RAQA 1RT4A 4MK8A 2PZSA 4RNNA 3HKWA 1EP4B 3KJVA 1EETB 4ED0A 4OL8A 4FM2A 1RTJA 3V81B 2GIQA 4ID1A 3KK2B 3OS2A 4CJQA 4KRFA 4KE5A 3MEDA 4Q8FA 4FCYA 3QIPA 2YNFB 4KFBA 4N56A 3VQDA 4B3OA 1FKPB 3KK3A 3OLBA 2YNGB 4LQ9A 2HNYA 3H98A 1RA7A 3QGGA 2UVUA 2VWKA 2P1JA 3WNHA 3QNOA 3V1OA 5KT2A 1REVB 3RTVA 1JLAA 4YNQA 1IKYA 4RW7B 1C1CA 5C5JA 2WK4A 3RBEA 1NKBA 4DL6A 4ZP7A 2UUWA 3MR6A 2Y1IA 5KI6A 4DFMA 2F8SA 3M8QA 3T5HA 1ZETA 2KZZA 2IAJB 2G8IA 3C6TA 4LD0A 4FM0A 2RDIA 4DF8A 4ZVFA 3VQQA 1BQMB 2HHWA 3QO9A 3BREA 1X9SA 4EEYA 5F9NA 5F8MA 1RTDA 3EPIA 4IFVB 3AVLA 3DOLA 4KKOA 4DL7A 4B9VA 3SUQA 4YR3A 5KFMA 1ZTWA 3K5NA 2AGOA 4ECTA 1FXXA 3I8DA 4TLRA 3ZCMA 2ITGA 4DQSA 3LP3A 1GOAA 1S48A 4O3PA 2DFHA 3NGIA 3DLGB 3PW0A 3DRPA 2ATLA 4ZHRB 1IKWA 5DGAA 2YKMA 3CYMA 3GIIA 2Q3SA 1D5AA 4TYBA 2XGQA 4AH9A 3K5LA 1SH2A 1LWFB 4F50A 4FJ7A 1RYSA 4G1QA 2E9TA 2FLPA 4YP3A 4PY5A 2ASJA 1N6QA 4ECRA 1VSFA 2HHTA 3M9OB 3NBPB 3FSIA 3ITHB 3H5UA 4B9NA 3DYAA 2FJVA 4MQ3A 3SQ4A 1A5VA 3K5OA 4DL5A 3L2UA 4FW2A 3HVRA 3RMDA 3C6UB 1NJZA 3KMQA 3SNNA 2BDPA 4CHQA 4M45A 1EP4A 4J9OA 1EETA 5DQGA 1RBRA 3IRXB 4NLXA 3KHRA 4OGCA 5F8LA 1U47A 5KT4A 3V81A 3AO4A 4IG0B 1QSLA 3KK2A 2V4RA 1RT7B 3GIKA 1HJRA 3FFIA 1L3TA 4O3QA 2YNFA 2AGPA 1N48A 1RDBA 1FKPA 3O3GA 2YNGA 1NK4A 3ZT4A 3RMBA 5JS1A 5KFDA 2RF2B 5F8HA 3MECB 3NFAA 2OPPB 2JC0A 1HNVB 1REVA 5SWMA 3NAEA 3TARA 2FBXA 4RW7A 2G8KA 4EP5A 4DTUA 4F4ZA 3SUNA 5EWFA 2UVWA 1S0OA 4OKEA 3IG1B 1ASVA 4Q45A 4GC6A 3U3GA 3RWUA 2IAJA 3IAYA 1NK5A 2BGGA 3Q8QB 1U09A 1SKWA 3O4NA 4O3OA 1VSDA 4FK4A 5KFWA 4J9KA 5I42B 1S1XB 1RCHA 3OHAA 3V4IB 2IJNA 5CZ2A 4DSFA 4IFVA 3DOKB 1CSJA 4M3XA 3UPFA 3SFGA 3AO2A 3QINA 2W9CB 2RKIB 3OL6A 4ELUA 2IM1A 2XY6A 5KT5A 4DSJA 3P1GA 3QZ7A 3NCIA 3KKRA 5KRTA 4MK7A 3DLGA 1JLQB 1BCOA 3HHKA 5KFFA 4ZHRA 1NK6A 4CHOA 4CEOA 3CFRA 4O3SA 3OYGA 3G86A 4KTQA 3E51A 5KG1A 2NUBA 4C8KA 5HP1B 3RB4A 2XC9A 5KFEA 1WSEA 4WXOA 5JXSA 4EO6A 2QV6A 3GIMA 3BQ2A 2FJWA 5DQHA 4CF1A 1RDRA 3NBPA 1K6YA 3ITHA 5HRRA 3V6KA 4OPKA 3MFHA 4I2PB 3HYFA 2ZKUA 4TYAA 4C8MA 1TKTB 3PX6A 4K8ZA 2VG5B 4AHCA 2PYJA 4WFXA 1K1QA 1HYZA 3L8BA 1YTAA 2FLLA 2C22A 1S9EB 5KFRA 3C6UA 2FVSA 3CWJA 4IQXA 1F21A 2KTQA 3SV3A 3QETA 3IRXA 4MKAA 1RDCA 3MXJA 3AA2A 4IG0A 1Q9YA 4GC7A 3HVTB 3V9UA 1RT7A 3L2RA 2BR0A 2DPJA 3ASMA 4KHUA 3D28A 4Z4EA 4DF4A 3PW5A 3HM9A 2JGUA 2E6MA 4TSXA 1FKOB 4E7HA 2HAIA 2RF2A 2HHSA 3F73A 3MECA 1GOCA 3SYZA 2OPPA 2D5RA 4ED1A 1HNVA 4CFBA 1KLMB 3ZSWA 3IGVA 1IG9A 4DTJA 4WXWA 4DSKA 1TKZB 3OYCA 3VQPA 4FZYA 3B6OA 2IDOA 3EPGA 4W5NA 4WE1B 3IG1A 3VN5A 4K50A 1WAJA 5HLFB 2XWYA 2O4GA 3FQLA 4Y34A 3LALA 3Q8SB 1UA0A 4JLHA 5KG5A 4O5BA 2B43A 4PQUB 2YNIB 5I42A 1S1XA 1XHXA 3V4IA 2ALZA 2P5GA 4J2BA 4ECUA 3PX0A 4O0JA 4ZPBA 3DOKA 1I6JA 3NF7A 3VQ9A 2V4QA 2XI3A 2W9CA 2RKIA 2GC8A 2X6SA 3ZSVA 3LZIA 4MK9A 3CIZA 5L1KA 1NKEA 4J2DA 2ASLA 4J9LA 1VSEA 3G6XA 3HO1A 2FJXA 1JLQA 5DMRA 3RB0A 5DG9A 4U7CA 4CHPA 4M3TA 4FM1A 4XPEA 1W0HA 3M8RA 4JS4A 1D1UA 3S3MA 1TK5A 1X9WA 2GUIA 5HP1A 4ECXA 4O44B 4NLTA 2R8HA 3TAMB 1QAIA 4GMJB 4K4VA 4E3SA 4I2PA 2D7SA 1TKTA 2B5JB 3P83D 2VG5A 1RBSA 3AA5X 3LANA 1QQCA 1WNSA 1NJXA 3HSTB 3U3YA 3OHBA 4RG8A 3JSMB 3MEEB 2C2DA 1S9EA 3NHGA 3CQ8A 4O55A 2IM2A 4DTPA 3MFIA 4CJEA 3OS0A
chains in the Genus database with same CATH superfamily
2MZJA 3GP9A 3TSPA 3OJSA 5KPTA 3ULHA 1HHSA 1VGYA 3JSRA 3M6UA 3LGHA 4A8XA 3VWSA 4LRBA 4B9MA 4FLWA 2HBJA 4E7LA 2PFFB 1SI9A 3TAFA 1XI1A 1CZBA 1LAWA 2P9LA 2B4UA 4DEZA 4B8CA 4LF4J 1LNQA 1FW6A 4M1KA 1VBKA 3MCNA 1KLMA 3SAFA 3KLIB 1KHVA 4H5WA 2C2NA 2OUGA 4DMNA 1SJQA 4WE1A 4E8UA 2AWZA 4IO1A 3ICLA 3G8QA 5D78A 1ZM2A 1IWAA 3VPZA 4C8OA 3I5AA 3C15B 4PQUA 4A2BA 2JFKA 2KHDA 4N8OA 4EFHA 5ETQA 3SQGB 3L3VA 2RHQB 2HW3A 3L7PA 1KOOA 2FY1A 5ETVA 4YN3B 1U25A 3AVNA 4IH7A 4CIGA 4PG5A 3AAWB 2AYEA 4E98A 4EP4A 3CCES 2RE1A 4OI1A 2JEFA 4A47A 1N32K 1SKUB 4XDDA 1OKJA 3CCSN 2GAGC 2VDIA 4JKHA 4QS8A 3TAMA 1HW9A 1F5CA 1WF2A 4ZOSA 4MIAA 5IT0A 3L4QA 2A1SA 1SC4B 2B5JA 1ASUA 4C23A 4FWMA 3CIMA 1U04A 4DV1F 4NYPA 5CXTA 1NSAA 5EN1A 2CZ4A 2XY5A 5FPDA 4MYUA 2OEKA 4P2XA 1WTFA 2DRBA 4NRUA 3ENWA 3FK4A 4CLYA 2IVFB 5IWAK 1DHMA 3K5PA 4BC3A 2UXBF 4Y6IA 1Q0NA 1PJ6A 4YOWA 5LL6Z 5J2QB 1IVZA 5AQGA 1ZC6A 3E01B 2BW7A 2GMHA 4UQGA 4ETXA 1F0XA 1U24A 3J7Z5 2MZSA 3BUZB 2DGOA 3LTOA 2IRXA 3TZZA 1HL6A 2P6TA 4Q44A 4HYKA 2R7WA 4LFAJ 1UAXA 3ELHA 2Z2YB 2F9TA 1RB0A 1BIUA 1I1GA 2HSEB 3FGUA 4IJNA 1NK9A 4DZDA 4XTTA 1IKVB 1X7VA 1QE1A 3BZKA 4USHA 1TL5A 3DRRB 3HZGA 1NM1A 3QZ8A 1K8AT 1QVGR 1OY8A 2VQFF 4ISGA 5LY3A 4K2JA 2O3DA 4DQRA 2QSWA 1R31A 1O6XA 5ADXA 4HHTA 4OHVA 2G4BA 1C0GA 1FDBA 3EL2A 1YQHA 3KG0A 1PAUB 1WF0A 3DLRA 2VFSA 4HACB 1N88A 2HPUA 2KYXA 2JH3A 5J2MB 1N36F 3U6FA 4C3MA 1JKHA 4DDFA 4B3TJ 5T7LA 1VQ8S 3NGRA 4QW8A 4J9QA 3O5BA 1WHVA 2H51B 1VIXA 3DRSA 4CJWA 4IYQA 4ANCA 2XSJA 2BJEA 4NLSA 3QEWA 4Q0BA 2ZOMA 4RW8B 2JVOA 2EPIA 4B3RJ 1HMVA 3UVJB 1RHUB 3ALYA 2HRTA 1U1QA 1RAJA 1NBEB 2XZDB 1R8PA 1UAWA 3I5CA 4DUYF 4I9LA 2QXLA 4I67A 4A46A 3VEWA 5BRHA 2XMAA 3VQCA 2OEJA 1U8WA 3M8PB 2F65A 2L9DA 4LFBF 3WC0A 4LY7A 2J0XA 1EIYB 1RADB 4CZFA 3CCUN 3UDEA 4DQQA 2A1BA 2HWHA 1XQSC 5AXKA 3V9SA 2KG1A 4IEIA 3CCMN 1SPBP 3CETA 4FXWA 3QPIA 3EE3A 1Z26A 2V67A 3MPYA 4CJVA 3W2VB 1IBLJ 2YWGA 2N82B 1I94J 3SUOA 2DFFA 2KVQE 3PTWA 4P2SA 1RT1B 4BG9A 4LR9A 3SSRA 4H0OA 4HT5A 1HR0F 4H0XB 3SCIE 4OZ3A 3MXMA 4HTUA 1CJVB 4CDIA 2HFZA 4Z4CA 4AQYJ 4AUKA 2YV0X 3UWTA 1GX5A 5GMEA 3L95X 4CGIA 5FRMA 4MAKA 3NDKA 1VLOA 3W0LA 2C2ZB 3MAAA 3T5JA 1HBOA 3MMCA 5K20B 1CS4A 1TP7A 4QS9A 2V94A 4OKJA 2KZMA 1WHXA 3F9KA 1YJNN 3CO9A 2R7YA 1JL2A 1RHRB 1HQUB 1R8HA 3OJUA 3QMQA 8AT1B 2O8FA 2F4VJ 3MD1A 4OX9J 2NQPA 5AQJA 1JJ2R 1TL1A 2FUG9 4X4SA 4P10A 2VOPA 1LK7A 3HSDA 3ENBA 1X4CA 1O13A 1HI8A 4Y0WA 2D0AA 2XS5A 1C0MA 3BO3A 2BE7D 1SJ3P 4Y2AA 2DISA 5LXYA 4CWBA 1N5YB 2DCUB 2BOAA 4FLVA 1U4BA 1VQNN 2M9KA 2W24A 2WFBA 1S0NA 4D3GA 3TVKA 1GTHA 4CIOA 5ETKA 1XK8A 4ZK7M 2HVHA 3NS6A 3V1RA 4JI0J 5C12A 4IFYA 1IR1A 1Q16B 4USVA 3G0ZA 2B4PA 4WPAA 2ZH2A 3BS9A 5GAHI 3JSBA 4NXNJ 4CIEA 2K8GA 1H7XA 5FROA 4KHRA 4NLPA 1VK0A 1VQ4N 5IT9U 1DARA 1Q8KA 3DXBA 2CQDA 2KM8C 3G9CA 1NMNA 2M3DA 4A5BA 1DTQB 3HT3A 3C16A 1MNEA 5M1KA 3K0JA 4YHHJ 5BPLA 4N41A 3MXHP 2PT0A 3AO3A 1CJUB 2K1RB 2D3ZA 3MOJB 4KPYA 2V8PA 2NRHA 4MFBB 2I1RA 2BXJA 1LEOA 3T19A 4LH5A 4B1YB 3L2WA 2EX3A 2RS2A 3F44A 1ATNA 1UPMB 4IDKB 1ATRA 4PXCA 5HVFA 4BG8A 4DMZA 5KT7A 2OPSB 4DR2J 3CC7S 4DV6F 1C0TB 4K8XA 1FK9A 3HSGA 1EKRA 4ED7A 4Q2LA 3O8WA 2DNOA 1S49A 3QWUA 3DAWA 2ZM6F 5HQMA 3TWHA 3U9DA 3DM2B 3UNGC 1FDDA 1S79A 4NE9C 3EZOA 3THWB 3OUYB 4ES2A 1B0PA 1RCOB 3CE8A 4L3KA 2DKOB 3CERA 2RD5C 2G1HA 1KLNA 3RUBL 3DDIA 5EXWA 3OLAA 3HL8A 5BPMA 2P8IA 3CJ7A 3OD2A 1I5OB 1YJ9S 3CCRS 2UUBJ 3GV7B 1X1PA 1X4AA 1QHAA 2QKBA 2EFVA 3NL0A 4E1MA 1C1AA 1VI7A 2L9WA 1FX4A 1REGX 4OHWA 3G71S 2DH8A 4NLDA 3PV8A 2LVWA 3QEXA 3IWNC 3NCRA 3TW0A 4DX8H 4AF1A 1JX4A 1UEUA 1JXEA 5AE2A 1RABB 4NLOA 1P8GA 1LW0B 2HVIA 2ASOA 4RNMA 2HQCA 2EKNA 2ZBQA 5KT3A 1UVJA 1WN7A 3GU0A 1D8YA 2XNQA 2ASPA 2CZ9A 2LYVA 1NG9A 2ZJPQ 1KEKA 3QQCD 3RW7A 3LPUA 2BJ8A 1V3RA 5ETTA 4JV0A 4RW4A 5L1JA 3DU5A 4MDBA 2DY9A 2FHJD 3NCQA 2MHEA 1FRJA 1FNMA 3NVMA 2B9XA 3J7YU 4NZ7A 3GB0A 1TVRB 4KSEB 4ELVA 1AW0A 2VHGA 1NCLA 2UU9J 1IV0A 5LMNK 5B8HA 3G6VA 2ILZA 4OIXA 2YCHA 2FVRA 2G8WA 4C0HA 1CPZA 1HBMB 1ITPA 4CF8A 1SS6A 1SQFA 5KTQA 2CQBA 4ECWA 3H6EA 1O1WA 3JTOA 1TTHB 3QRQA 5I3UA 4CH1A 4B3SJ 3VF4A 3IMXA 3C7NA 4LF7J 1VQLS 2QX0A 4NLWA 3R1LA 4NYFA 3VGLA 3GJRB 1I51B 2HHQA 4QWAA 3EGNA 2FIUA 3ETOA 2XHCA 1X9MA 3R6MA 4ER8A 1WBDA 4ZTFA 2V2ZA 4LRFA 4DCHA 4PA1A 3MN6A 3ZZUA 2DNGA 1FTRA 1A6LA 1IJJA 3N6MA 5FRNA 3DLKA 1SV5A 4CO3A 3K57A 3MWPA 4JI8J 1FXDA 4OGEA 2NUUG 2PMHA 3IM8A 5K14A 3FZLA 2JSXA 5M1OA 4KB1A 3ULEA 4J5OA 1U2FA 2YNHA 3VAKA 1CG2A 5H1SV 1MWYA 4TY8A 4FYXB 1BA1A 4ZITA 1Y0HA 2ATQA 4LF8K 2AX0A 4M3YA 4X4VA 1VC5A 4CGFA 4CBUA 2V34A 5AQUA 1Y7PA 4OX8A 1VRUA 3SPZA 4WIQA 1OMSA 3GZ7A 4HH0A 2AQ4A 2NNWA 2P9SA 2ZJPL 1C4AA 2PN6A 4J9MA 1TZ0A 4CNYA 4CBXA 3WQTA 4CJRA 4JI3J 1YJUA 2GVDA 4A62A 4GKJF 2JJ4D 3OYHA 4DV7F 2YQ3A 1S1TA 1FRLA 1HBUA 4E0DA 4ED2A 5AZJA 4LIWA 2ZHAA 4JV5F 1JJHA 2I7NA 4IBNA 2KKHA 2ADBA 4PUOA 3S3NA 2Z2LA 2HG4A 1JL1A 4CRJA 4CK1A 1WUAA 4CO1A 1K44A 1RU1A 3OYDA 4O0NA 5FIIA 2EKYA 4NMLA 4CM0A 1JLFA 2Q36A 1S1UA 3W61A 4OJ3A 1BI4A 2FVCA 2LQ8A 3BB5A 2CYYA 1TKXB 3VESA 4FPRA 3QBXA 4QYZK 1HYSB 3SK3A 2Z30B 3MN9A 2E1PA 4B02A 1RWWB 1VSLA 1BDGA 1Q5YA 2GV1A 2PAVA 4RW6A 4F3QA 2KYZA 3RAMA 3W2WB 2Z8QA 5H9EJ 2W6LA 4OLAA 1X8DA 2QKKA 1S4FA 4YDUA 2AA4A 2FGOA 1QHTA 1S9GA 8RUCA 4FJHA 1DQAA 1SUQA 3PVXA 4M5DA 1Y4ZB 1Q8IA 1QUPA 3EEQA 1SIWB 8ATCB 2EBGA 2RJZA 4DV3J 1SKRA 2V8DA 5JMVA 5A8KB 4ITSA 4QPXA 2WBMA 2GHWA 3CJSA 4ID5B 4OJRA 3AVCA 4I9QA 4X4PA 4CHYA 1MWMA 5C7PA 1TFYA 3RMCA 4LF2A 2OEMA 4X64J 3WX8A 1ZBFA 4K4TA 4ILHA 3ZSRA 4ELTA 3N4QA 1HKGA 3HI9A 4AL7A 1O51A 1X4BA 3GR1A 3AO1A 3GLJA 2ZJRQ 3NE6A 3CDEA 2PA8D 2HNDA 4CT8A 2WONB 2LECA 3LP1A 2CQGA 4ZPDA 3W63A 5AQOA 4LIRA 4JKFA 2KFZA 4TN2A 5LMUJ 5L1LA 2I5JA 2LEPA 1HQ2A 1HA1A 4PWDB 3DHWC 4DV5F 3OYAA 2HMIB 3IWLA 3ZTPA 3UCGA 3OVNA 3D68A 1BQMA 2YKPA 4KH5A 3AD9C 4KYZA 4Y2MA 3OYBA 4UY85 3RB6A 3ISNC 3OYMA 4BHQA 3VGMA 3E2EA 1EZZB 4PKGA 4I1TA 4FF4A 3ZEUA 4XH4A 4QZVB 2J9DE 1HRHA 3KG1A 3UDLA 2ZBCA 3FLCO 3BZCA 3VAIA 3A8IA 2KHCA 4A2AA 1TR0A 2X78A 4OZNA 1HKBA 2Y9HA 3M2UB 2R8IA 1TUUA 1SH0A 2IC3B 4EBEA 3O9TA 2M52A 3GG4A 4F9OA 2BJDA 4V1Ak 4JI2F 1SC6A 1RBVA 1IH7A 4JI5J 4IG3A 5B09A 1IBKK 1Y5LB 1KWMA 4DTSA 5A8RA 2UYTA 1CULB 2H5JB 5H1SQ 3J81U 1M90O 3S1TA 1RT6A 1OYEA 4Y2IA 2LKZA 2QLXA 1FWLA 1R8AA 4L8RB 4M7XA 2ABYA 5KGWA 1RBLA 3NAIA 4C97A 3D67A 4C11A 3NXZA 3CMES 1UWBA 4WWSA 4B3MK 1U48A 1YKWA 1X5SA 2ZJRL 2HBLA 1GOBA 1AB8A 3QLHB 3SIPB 2MKSA 5G0RB 1N4LA 2KRBA 5JS2A 5CCMA 3V6HA 4GKKK 1GXLA 4CP5A 4N8NA 1CC8A 5IV4A 4LSLA 4C4WA 2P2CB 4OPAA 4JYAJ 2XY7A 5DETA 2DY4A 2DNPA 5KFHA 2DGWA 1XNQF 1U26A 2RT3A 1TV6B 3WNGA 3GYNA 2A10A 1ZZFA 4DL4A 2QMUB 4DR6F 3A3PB 4CJKA 4WKRA 1VBYA 4PZVA 5IT9Y 1T9XA 2QA1A 4JKDA 4CEBA 5HBMA 4DR5J 1LFPA 3N0VA 4CIFA 4MIBA 3NWRA 2JC1A 4YMEA 4A8FA 3MF5A 1FDNA 1S1VA 5AR0A 3FZFA 3WZ0A 1WKLA 3O08A 4C7QA 1WNEA 2Z1HA 2UP1A 2DY1A 3MCAB 1CJKB 2GEMA 4GVEA 1YTUA 4YY3K 5J1NA 4ZVEA 4EBCA 1WSGA 4DFPA 1Q7YO 5BN9A 4B9QA 1VQMN 3VQTA 1XUPO 5KPRA 3VVUA 3HHLB 3VQ6A 2DEJA 4NCBA 3OSNA 3ZT1A 4LF6F 3QFPA 3I82A 4CJ7A 2G8FA 3SJJA 2J6SA 3P96A 1HNWJ 1UJ4A 3CF5Q 2GELA 1NPRA 4N5SA 1MG7A 3OYJA 4DTMA 4HUGA 2AZ3A 4PQAA 4KT0C 3ZT3A 3AA9A 2RUSA 2E1RA 1M5KC 2I2YA 2Z2ZA 1K9MO 1LXJA 2ITMA 1M1GA 5C25A 1TL4A 3QEVA 1C0UB 1L3SA 4ANDA 3QIPB 2KXFA 3M8SA 1VC6A 2FHJA 1WUUA 5E26A 1X0FA 2HNYB 1BXNA 2MB0B 1WOPA 1NH7A 4RUBA 2CQIA 2OA8A 1LWCA 4MTPA 1J9AA 4D3HA 4FSVA 4LQ3A 1HBNA 2JNJA 2IVMA 2QN6B 4WYLA 3CFPA 2BE2A 1RWXB 1WELA 1X4DA 3C6TB 3M8WA 4KHNA 3FFKB 2A0FB 5SUHA 1WSFA 4RWWA 3QRRA 1QD1A 3QO9B 4GW6A 1WI6A 3VTHA 3WXMB 1Y64A 3DGPB 2NLXA 2FTRA 1SL2A 4DV4F 3DOLB 4WFAQ 2ZDPA 5GAGU 5HJXA 1V5IB 4JI7J 2HHUA 1KBRA 3NMAA 4BQZA 2A3ZA 1URNA 3P5JA 2RAQA 2VF3A 5GADP 5AXMA 4BC5A 1RAEB 4XEIA 3BO2A 2HHHF 2CWKA 1G1XA 3RRKA 4B9TA 2P9EA 4IOCQ 3DRPB 1SH3A 3QDKA 4B08A 4CFCA 1EX4A 1GLCG 4ZIVA 2KXNB 1UOCA 1SJ1A 3C6AA 3NLCA 2O8CA 4FKYA 2GWJA 3HXMA 3CF5L 2YWFA 2V4JA 3PDNA 4FPIA 4DL3A 5JVGQ 3NS5A 3EGVA 2YTCA 1JLGA 2QYCA 5A2QO 1QVGM 3Q8VA 3SBGA 4TKTA 1ZS6A 4M8LA 1RT4A 4MK8A 4HEA9 3HKWA 3KJVA 3QJJA 3V81B 4OZ2A 4ID1A 4P2FA 1N34F 2VGNA 1GLBG 4CJQA 2DHHA 4FNHA 4FWKA 4KE5A 4DXLA 3DLLQ 3B82A 2VBZA 4DV0F 2QLWA 5MLCV 4KFBA 3VQDA 4IXCA 4JKEA 1RHQB 3ONQA 2YNGB 4WJBA 3H98A 4K42A 3PIOQ 1A0OB 3GYXB 2P1JA 3LQVA 5KT2A 1REVB 4RKUC 3CCJS 4RW7B 2QG9B 1C1CA 4EK2A 3QFHA 3A5OC 5KI6A 4DFMA 2YHWA 4PYDA 3L0QA 3T5HA 4WFAL 1ZETA 2KZZA 2IAJB 1QQNA 1W26A 2G8IA 2XYGB 4FM0A 4DF8A 1VQ5S 2HHWA 1RWOB 1J5EF 1X9SA 4EEYA 3ZZPA 5F9NA 2XS7A 1RTDA 2YHYA 3W3SA 3AVLA 2A3JA 2CPFA 4KKOA 4AL6A 4KHPF 1H6KX 4IOCL 4YR3A 2KT2A 4ECTA 1GXUA 4G6VB 3LP3A 4K0KK 4Y2KA 3G87A 2NXNA 1JJ4A 3M7VA 2PMWA 2VPXB 3J8AA 1UW4A 5JVGL 5DGAA 4ILJA 2WVEA 3R5DA 3BEGB 2XGQA 5AJ3F 2L41A 4F50A 2UXCJ 4BR2A 3ZTOA 4LR7A 4LBPA 4G1QA 1RYSA 4YP3A 4PY5A 4ECRA 2VQEK 3QT8A 3NBPB 3FSIA 2VKZG 4H03B 1FVQA 2VICA 4QQBA 3DYAA 1HIYA 2FJVA 3SQ4A 1OYDA 3K5OA 4USUA 4JI4F 3MEKA 2NUHA 2QZ8A 3DLLL 3RMDA 3A5MC 3I56S 3UD4P 3G25A 3KMQA 3SNNA 2BDPA 1EP4A 5DQGA 3KHRA 3HOSA 3PIOL 4J91A 3KK2A 3BGFA 2V4RA 4LFCK 1MW7A 4M5LA 3GIKA 1HJRA 4BC9A 2NR0A 2G2ZA 1F9FA 2G0JA 2AGPA 2YNFA 2KJWA 1WC6A 3WUHA 4HDHA 2B7BB 1Q8BA 3O3GA 3IXQA 1CJTB 1NK4A 5F8HA 2DIUA 2UUAJ 3I4PA 3NAEA 2FBXA 2G8KA 1BWEA 1NDCA 4F4ZA 5EWFA 2NRTA 2PDAA 2ZH3A 4OKEA 3IG1B 1ASVA 1U0HB 2CFXA 1U1LA 2C3OA 4GY2B 5IT4A 2BGGA 4GVBA 3Q8QB 1YAGA 3MDFA 4FK4A 4FKXA 1T95A 1RCHA 2DGUA 1LOUA 1VMBA 2B4OA 4ZVUB 3SCLE 2MTLA 1WC4A 1UTAA 3I6PA 4CI0B 3AO2A 2G1DA 3R2DJ 2W9CB 2RKIB 5FPNA 2P9PA 4ELUA 1X31C 1YDLA 1YSJA 3QZ7A 2XZTB 3NCIA 3KKRA 2IRYA 4OHYA 3DLGA 2AHOB 4DL0C 5KFFA 3QNWB 3JQJA 5CHCB 1NZ8A 4JK8A 2VONA 4OYMA 3RB4A 2Y8YA 5AXNA 2E5LF 2QV6A 3BQ2A 2EC2A 2FJWA 4CF1A 1RDRA 1Z05A 3ITHA 4I2PB 4ZA1A 4C8MA 3PX6A 3HHNB 4K8ZA 2CPEA 3KWGA 5MLCQ 3HKZD 4X66K 1AZSA 4PWUA 3C6UA 2KJVA 4ERDA 1F21A 3SV3A 3UNYA 2QYGA 3THPA 2CVIA 2NRXA 2XMMA 3AA2A 4IG0A 4FVCA 4NB4A 3V9UA 1NM2A 1U2RA 1ZM3A 3L2RA 3NCPA 1H2UX 3ASMA 4KGKA 3BR8A 1NAQA 1G3OA 1D4XA 3PXGa 1VQ8N 1IJFB 3PW5A 3ZXWA 5C2DA 1JNZB 4DV1J 2DGTA 3UDVA 3AJ2A 2UXDF 1Q86O 3F73A 2AEJA 3MECA 2AKWB 2D1KA 2OPPA 1RK8A 4CFBA 1KLMB 3IGVA 3EZWA 3MGJA 3F2KA 3OYCA 2W41A 4W5NA 3FR0A 4WE1B 2CG4A 3OTOK 4OX7A 4USMA 2O4GA 4WFBQ 4Y34A 2UXBJ 3BF1A 2MGZA 4BRGA 1WSVA 4PQUB 3J80U 1S1XA 3V4IA 2P5GA 1HNZK 3L4BC 1YI2S 1S3XA 2ZDOA 3ENQA 1VOMA 4O0JA 4O23A 1EO1A 1PAEX 3DOKA 5I4MA 4KC5A 3AQOA 2G0CA 1X4FA 1RAHB 2HBQB 1Q7LB 5DJBA 2X6SA 3ZSVA 3VEXA 2CJXB 5L1KA 3X1LB 3SDEA 2VDHA 3HO1A 1JLQA 4C1NK 3CXCM 4M3TA 3FMBA 5AQZA 4LRAA 3M8RA 1W0HA 5A8WA 1X9WA 3Q7CA 2GJFA 1OWXA 4MT1A 3K2YA 4OI6A 2VQFJ 5U47A 2R8HA 3TAMB 4GMJB 3O9SA 4USTA 1X9JA 1Q5VA 4E3SA 2D69A 2QMXA 2D7SA 2B5JB 3V4MA 1RBSA 5E3QA 4RG8A 2NXCA 4C0BA 9RUBA 1N36J 2C2DA 3VZHA 3QFUA 4CZMA 3CD6S 1FVSA 4AHVA 3HVTA 3D2EA 4CEDA 3M2VA 3LDOA 1TYQA 1D8ZA 4ENOA 3MK6A 4GVLA 4JRQA 2ROPA 3RR7A 2RRNA 3KTQA 1KS2A 3PLAA 2C2MB 3GSIA 3NVKA 2CPZA 4WFBL 4MKVA 4BVOA 3V9WA 5IM0A 4DUYJ 3NEKA 4IWVA 2MQ8A 1L5UA 3S7RA 4LFBJ 3R27A 4X65F 4HI2A 4O3RA 2HYIB 4DOZA 2OHDA 2BUPA 1HI1A 5KFCA 3LPEA 1A9NB 3ZSXA 2XMVA 5CZ1A 2HK2A 2YNIA 1JJCB 1QE1B 4TQRA 3AV9A 3KLVA 3RGIA 3TP2A 4PWWA 3H90A 4BROA 2MY7A 5DK5A 3D1OA 4DLGA 3GFZA 1FFSB 1LKZA 2XRIA 3O4QA 1HR0J 2EWHA 1H2TZ 3MN7A 5D0GA 4YB1P 2PGCA 4J2AA 3WQPA 1ZTTA 4P7VA 5BYRA 2VIHA 3OYIA 1JKHB 1M0SA 2R2SA 5T7LB 3VQ5A 3HVWA 2AV5A 1RCXB 3W1YC 2QXFA 1WORA 2VBWA 2RH3A 3DRSB 1EWQA 5AZIB 3P6YC 2OKQA 2XSJB 4Q0BB 2V9WA 1FCAA 4DSIA 1KCFA 3PJ9A 2NZTA 2D74B 1HMVB 3JSMA 5EUHA 2W2NP 1W2BM 1X5OA 2F7TA 4FOEA 4B3MJ 3O80A 4F2SA 4QOTA 3J7ZO 4CGGA 3UR0A 2FJDB 4DN9A 3CC7N 3O9RA 4RTFD 2DK2A 1BGXT 2ACYA 3BF3A 5A6WA 2X3GA 1XMQF 3O1WA 3O6QA 1B7FA 4WTOB 4LF5K 1Q79A 4WZMA 2XMJA 5ETLA 4DU1A 4CESA 1EKEA 1I39A 2RB7A 1K73O 3V6JA 2ZFHA 5F9LA 4F4AA 1UA1A 2JFDA 4LF9K 1MSWD 2DR6A 3UW1A 4YR0A 1YJNS 3HHLC 3M1VA 3I33A 3NF8A 5AQVA 3BF4A 2C3UA 5E0OA 1YJ9N 2YWHA 2R7SA 3CCRN 2NRRA 4FJXA 1WSJA 4BR5A 3M9MB 3K9KA 2W8KA 3JYTA 2DR7A 2MLYA 1R89A 1U7LA 4YQWA 2FXUA 1WBBA 4P71A 4U7UK 5DM6Q 4CJLA 1UEVA 4FJKA 3TNVA 2UVVA 3P5BP 3G71N 1KAXA 4L3NA 4X4QA 3POTA 4KJIA 2EC0A 3RBZA 3BO4A 3MAAB 1NPPA 2YHXA 1HBOB 3MMCB 2OZSA 2ERRA 3CMAN 3HOTA 1CS4B 4BR9A 3SLCA 1K47A 5AQYA 3MMBA 1NB2A 2P6SA 3D1QA 3CD7A 3RG6A 3R5GA 4FWQA 2W9AA 4BRAA 3OL8A 2O8FB 1Z2ZA 1TL1B 2N7YA 3VGSA 4AHRA 2FSNA 2RS8A 4W5RA 2Y1JA 4KREA 1FEEA 2OTJS 2QLFB 5MAOA 3R9LA 2A2DA 2HEKA 2ZVIA 3NWGA 5F3ZA 3AVAA 1T3VA 3X3UA 1DEJA 3CJ9A 3HSZA 4O4GA 4DR7F 4DV6J 4OHXA 4X2BA 2YPYA 3E9LA 2CNOB 2CNNB 3RAXA 3VENA 1RA6A 3HP9A 2ZM6J 4BE1A 4O4RA 4ILGB 4ECQA 2QM1A 3NGYA 1G6BA 1TUYA 1NO8A 3MZIA 3HX9A 3PO4A 5KRSA 5IC4B 1LV5A 1IBMK 4IFYB 2YY3A 4CEZA 4Z7YA 3OFEA 3M2RA 4U96A 3M9NB 1VQLN 4CFAA 2AJQA 3HK2A 2XMUA 5CA5A 2V2KA 3Q89A 2X74A 4WU3A 1XIQA 1FNOA 1ZZNA 1F3VA 2B7CB 1MMLA 1PILA 1VHFA 3ISND 1FXLA 2FHMA 3BSAA 4RU9A 3C16B 5DM6L 1EARA 1OJ4A 4LF4K 2CPHA 1RHJB 6FDRA 4F3TA 2QL9B 4MKBA 2OIHA 2P9UA 4Z7CA 1Y5NB 4AHUA 4U7BA 3MEGA 2KL8A 1GT8A 1NGJA 2HVEA 4I6MA 3OR2A 2WUSA 3DHXA 5KFAA 3TVYA 2ZC3A 1J5OA 2MDAA 3ZTQA 2NXUA 4UQTA 5HQLA 3M6GA 1NJIO 3WBZA 3ZO7A 1KONA 4YR2A 1VAZA 3E8OA 1PBUA 2VBXA 1FK9B 4YOXA 4FF1A 3DN9A 2R2RA 3IGNA 4DTNA 2AD9A 4FXVA 2AU0A 4U67Q 2DHXA 2X6NA 3CCZA 3DLEA 1CEZA 3D45A 2FZKB 3MTKA 3BSOA 4KH6A 4FJLA 4MO4A 2RDDA 2E6LA 3K58A 4K4ZA 2ZUGA 3EZUA 1QZ5A 4Z4IA 2O4IA 3MXIA 3W5XA 3FEXB 2DGVA 4IKFA 1JXLA 1IWGA 2R7QA 3FZHA 2E5JA 1AUDA 2LMIA 2COLA 1RKJA 5CQGA 5EY4A 4EAHD 2QFIA 3US5A 5FPEA 2E5HA 1FERA 1RAAB 2VZ9A 5AQNA 4JD2A 3I0SA 2C2OB 2ZHOA 3VAHA 5FDLA 1RNHA 2AYMA 2U2FA 4DU8A 3NNHA 3MR7A 2ROGA 4AXJA 4LR8A 1OH8A 2IGIA 1OPZA 3G8SA 4QIGA 4PKHA 1FNXH 3CC4S 4ECZA 2A1RA 4EYHB 4RW4B 1PG5B 1G4CA 4LFAK 2G0IA 1T11A 2XGPA 2ZBIA 4RW9A 3VEZA 4USJC 5KFNA 3G8TA 1NGEA 4GKJJ 2E4LA 2NREA 4F36A 4DV7J 1JLEA 1V6HA 3TX0A 5C10A 5BREA 4JV5J 1JLBA 4BRPA 2KG0A 5AQWA 3P3DA 2JWKA 1H7WA 4U67L 3GWCA 4BRCA 4EZ9A 3J80Y 3LGNA 4M94A 2KFYA 5I3UB 2J9DA 3TZYA 2CRLA 3BSNA 1J54A 3C7NB 4PKDB 1XBWA 5CYMA 1RU2A 3OL7A 2R42A 3KLGA 3FZ2A 4IQMA 3TZXA 1EHWA 1UETA 3O5TB 1RTZA 4B3TK 1NDKA 3WEEA 2EEYA 4A8SA 4H0YB 4DU4A 4ZPTR 3THTA 4B17A 1KVCA 3DLKB 1SV5B 2D9OA 1TUGB 2RHSB 4DR4F 4YOYA 2J9CA 1ZBTA 2MQMA 3HD2A 5K14B 3O3LA 2J0WA 2NSCA 2IJFA 3G6EN 2HWIA 2YNHB 4B3RK 3LAKA 2W7AA 4NLBA 3TAGA 4TY8B 1KP6A 2D4WA 4OYIA 2BBEA 1SVDA 4EYIB 1NOZA 3W5ZA 3W3DA 2PY5A 2H54B 1XC3A 1VRUB 2W4DA 2YBVA 3QGHA 2P9SB 2VFUA 1NGBA 3DMJA 2AJ0A 3MM9A 2XLKA 4YOEA 2GVDB 3ZSYA 4YORA 4X62F 4UZCA 1P9QC 2ZWOA 2ASMA 1MU2A 1S1TB 1HBUB 5E5NA 3GONA 5AZJB 1D09B 2QMWA 2H3EB 2XWXA 3CJ4A 4F2RA 2BABA 1IG8A 4PUOB 3D7SB 4URGA 2YX1A 4B1XB 3DRXA 3DLHA 1FE4A 4DUZF 1IBLK 2ZE2A 4K8RA 4JNEA 4W5OA 2E2QA 2UV8G 1I94K 1JLFB 1S1UB 3I0RA 1WOOA 2W42A 3SQ1A 3L2VA 1BI4B 3KUHA 1R3NA 4CVNE 4KHWA 2F96A 4AQYK 1VCTA 3F56A 5E2QA 1E6YA 4H4OA 3TPQA 1DLOA 4DV5J 4RW6B 2DPNA 5SZTA 4AD6A 5AQTA 4NXMF 1KQSR 4DUTA 1DRZA 1VQSA 2J76E 4CBWA 3AA8A 1K1SA 4MIWA 1WOSA 1S9GB 3DC2A 1WHYA 1SUQB 4M5DB 2F4VK 4OX9K 3T1HF 4H0PA 3BEXA 3RBDA 4OVLA 5E3PA 3O2IA 2WSFC 2W2OP 4TY9A 1IQZA 3HD1A 4ZS6A 4TXSA 1N8RT 1YZ7A 2C28A 4WP8A 4ZDNA 3CCVS 2CH5A 4HCBA 4Z4GA 3AO5A 3BBBA 4JI2J 4BC2A 1XMBA 4ICLA 3HFVA 2DT9A 3CW2C 2HKEA 2I0XA 3PCOB 1MMDA 3M30A 1RYRA 3CT9A 2QWNA 1C0UA 2Z2MA 2AEMA 1QAJA 1P90A 4DLEA 2HNDB 1T7PA 3CULA 4KO0A 2N7CA 5FJ4A 3GPAA 3Q8RB 1R0CB 3H59A 4GV9A 4NXNK 2C1EB 3LP1B 2MZTA 3CNQP 2P9KA 9ATCB 5GADI 1T0TV 3HJFA 5BRDA 4P52A 4RZRA 3MAQA 4NLRA 1NHUA 2ZNZA 4J9RA 2ACMA 3PSIA 2I5JB 1GK8A 3Q24A 3G10A 2FBVA 3AVIA 4FJIA 3HPOA 1ZYQA 1T03A 3D0PA 4NLCA 3DLBA 1KC8T 4GO7X 2A40A 3DCAA 2Q31A 4YHHK 4C98A 1XNQJ 4E89A 3IMQJ 4FJJA 3NH1A 3MWTA 3J81j 3BQ0A 4RCHA 4DR6J 2ZBPA 1JXVA 4ZMMA 3ZEUB 1QLNA 3LDQA 2IYGA 3E9OA 2HFUA 1SIZA 1BHNA 1HHQA 1F60B 4Z37A 4J9UE 5J2PA 3N79A 1RAFB 4NA2A 2R7UA 3HBTA 4DR2K 5GMDA 3D66A 2X1AA 4FLYA 4K4XA 5DM7Q 2YWKA 4PAAA 4B1VA 4I7FA 1T05A 4IG3B 4BBYA 1W7AA 5A8RB 4M3UA 1QY7A 4L6V3 3NGZA 3I9V9 1RT6B 2HURA 3WQUA 1TMMA 2ZD1A 2R8JA 2FVPA 1CLFA 4LC9B 5KFGA 1QQOA 3L6QA 3VQSA 4M3RA 4BACA 3I96A 4PR6A 5EWGA 3KDOA 4QIEA 2G8HA 4M5KA 3B4MA 4C11B 4QAGA 3GSDA 3TJ8A 3WXJA 1UWBB 4FZZA 5C24A 4OYWA 2RN2A 2LQJA 4LF6J 2AIRB 4CJUA 3PSFA 4Q43A 2YKNA 2F8MA 4XDCA 4BS2A 1Q9XA 2O8EA 2UUBK 2GO9A 2F5GA 3MM8A 4CGJA 3F5TA 3N5BA 2EBEA 4LSLB 3KHHA 2W01A 1PYOB 3BH6B 1P6TA 5F0WA 3ENAA 1H73A 5M2UA 5AQSA 3KLEA 3L7OA 3NF6A 1BY9A 1J6ZA 4UY8O 1M1HA 4CFDA 5B7WA 2YX7A 2WOMA 3HT0A 4FLZA 3OFFA 4F25A 2V7YA 4BE0A 2IVNA 5E41A 3PJXA 4M63A 2NZCA 5HL7Q 1BIZA 5HBMB 3MPDA 3PZPA 2GBZA 1BD6A 1U02A 1IR0A 1WEXA 3C94A 4FP9A 1D9DA 2EFPA 3VQBA 1PC4A 3SJHA 1S1VB 4RUAA 2E7XA 5D77A 3WC2A 2KHOA 4JKGA 4DSEA 2UU9K 2V52B 3KIOA 5DM7L 4CEFA 3LOUA 2CH6A 4NCGA 1XWLA 3E9PA 2KFNA 4DFKA 1MROA 3W60A 4DV4J 2Q79A 1VQ5N 4DI6A 2CGKA 1GXTA 4B3SK 5KG7A 3P31A 4LF7K 2B9WA 4CJ3A 5CD4H 2HHHJ 4OQJA 2E44A 4ECVA 4EU0A 5HOOA 2DGSA 5FD1A 5JLFA 1TUWA 4KR0B 2GGPA 1W9HA 3A8KA 2VD3A 3LH2S 2Y0SD 4IRCA 4G9ZA 1LCUA 1K0TA 4JKBA 2QSFA 3QWPA 4WFYA 5C25B 2WZ1A 1VYAA 4G1PA 4JI8K 4LF5J 5JVHQ 4ZJOA 3EVOA 2ZOFA 4CLLA 4B8AB 1N0UA 3TSQA 4H54A 4ED4A 4XO0A 3LM9A 4LMZA 4ECYA 1S97A 1LWCB 4H0VB 2ROEA 3M3ZA 3UKRA 5HL7L 2CJQA 1HBNB 1N34J 3FBFA 1BG3A 3VZIA 3ULDA 4QIFA 4LBHA 3I56N 4DV0J 2BE2B 2CJAA 3D6RA 1AA1B 3L3UA 2GJ2A 2H4YB 2E9ZA 4QJVA 4WIIA 4CECA 5KFVA 2BX6A 2XBPA 5D3GA 4BE2A 3SSSA 2E7WA 2EFQA 5F41A 4NZ6A 2HBYB 4ZLLA 3JQKA 4R0EA 5AQMA 4DU3A 5JJBA 5D4PA 4NI2A 1ITGA 5D0EA 4A8OA 1J5EJ 4BRHA 3SPYA 3OFHA 2HQGA 2O8CB 4P75A 4KHPJ 1Y9OA 3QMLA 1S6PA 3A8YA 2V4JB 1J2VA 4YFUA 4IOXA 3PRBA 3BKUA 5H9EK 3EE8A 3PW2A 5E3AA 1JLGB 5H9FJ 2F9WA 5BYSA 5LJ5Y 3TVZA 2IVYA 1RT3B 2QK9A 2HFOA 2Z0GA 3JXUA 1I3AA 1RT4B 3DJCA 5JVHL 1QSSA 2MZQA 5AJ3J 4DV3K 1HNIB 3KJVB 3OPKA 5KFKA 5K8PA 1NGFA 3TQEA 3NP5A 3U9ZA 1M5OC 2IVOA 4FLXA 2BQ3A 1Q81T 1KFSA 4KFBB 2IRUA 3CHWA 3QFWA 4OYZA 4N76A 3GIJA 1HNXJ 4JI4J 1JWWA 4BRIA 4AQYF 1KKHA 4X64K 4PG7A 1T9TA 3CJ8A 4CZLA 3MUMP 2A42A 3FRZA 1C1CB 3CQXA 4J2EA 2F7VA 4RBVA 4B9SA 2M88A 2V68A 3LDPA 3IO1A 2WBNA 5F8NA 3M5RA 1HFEL 2ZH9A 4I6YA 2F4VF 1QTNB 1ILYA 4RJVA 2M7SA 1CZAN 3H8YA 2W6KA 3PW4A 5GVQA 3FJ2A 3EXCX 5LMUK 4RR5A 1RTDB 4NLYA 4KGZB 3VEOA 4NO7A 2FHKA 4KKOB 1NHKL 2I38A 2CQCA 2ADCA 4WFZA 1NZAA 3EMTA 4WQ4C 3O9UA 5CCLA 4A61A 3MHYA 3EVMA 5HN0A 1LWEA 1SJRA 5D15A 4CZCA 1RTIA 4PL7A 1NGAA 2CPJA 1BA0A 4TU7A 1A5WA 1S59A 3UR3C 5GAEP 1SL1A 3IN5A 3CG7A 2F4FA 2HFSA 1NU0A 4G1QB 2FC8A 2FSKA 4JI0F 2HVDA 3F41A 3CCWA 1ZAWA 1WAFA 3KJFB 3IRWP 2VJVA 3DYAB 4H4KA 2GFFA 1YI2N 2Z57B 3T5LA 4ILLA 2H1YA 4AFFA 3MM6A 3CDUA 4JI5K 2H3GX 3DXMA 2NRZA 4CO0A 1FJEB 2KT5A 3JB9k 1EP4B 4J7CA 2B51A 3T9NA 1URRA 3AAPA 2E5LJ 3KK2B 4ES3A 4KRFA 2BJ9A 4Q8FA 4O8KA 4FCYA 3TTCA 2YNFB 2BTFA 4N56A 3KK3A 2H5EA 4RBUA 4LQ9A 2ZNYA 3R5JB 3N4PA 2G2OA 2VWKA 4NX9A 3WNHA 1HLUA 4YDDB 4A5AA 3JTPA 3J7AN 1JLAA 4YNQA 1N33F 1E6VA 3FUYA 1KNZA 1YG0A 3GOIA 4JYAK 3MR6A 3ATUA 3M8QA 5LXRA 3ZETA 3CD6N 1V3ZA 1ZM9A 2HZAA 4GVBB 4JKCA 3VQQA 4U8YA 2UXDJ 1WKKA 4R25A 3FBEA 1GTEA 1WD6A 5F8MA 1FJGF 4DCPB 4K43A 1UVNA 3CJTA 5KFMA 5IXUA 3H7HB 3K5NA 1KD1O 3VF6A 4DR5K 3I8DA 4TLRA 4Q7AA 2P9PB 3WDOA 2CJ9A 2IA0A 2KN4A 1S48A 1TL7A 2OMOA 3DLGB 3D2WA 3K9JA 2VB6A 3TUPA 2ATLA 4DV2F 2Q1NA 3M4XA 1U1KA 2YKMA 2JDJA 3GIIA 4TYBA 5DDPC 3D9BA 1LWFB 3CGIA 1JK9B 3I55N 2W4CA 1Q8LA 4CZJA 4B1ZA 3QBWA 3MI7X 2HHTA 2Q43A 1FRXA 4IZ9A 3M9OB 3ITHB 3AT1B 3LA0A 3QBCA 3CCTA 1IBCB 2B9EA 2V50A 4MQ3A 5AZIA 1A5VA 1RSCA 4LRCA 1SJ4P 4USKA 3ID6A 1CQNA 3PYGA 4DR1F 1AZSB 3C6UB 3P39A 2YWWA 4CHQA 4RBTA 2P9GA 3I8BA 1RBRA 2XS2A 4BGBA 1HNWK 5F8LA 1VQ7S 1IQTA 4ZCLA 3AO4A 4IG0B 1QSLA 3Q8YA 4PG4A 4IO9Q 2X1FA 5D4OA 2CIMA 3PKMA 3ID8A 1N48A 4L72B 1RDBA 1FKPA 4CH0S 1P8ZA 2OD4A 5DDOC 5GAGP 4ES1A 1FD8A 3ZT4A 2NPIA 2X1GA 4JI1F 2DR5A 3MECB 1AFIA 3OT9A 2OPPB 3R1XA 5SWMA 4YDUC 3GJTB 2B56A 1RUSA 5DZ7A 3SUNA 4DR3F 1S0OA 4X4OA 4GC6A 5DZ6A 5KPZA 4ZLPA 2E5GA 1MWZA 1NK5A 2MSSA 2MGZB 4O3OA 6AT1B 3LL3A 4WTYA 3SMPA 1S1XB 5BR9A 3V4IB 1FI4A 2IJNA 1UVKA 1CVJA 3EE9A 3DOKB 1CSJA 5L8RC 1HW8A 4M3XA 1IM6A 4K25A 3IR7B 4X65J 3OR1A 1U1RA 2XY6A 5KT5A 3EO3A 3P1GA 2JX2A 3TR5A 1BQXA 4QYRA 3SDEB 4JI7K 4ZN1A 2KDOA 1JLQB 1BCOA 3HHKA 2DD8S 3GFHA 3DXSX 2HVZA 2WTUA 2Q0RA 4CEOA 2HZVA 2JLFA 5A8WB 1YIJS 3EWGA 1M5HA 1WSEA 5JXSA 1WDDA 1CQMA 3H20A 3GIMA 1K6YA 5CABA 2MZ1A 3KJQB 2ZKUA 4JI6F 4Y28C 4ZCIA 4AHCA 3C6HA 4R0JA 4JI3F 1HYZA 3EICA 4IO9L 2GUPA 3L8BA 5A2QU 1YTAA 2C22A 1SQKA 3GL1A 5KFRA 3CWJA 4IQXA 4LT6A 2YPZA 2DYAA 3JTNA 3IRXA 2ZH8A 2VOOA 5BR8F 3HVTB 3MWBA 3D2EB 1HUXA 2CPIA 3B8HA 3WXLA 3M2VB 4KHUA 2QWLA 1TYQB 4Z4EA 2OTJN 2OD6A 3D1HA 4TSXA 4S0MA 2HHSA 1NUEA 3WXIA 4WP3A 1HWUA 2D5RA 5I3PA 4OLPA 1RACB 3ZSWA 5IM0B 4DTJA 4WXWA 4YB7A 4DSKA 4FZYA 4TLQA 3VQPA 2K7JA 2EVZA 4EGLA 1S0VA 1XMOF 1XMQJ 4NA3A 2XWYA 4EI2A 1XNRF 2K2PA 1NSKL 1T02A 3Q8SB 1VISA 4OLOA 2DNMA 2YNIB 2VC0A 1T9VA 1XHXA 6FD1A 3T1YF 2ALZA 4J2BA 1YGYA 4ECUA 2DNKA 4HLBA 3PX0A 2BOPA 4L75A 3ILJA 1I6JA 1OSDA 3VQ9A 3EM1A 2XI3A 4RUHA 1Y11A 4IOAQ 3CIZA 3W9HA 4CNZA 1EWRA 2ASLA 1VSEA 1Y00A 1JNRB 4CLTA 1F2HA 3A3OB 1AROP 5DMRA 5A76A 2NXEA 4YOTA 5FLXO 4U7CA 2RE2A 3PG9A 2IDLA 2Y0BB 3QATA 3U1MA 1KQFB 4XPEA 4JS4A 4TU8A 1D1UA 2RILA 1VBZA 3PKYA 4ECXA 2CQ2A 4NEYA 3IBWA 2QEXS 2ZH1A 2J7KA 4NL5A 2M4MA 2UXCK 1TKTA 3M8ZA 2FC9A 3P83D 2Q1LA 1R6VA 3AA5X 3D6HB 3LANA 1WNSA 1U0SA 3OHBA 2LP4A 3JSMB 3KUEA 2GMJA 1S9EA 3B78A 3CQ8A 3IC1A 2WW8A 4JBCA 1DQ8A 4DTPA 2W2MP 2L9NA 1TAUA 3OS0A 3V2UC 1PYSB 3DGVA 3AVFA 2A6OA 1LOTB 3VGTA 4CTAA 2R8GA 3NOGA 4DR7J 4KHQA 5L38A 1SCJB 3THVA 3W65A 4FYYB 4J9PA 3CMAS 4OJ1A 1FHTA 4W98A 3M1VB 4CLFA 2UUAK 1FRIA 2XULA 2DHSA 4IOBA 1GLLO 5AQHA 5D8HB 5HLFA 1D0EA 2PC6A 2AGQA 2WW4A 3NMRA 3JYTB 1Z2LA 1N32F 5A6PA 3P49B 2R2UA 4FPAA 4OJGA 3AVMA 1Q78A 3LAMA 3T3FA 3HPGA 4IOAL 2LQBA 1KVIA 3POTB 3D4JA 3TJ9A 1X3MA 4ZJLA 4JI5F 3D5MA 4F4YA 3THXA 3AB2B 3B8AX 2R8KA 1TK8A 3SQ2A 3PACA 4FWOA 3DNCA 3GE1A 3GV8B 3MMBB 1WWHA 2N4CA 2EFNA 2CA9A 4P9SA 2XM3A 3TABA 3MDQA 3G6YA 2BE9B 3C2PA 4CGHA 2QWQA 4KPCA 5IWAF 3CC4N 1F9EB 4V19J 4O44A 3L2QA 4CCHA 3IBCB 1FKAF 1W2IA 3M32A 2GQQA 1T6DA 2DEIA 1KSPA 4O4GB 4JYAF 2RSQA 4ALZA 2KH9A 4KI4A 3TI0A 3KYLA 2K3KA 3CDWA 1SQGA 3AJDA 2VA2A 2PE8A 4U6PA 4OZ1A 4P7TA 4I6AA 2KVIA 4ZPAA 4RNFA 2CJYB 1Z6RA 1E4FT 3VGKA 4K4YA 5B0FA 2QWPA 3AVKA 3M2RB 1QVFR 1PGZA 1H98A 3RRHA 4CO5A 3CC2N 1U1OA 5HAOA 4ZJQA 3UCZP 2VWBA 2XMWA 3TWZA 3OYLA 3UI3A 4HTLA 2WTFA 2W1BA 3EDRB 2HSTA 2EK6A 5E7OB 2VG7A 4ED6A 4CF9A 3NH2A 4DV1K 1B0VA 4BDPA 1VSKA 1UFKA 4A8WA 1VHIA 4ISFA 4USWA 2HHVA 3LPTA 2GQ2A 2P9UB 3THYA 4H4MA 2X1BA 1EQMA 2RDJA 1BL3A 1R27B 3MEGB 5AQLA 4YOUA 3RBXA 3SZ2A 1HPZA 4I6MB 4KGXB 3OR2B 4AL5A 2PI5A 3NGUA 2UXBK 5DLFA 4FLTA 2VYPA 1J5OB 3KHGA 5CAAA 2R4FA 1NH8A 3MOZA 2JRSA 5LSLA 5T7BA 2R7TA 4CF2A 3UB5A 4A4JA 1BE4A 5KFQA 3VQ7A 5C0YA 1S7IA 4L74A 3QNNA 1RT2A 1YTYA 3GBTA 1PBAA 1U1NA 3LDSA 3HSJA 1M5VC 3DLEB 4DFJA 3LP0A 2YJFA 4LH4A 2HBMA 4DB3A 4K4SA 1GMVA 4M5NA 3D6MB 2C2EA 1C2PA 5J1EA 2HK3A 2EG2A 2FB0A 1BC6A 4Q2MA 2OPRA 2VQFK 3FZMA 4ZVQB 3MR5A 1JLCA 1JB0C 3LDNA 1G7CB 3V9ZA 2V7ZA 3KK1A 4J90A 3G4SS 4W4MA 1FFGB 2MKIA 2HGNA 3T1AA 1S4EA 1N36K 3TX8A 4JKAA 4CD1A 2QA4S 2H4WB 2V63A 2V51B 1NGGA 3H42A 1B64A 3EZ5A 1VBXA 1YBUA 3BKFA 4JD2B 1RQ0A 3I0SB 3H46O 4DR4J 2D3O1 4BVPA 3IUCA 1VSMA 3HI0A 3EY1A 2OELA 4JI7F 5FDLB 4F0KA 4BRMA 5L9XA 3JQMA 4I56A 3CJ5A 1YJTA 2P5VA 5ETOA 4HUEA 1KVKA 1NHVA 3ZZRA 1PO6A 4EWTA 3CCVN 5LOQA 4CZGA 2QO3A 1XHZA 4DUYK 3KNGA 2IJRA 3T6BA 1DTTA 2MPUA 2IOCA 3FCVA 1NGCA 3KJNB 2ZH7A 3UN5A 2FZCB 2NLWA 4LFBK 1ASWA 4YOVA 4RW9B 4X62J 2ZKTA 1JLEB 2HHPA 5F8GA 2DRDA 1JLBB 1B7YB 4FJNA 2BANA 3A12A 4FBTA 1N56A 1NK8A 3I5BA 4K5SA 3ISZA 2DIVA 3AY9A 4DUZJ 4I68A 3ZNJ1 5THWA 4LSNA 2KW4A 4BDZA 1N5QA 4P2MA 5KFXA 3G6ES 4FLUA 1Z1ZA 3QT7A 1YWXA 5CYMB 3AGRA 1JIHA 1HR0K 3KLGB 4Z2XA 2V8HA 3V6DA 2I6WA 4Z4FA 2MLZA 1TUVA 4F26A 3HFKA 5J2NA 3AH6A 3WEEB 3KFWX 4AM7A 4ZVOB 2Z1GA 1UJ5A 4FN5A 3OS1A 2W7OA 1UFWA 4ISEA 2HLUA 1VC0A 2VG6A 4NXMJ 1NNDA 4CEAA 3KVGA 2Q0UA 3M05A 2RQCA 3KLHA 4MO5A 3H4DA 2GMLA 3MD3A 1RWUA 4KBIA 1SL0A 1RZMA 4I64A 3T1HJ 4C8LA 3H45C 3VTIA 3CM6A 3OW2R 2ETJA 3BDEA 4DQPA 3PFOA 4CLUA 5KG0A 1ULRA 3VAFA 3OSPA 2E8AA 4M42A 1B3TA 3D3BJ 3DMJB 3MM9B 3ZC4A 2RMLA 4KI6A 1R6YA 3HCXA 2UVRA 2KT3A 1ZBIA 3OVAA 1MU2B 4C1NI 1YITS 3RR8A 2BM0A 4OI0A 3QJPA 3BDPA 2XNRA 4CO4A 2CQ1A 1QTMA 2ZITA 2FBTA 2CADA 2OI2A 4W5QA 2APOA 3AXKA 2ZE2B 4OX6A 1FXRA 1SXLA 4XIUA 3BN4A 1DGKN 2HRYA 3U1NA 4DKWA 3RU0A 3I0RB 1YK9A 3ENOA 5D0HA 4O8UA 3DDNA 1T3OA 5CYQB 1U2CA 5KG3A 1M5PC 3DU6A 2YHAA 3AQPA 2LEBA 2OAUA 1JXBA 2DNYA 2MKJA 1E6YB 4H4OB 1DLOB 3EYZA 4BR4A 1LK5A 3NKYA 5A0YA 3R6LB 4OYOA 2OCEA 4OYXA 4Y1DA 2F40A 1P1LA 1YVUA 4RNOA 4BRFA 3CDBA 5DG8A 4RX6A 2MKKA 3JAMO 2LQ5A 4OI2A 5EHHA 2DTUA 1RTHA 1LXNA 3MCMA 4BCAA 1B0TA 3C95A 5HRNA 1DT9A 2LSNA 3BGUA 3R5BA 4DV6K 4O3NA 1JMTA 3FNNA 1BISA 3HTVA 3D2FB 4ICLB 2GQCA 4KTWA 1ZBUA 4E7IA 1GNKA 1RT5A 5K5MA 2ZM6K 3M30B 2B6AA 3CVKA 2ZHBA 3Q2SC 5HMZA 3CJ3A 4V19S 3ZT0A 4WU2A 5LMNF 4IR9A 2ALYB 4KO0B 2PMZD 1IKXA 2XB2D 3QRPA 4EBDA 3VOVA 2P9KB 1YXQA 5ETRA 5ADZA 1XTZA 1JCGA 1H2VZ 1NJYA 2R7OA 3PYDA 4DN0A 1X4GA 2CDRB 1F2GA 2GNKA 1TFWA 1VK8A 2A5XA 2BMBA 1T03B 4QPTA 3K0SA 1RHKB 4FBUA 1VJQA 4KBOA 3TQ1A 1L3UA 1AXQA 3CJAA 1JCEA 2KI2A 2OP5A 1VQPS 4WYBA 1RE1B 4K4WA 2JLEA 4BR0A 3CJ0A 4DG1A 3VCDA 4BQLA 5LJ3Y 1S10A 3RZAA 3PIPQ 2YJEA 1VQOS 3BR9A 3AVBA 3DLJA 2X3DA 2ZWHA 1BWFO 2IMOA 4OKKA 5BPNA 3MMAA 5J2PB 3ZSZA 1AFJA 4LF8F 2M0GB 5HI7A 5C15A 5GAHU 1VRTA 4I7FB 1T05B 3FRYA 3SI8A 2EHGA 3NH0A 3PM9A 2HF3A 1J53A 2EXUA 3SAGA 1RI7A 2FHOB 2CQPA 3M6XA 5IS2A 2ZD1B 1RWPB 4AT1B 3C46A 1KXPA 3E1YA 4DTXA 2BACA 3IS9A 3PR4A 3A0IX 2FC0A 5KQ8A 3AVJA 4R5PA 2XMKA 3G2XA 5ITHA 1RT3A 4KGVB 4L3QA 4CJFA 3JXOA 4PPZA 1NMEB 4F04B 2VFRA 2M2BA 5IQ6A 5C24B 1HNIA 4Z0UA 2OH2A 4CJTA 4ZIWA 4LRDA 3PO5A 2YKNB 2O8EB 3U02A 3EX7B 3MM8B 5BJRA 1HPMA 3K59A 1TL3A 3A1YG 2C3MA 2P9CA 3RMAA 4JHDA 2LEAA 3A13A 3KLEB 2QC3A 2AYBA 3SFUA 4KV8A 3FE1A 2WOMB 1KVBA 3AB4B 1JCFA 1TELA 2LCWA 4Y0FA 3S8SA 5GAEI 3ZX0A 2OZMA 4KB0A 1KTQA 1X4EA 2LXFA 2V5HG 3J7AP 2BH1A 4CE9A 2C2KB 1CXUA 3BYRA 3PIPL 5JUMA 1NGIA 1RGVA 4UOFA 2DXEA 4HH1A 2UUCJ 5K9FA 3B6BA 4NLGA 4UF4A 2K06A 4QIWD 4WK1A 4IO8A 3EGZA 2WSEC 1QUVA 2WVBA 4IRKA 3O3HA 3VQEA 4GKJK 1P9YA 4JKGB 2C2RA 4DV7K 2P5OA 4CHZA 1N52B 2BJ1A 1UPPA 2IIRA 4KAIA 2QW9A 4NCGB 4JV5K 2BQRA 3FGVA 4ZVHA 1MROB 4CK3A 5KGXA 4DX7A 3CJRA 1K8KA 4DPXA 2QWRA 1BHLA 4K2XA 2DJWA 4OHZA 2EFOA 4R8UA 3FZKA 4HHHA 1ZA1B 2GGPB 3DI6A 3Q7BA 3PW7A 1S5ZA 2X51A 3BM7A 2OPQA 1S76D 4J9SA 4LUBA 4CZHA 3QEIA 1R0AA 3CJBA 1QS4A 3VVTA 1FT8A 4GV6A 7FD1A 1JJ2M 4UTGA 1NGDA 4FWSA 4M41A 2WVFA 4JS5A 1NJWA 2FJBB 1SZ2A 1KN6A 1I3OB 2LU2A 4ZVGA 3CJKA 3FZBA 3KOAA 2J8SA 4FNIA 5KFLA 3UKRB 5HO4A 1NDPA 5KT6A 1OVYA 3AVGA 4KB7A 4OI3A 1OY6A 4C9DA 4UOGA 4NYOA 4X4NA 1X3NA 2Y3YA 3SQOP 3C66A 4M5JA 5AFUH 3OYEA 1HI0P 4IKAA 2OMLA 2IMWP 1C1BA 1RLDA 4PCQA 3VHQA 4RNHA 1WACA 4NYZA 5JICA 5D3GB 2FBYA 3MMJA 2NS1B 1IBKF 2OO4A 3QYYA 3OL9A 4JEPA 2EW9A 4KHMA 2E1AA 2YH1A 3LGMA 2PD1A 2W2QP 2Y8WA 1DFDA 3ZSOA 3EUNA 1TAQA 1BWVA 4DL2A 1B9DA 4WKYA 4NI2B 4RU2A 3ZZ0A 1TK0A 3A2FA 2JHEA 2JEIA 3LP2A 4PKIA 2CPDA 4JV1A 4B3MF 3QERA 2Q6BA 4KAZA 3GMGA 5DG7A 3PRDA 5K8OA 3P4IA 2W2PP 4GKKF 4DV5K 1S6PB 3H2LA 1J27A 1LWFA 2Q6CA 2OFHX 1H72C 4FXDA 2IFXA 4NASA 3TAPA 2CQ0A 2NYHA 3I4HX 3MPWA 1Q1KA 5GAGI 4URQU 2V8VA 2OFGX 4DQ8A 1WTBA 4DTRA 1A5XA 2MQPA 5RUBA 1GLFO 2LLZA 1DJ0A 2HS0A 5C42A 1NK7A 2P9IA 1R8CA 2XI2A 3FKBA 3PY8A 2IBOA 3RRGA 4ZCKA 3GV5B 2RVJA 4DHYA 3TJAA 4RUCA 2H9ZA 1VSJA 2MZRA 2PI4A 3PX4A 1YF5L 2DGXA 3J81Y 2QIFA 4JI2K 1S6UA 2MQLA 4OZ0A 3VQAA 3O3FA 4CJPA 2N4DA 5AT1B 2YHBA 2CVEA 5GIOA 5IC6B 5HVGA 4W92B 1RDWX 1EJ7L 4M7YA 4CK2A 2A2CA 4DCJB 3WX4A 2BM1A 1ZAVA 2LXIA 3SV4A 5TKWA 3L9ZA 2C3YA 3GJSB 2R7VA 4YY3F 3TAQA 2VFTA 1VQ7N 1WF1A 3WT0A 3WNFA 5AE3A 1YHQS 5CYJA 4BY9C 2POKA 3Q86A 3NGTA 1N33J 4Y2CA 3U27A 4CF0A 4ZLNA 4CZIA 1SJFA 1WEYA 2AW0A 3A8JA 2GIRA 4FJ8A 5B0BA 3EDQB 2LQ9A 1RKIA 2GX8A 2XCPA 1LWEB 4BWJA 1RTIB