2OPQA

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
534
structure length
515
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 146
structure length 515
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2opqA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opqA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opqA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opqA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2opqA05
4TQRA 1XR5A 3S3OA 5KT4A 3CDEA 4EO6A 3SV4A 1GOAA 2D0CA 4JV0A 2A1RA 5DG7A 3RWUA 2E6MA 5DQGA 4CGJA 1MU2B 3OSNA 3H2LA 5JS1A 4H54A 3BJYA 4RZRA 4F4ZA 3LZIA 3K57A 4NCAA 3M8QA 1L3SA 1JL2A 1WNSA 4Q45A 4DU4A 3HL8A 1LW0A 3AVHA 4AHTA 4O4RA 5HLFB 3NH2A 4OLAA 1WSEA 4DTNA 1RT7B 3MR3A 2W9AA 4FJIA 5HBMA 1TL3B 2YNGB 5EUHA 4H4OB 1LW2B 3KIOA 1RT7A 5CYMA 2OA8A 4DTRA 4J2AA 1J53A 4ZMMA 2IMWP 4U6PA 4YQWA 1S1XB 1CLQA 3I0SA 2FVSA 1GX6A 3RMCA 3G0ZA 2JGUA 2FVCA 3RMDA 4KI6A 1SH2A 4CHNA 1RTHA 2VG6B 2AGPA 4RW6A 4DFJA 2O4IA 4K4YA 5C25B 5KFGA 1N5YB 3AVMA 3NE6A 4EZ6A 4KSEB 1K1SA 3ZSWA 1HYSA 5HP1B 4DU1A 4OPJA 1BGXT 4KHSA 4NYZA 3CFRA 1N6QA 2XGQA 3OYCA 1RNHA 5SWMA 1RT1B 3NAIA 3ZSZA 5DLFA 3PUFA 3PW4A 4KAZA 4O5BA 4Z4IA 3QLHA 4R5PA 1C1BA 1TK5A 4DLEA 3SFGA 4KV8B 3DRRB 4DL2A 3CQ8A 1BCMA 1S0NA 3E01B 1C1BB 3BQ0A 1ASWA 3HVRA 3DLEB 1BIUA 3CDWA 1S9EA 3BQ2A 4Q0BB 4FW2A 4E1MA 4TN2A 4F4YA 1KLMB 3DLEA 3RB6A 4OKJA 3KOAA 4IQXA 4RU9A 4K4VA 3NF8A 3KHLA 1VSFA 1RDAA 2ZD1A 1DTQB 4CHPA 3SJJA 4XO0A 5F9LA 4WXWA 3SI8A 2UVVA 2Z1GA 4HUGA 3V9SA 3CFOA 4DTMA 4JRQA 2WONB 3LPUA 4QOZB 1C0UA 1GOBA 3U3YA 4H4MA 3PZPA 3DRSA 3D28A 2XY7A 2RF2B 4Q8FA 4OLBA 1VK0A 3GQCA 1B9DA 3IS9A 3DLKA 4CJPA 2WCXA 1NK0A 4WFXA 4IRKA 4OKEA 4OPKA 4E1NA 1EETA 2G8FA 1MU2A 5KG7A 2I5JB 3ICLA 4WZMA 4BDYA 3PW2A 1SH0A 3SQ1A 4W5OA 2VWKA 1UA0A 1LW0B 4NZ0A 4MIBA 1EX4A 3T5KA 2OZSA 4CIGA 3N6NA 1SKSA 4IH5A 3HPGA 4FLZA 4DQPA 4TYBA 5KFZA 3KHRA 1ASVA 1TKDA 2UVUA 4EP4A 4FJ5A 1TL3A 4B9NA 3OYDA 5F8MA 2HHWA 1C1CB 3D5MA 1IKYB 5J1EB 2BANA 3NAEA 3RRGA 3K5LA 4EO8A 4J9KA 2Z1JA 4F2RA 1WAFA 3TAEA 4CIFA 4X2BA 4I2PA 1VSHA 4KB0A 4DSEA 3NGYA 3OL8A 4DTXA 5EWGA 3TARA 2OH2A 1JIHA 2YHBA 3V1QA 1SKWA 3A2FA 3EZ5A 4URQU 3LP0B 1IKWA 3KJVB 3NBPB 3AVLA 1U09A 3MXIA 2D7SA 3N6MA 1CSJA 2WRMA 3SQ0A 4BACA 3EPGA 4RUAA 3MEEA 1UWBB 4NCGB 1YVFA 3KLHB 3SI6A 3NBPA 3CJ5A 4YFUA 4CHQA 4FJ8A 4DU3A 3QLHB 3LDSA 2D3UA 1QHTA 4JS5A 4MK9A 3HP9A 5FRMA 4BDZA 3H5XA 3IGNA 5L1LA 4I2QB 3CM6A 4IRCA 3V6JA 3O3FA 4FS2A 4DL3A 2FC0A 3QEIA 5JS2A 4DSKA 1A5WA 4RNMA 1ITGA 3KD1E 1C1AA 3OYFA 1SV5B 1RT5B 2V0NA 4NLXA 2XCPA 4DL4A 3AO1A 5CZ2A 1HNIA 1JLFB 2ZE2A 3NF7A 2HHVA 4KKOB 3OYEA 1D8YA 5KFVA 1S1VB 3QIPB 1NJWA 3P5JA 4MQ3A 4B9SA 3DM2A 3FRZA 3V9WA 3V9ZA 3KNAA 3VN5A 4ZP6A 5C24A 3O3HA 3AVNA 4CFCA 1IH7A 2KFZA 4C8LA 4J2EA 3V1RA 4M3TA 3I0RB 4RG8A 5HROA 3VQ5A 4ZPAA 5HRSA 2J6TA 3THVA 3RB4A 3GILA 1KSPA 3AVBA 2R2UA 4NLDA 2O5DA 4FJHA 5CY4A 1SKRA 5C5JA 3HVTA 1TVRA 1S9GA 1LWCA 1NK5A 5F8NA 1YVUA 2XWYA 1ZBLA 4O3SA 1KFSA 4ED1A 3ZT4A 5F8JA 4B3OB 5KFXA 1JX4A 4FBTA 2IJFA 3TAPA 4KO0A 1U45A 1W9HA 1BQMA 1WLJA 1HYZA 5HRPA 1RILA 5C42B 4LQ3A 5KG5A 1BI4B 4H4OA 4J9PA 2IBKA 4PQUA 3TI0A 4CEZA 2XRIA 5KFAA 2VA3A 3OL9A 1JXEA 4N56A 1X1PA 1NKCA 4F8RA 3TAMA 4IFYA 2R8GA 3CO9A 1U49A 3OYAA 2DFEA 5FDLA 4ECWA 3V4IB 2YNFB 1QQCA 4WYWA 3UPFA 3E51A 3PW5A 4ZP8A 2W42A 4DF4A 4FJ9A 4FM0A 3BSAA 3NDKA 1RT3A 4IFYB 2YKMA 1BHLA 1L3UA 3DMJB 1ZBFA 3LP0A 3KJVA 3OYJA 3TANA 1N5YA 4HUEA 4NLOA 2XY8A 5EU7A 5T14A 3L2WA 3O3GA 4FLUA 3L3UA 4ICLB 1HQEA 3KK1B 4FM2A 2G8UA 2ILYA 1C6VA 4M3XA 5SZTA 3M8PB 2XY6A 1N4LA 4O3QA 5KTQA 2AX1A 1JXBA 1NOZA 4CE9A 4FJMA 4J9OA 2OPQA 1RCHA 4E7JA 2RDIA 2AX0A 3L2VA 4B08A 4KB7A 4ECTA 1IKWB 4XPCA 1EP4B 4I7FA 3K5NA 3KLEB 3N6LA 3NHGA 3VQ4A 3L2RA 3PR4A 3QZ8A 3KHHA 3OVNA 2QKBA 3LP3A 2W8LA 1IM4A 4FLXA 4QWCA 4M42A 1VRTA 2VG5B 2JC0A 5KT3A 2DPIA 4F4WA 1S9EB 3NH0A 1RBTA 4NLQA 3I5BA 1N48A 4DWIA 3AO5A 5CYQB 1TK0A 3V6DA 2E6LA 4CJRA 4KHYA 3TVKA 4OKKA 3QESA 4LY7A 3CJ0A 3UIQA 3IG1A 3LAKA 4CFAA 1HMVB 5KFRA 2E9ZA 1TV6A 3CFPA 1DTQA 3H59A 4R8UA 1IO2A 3BSNA 3CM5A 2GUIA 1BQNA 3L2QA 4F4XA 4CF9A 2FJXA 2GIRA 3NMAA 4FJNA 2R8IA 1B9FA 4Q44A 4IKFA 5D3GB 4G1QA 1BQNB 3BSOA 2HWHA 4RW4A 3H98A 3PJXA 1JLCB 5DG8A 1WNEA 1EETB 1BQMB 4IR9A 4KRFA 3SYZA 2GV9A 4KTWA 1I3AA 1T05A 2UVRA 3HKWA 4B8AB 3I0SB 2KZMA 5KFDA 3VQ9A 3F9KA 4CJFA 4RW8B 5KFMA 5KGXA 4AHRA 3ZCMA 4OL8A 2EHGA 5KFNA 5CYMB 3C6TB 3HHKA 5EWEA 2HNYB 2IJNA 1XWLA 3K5MA 4DL7A 2ASLA 1IG9A 4ELUA 3VQAA 4B9LA 3C95A 2F96A 3OSPA 3OHAA 1TP7A 4WXOA 2Y1IA 1Q9YA 4ECVA 5L1IA 1VSJA 4IFVB 4ZVEA 3RMAA 3IRXB 1NK6A 4J9RA 4HUFA 4ED6A 4DSJA 3TAMB 2IM3A 5DGBA 4CJ3A 1SH3A 4URSA 4IDKA 3I5CA 4JLHA 3QEPA 4MK8A 2FVPA 1O1WA 4K4ZA 3H40A 1KCFA 1C0MA 3CJ3A 5KFOA 2C2DA 1RTIB 4PUOB 1W25A 3AA3A 2P5OA 4FK2A 2V9WA 2W9BA 1JLQA 4CJKA 2OPPA 3QETA 1QAIA 4R5PB 1TK8A 3QEXA 4RW7B 1S1TB 3BREA 4JUZA 4HVJA 5KT5A 4NLYA 4FJ7A 3KMQA 2W8KA 4BWMA 1IKXB 4CJTA 4O0IA 2W7PA 1LWFA 2XY5A 1VSMA 3WNGA 2OPQB 3F73A 2R7YA 3ULDA 1HNVA 4OVLA 2VWJA 4FJLA 2HVHA 1KHVA 3HVWA 1C0UB 1VRTB 2VG5A 2XI3A 1J5OA 4BE0A 2ATQA 3PV8A 1I39A 2HB5A 4Z0UA 5KI6A 4JV1A 1C0TB 3HPOA 2FBYA 4TXSA 2HWIA 4Y1CA 3KHGA 4CGGA 4F3OA 4ZVHA 3ZT3A 1BISA 5HRNA 4TQSA 1VSLA 4GMJB 5KFJA 3SNNA 4QWAA 5KGWA 4KBIA 2A1SA 3AVIA 1D9DA 4M41A 2AJQA 4DQQA 3PX6A 4M3UA 1W0HA 4DSFA 4K8ZA 4N5SA 3M9MB 1SUQA 4ECQA 4PA1A 3OS2A 4F3TA 4MK7A 2YNHA 1RDRA 4WE1A 3NCIA 3RBDA 3KLVA 4DTPA 1RDDA 3ZSXA 4KAIA 2UUWA 4FK4A 4CGHA 1F21A 3DOLB 2QV6A 3RMBA 3QO9B 4LH4A 1KRPA 3ZSQA 2P5GA 3BQ1A 4DFKA 5HLFA 2I5JA 4B9VA 5J2QB 3MFIA 4CCHA 4FXDA 2R2RA 2J6SA 4CERA 4RW4B 4FM1A 4DQIA 1K1QA 2AWZA 1WN7A 3SZ2A 3PHEA 3LWLA 4IBNA 3GV5B 3KLIB 1WSIA 1KLNA 4NLTA 3SFUA 4MKAA 5C42A 5KFKA 4CJLA 3M9OB 2FJVA 1K6YA 1U04A 1LW2A 2RKIA 1TKZB 2X74A 3AVKA 3DLGA 4RW8A 3IRXA 3G10A 4EYIB 3KLIA 2IA6A 2IM2A 2F8TA 1OS5A 4DQRA 2HNZA 1RBSA 5J1EA 1J54A 2GC8A 4IDKB 2OPRB 1N56A 3KKRA 1QSYA 3SPYA 3PJWA 3HO1A 2D0AA 4CEOA 3RRHA 2ZQBA 1UWBA 4NCGA 1QE1B 3K58A 1L3TA 3VQEA 3V9XA 3ALYA 3CJ2A 4FLTA 4NLGA 2G8IA 3TWHA 2HNDB 2BR0A 2FBXA 4ZTFA 2DFHA 3FFIA 3QGHA 2J6UA 5F8HA 4W5QA 3KLGB 3QGGA 4QW8A 1KFDA 3H4DA 1JKHB 1JXLA 4MIAA 5FROA 3OYGA 1WSFA 3NGIA 3FFIB 1CZ9A 1NKBA 4FK0A 1FK9A 3AVJA 2GIQA 4BE2A 2HHXA 4KKOA 3PX4A 3S3NA 5HP1A 1NK8A 1KHWA 4J9MA 4QAGA 1Y97A 5FRNA 1T8EA 4I2QA 4FJKA 2D41A 3CDUA 5KG6A 3DM2B 3RAQA 2C22A 1T3NA 1L5UA 4FYDA 4HCBA 2WHOA 4O0JA 4DS4A 4AHVA 3VQ7A 4ED8A 4KB1A 4Y34A 3H5YA 4CF0A 3MEGB 1HNVB 1S0MA 1QSSA 3DRRA 1HMVA 2ILZA 1RT2A 3NFAA 3OYBA 4RNFA 4FJGA 4K4TA 4CHYA 2V4QA 4EBDA 1KTQA 4N41A 3QIPA 1U47A 3MEGA 3IN5A 1C0TA 4N47A 2XI2A 5C24B 4Y1DA 3KMSA 1YTUA 4EBEA 3I0RA 3KTQA 4FZYA 3KKSA 2W7OA 3VQBA 4G1QB 4CGFA 1NOYA 1HQUA 3MECA 3C94A 4DL5A 5KFTA 3SUOA 1LWCB 2Z1HA 2G8HA 4QWDA 3QGIA 5KFLA 3AA4A 3QNNA 1HYVA 5J2NB 2D0BA 4B9UA 2YKNB 3VQ8A 2HW3A 3MEDA 5CZ1A 3Q8RB 3DOLA 1TKZA 3MR5A 2IC3B 4C8KA 1A5XA 1JLAB 5KRTA 1NJXA 4J9SA 1BI4A 4WZQA 4URGA 4DS5A 3T5LA 2YV0X 2D3ZA 1Q9XA 3ZSRA 3PR5B 2BRLA 2WK4A 4KI4A 3AA2A 1ZYQA 1NJYA 1JLAA 4CFDA 3V4IA 3L2UA 3OS1A 3P1GA 5E41A 3VQDA 3HT3A 4EP5A 3VQQA 3V6KA 2FLPA 4CJVA 3KK3B 4KREA 4HYKA 2R2SA 1S5JA 2XGPA 4AHUA 3UQSA 1RDBA 1CXQA 1HQEB 2RPIA 4C8OA 2WB4A 4DSIA 4KFBB 4M3YA 3NGZA 4NLPA 4RNOA 3BR9A 2KZZA 3M8PA 4DFPA 1I6JA 2HAIA 2W9BB 1DTTB 2BE2B 5EWFA 1ZTWA 4E7HA 4CF1A 4FS1A 2DY4A 4I2PB 1XR7A 3KLEA 1G15A 1JLEA 1RTJB 4YMEA 4NLUA 4MH8A 4TY9A 3G6YA 4LSNA 2FJWA 4ECSA 3KLGA 2R8KA 1RTDB 2IAJB 3SUQA 1S97A 2JC1A 3UDLA 1X9SA 4R0EA 4WYLA 4PY5A 4DTJA 1LAWA 1RTJA 5DG9A 3KK2A 4XPEA 2IOCA 2D5RA 4ELVA 2GBZA 4IR1A 3TAFA 3OYIA 4BDPA 1TQLA 4KPYA 2NUBA 4IRDA 1TKXB 2ETJA 4LD0A 4MKBA 4TSXA 1S1UB 4AILC 4ID5A 3RTVA 4AHSA 1JLFA 4NYFA 3HYFA 2JLEA 3C6UA 3SV3A 4RW9A 4CJSA 3B6PA 5EDWA 1S1VA 3SUNA 1IKVA 4F4KA 3ZT2A 4KE5A 2AGOA 1TKXA 4B9TA 2IM1A 1T05B 4RNNA 1HQUB 3DI6B 3MECB 2HMIA 2UUTA 3PVXA 3MAQA 2YNIA 5KFPA 4FBUA 5HRRA 5KFCA 3RB3A 1VSEA 1SL0A 2XO7A 1EXQA 4CEBA 1SUQB 2LSNA 2KQ2A 1ZETA 4NLWA 3EYZA 4CEEA 1DLOB 2B43A 3V81A 4RUCA 3AO2A 4CF8A 4EYHB 4GC7A 4ZPCA 2OPSA 4LH5A 3QZ7A 1WSHA 4YR2A 3SQ2A 2YHAA 3H5UA 1HARA 1D1UA 4Y2AA 2E4LA 4W5TA 4Z4GA 4IFVA 1RAJA 4K4SA 4CJQA 2CJQA 3QEWA 1S1XA 1RT6B 3RBEA 3HSTB 3T1AA 3VQCA 3G6VA 4J9QA 1GOCA 1SL1A 3VA3A 1TKTA 2RKIB 3KLFB 3JSMB 4Y3CA 2YNGA 3DLGB 1S6QA 1RT6A 4L8RB 3CG7A 4KHMA 3ZSVA 1U4BA 3DYAB 1VRUB 1ASUA 4CHZA 3KK3A 5KT2A 3QERA 1Z25A 1X9MA 2AQ4A 4FLVA 2C2EA 4RW7A 1T94A 3ZSOA 1RT3B 4PWDA 4K4WA 4HKQA 1VRUA 3ZT1A 4K4XA 4FJXA 3OYLA 4PQUB 2BE2A 5KG2A 1RYRA 3QNOA 2C2RA 3NAHA 5I3UB 2HNDA 4QWBA 4IG0B 3U3GA 4O3NA 4W5NA 1NHUA 5KFWA 3OYMA 3H4BA 4IH7A 1MMLA 4KFBA 4CECA 3NF9A 3HJFA 2FVQA 2VG7A 4J9LA 2YKMB 1QAJA 4CEAA 1EP4A 4I7FB 3PO4A 2QE5A 1LWFB 3GIJA 3OYHA 4K50A 1KLMA 3LP1B 1RT4A 3VQ6A 4ZPBA 4ZTJA 3V6DB 1S0OA 4ECUA 2JEJA 2E9RX 2W9CA 3AVFA 1S1WA 3QINA 2B6AB 3LP1A 3HVAA 1BL3A 2O4GA 4M45A 2FLLA 1IKVB 3GV7B 4Z4CA 3MR6A 4CK3A 3MR2A 2OYQA 3DI6A 2HMIB 3EZUA 1TV6B 3G6XA 3CIZA 3P83D 4NRUA 2YNIB 3AVCA 3QO9A 3D0PA 1TL1B 2KFNA 4HTUA 5J2QA 1S4FA 5KFHA 1S1UA 4ED0A 4WFYA 2B5JA 3K2PA 1ZBIA 3RR8A 1TAUA 1DLOA 3HXMA 3V81B 3PW0A 2YNHB 4U7CA 5DGAA 5D3GA 3T5HA 4AHCA 3AVAA 3ITHA 4O4GB 3UR0A 3BGRA 2QKKA 3FQLA 3LZJA 4IG3A 1EKEA 2RN2A 1J9AA 3V9UA 5KFSA 1VSKA 4CIEA 5KFEA 1HRHA 1QTMA 2HNZB 4HCCA 3IS9B 3FDSA 2BQ3A 2OPRA 3LWMA 2OPSB 4E7KA 4CJUA 2ATLA 2IM0A 4J9NA 1RYSA 3LALA 4ECZA 3Q8PB 5JXSA 3DLRA 3C6TA 2WOMB 5F9NA 4GVMA 2HNYA 5HBMB 4W5RA 3EPIA 5F8LA 4F2SA 4DG1B 3NKYA 1TKTB 2AU0A 2BDPA 3LANA 3OLBA 3RR7A 3NF6A 3ZSYA 5DMRA 3FQKA 1VSIA 1GX5A 3DLHA 1QE1A 1JKHA 2HHSA 4F50A 2HHUA 1SL2A 1KVCA 4DG1A 3HPHA 3OY9A 4TY8A 5T7BA 4Z4HA 3PX0A 4E7IA 3OLAA 1XI1A 4M3RA 1S9FA 2KW4A 2IS3A 5KG0A 1RTIA 4PUOA 1L3VA 4M3WA 3OL6A 4IOBA 4KHRA 3VA0A 3LP2B 1S48A 4TY8B 2V4RA 2R8HA 5L1KA 4ZP7A 1HYSB 5I3UA 4EBCA 1Q8IA 1REVA 3LAMA 4CF2A 2P51A 2P1JA 3NH1A 4CFBA 2HHTA 1FKPB 1B92A 2DFFA 1IKXA 1C2PA 3TABA 2EC0A 1RTDA 4CJ5A 4CGIA 3VQSA 4O3PA 4ZP9A 4ECRA 1NK4A 2VG7B 1REVB 3KLHA 1SV5A 4DLGA 1U48A 4FVMA 2B6AA 1RT5A 3AVGA 3IGVA 1FKPA 5KRSA 3DDKA 4LSLA 1S1TA 3E01A 3OL7A 3MXMA 4K8XA 1WAJA 1RBRA 4ED2A 3HP6A 3QEVA 3S3MA 5KT7A 3CJ4A 3MTKA 4Z4FA 3T5JA 4CJ4A 2B5JB 5DQHA 5KFQA 3MF5A 3NL0A 3ZT0A 1WSGA 4J2BA 2QXFA 2JEIA 4DQSA 3IAYA 2DPJA 3HK2A 4G3IA 2ZE2B 1RBVA 3O4NA 5KFFA 3BGRB 1J5OB 1FKOA 4JRPA 2G8VA 4Q0BA 3ASMA 2PZSA 3T19A 1KVAA 4ID1A 2WONA 4ZVGA 2HHQA 2PYJA 4KO0B 2QK9A 4ZHRA 5HROB 4BWJA 1QSLA 2XC9A 1JLBB 4QWEA 4E3SA 2VA2A 2JEGA 2ZD1B 3ISNC 3HVTB 1S9GB 2ASDA 4ZHRB 3CWJA 5J2MB 3PO5A 5DQIA 4B8CA 4WE1B 1FXXA 4E19A 3AO4A 3LPTA 3I8DA 5FDLB 4Q43A 4OGEA 3HM9A 2G8WA 5L1JA 4ZVFA 4CEFA 3G86A 1S6QB 2BGGA 3DRSB 1A5VA 3U6FA 3V6HA 2FBVA 4NYNA 2BQUA 3H08A 3DMJA 1Z4UA 4FLWA 4O3RA 2WOMA 2F8EX 3DLKB 4K4UA 2EX3A 4DL6A 4CEDA 4QCLA 3JYTA 1YTAA 1BCOA 3L3VA 3NGDA 4O3OA 2Y1JA 3OJSA 3M9NB 1JL1A 3SCXA 2ZKUA 3Q8QB 4JV2A 2BANB 2FLNA 1ZTTA 1T03A 3LP2A 1JLGA 1NK9A 3B6OA 1HJRA 4DEZA 3SUPA 1D9FA 1NK7A 3CYMA 1XHZA 1DTTA 4FZZA 2ALZA 3KK2B 4ICLA 3BSCA 4KHNA 1T03B 4YP3A 1VSDA 4DMNA 2DTUA 4XIUA 1JLEB 3BDPA 4CJWA 1C1CA 2R2TA 2PY5A 4LSNB 1IKYA 2KTQA 4ZPDA 4HHTA 4ID5B 1FK9B 2BRKA 4Z4EA 3KD5E 4N76A 2ASJA 4RW9B 3DOKA 1Z26A 3CVKA 2CKWA 1UA1A 4RNHA 3IG1B 1LAVA 3OYNA 3OS0A 5KG4A 4E89A 5KFBA 1RDCA 4NLRA 2W9CB 5F8GA 4I9LA 3OHBA 4IH6A 5CYQA 2BQRA 1D5AA 4J2DA 4EZ9A 1S10A 3DRPB 2F8SA 2FVRA 1NHVA 3GYNA 4E7LA 1NJZA 1HPZA 3GIMA 2C28A 4LSLB 3C6UB 4H8KA 4DTUA 1S6PB 4QW9A 3H5SA 3MEEB 3TQ1A 3S9HA 1TL1A 3M8RA 1BIZA 3ISND 1XR6A 4GC6A 4TYAA 2RDJA 3FSIA 3DRPA 3GV8B 5F8IA 5J2PB 4R8UB 5DLGA 2WTFA 2FBTA 1WSJA 4WFZA 4M3ZA 1S6PA 4CGDA 3WNEA 3QYYA 3GIKA 4BE1A 4FZXC 3D45A 4ECYA 4YR0A 1RT2B 1ZBUA 4M95A 2X6NA 1D0EA 4LQ9A 3KLFA 3V1OA 3OJUA 5J2PA 4FW1A 3JSMA 4DTSA 4TLRA 5K14B 2JEFA 3K59A 5J2MA 4ED7A 4Q8EA 4Y2CA 1HNIB 4KTZA 5JUMA 2R8JA 2YKNA 2Q3SA 1JLCA 2IC3A 3QIOA 5KFIA 1XC9A 3DLBA 1CZBA 3SQ4A 1JLBA 3M8QB 3L8BA 3AV9A 4MFBB 3MXJA 4O44B 5I42A 1R0AA 3RAXA 3TAQA 1NNDA 1UAXA 3JYTB 2ITGA 3O4QA 4B9MA 3DYAA 4IG0A 3AA5X 4DSLA 4KHWA 3T3FA 2X6SA 5J2NA 2AGQA 1X9WA 4DF8A 3TR8A 5KT6A 3K5OA 4MFBA 3MEDB 1RA6A 3VQPA 3M8SA 4O44A 5I42B 1R0AB 4ECXA 4CK2A 1TVRB 1RTHB 2VG6A 1JLGB 4RW6B 3WNHA 4UQGA 5KG1A 4PWDB 4C8NA 2HVIA 1TGOA 1JLQB 4B3OA 2YNFA 1YT3A 1TAQA 2OPPB 4KHQA 3GIIA 4M94A 2B4JA 4Q5VA 4CK1A 2E9TA 4NLVA 3QIDA 3AO3A 5KFYA 3SPZA 4JS4A 4DFMA 3PW7A 1N6QB 5L9XA 3PY8A 2OZMA 4FJJA 4I9QA 3RB0A 2IDOA 5KG3A 4KTQA 4YR3A 4NCBA 4AH9A 3KK1A 4GW6A 1CXUA 1S1WB 5C25A 1QUVA 3TAGA 3DOKB 4O55A 4KV8A 4C8MA 3MFHA 4ED3A 1UOCA 4CJEA 5KFUA 2UVWA 1RBUA 1RT4B 2XHBA 4DTOA 1RT1A 4FCYA 2G8KA 2I1RA 1HPZB 3I5AA 4ELTA 2Z1IA 4OGCA 4CHOA 3OYKA 4FLYA 1NKEA 1T7PA 4QPXA 1S49A 3ITHB 4O4GA 1QS4A 1XHXA 2IAJA 1LV5A 4CESA 3WNFA 1LWEB 4KHUA 4IG3B 4IKAA 2IGIA 4YNQA 2X78A 2XCAA 4CEQA 5DK5A 3Q8SB 4OJRA 4NLSA 4NRTA 2PYLA 1KVBA 1ZBHA 4EEYA 4H4MB 5K14A 1LWEA 3EY1A 1FKOB 4E0DA 2RF2A 1RA7A
chains in the Genus database with same CATH superfamily
1RI7A 1MNEA 2CJYB 2DNMA 5KT4A 1UJ4A 3LOUA 1Z1ZA 1GOAA 2A1RA 2XWXA 3PYDA 2BE7D 2E6MA 5DQGA 2E2OA 3AOAA 5AZJB 4H54A 4DR4F 3BJYA 3LZIA 3TEHB 4J8FA 3HSZA 3M8QA 4MDBA 4DR5K 1JL2A 4QPTA 2DXDA 2PA3A 1LW0A 3AVHA 4CZIA 4DV2K 1W7AA 2RSQA 3DNCA 4NXNK 1WORA 2XBPA 1WSEA 3VF4A 1RT7B 1OH7A 3O6QA 1F9HA 4JI5J 5HBMA 2L08A 2JFDA 4M5GA 4FWPA 5BRHA 5EUHA 4USJC 3D1HA 1LW2B 5TKWA 2IDLA 3WXIA 4DTRA 3W64A 1S1XB 4GMKA 3W9JA 1CLQA 3FRYA 3FEZA 1YWXA 1GX6A 4IUFA 3QT7A 2JGUA 1ICEB 2FVCA 1NGHA 5E3QA 2AGPA 2D69A 4K4YA 1MG7A 2OELA 3ZX3A 3NE6A 4EZ6A 5AE2A 4NOHA 3CIMA 2CWXA 4DU1A 4OPJA 3UNGC 3QB0A 2IPOB 4CLPA 3IKMA 3SIPB 3QJJA 5SWMA 3ZSZA 3PUFA 2AIRB 4JI6F 3CC4N 1RLDA 2E66A 2KO1A 3SFGA 3SSRA 4KV8B 3DRRB 1MWZA 3CQ8A 1HBOA 2GZOA 1CC7A 3GOIA 3SEOA 1DQAA 3ID8A 5H9FJ 1ZM9A 4K41A 3BQ2A 1YJ9S 2HIYA 2C2OB 3BZKA 4E1MA 2QG9B 3KVGA 1RDWX 1KLMB 2RQ4A 4OKJA 3PYGA 3KHLA 3HBTA 2UXCJ 1G4CA 1HUXA 2BW2A 1RDAA 2ZD1A 5HVHA 3PYFA 4B3SF 3G8SA 2YWKA 2VQEF 2FC8A 2K7JA 5F9LA 3CUNA 4LRFA 2EVZA 4HWIA 4HUGA 3R8EA 1Q5VA 3CFOA 2XO6A 3AD8C 4UY85 4HHUA 3Q8UA 1C0UA 3CDBA 1U0HA 3U3YA 4DU7A 2DR9A 3OQ2A 4P7VA 4YB1P 2XY7A 1VR6A 2CQGA 4Q8FA 4OLBA 1VK0A 1B9DA 5HL7Q 3H0PA 2EFQA 3IS9A 1YX2A 2WCXA 4IRKA 2RE1A 2DBBA 4E1NA 1WWHA 2EI5A 2PBDA 1MROA 4X62F 4HACA 4DUTA 2VC0A 2I7NA 2ALYB 1UA0A 3P96A 1SC4B 5DM6Q 1EX4A 1JCGA 1ZM2A 2OZSA 5BYRA 4CIGA 4BRKA 3J7A1 4DQPA 2K2PA 2O8DA 4TYBA 3H45C 1TKDA 2DNYA 4OI4A 1LXJA 3SBMA 2F9WA 2I8EA 2RMLA 4FWSA 1CQNA 3WXJA 2HHWA 4ZPWR 1IKYB 1K0TA 2YHYA 2VFVA 2MZTA 1NHKL 1H1VA 3K5LA 4EO8A 4ZK7M 4P75A 2YX1A 1X31C 4JI3J 1WAFA 3TAEA 4LF5J 3V4MA 3T1HF 4DR7F 4OHXA 1OH8A 1V4SA 2YWGA 3GZ7A 5EN1A 4USVA 1FVSA 2OH2A 4H5WA 2N4CA 2VD3A 2NR0A 3A2FA 4URQU 3NBPB 1XBWA 3TZYA 2KU7A 1CSJA 2O66A 2G0CA 4MO5A 4QU7A 4RUAA 1RWKB 3SI6A 3CJ5A 1YJTA 4CHQA 4FJ8A 3QAUA 4DU3A 4EFHA 3QLHB 3DU5A 3LDSA 2G2YA 4U7UD 4FWLA 4AXIA 5FRMA 5E7OB 4AYBD 5M1QA 1BDGA 3CM6A 2LQBA 1HBOB 5D0EA 1QVFR 4I6MA 2FC0A 2JL9A 4CO4A 2BKOA 2UUBF 1C1AA 3UI3A 1RT5B 1PC5A 4F26A 4NLXA 5BR8F 2YQ1A 1HI1A 2P6TA 1FRXA 3VGTA 3ZTOA 4FYXB 1D8YA 5KFVA 2M52A 3P5JA 4B9SA 4ZPTR 1SI9A 3DM2A 3V9WA 4OYPA 4CW7B 3RUBL 2IRUA 3O3HA 1Q16B 2XZDB 4J2EA 4M3TA 3I0RB 5HROA 1JJ4A 1GTEA 1NGAA 1FFWB 1WD6A 4PAAA 4IO9L 2J6TA 1YLXA 3GILA 4FJHA 3WIUA 5C5JA 1TVRA 1S9GA 1LWCA 4TU9A 1ZBLA 3D0GE 4EUVA 4RKUC 3MUVP 3ZT4A 3SCJE 3M6UA 2MKIA 4KO0A 1ZC6A 1W9HA 5B8HA 3HOTA 5C42B 2A6AA 2CGJA 1P90A 1BI4B 4H4OA 4X4PA 5ETPA 4J9PA 4PQUA 1UZDA 1HKCA 5BRDA 3JQKA 4C0OC 3OL9A 1NKCA 1X1PA 3TAMA 2R8GA 1U49A 3ZZ0A 4ECWA 2RILA 4WWSA 3UPFA 3MEKA 3E51A 3K8VA 3PW5A 2YKPA 3VEWA 4FM0A 4USIA 1VQKS 4TNOA 3KJQB 1L3UA 1BHLA 1ZBFA 3TUIC 3KJVA 3OYJA 2JHEA 2JOQA 5EU7A 4DV2J 2F7VA 3L2WA 1HQEA 2NRHA 5A8RA 2R7XA 1YI2S 4M3XA 1RWWB 5CABA 3C2PA 1B0VA 3MUMP 1OJ4A 1Q78A 3NNAA 4J9OA 2NXEA 4BROA 3VVTA 2N4DA 1KVKA 3FZBA 1LOUA 2ABYA 4ECTA 1IKWB 2Z57B 5LSOA 3T1YF 3PR4A 4X65K 3QZ8A 2QKBA 2HBMA 3LP3A 1PIEA 1CJKB 3Q24A 2CZ9A 2KRRA 1WC1A 1VRTA 2J4RA 1EHWA 3A12A 2PIIA 2P9GA 2F4VF 1S9EB 3MCMA 3I5BA 4UOGA 4FYWB 5CYQB 3NP5A 1TK0A 2GEMA 3V6DA 4FPBA 1SIZA 4CJRA 1CJKA 2VC1A 2NXCA 1TZ0A 4H0PA 3TZZA 1VQMN 5HVGA 2IRYA 5LJ5Y 1LFWA 1Y9OA 2UUBK 4JKGB 2E9ZA 4PPDA 3VEYA 1C4AA 3NG8A 2W2OP 3WUHA 1BQNA 2P6SA 4CF9A 2RRNA 4LF8K 4CLTA 3JAMY 2R8IA 4Q44A 5D3GB 4G1QA 4C1NK 1BQNB 4C0HA 1U1PA 4OZ3A 4DZDA 4EFAC 1WNEA 1F9EB 1BQMB 4IR9A 3G82A 5E0OA 4CDIA 2DO0A 3EMTA 4ZA1A 3NEKA 2UVRA 3L7UA 4X65F 3HHEA 4OV1A 3CJKB 3I0SB 3CNQP 4LF4J 2KZMA 3VQ9A 5BREA 4RW8B 3F9MA 4H03B 4JI4J 3ZCMA 4OL8A 4RJVA 4L73A 3C6TB 5EWEA 2LFVA 2H1YA 1IG9A 3VQAA 3C95A 5JMNA 1B4SA 2DGOA 4WXOA 1Q9YA 2QTDA 4IFVB 4ZVEA 3IRXB 3D6MB 5HMWA 4J9RA 2P9PA 3TAMB 4RX6A 2VUGA 5M1OA 4CJ3A 3CD7A 4URSA 1FFGB 4IDKA 3OR1B 4JLHA 1T9UA 4K5RA 1YHQS 2CUYA 3DXMA 4ANDA 1KQKA 2MQMA 4FZVA 2P5OA 4P2SA 2B9XA 2M8DB 3OR1A 4R5PB 1TK8A 3L7OA 4OMFG 4RW7B 1S1TB 3BREA 4JUZA 2PMZD 4HVJA 2B3TB 2ZKTA 4HTJA 3KMQA 4PKHA 5GAGP 3M2UA 5IV3A 2BE9B 2KG1A 3LF0A 4A48A 1Z6RA 2XY5A 1VSMA 2ACYA 2CPEA 2IHR1 2XNRA 2ZOMA 3ULDA 4MKVA 4OVLA 3PM9A 3T6BA 3EJMA 1QM9A 1X4DA 2E8AA 3CJ7A 1VJQA 1KHVA 1UW4A 4ILLA 2J5AA 2V2ZA 3HVWA 3E1YA 1VRTB 2XI3A 1IQTA 2GVDB 3PV8A 2ATQA 2HS4A 4PABA 3T1YJ 1NCLA 3DLJA 3HPOA 2ADCA 4KHPJ 5I9EB 3T41A 2CGLA 2D74B 4B3RK 2V63A 2P5VA 2HBYB 1ATSA 3ENVA 3MMBB 2XLIA 2RIJA 5AQHA 1EWQA 4N8NA 5EX3A 3AVIA 4C98A 4DQQA 1NUEA 1HBNA 3UD4P 2CQPA 1X3NA 1SUQA 4CQ1A 3VV2B 3EZOA 3RBDA 4DTPA 2CAJA 3ZSXA 1S72S 2UUWA 4OX7A 3S8SA 1IWGA 3D2FB 3OFHA 3CF5L 2J6SA 4RR5A 5GAHI 4KH0B 1ZOTA 1X5TA 2CZ4A 2AWZA 1BO5O 1YZ7A 2HK3A 3LWLA 3VZIA 4NXMF 3KLIB 1KLNA 3SFUA 4CJLA 1CLFA 1IQZA 3M9OB 3LL3A 1K6YA 1KAXA 3JXOA 3TO8A 4DV5J 3AVKA 4RW8A 2APOA 5HSPA 4DR4K 2F8TA 2MQOA 1OS5A 2BJ7A 2BJ3A 4ISGA 3AOBA 3TQEA 5J1EA 2UUAK 2GC8A 5DDRC 2OPRB 1KAYA 3P45B 3DLLQ 1OYEA 2D0AA 2CQ3A 2ZQBA 4PRFA 4GV3A 3V9XA 2HGLA 5B0CA 4DV5F 1Q7YO 1SS6A 3QPIA 2DH9A 4OZLA 2OTJS 3GG0A 2O8BA 3TWHA 1VISA 1LK5A 2XNQA 5IOLA 3BV8A 3FFIA 2NXUA 5F8HA 1RHMB 3KLGB 4OYIA 1UZHA 1S76D 3MZIA 1KFDA 3H4DA 3MM5A 2UXCK 2AJ1A 2E1CA 3TTCA 1QAYA 4H4KC 3T1YK 2CZVC 1OH6A 3FFIB 1NXIA 1BE4A 2GIQA 3S3NA 4QAGA 2Z2LA 1Q5YA 5HI7A 3UN2A 3WX4A 5KG6A 4WFNQ 3RAQA 4Q2MA 1X4FA 4FYDA 3BF3A 1W2IA 2RH3A 4DPWA 4AHVA 3KG0A 3VESA 1V9OA 2EBGA 3TJ9A 4C1NI 2LQ9A 3R9LA 4AD6A 2P2CB 2Y0BB 4GKJF 3EE9A 2ILZA 1RT2A 3ET6A 3NFAA 2MZRA 4RNFA 3HCXA 4K4TA 4FJGA 3W2WB 4FWOA 3MGJA 5IZHA 5BPMA 3IN5A 3GSIA 3H2VE 4N47A 3ET6B 3IXQA 5AQUA 4ES2A 3I4HX 4EBEA 2K7KA 1FA0A 3MD1A 4KT0C 3R6MA 4Y0WA 1RK8A 3I6PA 1SIWB 3R27A 3KTQA 4FZYA 4QR1A 4O0NA 2BJ8A 2RUSA 1MA9B 1Q8KA 3DFEA 2CPHA 2ZHOA 1VQ7N 1XMOJ 2HBLA 1IJFB 3O9QA 2G8HA 1HNZK 1FE0A 3AA4A 4OQJA 3QNNA 5J2NB 4B9UA 2YKNB 3VQ8A 2ZH5A 3FCHA 2HW3A 2DTJA 5CZ1A 1Q81T 1MDUB 4RTFD 2ASPA 4CLWA 1U2RA 1NJXA 4J9SA 2GGPB 4YOVA 3ZSRA 2OSQA 1VBYA 2BRLA 1S22A 3SXLA 4KGMA 2D0PA 1NJYA 4X64F 4LRDA 4QS9A 3OS1A 2WBMA 3UR3C 3VQQA 4F0HA 2F5GA 5JJBA 5M2UA 2AP6A 4KREA 1S5JA 4FL9A 3CB4A 4DSIA 2LP4A 2WB4A 4KFBB 4M3YA 3HSDA 1CJUA 3HD1A 3NGZA 1HJOA 2YHWA 1WG1A 4DFPA 1UVKA 1F2GA 2QC3A 2W9BB 2ZGYA 2MZ1A 2HYIB 2AMCB 5K5MA 5EWFA 1ZTWA 4LR9A 2V7ZA 3SCKE 2ZH2A 1YITN 1XR7A 1A0OB 4YMEA 2L41A 2XMWA 3M1VB 3G6YA 4LSNA 3CC2N 3KLGA 4I56A 2R8KA 3MM5B 3DLLL 4JI1F 1UEVA 1S6UA 4PY5A 1HR0F 1N8RO 5AQQA 4WU2A 3CCWA 4XPEA 4DKWA 1RISA 4L72B 2GBZA 3TAFA 2YWFA 3OYIA 2WTUA 4ZS6A 2CADA 4BDPA 3HF5A 4KPYA 3VGSA 5K8MA 1TKXB 2E7WA 2FHJA 1S1UB 1HWIA 4ID5A 2ZVSA 3RTVA 1QY7A 2DB1A 2JLEA 1JXVA 4PR6A 3TJAA 1HA1A 2LDIA 1IKVA 1T05B 4RNNA 3MAQA 1CC8A 4D3GA 1YJVA 2D3O1 1SL0A 1A7GE 2PE8A 4DMZA 3OBIA 1QQMA 3D2WA 5A76A 2KQ2A 1N0VC 1ZETA 2DNZA 4DCOB 4CEEA 2B43A 3AO2A 1N8RT 4CF8A 2JVOA 1WSHA 1MSWD 2HLTA 5AQPA 1GLCG 3H5UA 3O9UA 1XN9A 2RRAA 4BRLA 1D1UA 3V5RA 4BC9A 4W5TA 1BOTO 4Z4GA 4LFCF 4IFVA 2XSFA 4HLBA 2CJQA 3VAKA 3HSTB 3OXLA 4LRAA 4DUYK 5DM7Q 1GOCA 1KTVA 4L3NA 2H51B 1TKTA 3KLFB 4Y3CA 1GH8A 3DLGB 1VCTA 3ZSVA 3DYAB 2LQ5A 5HQ8A 5LY3A 5KT2A 4XK8C 2GFFA 2E5IA 1FD8A 1PYSB 2GAGC 2PO4A 4QQBA 2C2EA 1YJWN 2HQIA 1ZZNA 1X4BA 1BY9A 2DR6A 1UETA 4YY3J 2E1YA 1D4XA 3ZT1A 1QVGM 3VENA 2IVMA 1KVJA 1VQ4N 3ULEB 3EM1A 4F9OA 2HNDA 4PG7A 5A8RB 5KPZA 1U1RA 5KFWA 3OYMA 1K44A 4IH7A 2UUCF 1M5SA 1UW9A 1WUUA 4KFBA 3ZEUB 2FVQA 3BO2A 2YKMB 3WC0A 2GO8A 1S6OA 5EX5A 4DR3K 5AZIA 3LDQA 3H90A 4BRGA 4K50A 1F5AA 2WSFC 5EVZA 1FE4A 4OZ2A 3VQ6A 2QMXA 3UDCA 3V6DB 2OSRA 3OFFA 4TU7A 3MCNA 2LEBA 2W9CA 3AVFA 2RD5C 4JI2F 2YPYA 1I94F 2FLLA 3MR2A 2OYQA 4QU6A 3DI6A 2W4CA 3ATUA 1TV6B 3C15B 4FSVA 2KXFA 4X66K 1TL1B 1UVIA 3SAHA 2IYIA 1GTHA 5KPRA 1S1UA 1NZAA 2RQMA 2AEJA 2B5JA 3N79A 3V81B 4ISEA 2GJFA 3K0JA 1I94J 1NPPA 2KT2A 5D0GA 4DV7F 5AJ3F 2UUAJ 4NA1A 2YNHB 4U7CA 5DGAA 3T5HA 3AVAA 3ITHA 2HBQB 3OVSA 3TUPA 2BVZA 5GAGI 2HS3A 2PA8D 3O3LA 5GAEU 1EKEA 5IWAJ 4KRWA 5KFSA 1VSKA 1FRIA 4CIEA 3TSUA 2HNZB 3CCQN 3IS9B 1VHFA 3LWMA 4QOTA 2OPSB 4CJUA 1D9AA 2ATLA 1SJRA 1KKHA 2IM0A 4J9NA 2P9LB 4OZ0A 3LALA 3GPAA 1Y4ZB 3FMBA 4KGXB 3KWMA 3QDKA 3O9SA 3C46A 4CYUA 4BR2A 4F2SA 2P9LA 3UFCX 4YDDB 1Y5NB 1S7HA 2K8GA 3EGZA 1TKTB 5LM7E 2BDPA 1NEEA 1FJCA 4X4TA 4XTTA 3RR7A 3R1HA 5DMRA 1S79A 3FQKA 3M3ZA 1GX5A 3DLHA 1IBMJ 1GAOA 5CZXA 2DNQA 5E26A 4DV2F 2BOPA 1KVCA 2BMBA 4TY8A 3PX0A 4Z4HA 3OLAA 3CQYA 2YTCA 2AJ4A 2IS3A 2XLKA 3HI9A 1U02A 4M3WA 1D3WA 4IOBA 3F5TA 4KHRA 2LXUA 1FT8A 3G6ES 2J7UA 1X4CA 4EBCA 1Q8IA 2FJBB 4DOZA 5D6GA 3OPKA 2HHTA 3H25A 1C2PA 2ASOA 3QWPA 4MYTA 4ZLNA 1XNRK 2NRVA 4CGIA 1WOSA 4O3PA 3THTA 3M32B 1Q82T 2VG7B 3KLHA 4DLGA 5FPDA 3AVGA 2IVPA 1KP6A 3LW5C 3DDKA 3NGUA 4WFBQ 3J7YP 3MXMA 1FTCA 5GINA 3HP6A 1OY9A 2OD6A 3G71N 4PG5A 3AQPA 3ZZTA 4JI0F 3CJ4A 4Z4FA 4IWVA 2AV5A 4CD1A 3SQGB 4J2BA 4B3TK 1KNZA 2HBZB 3BGLA 3IAYA 2QMUB 1FDAA 2YJFA 4F3MA 4G3IA 3BGRB 4K0KK 3TUZC 4AQYF 1R0CB 2G8VA 4Q0BA 3NLCA 4I6YA 4JD2A 2ROPA 4ZVGA 2HHQA 2HQCA 2Z2YB 4ZHRA 2NZ4A 4YHHK 2CQ0A 2YX4A 2YH1A 1JLBB 2P9IB 2ZD1B 1ZS6A 2LQ8A 2MQQA 5DQIA 2BYCA 4CTAA 4A61A 1WUAA 4H0OA 4LF5K 5FDLB 2B0GA 3HM9A 4PHTX 2OIHA 2F8HA 4DV6F 3I31A 1S6QB 3DRSB 4JI1J 3MCAB 1SBRA 1DARA 2NLWA 3EGVA 4NYNA 4JEPA 1KQFB 2MQNA 4FP9A 4A8YA 3MI7X 3FVYA 2GQ2A 2EX3A 3SBGA 3TSQA 4ILHA 4JI7J 3JYTA 1YTAA 4C9DA 5L8RC 4DR5J 2UYTA 1BCOA 3H20A 4BS2A 3M9NB 1JL1A 1NSPA 3M1VA 1U0SA 2K1RB 1NMDA 1ZTTA 1T03A 1C4CA 1HJRA 4DEZA 2G1DA 3SUPA 3L09A 1U2CA 1XHZA 2F9DA 1DTTA 3THYB 4DQ8A 2F63A 5ETRA 2HHHJ 3EXYA 1T03B 2AYEA 3ETMA 4YP3A 1VSDA 3FE1A 3IBWA 4JHDB 3BYPA 2MKJA 3CCTA 3RW7A 1IKYA 2QI2A 3I87A 1HIYA 2V8PA 3W2VA 6FDRA 3KD5E 3DOKA 2CJAA 3GFZA 4RNHA 2NLXA 1N5QA 3BPDA 3ETOA 3Q8YA 3Q7BA 4A8FA 3LM9A 5F8GA 3OHBA 4IH6A 5CYQA 2BQRA 4JV5J 1D5AA 4DR3J 2F8SA 4DN9A 4E7LA 1VMBA 3M2VA 1RAEB 1PJ5A 2E2NA 3FSXA 2EKYA 2DRAA 4FYVB 3TQ1A 3VAHA 3M8RA 5DM6L 4RL1A 3DJCA 1XR6A 5KQDA 5GAHP 4YHHJ 4WTYA 5F8IA 2QIFA 2A3JA 5BJRA 5DLGA 4CGDA 2Z58B 3QYYA 3GIKA 4F7VA 3D45A 1ZBUA 5HL7L 3N5FA 3FZ2A 1D0EA 1D09B 2H4YB 3VERA 2F1FA 3RSEA 4ED7A 2BV3A 3CW2C 2BTFA 4WQ4A 2R8JA 2YKNA 4CJ7A 3IFEA 1JLCA 4A4JA 1JLBA 4BBYA 4BRNA 3TP2A 4NMXA 1UAXA 3AY0A 1QUPA 3O4QA 1SXLA 4DSLA 5C15A 2X6SA 1X9WA 2V2KA 4DV0F 2HURA 3TR8A 1O5JA 5KT6A 3MEDB 1RA6A 4YOEA 5M2RA 1LK7A 1VQ6S 3MURP 1KQSM 2YNFA 3H1QA 3M30A 4USWA 2B4JA 4JKEA 2E9TA 2V50A 2XYHB 3QIDA 4FXVA 3AO3A 2FF6A 4JS4A 4DFMA 1RWNB 5AQYA 2IYGA 3JB9k 4OJHA 5MLCV 3EDRB 4YR3A 4GW6A 2LQJA 3DRYA 5C25A 3NMRA 4UOFA 1IBMK 5JVGL 4KV8A 3POTA 4DR6F 3GR1A 3AY9A 2XYPB 4CJEA 4GNIA 1HWKA 2UVWA 1YRXA 1WSVA 5AQNA 2H3EB 2AF6A 2X1BA 1RT1A 1PYTA 4FCYA 3MN7A 2VZ9A 4P74A 5AJ3K 3I56N 2LYVA 4RWXA 3VAIA 2GHWA 2UV8A 1U8WA 3CD6N 3UVJB 2VQFK 2G0IA 4JKAA 3O5BA 1FO1A 2IAJA 4PCQA 4G1PA 4KH4A 5GAEP 3PIPL 1LWEB 3GBTA 2R7TA 4IKAA 3F41A 2IGIA 2QXLA 2P9SB 4B3SK 1AB8A 3BF1A 5IWAK 2GMHA 4XDDA 3Q8SB 4B1XB 2PYLA 1KVBA 4MTPA 1NB2A 2KJWA 3SMZA 1LWEA 3EY1A 2XSJA 2ZFHA 3K89A 3S3OA 3MM6A 3CDEA 3FK4A 2JWLA 1JNRB 2JX2A 4EO6A 3SV4A 1LNQA 2FJEB 3RWUA 3TUJC 2KT3A 5JS1A 3CIPA 3GDQA 4I69A 4NCAA 2QYCA 3QFPA 2AT1B 1Q1KA 2GVZA 3L4IA 3PKMA 2OTLN 4C97A 4BRCA 3KK7A 1QQNA 1H73A 3G87A 1VQ9S 2B9EA 2ZJPL 4LMZA 4UUWA 3VAMA 4H4OB 1M5VC 2HS0A 3TEGA 5LL6Z 1RT7A 4ANCA 4DR2F 4ZMMA 3QBCA 1WC5A 5F0XA 1T11A 3G82B 2ZWPA 3M6VA 1F60B 4KH6A 3W62A 4OIXA 3I0SA 3RMCA 3CCUN 3G0ZA 4KI6A 1GQEA 3M8WA 4LBHA 1TU0B 1HFEL 4DFJA 2O4IA 2D0OA 2YPZA 1FRHA 2VHGA 4M5DB 4ZCLA 1FWLA 1DT9A 2YJEA 4OZ5A 3HFKA 4E2FB 4L76A 5IT9Y 3D1OA 2J0QD 4BRAA 1NZ8A 4KPCA 4NO7A 3OYCA 1RNHA 4PXEA 3PW4A 5CQGA 1YIJS 1OQ6A 3QLHA 1C1BA 4H5TA 4DLEA 2QSWA 2ZDPA 4FF3A 5C10A 4LR7A 2HRYA 3E01B 1IN0A 3CJCA 3CDWA 1S9EA 2XULA 1HNXJ 3H1VX 3AFGA 4Q0BB 3RBZA 3SMPA 2J0XA 5DJBA 1UP1A 3EGWB 2CH5A 1KN6A 1RKIA 2XB2D 4IQXA 3NF8A 4K4VA 3LGHA 3CO0P 3M2UB 2AYBA 4LFAF 3HSJA 4V19X 2CG4A 4LSZB 3TOQA 1VHIA 4CHPA 3SAGA 1RAHB 2Z1GA 3FSYA 8RUCA 3ILIA 2WONB 2KHCA 1RGIA 1KC8O 2NPFA 3LPUA 2VPYB 3UCZP 6AT1B 2ZZTA 5D4NA 1H38A 4QYZK 2PFUA 3D0IE 3PZPA 3DRSA 3Q7CA 2DGSA 1UMJA 4BGAA 4TLQA 1K8KB 3SSSA 3P31A 1FTRA 4WFXA 1EETA 1MU2A 5KG7A 4WZMA 2FGCA 1G1XA 4BDYA 3PW2A 1B64A 4DDFA 2V2VA 4ED4A 4K0KJ 3BBFA 3T5KA 3N6NA 1NGIA 4CYUB 3MM7B 1SKSA 1TL4A 3UKUB 2HFSA 2WW8A 1FKAF 1JNZB 5KFZA 5B7WA 5K8PA 5EX0A 2O3DA 4DX5A 3KWGA 1ASVA 3A4TA 3G2XA 4FJ5A 4P10A 1TL3A 2LLZA 1WI8A 1VQ5S 2E44A 1EQYA 3D5MA 4KH5A 3J7ZO 2BANA 2IY5B 3NAEA 4W98A 2F4VJ 2Z1JA 4CIFA 4X2BA 2OMLA 2BUPA 4I2PA 3AAWB 3P38A 2J9DA 1R43A 3NGYA 4DTXA 4NYPA 2GV1A 4LF5F 3BZQA 1JIHA 2CQBA 3EZ5A 1IKWA 1WEZA 3AVLA 3MXIA 4LF9K 3FBCA 5CAAA 2CRLA 3SAFA 1U2VB 3EPGA 2GX8A 4H0YB 4IJAA 3IR6B 2YI1A 1U7LA 3KLHB 5DS7A 2PT0A 3NBPA 5T7LB 4YFUA 5A8WA 3FFKB 2O8CA 3CCSN 3W0LA 5AQVA 3HP9A 2CWKA 5L1LA 2QA1A 3BYRA 1V4TA 5IT4A 3PEHA 3DOMB 4IRCA 4QYZJ 3EGNA 4DL3A 5CR4A 1OYDA 2B4UA 1N54B 3MMCB 1ITGA 1KWMA 4A2BA 5IT9U 2V0NA 2KG0A 2XCPA 4GVBB 2OGUA 5CZ2A 2HHVA 1MMNA 3OYEA 2DNKA 2XLJA 4LF2A 1S1VB 3QIPB 2VIHA 4ATNA 3FRZA 4OYOA 4OYZA 3VN5A 2GNKA 4ZP6A 1CS4B 5C24A 2ZOFA 4CFCA 3S7RA 2KFZA 4WPAA 3BZCA 4C8LA 2KVIA 5M1PA 2PI4A 1HNXK 1WC6A 4Z7CA 4ZPAA 2MSTA 2F40A 4ZN3A 1RAFB 1X0PA 3CJKA 1YBUA 3JQJA 3AVBA 2R2UA 4NLDA 1SKRA 1ZM3A 1NK5A 5F8NA 1YVUA 2BH1A 2XWYA 1KFSA 2QA4N 2BJ9A 4CTAB 2AD9A 4A8OA 1VBXA 1VQSA 4B3OB 3LH2S 2X1AA 2O8DB 1NDLA 1U45A 1EB0A 1XMBA 3B82A 2YY3A 1HYZA 5HQMA 1R8CA 3OFEA 4DV4K 5BR8K 4A8SA 1BC6A 2V4JA 4N56A 2CG8A 4F8RA 4IFYA 2P9NB 3CO9A 1H72C 3EX7B 2DGVA 2M8HA 2YWWA 4B3MK 2NUHA 4OJ3A 4ZP8A 2W42A 4ANEA 3PIOL 4LFBF 5G4DA 3NDKA 3CQXA 3LGMA 1P6TA 1N5YA 2XY8A 3S41A 2ZC4A 2G8UA 3AAQA 3MPYA 2VPWB 3TX0A 5KTQA 3CJRA 1NOZA 4FJMA 3U27A 4E7JA 1U6FA 3M7VA 2RDIA 3L2VA 3MMJA 1TUUA 3LPEA 1HHTP 3NHGA 3N6LA 3R7SB 5AZIB 4O5FA 2FZKB 3UN5A 4C11A 2W8LA 5D78A 1IM4A 4NPOA 4FLXA 4RUHA 4BG9A 2DPIA 2CPZA 4NLBA 2EFNA 1N48A 3FZFA 4ZVPB 2EFOA 2ZZNA 2E1RA 5T7LA 1VIOA 3NNHA 1RWOB 1WDDA 1OWXA 2AJ0A 2ROGA 4OKKA 3H2UB 1YJNS 1G7CB 4A62A 5ETTA 2R7SA 3N0VA 1HMVB 5KFRA 1HBUB 1TV6A 4JYAJ 2JWKA 3CFPA 1DTQA 4M5IA 2MXYA 2B51A 1IO2A 1AXQA 1VLYA 3BKUA 5HMXA 1FRLA 1I51B 4F4XA 2DITA 5AQTA 3NMAA 2M3DA 3US5A 1S12A 2AYGA 1B9FA 4IKFA 3LUYA 4A8WA 2GAHC 3UE2A 2MB0B 3O9TA 3H98A 1YK9A 3LQVA 5AQLA 1JLCB 5DG8A 4JNEA 3SDEB 3SYZA 2GV9A 1ZBTA 3P4IA 4KTWA 5CCLA 1T05A 1VQLN 4B8AB 1XNQF 3AGKA 2C3OA 3MPDA 3U8XA 3F9KA 4CJFA 1FX4A 5KGXA 4YOTA 2E5HA 1UFWA 5LMNJ 2PGCA 3JAMO 2HNYB 1YAGA 1XWLA 3MMAA 3K5MA 2UUAF 4DL7A 2C3YA 2MDAA 1DQ9A 2CQIA 4ELUA 2QYGA 2A5XA 4FXWA 2M7SA 1VSJA 1NK6A 3ZTPA 2L9WA 4A47A 3UB5A 2C42A 3HM8A 3W8PA 3I5CA 3QEPA 4I0WA 2FHKA 4K4ZA 1H74A 2JSXA 1IXKA 2WSEC 1CJUB 1YTYA 4FK2A 4GKJJ 4DR4J 2KJVA 3EDQB 3ZXWA 2W9BA 1JJ2R 2YH0A 3TW0A 1C0GA 3HULA 5A6WA 1FWKA 4OYWA 3C6HA 4NB4A 3I82A 3UCUP 5FPNA 2J8SA 4ZITA 5KT5A 1U1NA 3R8YA 4NEZA 4IOAL 4NLYA 3VETA 1DFDA 4BWMA 3PIOQ 2VDIA 3P5BP 1EARA 5K20B 2OPQB 3F73A 3QFHA 3WXMB 3FLCO 3CC7N 2WVCA 4DX8H 2HVHA 2C3PA 1E4GT 3WEEA 1N32F 2NS1B 2EK6A 3OFGA 4CZKA 1J5OA 2CDRB 4RBUA 1Q79A 1BHNA 2BXJA 4Z0UA 1QVGR 2P9SA 5KI6A 2O01C 2FBYA 2HGNA 1LWXA 2JNJA 1WC0A 2HWIA 2Y9HA 2OJ3A 4JI6K 4P72A 5KOWA 5D0HA 2JFKA 3W60A 2X1GA 3BUZB 1MW7A 4PXDA 3W9IA 1HBUA 3SNNA 4QWAA 5KGWA 2DCUB 2A1SA 1ELOA 2AJQA 4M3UA 4K8ZA 1KEKA 3A8IA 3M9MB 1J5EF 1S59A 2VONA 4PA1A 4F3TA 4JI8K 4YB7A 1OQ3A 2VF3A 2ZBPA 2EG1A 1RDDA 4DX6A 1PILA 3MMBA 4FNHA 3B4DA 1T9XA 4FK4A 1F21A 3AODA 3DOLB 5BYSA 4BREA 4ZVOB 3AA9A 4LH4A 1KRPA 3ZSQA 2P5GA 1BWEA 3A1YG 3BQ1A 2R7WA 3VALA 1W97L 2IRXA 4QYRA 5J2QB 3KNGA 2P9IA 3OTDA 1VQ8S 4FXDA 2GWJA 4FM1A 2ZC3A 4HHHA 5M2PA 3SZ2A 4C23A 1SPBP 3GV5B 4WCEQ 1WSIA 5KFKA 3CC7S 3P5TL 1XMOF 2FJVA 1TKZB 3CCJN 4DV7K 3JTNA 3KLIA 2IM2A 2I6WA 4DQRA 4I6AA 2HNZA 1VQNS 3FZLA 3D67A 1AFJA 1M1HA 2R3VA 1QSYA 3KKRA 1U2VA 2VQEJ 1SZ2A 3PJWA 3BBBA 2HF3A 3RRHA 4NCGA 1QE1B 5G0RA 3K58A 1U25A 1WOPA 3BO3A 3J81Y 3VQEA 5LSRA 3ALYA 1YSJA 4HH0A 4ZVRB 3MN6A 3S6EA 2IIHA 2XMMA 2G8IA 2GA7A 2BR0A 2FBXA 4OX9J 4J9UE 2C3MA 1G2EA 3CCZA 4JI8F 3QGGA 1X0FA 4QW8A 1JKHB 5FROA 3OYGA 3J80Y 2PC6A 2NQPA 3NGIA 1CZ9A 4FK0A 3I9ZA 4KKOA 5HP1A 5GMEA 3HHNB 4I2QA 4TVAB 2FGOA 2QX0A 2VCPA 2H5JB 3CCVS 2W2MP 5DRKA 4OYXA 3W5XA 1HNZJ 2WHOA 1NGFA 4ED8A 1R59O 1FDBA 3P4UB 1S0MA 1Q82O 5AR0A 3DRRA 2X3GA 2V4QA 4YOWA 4LF8J 4DV5K 4OLOA 1X4GA 2QJ3A 5HK4A 3PCOB 2XI2A 5J1PA 2B8QA 4Y1DA 1WF1A 3OHRA 1V6HA 2VICA 2FXUA 2W7OA 3W1YC 5AQOA 4CGFA 3MECA 1ZM4A 2UZAA 3HHLA 4DHYA 2VQFJ 2B56A 3NGSA 5KFTA 3BEGB 3SUOA 1LWCB 1E4FT 3BH6B 1YJNN 1XIQA 3GMGA 4LFCK 3AB2B 5E2QA 2D0BA 4PYAA 1MWKA 3F56A 4C3MA 1WF0A 3DOLA 5A6PA 4LR8A 2AEFA 4CZHA 1A5XA 1JQGA 3BGUA 5HMZA 1JLAB 2WFBA 4GV6A 2ROEA 2ZHAA 1BI4A 4WZQA 2F7TA 2Z2ZA 2E2QA 2EK1A 2LEAA 2VBXA 2ZBQA 2ZEJA 2CPDA 4CP5A 1NB7A 3TTDA 2AKWB 4FPAA 3HFZB 2DHSA 3IWNC 2LA6A 4KI4A 4LF7K 1ZYQA 5AXMA 3C65A 2DXEA 2CDQA 3V4IA 3MCOA 3MWBA 4M5KA 3ULEA 3P1GA 1O6XA 4AM6A 3ZZYA 2VKRA 2WBRA 3W63A 1NRKA 4CJVA 2R2SA 2A6OA 4CLKA 1FD2A 1GEHA 3CMEN 1NM2A 1GMUA 2ZUGA 3EZWA 1HQEB 1SB6A 3ZEUA 4NLPA 4RNOA 1Y11A 4BRQA 3BR9A 4RU2A 1H0HB 3M8PA 1I6JA 4FNIA 5C0YA 1ZA2B 2BE2B 4MMOA 2M9KA 5ADXH 2HWTA 4DI6A 1UEKA 1NGEA 2W40A 3TA1A 2G13A 3M2RA 3MTJA 1JLEA 1RTJB 4TY9A 4MH8A 5DO2A 1KC8T 2OO4A 1ZPWX 2HBRB 4DR1K 1SJQA 4EIAA 3TYTA 4CZEA 2OHDA 1IVZA 3FZMA 4LF6K 3UDLA 4ZLJA 2J9CA 2AZ1A 1RTJA 1SJ3P 5DG9A 3MAHA 4HHJA 2D5RA 4DHVA 4WFAQ 4B1ZA 1I94K 2NRXA 4PEOA 4WQ4C 4RBVA 2RUGA 2MKCA 2NUBA 4IRDA 2GS8A 2O8EA 4M7XA 4UTGA 2LCWA 5LMUF 4TSXA 1BQXA 4USTA 4AILC 1JLFA 4L74A 3W5YA 3K8WA 1GMWD 4DV3J 3SV3A 2R7QA 1F1BB 3CJ9A 3PSIA 3HSCA 2HZVA 1S1VA 1BLUA 3ZT2A 1TKXA 4B9TA 5CE3A 2HMIA 2UUTA 1VQON 4OI1A 1DAXA 5HRRA 1VK3A 2V67A 3RB3A 2PI5A 2WSCC 2LSNA 4JD2B 1FERA 3LPYA 4NLWA 3EYZA 3FKBA 1DLOB 4DR2K 4RUCA 2NRZA 2QO3A 1HNWK 1YBAA 4EYHB 2ACMA 2OPSA 4ZPCA 4GC7A 1VQPS 2IBOA 4ZOSA 4GY2B 2JWNA 1CQMA 1HARA 3PNIA 5ETSA 1WDTA 3MDFA 3QEWA 1S1XA 1RT6B 1EKRA 3T1AA 3ZO7A 3G6VA 4BHQA 3PRBA 1SL1A 1E6YB 3CMES 3JSMB 2XHCA 2A0FB 1HQ2A 4L8RB 2FC9A 3CG7A 4KHMA 1U4BA 4WKYA 4DPYA 3KK3A 2KM8C 2LEPA 4HL9A 1HKGA 2AQ4A 1Z25A 4YDXA 1XQIA 2GW8A 3AGRA 3FBEA 2F9JA 2YVSA 3QBWA 4OI0A 4PWDA 5HJXA 2Q79A 4K4WA 1BWVA 4FJXA 4PQUB 3QNOA 2D9OA 1DBDA 3BDEA 2C2RA 4ISFA 1NBWA 1Y3JA 5JVGQ 4O3NA 4UOHA 1VFJA 4Y6IA 1OY8A 4FDFA 2VG7A 4I4BA 4C0BA 1VQ5N 1QAJA 1NDCA 4CEAA 1EP4A 3PO4A 3LDOA 3GIJA 3D2EB 5T41A 3ENWA 2CPFA 1GLAG 5BRFA 3CJAA 3D9BA 9RUBA 5AQZA 3SK3A 2RJZA 2JEJA 3C16A 3JS9A 1BL3A 4GKJK 4WP8A 2IVNA 4CK3A 3UKRA 2LU2A 4NXNJ 1BUXA 3EZUA 1DZ5A 5CYJA 3G6XA 3D7EO 2ZHBA 3P83D 4CZLA 2POKA 2YNIB 4EHUA 3AVCA 3D0PA 2R4FA 4KGKA 1YG0A 2DNRA 4WQ5A 5J2QA 4C6AA 1S4FA 5E3AA 1NMEB 1KQGB 2Q6CA 2QLXA 4QIFA 2A40A 3PW0A 1T6DA 4F36A 5D4PA 5EXWA 1TL5A 2KI2A 2XMJA 4M5MA 1S4EA 3LZJA 1GMWA 3O9RA 4U95A 5ETQA 3SDEA 1DHMA 1WBDA 2GIFA 2WVFA 2V7YA 1QTMA 1PSDA 3FDSA 2BQ3A 2OI2A 2CJXB 5ELZA 5M1FA 2JVRA 2NCKL 3CCRS 2QEXN 4CBUA 2R7VA 1IM6A 4KH1B 2HRUA 3LDLA 5JXSA 4WU3A 5F9NA 3KUGA 2HNYA 1YJRA 5HBMB 4YN3B 3MMAB 3O1LA 3P8BB 3UKUA 4R79A 3NS6A 4UW2A 4DUZJ 3R5AA 1IR2A 3H6EA 4DG1B 2AU0A 4X66F 4L3QA 4H0TB 3OLBA 1M90T 1XMQJ 2IA0A 3DDNA 4V1Ak 2HVDA 3NF6A 2MJUA 1VSIA 4H0XB 4B3TF 2IVFB 4CBXA 1JKHA 3PTWA 1BA1A 4GVEA 4DG1A 3HPHA 2CGKA 2MZJA 5T7BA 3HOSA 5EGYA 1ZA1B 4Z7YA 1S9FA 2GUPA 2I2YA 2BKNA 4CI0B 4DUYJ 4MT1A 2FY1A 3EKSA 3VA0A 1S48A 3CCUS 3HX9A 4TY8B 5L1KA 4LRBA 1REVA 3LAMA 4DPOA 2EWSA 3MWTA 4YHHF 3R7BB 2UXBF 3NH1A 1R0BG 3WQTA 4PG4A 4NX9A 3SCLE 2MEWA 3VQSA 4ZVQB 4HTLA 1WKJA 1NMNA 3OVAA 1REVB 1SV5A 2HKEA 4ZIWA 4FVMA 4L6V3 1RT5A 3GE1A 1VQ9N 4PYDA 2LDYA 1N36K 4PL8A 2WVEA 4RPFA 1U26A 5GAHU 1RBRA 3M32A 1Q81O 3QEVA 1HI8A 3TA2A 2AZ3A 5KT7A 3WZ0A 5DQHA 2W24A 1WSGA 2ZF5O 4JP8A 4BY9C 3KYLA 1LEOA 4DQSA 4BQZA 1RTZA 1T9TA 2Q3PA 2ZZMA 4R25A 3UKRB 2ZE2B 1RBVA 1EIYB 2CJKA 1EWRA 5DETA 3EEQA 3D7SB 5B0DA 2RB7A 1UVJA 4JRPA 2MYFA 3ASMA 3N5BA 3T19A 1KVAA 4ID1A 2PZSA 2PYJA 3CE8A 3VR1A 1Q53A 5BR8J 3T69A 3QBXA 4DV7J 1WC4A 1QSLA 3RRKA 2LU1A 4P71A 2XC9A 4E3SA 2VA2A 4BC5A 3U1MA 3VTIA 1UJ6A 4ZHRB 3CWJA 5J2MB 4CT9A 2Q0RA 4LFBK 1QTNB 3RAMA 1FXXA 4E19A 2CNNB 3AO4A 3EVMA 3I8DA 1PG5B 5LOQA 4W4MA 3MUTP 4CVNE 2IDEA 3I56S 4XH5A 4CEFA 2P8IA 3ILJA 3FZHA 4WBFA 2K06A 2FBVA 3V6HA 4CO5A 2DNHA 1WHYA 3DMJA 1Z4UA 1RWPB 3K17A 5F3TA 5EHHA 4CEDA 2HFNA 1IBKF 4BR9A 3L3VA 2A2CA 1WHWA 1NLKL 4O3OA 1Q8BA 3GP9A 3Q8QB 4OI6A 3VAFA 2E5LF 3TRGA 3LP2A 1JLGA 1FDDA 1NK9A 2HEKA 4BR5A 1NK7A 4RCHA 1XERA 2EFPA 2VODA 4FZZA 5IS2A 1IJJA 4UY8T 3GONA 4ICLA 5FLXY 3VZHA 5H1SQ 1VS3A 4XIUA 4GKKJ 2B4PA 4QJVA 4CJWA 1C1CA 3THXB 2HQFA 2KTQA 2W4DA 2DGXA 2ZM6K 4N76A 1Q4RA 3FMWA 1T9YA 3CVKA 1UA1A 3IG1B 3OYNA 3THXA 2EXUA 3T7ZA 3OS0A 2XZTB 5B0FA 4M5JA 1CG2A 3IR7B 5KFBA 2OEMA 4DR1J 4P73A 1OMSA 5IC4B 3DRPB 2FVRA 3HRGA 2CVEA 1HPZA 4IEIA 1S6PB 2BM1A 2OFHX 4B1VA 5GADI 3AOCA 2YHXA 1K8AO 1K9MO 3ISND 2XSJB 2UU9F 4GC6A 4TYAA 4ENOA 2RDJA 3KDOA 3GV8B 3DRPA 3VGVA 3H42A 4OX6A 5J2PB 3UDVA 2QWRA 1BWFO 2FBTA 4WFZA 4M3ZA 1HKAA 2DO4A 1GXTA 1HWJA 3F0NA 4FZXC 7FD1A 4IO1A 4YR0A 1RT2B 1B70B 3M8YA 2HPUA 4LQ9A 3MM9A 3C66A 5J2PA 3JSMA 2VBZA 4K5SA 4DTSA 4NI2B 4TLRA 1HWLA 5CHCB 3C14A 1UPPA 1KD1O 4BLGA 4KBOA 5JUMA 3M8ZA 4OHWA 2Q3SA 3ZZZA 2PDAA 3DLBA 1CZBA 1AROP 2VGMA 3M8QB 1EKSA 3L8BA 2HZCA 5D8HB 1RE1B 1EAYC 3BR8A 3JYTB 5AQRA 4BRHA 1F5CA 3IAM9 1CULB 5J2NA 4ZVTB 1XC3A 5B0AA 5D4LA 3PFOA 3WNHA 4JI0J 4C8NA 1TGOA 3LDNA 1JLQB 4B3OA 1TAQA 3QWUA 1B99A 2YKAA 4YDUA 1EX8A 3GIIA 4M94A 4Q5VA 5ADXA 1OSCA 4NLVA 4OZ1A 3SPZA 4M7YA 1VC0A 5L9XA 2J0SD 2D1KA 1N36F 2OAUA 4ZVUB 1QZ6A 4IJNA 3RB0A 2BJDA 5KG3A 4YOYA 3ZETB 1CXUA 3TAGA 1UVLA 2HFVA 3DOKB 2U1AA 3BM7A 1V3SA 1NGDA 5LL6d 2L9NA 3GJRB 5IXUA 1VBZA 1RT4B 2XHBA 3G4SS 2QWNA 2ZM6F 1MWQA 4CLLA 1CVJA 4JI2J 4H5VA 3ILOA 4I6WA 4UZBA 1U24A 2DGWA 1RAAB 4ELTA 1HW9A 4FLYA 3VAJA 3D3BJ 4QPXA 4O4GA 1G99A 3ZZUA 1MWMA 2NUUG 1XNRJ 3WNFA 4OPAA 3VEXA 5IT9O 2JH3A 2X78A 2XCAA 2W6KA 1ZAWA 1KONA 4NLSA 4CZMA 1H2TZ 1YKWA 5K14A 4NA3A 1FKOB 2RF2A 2HGMA 5FJ4A 1FRJA 4TQRA 2ZH8A 1RA7A 1OIAA 1RGVA 1IG8A 3CSKA 1HD1A 2D0CA 5DG7A 4P2MA 4AXJA 1MU2B 3OSNA 3H2LA 2DHAA 4RZRA 4F4ZA 2H54B 3K57A 1WKLA 4DV3K 4OI3A 1KDNA 1L3SA 2VFUA 2WW4A 4OYMA 4X62K 3HL8A 1GXUA 4I68A 4AHTA 3NH2A 4OLAA 4YY3K 2W9AA 4JI7K 4FJIA 2MKYA 1TL3B 4C7QA 3DHWC 2L48A 3PIPQ 1ZPVA 4LF8F 4KQZA 3JSRA 3GSDA 5CYMA 2OA8A 3WHIA 1HNWF 4U6PA 4U8YA 3CD0A 4RBTA 1ACMB 1HX1A 3AAPA 2UV8G 3H7HB 3L95X 3J81j 2XG8A 5AQIA 3THWB 4ES3A 4CHNA 3HTVA 4RW6A 4TKTA 5C25B 4PWUA 5KFGA 1N5YB 3QSYB 4J37A 4WCEL 1HYSA 4JI5K 1BGXT 4KHSA 3NOGA 4NYZA 3CFRA 2XGQA 2UXDJ 1RT1B 3NAIA 5LJVA 5DLFA 2AP1A 5AQJA 4KAZA 4O5BA 4Z4IA 4JN4A 5AQKA 5LJWA 2QEXS 3CCRN 3O1WA 2UU9K 2FSNA 3TA0A 4PG8A 4DL2A 2EPIA 2DNPA 1BCMA 1Z05A 4D3HA 4CH7A 2XS7A 3L7PA 1C1BB 3BQ0A 1ASWA 5AQFA 3SJHA 4BC3A 3HVRA 3DLEB 1BIUA 3J7YU 1HLWA 5GAGU 2GMJA 1FXDA 4QS8A 4AL6A 4FKXA 1F6TA 1JCFA 2WAQD 4O8UA 3RB6A 3KOAA 4RU9A 1ITPA 3CERA 2V5HG 3TPQA 2EBEA 1VSFA 1F9FA 4UY8O 3SJJA 5A2QU 2RHQB 3SI8A 3V9SA 4CD3A 4JRQA 5AZJA 5BPLA 3WEEB 4HI1A 3G8TA 2ZJRQ 1CJVB 1Q95G 1GOBA 2RHKA 1MWYA 4H4MA 1FF2A 2RF2B 3ATVA 5D4OA 3UN3A 1YIJN 3SSQA 3DLKA 2XMAA 3DWLA 4OPKA 1Y0HA 2ZBRA 2G8FA 1WHVA 1MN9A 2QT7A 2C2ZB 3D2FA 3EN9A 3C3LA 2I5JB 3ZLJA 4DV1J 2BEFA 3A8YA 2V8DA 3SQ1A 4W5OA 5GADU 2VWKA 2WBNA 4MIBA 4E8UA 3R5BA 2V4JB 4DUZF 1S7IA 2BUNA 4N8OA 5K8OA 4IH5A 3HPGA 5AQWA 2ZWOA 3JAMU 3KHRA 3W66A 2UXCF 2Q6BA 5CCMA 2VB6A 3SMSA 4HH1A 1N5VA 1KBRA 5F8MA 4DZ6A 2ZOGA 1C1CB 1FI4A 2K1RA 4J9VA 5J1EB 2I0XA 3BO4A 3RRGA 3MWPA 3IMQJ 3SQOP 2GCFA 1VC6A 1VSHA 3ELHA 3ENBA 2RS8A 2DCLA 3THYA 1HR0K 2LKZA 1V3RA 2JRSA 5EWGA 3VEVA 2HQ3A 2E2PA 1GXLA 3LP0B 1AUSL 2MZQA 4UT4A 4CNYA 4RWTA 2Q1LA 2F8MA 1R8HA 2D7SA 3L4QA 3CPEA 3N6MA 4CO2A 3SQ0A 4CH0S 1RXOB 5D15A 2B4VA 2MY8A 1PO6A 2YX6A 3EVOA 2WZ1A 4NCGB 3GJSB 3NXZA 3DC2A 3K7RA 1TUYA 5M1NA 1RU1A 4CO0A 4ZJOA 3ADAC 2FB0A 1QHTA 4NLCA 4JS5A 3HHLC 3J7ZT 4JK7A 2AEMA 2LXIA 4NZ7A 2CNOB 2XZWA 3V6JA 3HZEA 4OPHA 4K43A 5IQ6A 3A8EA 3QEIA 2H9ZA 5L39A 5JS2A 2QZ8A 4DX7A 3HT0A 3KD1E 3OYFA 2WUSA 2PSZA 3HJVA 1JB0C 2ZWHA 5AQXA 3AO1A 1HNIA 1JLFB 2ZE2A 4KKOB 2HK2A 3W2WA 2ZNYA 3LA0A 1NJWA 4USHA 4MQ3A 2QWQA 5AFUH 4ZIVA 2AA4A 2KKZA 3KNAA 4JKHA 2DR8A 1IH7A 3S01A 2HMPA 3V1RA 4RG8A 2YXLA 4WTOB 4WYBA 5HRSA 5BN8A 2RRBA 5GIOA 3M6WA 4ZDNA 1R6VA 1KSPA 1J2VA 3OT9A 2O5DA 5CY4A 3J80U 4ED1A 2V69A 2ZDOA 3MCSA 1OH5A 4MAKA 2E20A 5F8JA 1Q0NA 2QWMA 1R27B 3TAPA 3ZNUA 4TU8A 3BH7B 4DB3A 5HRPA 2W2QP 4V19J 1RILA 4JI4F 2IBKA 3BN7A 1WG5A 1VQLS 2KYXA 2XMTA 4BC4A 4CEZA 2XRIA 1NWKA 2VA3A 1JXEA 1P9YA 2HQGA 1JJCB 5FDLA 2NRTA 1QQCA 3CCSS 4WYWA 2RQKA 3RGIA 4FJ9A 1D8ZA 3UD3P 5ETNA 4IFYB 3BBCA 4CZJA 4HUEA 3R3TA 5T14A 2KDOA 2ZITA 4DXLA 3N9UC 4NA2A 2PD1A 3L3UA 4ICLB 3GG1A 3KK1B 4DU8A 4LT6A 5H9EK 3PEJA 2ILYA 3ENHA 1C6VA 3MXHP 3ENQA 3CCES 3A5OC 2R7UA 4O3QA 3H8YA 5FPMA 3IDHA 2CPXA 2P9CA 5IFMA 1H2UX 2OPQA 1RCHA 5AQGA 4KB7A 5BYQA 4XPCA 1EP4B 3KLEB 1ULRA 1U6ZA 1T02A 4QWCA 3IAS9 4I6MB 4M42A 2VG5B 4F4WA 3MMCA 3NH0A 3J7AP 4DWIA 5JLHA 4OYAA 5F2RA 5B0BA 3R5CA 4R0JA 2E6LA 3CCEN 2FY8A 2G2ZA 3OR2B 3TVKA 5C12A 3QESA 4LY7A 3CJQA 3UIQA 4CFAA 1N5TA 2DGTA 1NSAA 3H59A 3MAAA 1T44A 2KLAA 3TU5A 3CM5A 2QSFA 1LXNA 2GUIA 3I96A 2RHSB 2FSJA 2NXNA 3RBXA 2DXFA 1Y7PA 3OTEA 1LCUA 2FJXA 2GIRA 4OHZA 4EHTA 4FJNA 3MM9B 2COLA 2YBVA 4LF1A 1NBEB 2V8GA 1R6YA 1NH8A 1N34F 4DN0A 4FF4A 5F41A 1RCOB 4RW4A 4IXCA 4QIWD 4WK1A 1VQPN 3DXSX 3CJTA 2EEYA 3KDNA 3ISZA 3LDPA 1J5EJ 5KFDA 2XMKA 5GMKa 2J7WA 4J91A 3GFHA 4QIEA 4AHRA 1KAZA 4KYZA 3CHWA 1CULA 2EHGA 1RWVB 5KFNA 1RKJA 3HHKA 1K47A 4FPIA 2IJNA 1UCNA 5H9EJ 5J1NA 2CQ2A 4B9LA 3OSPA 3OHAA 2HF4A 1Q86O 1TP7A 4ECVA 3RMAA 4DSJA 1PBUA 1IBLF 1QDUB 3E8OA 1TFWA 1SH3A 4QBUA 3ZC4A 5BPNA 4MK8A 2FVPA 1HI0P 3H40A 2HSEB 1V5VA 1C0MA 3CJ3A 1RTIB 1W25A 3HDSA 1YRUA 2ZGZA 4F3QA 2V9WA 1FEEA 4CJKA 2OPPA 1QAIA 3QEXA 1GK8A 2A6MA 4BG8A 3M2RB 4FJ7A 3A5MC 2W8KA 1WKKA 1IKXB 4K2XA 3T9NA 4CJTA 2E7VA 3Q2SC 4O0IA 2W7PA 4ZCIA 1LWFA 2R7YA 2B7CB 1PAUB 4OJGA 4LBPA 1RHQB 4FJLA 3BP8A 4CZGA 4DR7J 2VJVA 4ZJLA 2VG5A 2HQDA 4RO0A 3IBFB 3VGMA 4BE0A 5I4MA 1I39A 2E5JA 2HBJA 2CXEA 2LXFA 2Q0UA 1RBOB 2O67A 2WB1D 4TXSA 4Y1CA 3C15A 2OTLS 2XMUA 4CGGA 4F3OA 5JVHL 4ZVHA 3ZT3A 5HRNA 3W9HA 5HVFA 5E5NA 4O23A 4KBIA 1D9DA 1K8AT 1IV0A 3QSIA 3VGUA 4ECQA 3QRPA 2VFRA 4WE1A 3AD7C 3HSGA 3NCIA 3KLVA 4KAIA 1UWAA 1N34K 2QLJB 3RMBA 2XTJP 4B9VA 3X1LB 2XMVA 4CZFA 1P1TA 3GU0A 2R2RA 4B3MF 3G6EN 4CERA 4RW4B 2VOOA 3HLUA 4DQIA 1K1QA 4OX8A 1RJJA 1YGYA 4MKAA 5C42A 1ZXOA 4ILJA 3TZWA 1RAOA 3TSPA 3U9ZA 5EOYA 1U04A 4KGVB 1H7XA 4OI2A 1N32K 3D6FB 1TFYA 3D6TB 3DLGA 3IRXA 4EYIB 2IA6A 2GGPA 4A46A 3CD6S 1RBSA 4QIVA 1J54A 4IDKB 2A2DA 5HANA 4H5RA 3E3XA 4LF9J 2VBWA 1X5PA 4CEOA 3UD5A 1UWBA 2Q97A 2W25A 1QJHA 3WDOA 3CJ1A 4OYBA 1WTFA 4ZPVR 1W7WA 3CJ2A 4FLTA 4NLGA 1S99A 1RAGB 2JJ4D 5TKYA 1UFLA 2QL9B 2HNDB 4X62J 4ZTFA 2AHOB 3D3CJ 2A41A 4I1TA 4MO4A 3QGHA 2J6UA 2UUCK 2HVZA 2G4BA 5C2GA 3VEZA 2UUBJ 1JXLA 1DY3A 1U2FA 2IFXA 1TELA 3Q83A 1WSFA 1FFSB 1TMMA 4YOUA 4MLHA 3AVJA 3O1BA 2HHXA 1HLUA 4J7CA 2DGQA 4J9MA 5ETMA 2F4VK 2IJRA 3QFWA 2B8PA 4DCPB 4FJKA 2AW0A 2D41A 2O8EB 3BY5A 3OBYA 1DRZA 5LXRA 2DHGA 4FOEA 1L5UA 5D0RA 4HCBA 1VAZA 3C8YA 3VQ7A 4KB1A 3QGPA 3EXCX 5DDPC 3H5YA 3C7NB 3MEGB 1HNVB 3EE8A 1BXNA 2CQHA 1QSSA 3RJMB 3GIRA 2W2PP 2UU9J 2O8FB 2E7XA 2YWHA 3FEYB 3VWSA 1VQNN 4CHYA 5DDOC 1FJGF 4J90A 4N41A 4ZLPA 1FHTA 3SQGA 5GMDA 3BS9A 1U47A 4WK3A 1VI7A 3PRVA 1NM1A 4WF9Q 5C24B 3VHQA 3KMSA 1T95A 3I0RA 3IWLA 4PKDB 3DXKA 3L0QA 3QT5A 1NU4A 4JI2K 4G1QB 4DL0C 1HQUA 3HKZD 3C94A 2CPIA 4KGZB 3Q89A 2B7BB 2QN6B 3K2YA 1U8SA 3NGTA 4RUBA 1NPRA 4QWDA 1VK8A 4Q2LA 5KFLA 3BB5A 1VQMS 1O51A 2XHWA 4JI3K 1U6BA 3MR5A 2IC3B 4C8KA 2HHHF 2NZCA 5KRTA 4HDHA 3VGLA 4URGA 4DS5A 3T5LA 1X8DA 2D3ZA 1Q9XA 3PR5B 3HHLD 2DH8A 2WK4A 1YVNA 3AA2A 1JLAA 2X51A 2MZSA 4OFZA 2ZH1A 4JYAF 1ZBSA 3OA9A 3C6AA 4DPXA 3WBZA 4DR6K 4K25A 4OO1J 5E41A 1F3FA 3MCPA 3VQDA 3NNCA 2P9PB 1X60A 2VGNA 2OCEA 1TR0A 3L6QA 3UQSA 2ITMA 4ZN1A 4FPRA 4DBQA 2V94A 2NRWA 1E6VB 3E9LA 4E7HA 4B3RJ 4PZVA 1URRA 3R5DA 2GELA 9ATCB 5LMNK 2DY4A 3NOCA 1G15A 4KHPK 2BACA 3THPA 4NLUA 2FJWA 3O44A 4C11B 3G4SN 2X7IA 3MAAB 1C0FA 2QA4S 1S97A 3TVYA 3OXGA 1X9SA 4WYLA 1LAWA 4P7TA 1DURA 1BG3A 3U9DA 1TTHB 4IR1A