2OPQA

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
534
structure length
515
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 146
structure length 515
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2opqA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opqA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opqA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2opqA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2opqA05
2G8HA 1JL2A 1IKYB 2PYLA 1JLBA 3MR2A 1S6PB 1NK9A 2HHQA 4CEOA 1XR7A 4FJNA 5KRTA 3TABA 4CEDA 3KK2B 1MU2B 4URQU 5DG7A 1BQMA 5CY4A 1EETB 2V4RA 1OS5A 3VQ6A 3VQ9A 5J2MB 1RDAA 4EEYA 4NLQA 4TYAA 2HAIA 2IA6A 3VQPA 3CQ8A 1YVUA 3MECB 5J2PB 2AX0A 1LWCA 1BI4A 3KKRA 2KFNA 2G8WA 4U7CA 4Q45A 3T5JA 2WCXA 4CJPA 4XPEA 2C2EA 3SV3A 2WONA 4B8CA 1X9WA 4IG3B 1TL3A 2YKMA 3OYDA 5KFOA 3C6TB 3FFIA 5F9LA 3V1OA 3OY9A 2Z1HA 4MKBA 1S9GA 1QAIA 3H5XA 3VN5A 3OS1A 3M8PA 2IC3B 4KB0A 1WNSA 4JS4A 1YTUA 3KK2A 1RTDB 3DLHA 1X1PA 3V6DA 4RW6B 4KREA 5KG4A 3RBDA 4G3IA 1NOYA 3O3HA 4FK2A 5KG6A 5KFVA 1NKBA 4J9OA 4Y1CA 3PZPA 2F8SA 1TKXB 4UQGA 4JS5A 4OPKA 1S0MA 1NHVA 1RTDA 1MMLA 1CLQA 4CIGA 4K8XA 4NLYA 5I42A 4HUFA 3LALA 1ZBIA 2EC0A 3ZT1A 1S9EA 1TL1A 3GIJA 4ZHRB 1ASUA 2AGQA 4E7HA 2HHWA 2QK9A 3AVAA 3DOLA 3ZSOA 4K50A 3G0ZA 4DTJA 4LQ3A 3HP6A 4KBIA 1S0OA 2ASJA 4KO0B 4R8UA 2FLLA 4MFBB 4K4XA 2BQ3A 2IJNA 3P83D 2W9CB 2WTFA 3LZIA 2G8UA 5KT6A 4QOZB 3RB0A 5DGAA 2A1RA 2W7PA 4RUCA 3AVHA 2HWIA 2LSNA 1XR5A 2Z1IA 4NCGA 2E9TA 1B92A 5I3UB 4EZ6A 3OLAA 1XHZA 1F21A 5J2NA 4R0EA 2IS3A 4JRPA 2IM0A 2W9BA 3SZ2A 1S6QB 4CGGA 4CCHA 2O4GA 4OGCA 3JSMB 4F4XA 3PX4A 3QZ8A 3IGVA 3OYFA 4NLPA 4CHYA 1S4FA 3DRPA 5L1LA 3RTVA 5I42B 4FK0A 1VRUB 3DOKB 3DI6B 1T05B 5HP1B 4YR2A 4RUAA 3V81B 5KG2A 3GV7B 3EZ5A 5KG7A 4J9KA 4QW9A 4DQQA 1C0TB 3C6UA 4FW1A 4FLUA 2HW3A 2G8IA 1L3UA 2YV0X 4YQWA 4JUZA 4ZTJA 4TLRA 3MEGA 4HUEA 3AVJA 4CHNA 3LP3A 4I7FA 4H8KA 2BANA 4LSLA 3GIMA 4RNNA 3QGHA 2WB4A 4CEEA 1LWFB 5HLFB 4C8OA 4DU4A 1EP4A 3ZT2A 3OYNA 3NAEA 2OH2A 1C1BB 4AHSA 3AVGA 5KGXA 5K14A 1R0AA 2W9BB 3NHGA 1RTIB 3MF5A 4CEZA 1RT5A 4FM0A 4O44B 4YR0A 5KFPA 3O4NA 2XI2A 1ASVA 4MIAA 3ZCMA 1HNVA 3CFPA 3BJYA 5KFJA 1GOBA 1D9FA 3MEDA 1HPZB 1XR6A 1XC9A 4I2QA 4E7IA 3VQEA 3PJXA 2BR0A 1O1WA 5F8GA 4CERA 4ZTFA 1RT4A 1D1UA 3KTQA 3QNNA 3SPYA 3KOAA 1JLFA 2R2SA 5L1KA 4J9LA 4LY7A 2KZZA 3OYHA 3BDPA 1NK5A 4PQUA 4RNFA 3K5OA 4CJEA 3OHBA 1LAVA 5FDLA 1QE1A 3KLHA 3G10A 4IFVA 3M8QA 4F3TA 4Y3CA 3KHGA 1JLEA 5KFIA 1I6JA 1S1WB 5L1IA 3VQBA 5SWMA 1U49A 3ZT4A 1HQEA 2FBTA 3AVIA 4DFJA 2OA8A 5KFMA 1RT3B 1KRPA 4C8KA 3PR4A 3V6KA 3B6OA 4RW4B 3EZUA 2XY8A 2BQUA 1HYZA 5CYQB 3CO9A 2AGOA 5EWGA 3KK3A 4O4GB 1LW2A 2HMIB 4IG0B 5CYMA 4ED7A 4CGJA 2XCAA 2FVCA 4ECZA 4FLZA 4FJGA 4J9MA 3L2VA 3KK1B 3NF6A 1NK4A 1A5WA 1RBSA 1JKHB 4DTPA 1QSLA 5FRMA 4TXSA 2FVQA 5KT2A 1JIHA 1RYSA 3HPHA 4FCYA 1Q9XA 2D5RA 1U45A 3T5LA 4CIFA 2ZD1B 4HYKA 4BACA 4DTRA 4N47A 3OJSA 4CHOA 4C8LA 3AVFA 4EP4A 4O3RA 3L2QA 1S1TA 4DTMA 2ITGA 3CM5A 3V9WA 1J54A 1CSJA 3QGIA 1K1SA 4CJKA 3MEGB 4M3WA 1RYRA 2JEFA 4NLXA 3VQ7A 2HHVA 2O5DA 4F50A 1LWEB 4O5BA 1SKWA 1KFSA 4J2DA 4KAZA 2R2UA 1DTQA 3RWUA 2ILYA 1WSIA 4CHPA 3V81A 1VSJA 3KHRA 3TAFA 3NH1A 1RTJA 4IQXA 4OPJA 3LP0A 3T19A 3U3GA 2PYJA 1FXXA 4DSJA 1HMVB 3CDWA 3IG1B 5DQIA 4RU9A 5EUHA 2XC9A 2UUTA 5KFNA 4O0JA 4CF2A 4IFYB 1QSSA 1TKXA 3RR7A 1BHLA 3P1GA 4RW9A 5JUMA 2G8VA 5FRNA 4DLEA 3V4IA 5KFFA 3NFAA 4O3NA 2W9AA 4ECXA 4Q8EA 1TKDA 5SZTA 5J2QB 2DY4A 2UVUA 1SV5A 1U04A 1TK8A 4RW4A 4I9QA 1S1XA 3D5MA 4DF8A 4CJLA 4CHQA 3V9ZA 1SL2A 2XCPA 1RT5B 4Y34A 2R7YA 3OYKA 5K14B 1R0AB 3LP1A 3VA3A 2ETJA 3AVLA 3QEPA 3QO9B 2BRKA 4J9NA 2B43A 1G15A 4CEBA 3NGYA 3Q8QB 3AO4A 1JLGA 4DTOA 4FJIA 3NF9A 5HP1A 4Q0BA 3DLEB 1VSIA 3VQ5A 5T7BA 3KLFA 3MR3A 4IFVB 1WAJA 3ZSYA 1IKXB 4MIBA 5F8NA 2WOMB 1C1CB 2RF2A 4NLUA 3NGIA 3JYTB 5HRNA 3NGZA 4QWBA 4RW8A 5KFEA 2XY7A 4Y2AA 4HVJA 2W7OA 4NLSA 3VQCA 4Z4IA 3I8DA 4IR9A 3HXMA 3L3VA 4PA1A 3MTKA 1JLGB 1TKTB 3SQ2A 3SCXA 1U47A 4EO8A 5KFAA 3NCIA 1RNHA 1TVRB 4I2PA 2BGGA 4N41A 5C25B 1J5OA 5KFCA 4CHZA 3H5SA 4J2BA 4KV8A 4CK3A 4CF1A 1RT1A 4WYWA 1WSGA 3IRXA 1WSFA 4HTUA 4QWAA 3CJ3A 3ASMA 1GX5A 2ZE2B 4DL4A 2P51A 1REVB 3ISNC 1BQNA 2ALZA 4I2QB 3UQSA 1JLQB 3OHAA 3IAYA 4CJUA 3OL9A 4FJ7A 2W8LA 1WSEA 2YNHA 2B5JB 1IO2A 4CESA 1U09A 1W9HA 1GOAA 3GV5B 5F8MA 4TSXA 4B9MA 2OZMA 1FKPB 4B3OA 4PQUB 3AVKA 3K5NA 4CGFA 4KB7A 2HNYA 4FLYA 4M41A 4DFKA 1BGXT 3OYMA 2CKWA 3QETA 2O4IA 4ED0A 2B5JA 5HBMA 1SH0A 4XO0A 4CJTA 4N56A 1HPZA 3FRZA 3IN5A 3EYZA 4Z4FA 4FJ8A 3M8PB 4MKAA 4TY8A 1L5UA 3TI0A 3C6UB 1C0TA 4GMJB 3ZT0A 3CIZA 4DL6A 2WONB 1WLJA 3OSPA 3SFGA 1RCHA 3OYCA 3QIOA 1TK5A 1C1BA 4M45A 3DOKA 4CF8A 1T94A 4IG0A 5CYMB 2PZSA 1JXLA 4KHQA 4KHNA 4Z4CA 4FM1A 5DQHA 2UVVA 4DG1A 2FLNA 5KG1A 4CF0A 3M8RA 3QERA 1JX4A 1BI4B 5J2PA 3DRRA 3OYAA 3OVNA 3CJ2A 2WOMA 2B6AB 2YNIB 1N6QA 4OL8A 4LH5A 3NDKA 1KFDA 4ED8A 4AILC 1QUVA 1NJWA 1UA0A 4CECA 4CJFA 3DRPB 2W9CA 2BANB 4LSLB 1QQCA 3B6PA 4NLWA 1IH7A 4ID5A 4MQ3A 4F4WA 1GOCA 3CJ4A 2R2RA 1RBTA 1RT2A 2FVPA 1S1VB 2GBZA 4ECUA 4HCCA 5CZ1A 4URSA 1B9DA 1SV5B 5DG8A 4Q43A 1W0HA 3OYIA 3CJ0A 2IAJB 1ASWA 3OL6A 1WAFA 4K4ZA 1BCOA 1RT7A 1HNVB 4CFBA 4IRDA 5HROB 3RR8A 4RW7A 1Z26A 2YKNB 3C95A 1XWLA 3L2RA 1UWBA 2VA2A 4ECRA 4DSEA 3H2LA 1RTHA 2D0BA 3SUPA 3D45A 2YHAA 3N6NA 3KHLA 4RNHA 4FLVA 1S48A 3G6VA 2JEGA 2D7SA 4AH9A 2AX1A 4EBCA 3FQLA 5KFWA 5KFDA 3RMCA 1FK9B 2HB5A 3AVNA 4KO0A 1C1AA 2BRLA 1LW0A 5DGBA 4R5PA 4IH7A 1IKVB 3C94A 4RZRA 4IH6A 4BDPA 3NH0A 2FC0A 5J1EA 3T3FA 3KD1E 3DI6A 1T05A 1JLEB 3PY8A 4J2AA 1QSYA 2AQ4A 4ZPBA 2GIQA 4CEAA 1NK0A 3QESA 4O55A 3T1AA 3THVA 4K4UA 3CFOA 5KG5A 4ZMMA 1FKOA 4MH8A 3TANA 3BQ0A 3KLEB 1VRUA 2A1SA 2DPIA 5I3UA 1N48A 4K4TA 3ZSZA 4QWCA 2UVWA 4W5RA 1BQNB 1J9AA 2F96A 2E6LA 2BE2A 4ELUA 2HHUA 1L3VA 4KAIA 1XI1A 1EKEA 4ED1A 2HWHA 1Q9YA 4CGDA 3M8SA 4ZVHA 3MEEA 1FKOB 2ZQBA 3M9MB 1RBRA 1D8YA 1NK6A 4IDKA 1BL3A 3KJVB 4DG1B 1YVFA 4FBUA 1RBUA 4CJ3A 5KFLA 4ZHRA 2W8KA 1A5XA 1LW2B 2HMIA 4FLXA 2IM2A 3K5MA 4WXOA 4FJXA 2C2RA 4MFBA 3HVTA 4R8UB 2ATLA 2CJQA 4IKAA 3PUFA 3DRSB 4JV0A 1SL0A 2YNFA 1TP7A 5KFQA 1TQLA 2HHXA 3LWLA 3DLRA 2Y1JA 3Q8SB 4NLGA 1S9EB 1TL1B 3L2WA 1SUQA 4DU1A 3HK2A 4Q8FA 2D41A 4PUOA 2P1JA 4Q0BB 2WHOA 3BSCA 4DL2A 3QIPA 3H98A 3MR5A 5J1EB 2XGQA 1S1TB 3HM9A 3TAQA 1D5AA 2UVRA 3S9HA 1RILA 3BGRA 1SUQB 1QS4A 2OZSA 4CGHA 1CXQA 3K58A 3S3MA 1C2PA 3SUOA 4I9LA 2OPRA 1CZBA 3E01B 4RW7B 3T5HA 1TVRA 4I2PB 5KFGA 1LWCB 3ZSWA 4LH4A 4X2BA 3MXIA 2YNHB 3PO4A 4F4KA 1CZ9A 5J2QA 3NE6A 4JV1A 3I0SB 1YT3A 4F2SA 1JXBA 4PUOB 2XY6A 2E4LA 5CYQA 1DTTA 4F2RA 3HYFA 3WNFA 4IDKB 4M3XA 2OPRB 2GIRA 1S6PA 1HNIA 1S97A 4ZP7A 5HRSA 3NBPB 1N56A 5C42A 2Z1GA 1JL1A 3I5CA 4RNOA 4WFXA 5C5JA 2VG5B 4O0IA 4Z4GA 2XGPA 3H59A 3DLEA 3SUQA 1VSDA 1JLAB 5JXSA 4O3QA 5DG9A 3KLEA 3JSMA 1TKZB 4J9QA 2HNZA 4K4SA 4EYHB 2G8KA 1C6VA 4FJ5A 3OYEA 3SQ1A 1HQUB 3KLIA 4B9UA 4K4VA 4IH5A 1VSHA 3LDSA 1ZTWA 3QIDA 3BR9A 3ULDA 3VQSA 4B8AB 1TAUA 2V9WA 4KHUA 3FSIA 1SKSA 3L8BA 5FROA 4B9SA 2IJFA 5KFTA 5T14A 3F73A 2YNGA 4WE1B 3HVWA 4AHRA 3LP2B 3VQAA 4ED3A 3OYJA 1XHXA 2XRIA 2AGPA 1VSEA 3HJFA 3DOLB 5KFZA 2QKKA 1NK7A 3ICLA 4QW8A 2XY5A 4DQIA 2D3UA 4ECTA 2HHTA 1NJXA 3G86A 2IDOA 3SV4A 2EX3A 4ECVA 3UPFA 1LWFA 1IKWB 5HLFA 4B08A 4QWDA 2OPSB 4FJJA 4ZVGA 1WNEA 2OPPB 4ID1A 4FS2A 1KCFA 3KMQA 3LANA 1NK8A 1LV5A 4AHVA 1RA6A 3KLIB 3PW2A 1L3TA 4E1MA 1HYSA 2VG6B 2JEIA 3H08A 4BDYA 4IFYA 1DLOB 1S1UB 4KHSA 3CVKA 3H5UA 3NAHA 2IAJA 2D3ZA 3ALYA 3D28A 3HKWA 5HRRA 3KHHA 4HCBA 4KKOA 4NYZA 4G1QA 2KTQA 3LP0B 3BSAA 2UUWA 3V1QA 1C0UB 1T7PA 1Q8IA 4FVMA 2X74A 1ZYQA 4CK1A 4AHCA 1IKVA 4RG8A 5JS2A 3GYNA 1IM4A 2BDPA 1DTTB 4WZQA 2KW4A 4CFAA 2QKBA 4O4GA 4OLAA 2Y1IA 4DU3A 4M42A 4NLDA 1MU2A 2ZKUA 1RDDA 1VSLA 3S3NA 1TV6B 4OKKA 5C24A 2IM1A 1C1CA 3NAIA 3L3UA 1S1WA 2RPIA 3DLBA 2D0AA 5D3GA 4ECWA 1HRHA 2EHGA 4ZPDA 3G6XA 3I5AA 3OS0A 3DRRB 3ITHB 2FBXA 1JLFB 3RB4A 3CWJA 3OSNA 2FBVA 1HNIB 4ID5B 2J6UA 4B3OB 1HYVA 4FXDA 1A5VA 2W42A 4M95A 3AA5X 4GC7A 4BWMA 3G6YA 4MK7A 1D0EA 1X9SA 4KHWA 3GILA 5KFBA 4GC6A 4DL3A 3CDUA 2I1RA 1NOZA 3UR0A 3QNOA 3M9OB 1BIUA 4MK8A 1RTHB 5EWEA 1RBVA 3EPGA 3TVKA 2G8FA 4K4WA 1HJRA 1RAJA 1S10A 3RB3A 2BE2B 4CF9A 4QWEA 4RW9B 4H4OA 2F8TA 3IS9B 3TQ1A 2FBYA 3HVAA 2FJVA 4F3OA 3QIPB 4IBNA 4NYNA 1ZETA 2KQ2A 3H4BA 2DFHA 3AA3A 4DTNA 3HPOA 4IKFA 2V0NA 2IGIA 1RDCA 3HHKA 1T03A 4CGIA 3CFRA 3WNGA 5KTQA 2RF2B 3RRGA 3BQ2A 5C25A 3RBEA 4ZP9A 4JRQA 4DMNA 3DLGB 1HMVA 4M94A 3KLFB 4EO6A 1JLCA 4CJ5A 4YP3A 4E3SA 3V9UA 4XIUA 4NLTA 3MFHA 3P5JA 3V1RA 5HRPA 4DSKA 2BQRA 4C8NA 4DQRA 3KLHB 2ZE2A 3KMSA 4AHTA 5KFYA 2QV6A 2AU0A 3LP1B 1UA1A 3I5BA 3GIKA 3EY1A 3EPIA 3AO5A 3V6DB 4CFDA 1IKXA 5DLGA 2FJXA 4Q44A 3NH2A 3H40A 4J2EA 3HVTB 4LQ9A 4F4YA 4Y2CA 1WN7A 3OLBA 2X6NA 2I5JA 2XHBA 5F8HA 3KK3B 4YNQA 4KB1A 4FLTA 4BDZA 4FK4A 5F8IA 2E6MA 4IG3A 3QO9A 4EBDA 1J53A 4WFZA 4FZXC 4TY9A 3AO3A 4FJLA 1RT7B 4NLRA 5J2NB 2R8JA 1RT3A 5J2MA 1J5OB 3DDKA 3IG1A 1ZBUA 4TQRA 2C28A 4KHRA 1B9FA 5HBMB 2RDJA 2J6TA 3CJ5A 1JLBB 3T5KA 3MAQA 4XPCA 4ED6A 3OYBA 4LD0A 3RRHA 2AJQA 4OKJA 3SNNA 5L9XA 3SI6A 4TY8B 1D9DA 1SKRA 2F8EX 3HVRA 3PVXA 1RDBA 2ATQA 5F9NA 4BWJA 3VQ4A 5KRSA 4DQPA 4DSIA 4FYDA 4G1QB 2R8GA 4DTSA 3AO1A 3ZSXA 5FDLB 4W5TA 4KTZA 1S9GB 1N6QB 4KTQA 4B9LA 3IS9A 3VA0A 2YKMB 3SQ4A 3DLKA 3FDSA 4L8RB 3KK1A 1S0NA 1N5YA 4KHMA 1RTIA 4AHUA 5F8JA 3M9NB 2IBKA 1VK0A 4TN2A 5EWFA 4ELTA 1EETA 3QEWA 4OLBA 1NNDA 4DS4A 1TKTA 3V6HA 3DMJB 1S5JA 3RMBA 3OJUA 4CJQA 2ASDA 2NUBA 3GV8B 4E7KA 1LWEA 4F4ZA 5KFUA 4PWDB 3TAPA 4B9TA 4ECYA 1YTAA 4EBEA 3DLKB 3SFUA 1U48A 1EX4A 3UIQA 2R8IA 3ITHA 2Z1JA 1KLMA 3BSOA 4WE1A 3QEVA 1KVCA 5KFHA 1ZTTA 3GIIA 3M8QB 4DSLA 3TARA 3QLHA 4E19A 4ICLB 4DSFA 2VG7B 4F8RA 3LPUA 2JGUA 1N4LA 1C0MA 4DQSA 4H54A 1IKYA 4Y1DA 1HQUA 3OS2A 1JKHA 5KGWA 2YNFB 3H4DA 2ASLA 1FK9A 3GQCA 2DFEA 1EXQA 1JLAA 1K6YA 4NCGB 1VSMA 4NYFA 1VRTA 4Z4EA 1KHWA 4YMEA 3OYGA 2HNDB 1KVAA 4H4OB 1U4BA 3AA2A 4YFUA 5KG3A 2OYQA 4ZVFA 2KZMA 4DFMA 1TV6A 2C22A 4B9NA 3S3OA 3NMAA 4O44A 3CG7A 3I0RA 3ZT3A 4FLWA 3IRXB 3PW7A 3LPTA 2DFFA 4FM2A 1WSJA 4O3PA 3NL0A 4KI4A 4BE0A 3N6MA 4NZ0A 4EP5A 3AVBA 1NKCA 3LP2A 2JEJA 2IOCA 2KFZA 3KIOA 4DF4A 2I5JB 3K59A 1K1QA 2FVRA 3K57A 2DPJA 3RMDA 4Z4HA 1LAWA 4DLGA 3IGNA 3PW4A 5KT3A 1S1UA 4DS5A 1S49A 3O4QA 3RAXA 2FVSA 2HNYB 1RT6A 4M3YA 4QAGA 3SYZA 4QPXA 4KTWA 3PX6A 4FW2A 3K5LA 2RDIA 3ZSVA 1T3NA 2OPPA 1Z25A 2IM3A 4J9SA 3OYLA 1JLQA 3SUNA 2X78A 3NGDA 2VG5A 4CK2A 1ZBLA 4E7LA 1ITGA 1QE1B 4MK9A 1QAJA 1S6QA 3E51A 1LW0B 3RB6A 1KVBA 4ZPAA 1T03B 1TL3B 2VA3A 3DRSA 2HNDA 3SPZA 1IG9A 2XWYA 4JV2A 2VWJA 3MXMA 4CE9A 3VQQA 3C6TA 1KSPA 4E0DA 1REVA 4IRKA 3D0PA 4N5SA 3KLGA 4OKEA 2B4JA 2GC8A 1CXUA 3PHEA 4PY5A 3QGGA 1ZBFA 1RT1B 4KV8B 3I0RB 2DTUA 4M3RA 2QE5A 1SL1A 3A2FA 2VG7A 3N6LA 4ICLA 3BQ1A 3MR6A 1BQMB 4O3OA 5KI6A 3AVMA 4TQSA 1RTJB 4ELVA 4E7JA 1NJZA 2RKIB 1RT2B 4HKQA 4QCLA 2WRMA 3V9XA 3DLGA 5KFRA 1HYSB 4J9RA 4R5PB 3QINA 4H4MB 1HQEB 3O3GA 2HNZB 3PO5A 1VSFA 5JS1A 3LAMA 5L1JA 2JLEA 1BIZA 4ECSA 2OPSA 3PW0A 3ISND 3QLHB 1TK0A 1KHVA 4FJKA 2IC3A 3CDEA 3LWMA 4LSNB 4ECQA 2ZD1A 3FFIB 1TAQA 4NCAA 2XO7A 3AVCA 5KFKA 4FS1A 1L3SA 4U6PA 4Q5VA 3KJVA 1JXEA 3NF7A 4DTUA 4W5QA 3FQKA 3K2PA 1HARA 4J9PA 3VQ8A 4RW6A 1TGOA 3AA4A 3BGRB 3I0SA 3H5YA 2Q3SA 3PJWA 4LSNA 2AWZA 3DMJA 2ILZA 4DFPA 3SQ0A 4NCBA 4FZZA 2HHSA 3KKSA 2FLPA 4NLVA 1VRTB 4KHYA 1T8EA 3E01A 3NKYA 4KPYA 1DLOA 1UOCA 3CM6A 4E1NA 1BISA 4BE1A 4W5OA 4H4MA 1S9FA 1N5YB 1SH3A 5DLFA 4WFYA 4E89A 1GX6A 5HROA 4OVLA 4CJRA 3JYTA 3OL7A 3TAEA 4IR1A 4K8ZA 3HO1A 1X9MA 4NLOA 3L2UA 1C0UA 1RDRA 5KT4A 4HHTA 5KG0A 3PX0A 3BSNA 1NKEA 3DM2B 1I3AA 4Z0UA 3DM2A 4FJHA 3UDLA 2FJWA 1QHTA 1S1VA 1NHUA 2PY5A 3WNEA 1KLMB 5DQGA 4TYBA 5F8LA 3AV9A 5KFXA 3PV8A 3OL8A 4FBTA 4DL7A 2QXFA 4B9VA 3TWHA 1TKZA 2GV9A 3BREA 2YNGB 1S1XB 4FJ9A 3HT3A 3ZSRA 4N76A 5KT7A 3QZ7A 3RMAA 5CZ2A 2X6SA 4M3ZA 2JC0A 4KRFA 4KFBB 2B6AA 2YNIA 4KSEB 3LZJA 2P5GA 5C42B 4IRCA 4CJ4A 3NBPA 3QEIA 4EZ9A 1BCMA 4CIEA 3SI8A 2OPQA 2E9ZA 3KLGB 2XI3A 5KFSA 3SJJA 3Q8RB 2IMWP 3WNHA 4EYIB 3V6JA 4CJVA 1SH2A 4DL5A 4RNMA 3HL8A 3Q8PB 3DYAB 3MFIA 2YHBA 1KLNA 5E41A 4OJRA 4HUGA 3KD5E 3PR5B 3QEXA 2R8HA 4URGA 3ZSQA 4RW8B 4DEZA 3TAGA 4YR3A 4WYLA 2VG6A 2R8KA 5DMRA 3U3YA 2RN2A 1DTQB 2E9RX 3HSTB 4ZP6A 1RT4B 1I39A 4NRUA 2VWKA 4WZMA 4CJSA 5D3GB 3CYMA 1RA7A 3DYAA 3TAMB 1W25A 1Z4UA 1VSKA 4GW6A 2P5OA 1KTQA 3HPGA 3VQDA 3MEDB 4C8MA 3RAQA 3LAKA 4OGEA 4DWIA 1JLCB 3QYYA 2J6SA 5C24B 4M3UA 1QTMA 4PWDA 4CFCA 4KI6A 4O4RA 4CEQA 3U6FA 4IOBA 1RT6B 3MEEB 4CJWA 5KT5A 2C2DA 4FJMA 1FKPA 4JLHA 4FZYA 2GUIA 4KFBA 2YKNA 4BE2A 1IKWA 1ZBHA 3MECA 1EP4B 3NF8A 2WK4A 3MXJA 3KNAA 2R2TA 2JC1A 2HVHA 1WSHA 3TR8A 5EDWA 4ZP8A 3TAMA 3V9SA 1UWBB 4O3SA 2V4QA 4W5NA 3V4IB 2OPQB 4GVMA 4M3TA 3O3FA 1UAXA 2D0CA 3PW5A 3HP9A 4DTXA 4WXWA 2HVIA 3KLVA 5DK5A 4KKOB 1Y97A 2RKIA 4NRTA 4ZVEA 3F9KA 4K4YA 4CEFA 4I7FB 5EU7A 1NJYA 3AO2A 4ED2A 4KE5A 4ZPCA
chains in the Genus database with same CATH superfamily
1IBLJ 4QU6A 2QA1A 4FP9A 3KVGA 4ZJQA 1NK9A 2HHQA 4CEOA 4ZPWR 2GUPA 4IFEA 5KRTA 3IAS9 4LF9J 3KK2B 1FRXA 2BA9A 5DG7A 1Z6RA 3D66A 3FZHA 1OS5A 3VQ9A 4EEYA 2QMXA 2AYMA 4OZ5A 2IA6A 2IA0A 1X4FA 1LWCA 3MN9A 3FEXB 4CJPA 2WCXA 4XPEA 4WYBA 2P8IA 3CCSS 3OYDA 5KFOA 1BWEA 3C6TB 5F9LA 3V1OA 1F6TA 2FF3B 2HWTA 4UY8O 2HS4A 1IBCB 2BJDA 1GLCG 3R5BA 1U1KA 3PIPQ 4JS4A 4A8WA 2KXHA 2XEXA 2JSXA 3DOMB 4KREA 5KG4A 1U8SA 3VGVA 3ZTPA 4FK2A 5KFVA 2QWOA 2RUGA 4YOYA 3LW5C 2JJ4D 4UQGA 4OPKA 1Y5IB 5LXRA 2X1AA 4O5FA 4AL6A 2NZCA 2DEIA 2DITA 3O6WA 4HUFA 4H0XB 3BGUA 4QBUA 2E2OA 1NUEA 3ZT1A 2F8MA 3GIJA 1REGX 4YOEA 3SMSA 2AGQA 5AXNA 3A8KA 2YWGA 4L3KA 2QK9A 1CJTB 4LFBJ 3R5JB 2V67A 4DTJA 2DR7A 4CLWA 1SC3B 4K4XA 4FWPA 5HAOA 2W9CB 4YORA 2F9TA 3LZIA 2ZBQA 3OW2M 4HEA9 2R7RA 3AVHA 2NCKL 2IVFB 2LSNA 1XR5A 2HQCA 2E9TA 4UOHA 5I3UB 3OLAA 5J2NA 2LKZA 1VQ8S 2Q43A 2IBOA 3DLLQ 2O4GA 4G6VB 3JSMB 3PX4A 1HWLA 2KFYA 1QVGM 5I42B 3FCVA 4LFAF 4FK0A 3TZYA 3DI6B 5HP1B 5M1PA 5IT9O 2NPFA 4JI8F 3EZ5A 4J9KA 2E88A 3L4QA 4DQQA 3MN7A 3TX0A 2G13A 1U02A 4DMZA 4XDDA 2XTJP 2HW3A 2RIJA 2HRYA 4ZTJA 3AVJA 2GIFA 3LP3A 3VEYA 4X66J 2XNRA 2VASA 3GIMA 4F67A 2EXUA 5E84A 3G6EN 1LWFB 5HLFB 4DU4A 3OYNA 3NAEA 4NMLA 1MWYA 2E1CA 3O9SA 1FNOA 1LXJA 4CT9A 1XMOJ 1GFWB 5DM7Q 1RT5A 3D2FA 1MN7A 2QEXN 2GJ2A 2XI2A 1ASVA 1RLCL 3D9BA 3VZHA 4JI5K 2KT5A 1D9FA 3FZFA 3MEDA 1S77D 1XR6A 1EQYA 4JKHA 4E7IA 3VQEA 3PJXA 2I7NA 3EX7B 2BR0A 2E2QA 1AYEA 1WEZA 4M63C 1O1WA 3ATUA 5F8GA 4CERA 2K1RA 1RT4A 5MLCQ 2MKSA 5ETOA 4J9LA 2KZZA 3BDPA 1NK5A 5DDOC 4PQUA 2NR0A 3U9DA 1IR0A 3K5OA 3OHBA 2UUBJ 3G10A 3M8QA 1DQAA 1SC1B 4F3TA 2A6OA 4A4JA 4B3MF 1U1PA 5SWMA 5C15A 3AOCA 1MMNA 2J76E 2OA8A 5KFMA 2NRTA 4JKAA 2M7SA 2YXLA 2AYEA 3UI3A 2QC3A 3T1HJ 3J8AA 2XY8A 2BQUA 3L7OA 2QWPA 1R8CA 5B0GA 3VCDA 5EWGA 4O4GB 2CJXB 4IG0B 4OYBA 3P8BB 4HR2A 1S6OA 4ECZA 1ZXOA 3DKDA 3KK1B 4KQZA 1JKHB 1S59A 3K0SA 1RYSA 4FCYA 5EXWA 4HYKA 4DTRA 1XNQF 5LJ5Y 4CHOA 1MW7A 2GO9A 3L2QA 1S1TA 3FRYA 1FD8A 3OW2R 2ITGA 3CCUN 2E7WA 3CM5A 1OH8A 1J54A 1H2UX 3W5YA 2A6AA 4NI2A 1K1SA 4CJKA 4FSVA 1FTCA 3J7YP 4RKUC 1G3OA 3VQ7A 4F50A 5ADXA 4O5BA 1KFSA 4J2DA 2R2UA 3MM5B 3JS6A 3RWUA 1AUSL 2GQ2A 4CHPA 3TAFA 1WBDA 4LF7J 1NZAA 3LP0A 1FXXA 2NS1B 3CDWA 3VEZA 2UUTA 5KFNA 1QSSA 1K8KB 3O1BA 4JKDA 1SCJB 5LL6Z 3P1GA 3Q0AA 1OPZA 1NSPA 3GE9A 2MDAA 3V4IA 1F3FA 4USVA 4O3NA 4ECXA 3SMZA 4C3KA 3MMAA 5DS7A 5SZTA 5J2QB 1SV5A 5K9FA 4RW4A 1Y64A 3OTDA 3DFEA 1NCLA 3D5MA 3R5AA 3V9ZA 3S8SA 1MG7A 4CLFA 2R7YA 2BE7D 1U0SA 2FJEB 5EY4A 2CRLA 2B43A 3R3LA 5DDPC 3QT7A 3NF9A 3DLEB 2B9WA 1VSIA 2Q6CA 4M8LA 3AXKA 1Y4ZB 4W92B 3TUZC 1WC1A 4ZVPB 2P9KA 1C1CB 3ZTOA 3BPDA 3JYTB 2D0PA 4YY3J 1CJUB 1N36F 4RW8A 2V94A 1VQ9S 4HVJA 2E5HA 5GAHU 4ED5A 4IR9A 3SDEB 4MLHA 5CR4A 2CWKA 5LXYA 1JLGB 3SQ2A 2J0SD 3NCIA 2C3MA 5C25B 4DR7F 4DV1J 1J5OA 3JSRA 3MMAB 4B1VA 5FJ4A 3WIUA 4KV8A 3BZCA 1RT1A 4Y2IA 4WFBQ 4DCHA 2XHCA 3H2VE 3KXDA 4EUVA 4QWAA 1S7IA 2ZC4A 3WZ0A 4USWA 4OIXA 1JLQB 4LF4J 3IAYA 4USKA 5GAHP 4FJ7A 1UEKA 1U09A 2OHDA 3KKFA 5CH7B 3R2DJ 2Y1LB 4PG6A 3GV5B 2DR9A 4TSXA 4NB4A 3AVKA 1NO8A 3SLCA 3MMVA 1SPBP 3NGUA 3THYA 5GADI 3QETA 3H7HB 4B3SJ 3PFEA 3HHDA 5HBMA 4N56A 3ULEA 2CADA 4ZDNA 3CUNA 3VEOA 1PG5B 5K20B 3OUYB 1L5UA 4TY8A 2A3JA 3TI0A 2QM1A 2C2OB 1RWNB 1C0TA 3ZT0A 3SEOA 4XH4A 3CIZA 2CDQA 3ZZOA 3SFGA 5HVFA 1TK5A 5MAOA 2RDDA 2RNEA 1WSRA 2Q0UA 4IG0A 2PZSA 1JXLA 4KHQA 3Q23A 1YJ9N 2IJRA 3M2VA 2ZJQQ 3GLJA 2QI2A 4LF9K 2FLNA 3CXCR 2DXFA 3M8RA 2V50A 3QERA 1BI4B 2QWMA 3EL2A 3UKRA 4BC3A 3OYAA 3OVNA 5M1NA 3FJ2A 1UVNA 1YBUA 4EAHD 1KFDA 1J6ZA 3I32A 1TYQA 1NJWA 1UA0A 3M6VA 4CJFA 2DNRA 1Q7YT 3SBTA 4LSLB 5GMEA 1HFEL 4C4WA 4EHTA 2IVMA 2WW8A 4KY3A 1ZH5A 3LPYA 3MM5A 1IH7A 3W9IA 4MQ3A 4F4WA 3HMJG 1GOCA 2UU9K 1B7YB 3CJ4A 2R2RA 1N0VC 1UEVA 3A8JA 4NI2B 5AQSA 3S01A 3PXGa 2PEBA 4QIEA 4URSA 4Q43A 4M5GA 4FO0A 1W0HA 2IAJB 4JI4J 1BCOA 1RT7A 5HROB 4CLPA 3RR8A 4Q2MA 1Z26A 3H1QA 4XH1A 2CQ1A 3VVTA 4DSEA 1HR0F 3CW2C 5GAGU 3SUPA 1XBWA 3U27A 1M5PC 3VMFB 3ZX2A 4FLVA 1S48A 1LOTB 2JEGA 2ZKTA 4AH9A 4EBCA 3BH7B 2HB5A 3WQPA 2Z2LA 3SCIE 1FXRA 2DGSA 3PLAA 2W2QP 1YJVA 2KKZA 5IOLA 5BPLA 3O44A 4JI1J 4RZRA 2MKJA 4IH6A 2XZDB 2E7VA 4BDPA 4MKYA 1OVYA 1MA9B 5J1EA 2ASMA 2SXLA 4H5TA 3DI6A 4MT1A 3PY8A 1FF2A 1LK5A 2BUNA 4H4KA 1FWKA 3DDIA 1RCXB 2C2KB 3FNNA 4OHVA 1WI8A 4B3RK 2DB1A 4K4UA 3W8PA 2FZGB 4DV7J 4OZ1A 3L7UA 3TANA 3BQ0A 4OX9J 5AE1A 4LF2A 2DPIA 1JCEA 5I3UA 4IO8A 3I4PA 4GVEA 3M6GA 4W5RA 5BRHA 4NXMK 4NXMJ 2BE2A 2FJBB 4ELUA 2EBGA 1L3VA 4KAIA 3TTCA 4BRIA 3RBZA 4GKJF 2KVQE 4ED1A 1BA1A 1OH5A 4X65K 1GMVA 3EO3A 1KNZA 4K5RA 3CTRA 5IT9Y 1W2BM 5KFLA 1LW2B 2IM2A 3K5MA 4A8SA 3ULEB 2R7OA 2WBMA 4WXOA 1NGFA 3VERA 4R8UB 4OZLA 2CJQA 4IKAA 3NG8A 3DRSB 2XMKA 1BUPA 3DLRA 5BREA 1VHFA 3R9PA 3Q8SB 4NLGA 3EGNA 1TL1B 5IV4A 1SUQA 3HK2A 5F0XA 2LYVA 4DV1F 2K2PA 1VS3A 2CYYA 2VFTA 1RAOA 4LREA 1U1MA 2P1JA 1H7XA 4Q0BB 1VC5A 2H3GX 2A5XA 3MR5A 4RBVA 4RBUA 3HM9A 3TAQA 3EWGA 3S9HA 1GNKA 3FBEA 1SUQB 1QS4A 4L73A 1CXQA 1C2PA 4ZIWA 3TVYA 2OPRA 5RUBA 1CZBA 1LWCB 2KU7A 2WVBA 4GV6A 4KYZA 2YNHB 2KKHA 3CMQA 1V5IB 3PO4A 5BJRA 3I82A 2WBNA 2DK2A 3CSKA 5CYQA 2EW9A 2F9WA 3VAIA 2VHGA 1V5VA 2DR5A 7FD1A 4ZP7A 3I5CA 3OXGA 1Y5LB 4A61A 4AE5A 1XMQK 4O0IA 4Z4GA 4NMXA 3H59A 3DLEA 1D09B 4Y28C 1VSDA 5JXSA 4O3QA 4DR4F 3VAFA 2GWJA 2MHEA 5AQZA 3CDBA 4K4SA 3J7AN 2G8KA 3CJQA 3OBIA 5HJXA 4FPBA 1VSHA 4F3MA 3UFCX 3ULDA 4YB7A 2FXUA 3OVSA 2V9WA 3FSIA 1HPMA 5KFTA 4LJMA 1RFQA 3ZEUA 3HVWA 3VWSA 2CQ2A 2XRIA 1Y11A 5B0FA 3BEXA 2O8DA 2W24A 4GV3A 5K8NA 3TU5A 1WF2A 3ICLA 4DV0F 1AW0A 3M7VA 4DQIA 4CLKA 1WKJA 2IMOA 2IDOA 5AQYA 4UF4A 2EX3A 2O3DA 2HFNA 3HX9A 3T7ZA 1CS4A 4B08A 1UW4A 4AL7A 4FDFA 3MCAB 1KCFA 1RACB 1NDKA 3LANA 3A1YG 1NK8A 2IRXA 1LV5A 1DJ0A 3KHYA 4CLTA 1HYSA 4ED4A 2JEIA 3VAMA 4YS2A 4KHSA 4C0OC 1WBBA 2IAJA 4QYRA 3FMWA 3KHHA 2RQMA 4HCBA 2K3IA 1ZOTA 2H1YA 2PT0A 3BSAA 3BN7A 4ZVOB 3W60A 3V1QA 3DLLL 3L4BC 4FF3A 1Q8IA 1XERA 1BA0A 5BYSA 3ET6A 5AXMA 1J27A 1IM4A 2KW4A 1KEKA 1TFYA 5LJ3Y 3C3LA 4O4GA 3R7NB 4MLEA 2GCFA 2Y1IA 4P2MA 2ZBCA 3QFUA 1RI7A 2UUAK 3FZKA 3P3DA 1UJ6A 1H74A 2AIRB 5C24A 1VLOA 2YKOA 1C1CA 3G2XA 4PWUA 2AYGA 2XULA 3DLBA 2EFGA 2I8EA 2K8GA 4BRGA 1YHQS 3WUHA 4ECWA 2JOQA 5FLXY 2GQQA 2EHGA 2NRZA 2FSKA 4FWQA 3PG9A 2MJUA 3DRRB 2FBXA 6FD1A 1RWOB 3OSNA 2IIRA 3CWJA 3DNCA 4DBQA 4ID5B 2J6UA 3CPWM 1I51B 4FXDA 2WB1D 1UFLA 1A5VA 3DN9A 2FZKB 3N79A 4GC7A 4BWMA 4E8UA 3LM2A 3NOGA 1D0EA 4KHWA 3GILA 2LU1A 3WX4A 3Q24A 1TUVA 1YSJA 3CDUA 1X9JA 2CNNB 3VESA 2I1RA 2E29A 3UR0A 3DXSX 2CPZA 3EGZA 3M9OB 5IT9U 5CHIA 3TZWA 1IBLF 3TVKA 5HMWA 4A5AA 3KK7A 3UCUP 1WUAA 5LL6d 4K4WA 3D7EO 4Y2KA 1Q5YA 2GMHA 4BGAA 4QWEA 3M2RA 3CJ9A 2F8TA 3SCKE 1UEUA 4EFAC 3A8YA 1ZETA 2MMYA 3PYDA 3H4BA 3IWLA 4DV6F 2DVIA 2YWHA 3S41A 4DTNA 3HPOA 4AL5A 3B4MA 4IKFA 2IGIA 4UQTA 1J5EF 1RDCA 4YOTA 4WIQA 5LMUJ 3VHQA 2N3OA 3QBCA 2RF2B 4L3NA 4DL0C 4RBTA 2F7VA 3BN4A 5C25A 2B4OA 1D3WA 3NOCA 2CFXA 9RUBA 3PSFA 1HMVA 7FDRA 5KOXA 1JLCA 4E3SA 2BACA 3V9UA 4XIUA 2BM1A 4A8YA 4DQRA 3KLHB 4DDFA 3BBFA 4DHYA 4ILJA 1NDLA 1T9WA 3LP1B 3D7SB 3I5BA 2AT1B 3CERA 3EY1A 3EPIA 3V6DB 4CFDA 2VC1A 4QR1A 4DV3K 2FJXA 2I6WA 4Q44A 2CVIA 2DNPA 3EGWB 4I64A 2PSZA 1XNRJ 1EJ7L 4KB1A 6FDRA 1QHAA 4FZVA 4DV0J 4ZLNA 4H5RA 2O8EB 2H4YB 2H54B 2IRYA 3NCQA 1FDBA 1J53A 2J9EA 2MQOA 1WC6A 1YJUA 4TY9A 2VZ9A 2VJUA 4DV5K 4FJLA 2LDIA 4NLRA 5T7LA 1GH8A 2Z56B 1Q82O 3B4DA 4OYWA 1HWKA 3W0LA 4CT8A 5HVGA 3IG1A 2FIUA 3OPKA 4TQRA 4KHRA 1YZ7A 2YHXA 2RDJA 3FEZA 3MCSA 2P9EA 4XPCA 3C19A 3NGRA 4WU3A 1NLKL 3O80A 5L9XA 3SI6A 2J5AA 1D9DA 3H6EA 2EWHA 1Z2LA 2FUG9 3DOMA 4DR4J 4WQ4A 3HVRA 5DDQC 4F04B 2ATQA 4OI4A 4DSIA 2MSSA 2HBMA 2YHWA 4DTSA 5HANA 1YBAA 2OD6A 4OHWA 5FDLB 3BGFA 3ZSXA 4KTZA 5DZ7A 1SZ2A 1WOPA 3IS9A 1JK9B 1SC6A 2AZ3A 3FDSA 1XMQF 1S0NA 3VETA 1RLDA 4CH0S 4JKBA 3C15B 4M7YA 1Y00A 3NRBA 5B0EA 2ZJPQ 2B9EA 3AA9A 5HL7Q 1NNDA 4DS4A 3W64A 3CMES 1URRA 5AQUA 2VL1A 1VHXA 2ASDA 1LOUA 1PGZA 4Y65A 3NS7B 3C15A 3TSPA 3F9MA 4E7KA 5AQMA 4NXNF 1NGJA 4B9TA 2CNLB 1YTAA 1U48A 2Y3YA 1Q53A 2RHQB 2R8IA 3MPYA 4UY8T 3CJBA 2ZHOA 2Z1JA 1KLMA 2RAQA 3QEVA 2C1EB 1B7FA 4ZLPA 1ZTTA 3IBCB 4KH0B 1PBUA 4ETZA 5KQDA 1NZ8A 3QLHA 2F5GA 4TU7A 2RVJA 2Z30B 4XK8C 3LPUA 1KAZA 2JGUA 5AE2A 1C0MA 3Q89A 4K0KK 1LNQA 4I68A 3NWRA 3OTCA 4Y1DA 1HQUA 4E2FB 3OS2A 5B7WA 5ELZA 2ASLA 2DFEA 4KH4A 1V4TA 4B1YB 3R7BB 1IUJA 2KT2A 4NYFA 1X5SA 3GFHA 2UU9J 4YMEA 1KHWA 3OYGA 4H4OB 1U4BA 3PYFA 1EKSA 5JICA 2OYQA 3BEGB 1UZHA 2HIQA 4B9NA 3EVMA 2AEMA 4O44A 4WU2A 3A3PB 3IRXB 3QFHA 1K9MO 1S5ZA 2IDLA 3TSQA 1BU6O 3H45C 1YF5L 3D0IE 3SBMA 4EP5A 5L39A 1NKCA 2KFZA 2VONA 3KIOA 4DF4A 3QWUA 2DIVA 4FOIA 1VJQA 4DLGA 2E5JA 2YX7A 1DGKN 4PABA 4DCJB 2LFVA 4NZ6A 4M3YA 4QAGA 4S0MA 5THWA 3TNVA 3SYZA 3LQVA 4PKIA 1HNZJ 2YJFA 3HSZA 4MYUA 3ZSVA 4WP3A 5JLFA 4CZHA 3WX8A 3BZKA 2IM3A 4J9SA 1VQ6S 1HLUA 1JLQA 2X78A 3MD1A 4LC9B 1CLFA 1QD1A 1J5EK 4E7LA 3R97A 1W7WA 2HKEA 3W7BA 2YBVA 4OI6A 1YVNA 1QAJA 3E51A 1LW0B 2HQDA 3TEHB 5E3RA 3D1OA 1H98A 4JKCA 1SQFA 2Q1NA 3EVWA 1JJ4A 4OQJA 1IG9A 4JV2A 2QLFB 3D4JA 2CG4A 3FZBA 1KSPA 4GO7X 1N32K 4N5SA 2BKPA 4OKEA 2BJEA 1RWVB 4WKRA 1CXUA 3KUGA 2M4MA 4JI4K 1RT1B 4KV8B 3I0RB 3B8HA 2QE5A 3O1LA 3N6LA 3BQ1A 1ROFA 1BQMB 4O3OA 2DRAA 3GP9A 1TUYA 1N8RT 4ELVA 3P5BP 1NJZA 1HW8A 2RKIB 5E7OB 2DGWA 3ADAC 2C3OA 1O8BA 2HVDA 2VIHA 1HQEB 3O3GA 3ZZRA 3HSJA 5L1JA 5GADP 5A2QY 2IVYA 1BIZA 2XNQA 3P96A 1TK0A 4KH6A 2DR6A 2LA6A 2IC3A 4WTYA 3C14A 4DX7A 3MMBB 2AJ0A 4DV4K 5JJBA 4HH0A 1E6VB 3G82B 1FX2A 3U8XA 4WP9A 1VDHA 4U6PA 3KJVA 2RUSA 2Q2RA 2M9KA 2VC0A 4RWTA 3BPSP 1TGOA 3PCOB 1HX1A 2PO4A 4DZ6A 4LSNA 2ILZA 3QB0A 3M5RA 3T6JA 1WI6A 1HA1A 4NLVA 3OXFA 3GFZA 3VAHA 4K25A 1DLOA 1APSA 3ENBA 1K47A 4FPIA 1BISA 1S9FA 1WHYA 3NNHA 5DLFA 4V19X 4WFYA 1GX6A 4QQBA 1BOTO 4USIA 5HK4A 3AB4B 3F44A 4K8ZA 3TUPA 1X9MA 2QMUB 4ZN3A 1NGIA 1RDRA 5ETQA 4HHTA 1MSWD 2OEMA 1NKEA 3DM2B 4Z0UA 4CNYA 2VBWA 5AXLA 3UDLA 4B3RJ 1KLMB 4H4KC 3J80U 2HK2A 2UV8G 5KFXA 2GFFA 1FD2A 2KB2A 4KH5A 2QLJB 3THTA 4FBTA 4B9VA 5MLCV 1TKZA 3T69A 2GV9A 1HL6A 3BREA 1S1XB 3MPUB 4B02A 2QTDA 1XC3A 5M2UA 4A47A 3U1MA 3RMAA 3IA0A 4M3ZA 2KYXA 1CZAN 3W2WB 2ZWHA 4ISEA 1QAYA 3G8SA 5C42B 3NBPA 3QEIA 3MXHP 5HN0A 1BCMA 5H9EJ 5BR8F 2MZTA 2XI3A 1RTZA 3QATA 3PIPL 4DU8A 2IMWP 2RQKA 1IBKF 2VQFK 3CCSN 2UYTA 2WW4A 5D6GA 3GWCA 1XUPO 2LU2A 5E41A 4OJRA 2V8HA 1VQSA 1F5CA 4X64F 2F4VK 4PXCA 4DEZA 2VWBA 3OR2A 3TAGA 2R8KA 2DO0A 2OTLS 2RN2A 1DTQB 3HSTB 4ZP6A 1WDTA 1RT4B 1TL7A 3AQOA 4BR0A 1NGEA 4WWSA 3SAFA 3CCWA 3THPA 4DOZA 1Z4UA 1VSKA 2OSQA 3HPGA 3MEDB 4DWIA 3QYYA 4BGBA 4ZVSB 4M3UA 1WC5A 4DV1K 3U6FA 1VOMA 4CJWA 5KT5A 2C2DA 4FJMA 2ZWPA 5AFUA 1JCFA 4JLHA 2GUIA 1VHIA 2YKNA 2NRVA 1IKWA 1ZBHA 3MECA 2D74B 3ZTSA 3K9JA 3NF8A 3MCPA 2WK4A 3MXJA 3LDOA 2JC1A 3J7A1 1UPPA 5EDWA 1C0FA 4ZP8A 1VQKN 5AZJA 1R6VA 1OY6A 1IBMF 1WC4A 2V4QA 2OPQB 4CH1A 2XMUA 1UAXA 3AFGA 2OMLA 2ATCB 1H1VA 1TUWA 1HQ2A 2IYIA 5AJ3K 1WWHA 3KLVA 1ZPVA 4NEYA 4NASA 4N8OA 2KYZA 1HWUA 5LMNF 1VQ5S 4ZVEA 1AFJA 3NGTA 4Y00A 1F5AA 1JNRB 4KE5A 2G8HA 2CWXA 3ELHA 3AOAA 4PPZA 1JL2A 1IKYB 3VQTA 1U7LA 5DM6Q 4PXDA 5HJYA 4JI4F 5JVGQ 3V5RA 2DY1A 1KVKA 4FJNA 3TABA 1OYEA 4CEDA 3M8YA 3G71S 1MU2B 2HGNA 1OY9A 5E33A 3R1LA 3UN5A 4DR3J 1HLWA 5CY4A 4KGZB 2O8CB 1RDAA 4NLQA 4TYAA 1CVJA 2GNKA 5AFUH 3CQ8A 1YVUA 3MECB 2KFNA 1BI4A 3VTIA 1TMJA 2G8WA 3NNCA 4JB8B 4Q45A 2KO1A 3JQJA 1X9WA 2O8EA 3C6AA 1UAWA 4HDGA 3AAPA 3OY9A 2Z1HA 1VBYA 4PG5A 4PG7A 1LEOA 3BF4A 3VN5A 3OS1A 3T1HK 3M8PA 2IC3B 5AQPA 5D0EA 3MHYA 1S76D 2HVEA 4YN3B 1VQ4N 3DLHA 4M5DB 2K06A 2A6MA 3V6DA 4DCPB 1F2GA 1NOYA 4ZVRB 1UVMA 4O8KA 2CH6A 5KG6A 3IR7B 4IOCQ 1FDDA 3PZPA 2QWRA 2UXBK 3PEHA 2YHYA 2QXLA 1SJ3P 4I4BA 1MMLA 2AJ4A 3UVJB 4X62K 3ILLA 4DR7K 2AEJA 2HBJA 2EC0A 1HBOB 3CMEN 4ZHRB 2KRBA 2HHWA 4E7HA 4DHVA 1S22A 3AVAA 4EMDA 1T95A 2M0GB 2GVZB 4KBIA 1S0OA 3CPEA 5GAGI 3EICA 5M1FA 4MFBB 3MR7A 3M1VB 3P83D 4EIAA 2WTFA 5KT6A 4QOZB 3IDHA 5DGAA 2VH7A 4GVBB 1B92A 4UOGA 1FRHA 4R0EA 2IS3A 4ZVTB 4U8YA 1XMOF 2IM0A 2MQMA 4LF6J 3SZ2A 2M8HA 3FUYA 1RHRB 5GAEP 1IV0A 3IGVA 4CHYA 2BW7A 1OYDA 4CLUA 3DOKB 3HHLA 3BBCA 2NZTA 1SQKA 2FTRA 3CEDA 3EE9A 1PJ6A 2RU9A 3GG1A 3GV7B 3E9OA 4QW9A 3QBXA 4HH1A 1YDLA 4JI8K 4XTTA 2G8IA 5D0HA 2QFJA 4YQWA 1FVQA 2PC6A 3MEGA 1U1NA 4I7FA 2BE9B 5IV3A 2V52B 4LSLA 3QGHA 2WB4A 4CEEA 3VR1A 4C8OA 2CJBA 1EP4A 3BS9A 3ZT2A 4LF4F 2OH2A 2FD2A 4AHSA 5B0CA 1KAXA 3J81j 3NHGA 1RTIB 4CEZA 2O8FB 4O44B 1FRLA 4YR0A 3I56S 3ZCMA 1HNVA 3BJYA 4JI5J 3KUEA 4EU0A 2NXCA 1GOBA 3I96A 4DPYA 2KHDA 4I2QA 1H2VZ 1U2FA 2H5EA 5GINA 4ZTFA 1SQEA 2CJAA 5E3PA 1R8PA 3SPYA 3I9V9 1JLFA 5L1KA 2W40A 4RNFA 4IFVA 1R59O 1N32J 4Y3CA 3TVZA 3QJPA 5L1IA 3VQBA 3K7RA 1U49A 1RZMA 2PFDA 2X1FA 1OH7A 2PEHA 3M30A 1QDUB 1A6LA 2Q1LA 1HYZA 3PIOQ 5CYQB 3UWTA 2AGOA 3HRGA 4CLYA 2HMIB 5DM7L 4IO9L 2XCAA 5A8RA 4J9MA 1ZC6A 3GL1A 3NF6A 1RBSA 1ATNA 4CZKA 1QSLA 2L9DA 4TXSA 5KT2A 1JIHA 2N7CA 3CCES 4DV4J 4PRFA 2D5RA 2EK1A 1FFWB 3T5LA 3F2KA 2ZD1B 4CIFA 4BACA 3H3OB 5B8HA 5F41A 3OJSA 4C8LA 3AVFA 4O3RA 4DTMA 3UVJA 1XNQJ 2HZVA 2I7PA 3C7NB 2RS2A 2PFFB 3S6EA 4TLQA 4CZEA 1SKWA 2CQ0A 2ILYA 3OVAA 1U24A 2W25A 3KHRA 4IYQA 5EVZA 1RTJA 4OPJA 1UVLA 5IM0A 4FNIA 2H48B 4CO3A 5IQQA 2MB0B 4IOAQ 2FJDB 3IG1B 3T1HF 5E3QA 4IFYB 3RR7A 1BHLA 2N7YA 1XEZA 1F9FA 4RW9A 2LCWA 5JUMA 4LSZB 2G8VA 4DLEA 4PHTX 1SVDA 3KJNB 4DCOB 1KP6A 1ZA2B 1X3NA 2VDHA 4Q8EA 3THWA 3JXUA 1N88A 2DKOB 4C2MA 2UVUA 4DV7K 1U04A 4PXEA 2OMOA 1TK8A 2CPDA 5IM0B 4I9QA 4DN0A 1SL2A 2XCPA 1RT5B 4Y34A 2BYCA 1HHTP 4QR2A 3OYKA 1YJ9S 1BUXA 3LP1A 3J7Z5 3QO9B 4J9NA 3W2VA 1G15A 3QJJA 3AO4A 1NPKA 3WQUA 4Q0BA 1N5SA 4B3RF 3IM9A 1HBMA 2GMLA 3N4QA 3OTBA 3ZXWA 3ZSYA 1IKXB 4ZLLA 2RF2A 1UW9A 3QMLA 3NGZA 3JSYA 2VB6A 5KFEA 2XY7A 4ATNA 5EGYA 4LFCK 3O9TA 2W7OA 2VICA 4NLSA 4B3MK 4CZFA 1Q5VA 2IVNA 4CBUA 2ACYA 4BR9A 2HFUA 2EFQA 1T9VA 5KFAA 3CCRS 1RNHA 1TVRB 2BGGA 2UXCF 1YJWS 1V9OA 5AXKA 3JQMA 2K7KA 3H5SA 2J7KA 1DAXA 4WYWA 1NSKL 2Q0RA 4Z7CA 3VZIA 2DHHA 2QN6B 3CCQN 3CJ3A 4I67A 1CJKB 3ASMA 3J80Y 2ZE2B 4DL4A 5FLXU 1REVB 3ISNC 4K2XA 2EKYA 3OHAA 1S6UA 4CJUA 3CCTA 1IO2A 4CESA 1X31C 1QJHA 3TYTA 4I6MA 3EE3A 4CGFA 1X4GA 4KB7A 4PL8A 4U8VA 3TRGA 2R42A 1BGXT 4HTIA 2QWNA 4RL1A 2Z8QA 2B5JA 2KI2A 4V19S 4XO0A 4G65A 4CJTA 3FRZA 3IN5A 3EYZA 3J7ZT 2QA4S 1NRKA 2YH0A 3L7PA 1WACA 1VCTA 4JP8A 5F3ZA 1UJ5A 2G4BA 2NSCA 3C6UB 4MMOA 3D54A 3E2EA 1FEEA 2L9WA 5M1KA 2WONB 3U7JA 4LT6A 3OSPA 3UCGA 2VFRA 3OYCA 3QIOA 1NGCA 2QLWA 2D3O1 2KL8A 3BO3A 4AF1A 2UV8A 1I3OB 3D0GE 1U2VB 2GHVC 4NLCA 4DG1A 2HS0A 4JI7J 3VOVA 1R8BA 4JD2A 4QZVB 3R1XA 3CJ2A 2RJZA 2WOMA 1N6QA 1JJ2R 2M70A 1DZ5A 4OL8A 2R7UA 3P6YC 4LH5A 3NDKA 4C11A 3AJ2A 4FXVA 1QUVA 4DV6J 3FCWA 3A0IX 4KRWA 4DZDA 2J0QD 1NGAA 3ENQA 2ZHAA 2YCHA 3FMBA 3G8TA 3B6PA 3C46A 4C0BA 2XMMA 3UB5A 2DISA 4ZIVA 3PRDA 1WELA 3CCVS 3HZGA 2U1AA 4USUA 2GBZA 3PSIA 3DGPA 2Z2MA 4ECUA 1OIAA 4USJC 4HCCA 5CZ1A 4UUXA 4MDBA 3TOQA 2RB7A 3PRVA 3OA9A 1KVJA 3OL6A 4CO5A 2ZJPL 2M52A 2DPNA 4IRDA 5A2QO 4RW7A 1KTVA 2XMWA 3C95A 5AQRA 2HBQB 4V1Ak 4ILGB 2FJAB 2DGQA 4ETXA 2D0BA 3D45A 5I3QA 4LRFA 1QLNA 1IQTA 4RNHA 3MK6A 4O23A 4CBXA 2V34A 2D7SA 3EDQB 1U25A 1VYAA 3RMCA 1FK9B 1J2VA 3AVNA 3HI9A 4NWBA 5DGBA 3SBGA 3C94A 5BYQA 2DH9A 2OI2A 3J81O 2NRRA 1S4EA 3CI5A 1GK8A 3B54A 3NMUA 4OI3A 1XJWB 4ZPBA 2GIQA 1IBLK 5AQVA 3FC9A 5IXUA 1NK0A 4TKTA 3LDNA 3THVA 3CFOA 3PEJA 5HQMA 5AQJA 4ZMMA 1FKOA 4MH8A 3KLEB 2QO3A 2NRWA 2A1SA 1N48A 5D0RA 2EFNA 2UVWA 1LFWA 5A8WA 1B70B 2JH3A 3ZTRA 3GMGA 5DZ6A 1NMEB 2P9IA 2VPXB 3KNGA 4TU9A 1PC5A 3TZXA 2HWHA 4ZS6A 1Q9YA 5CCLA 4Z37A 3M9MB 3H42A 1RBRA 5GAEU 2YKQA 2XSJA 2W2OP 4BQLA 1YVFA 2JLFA 3LA0A 1WKKA 4PG4A 7AT1B 4FBUA 1A5XA 3HFVA 2JDJA 2HMIA 5FLXO 5E3CA 3MX5A 4FJXA 1N33K 2KG1A 5CZXA 1RWPB 4F0HA 4MFBA 3HVTA 1HKBA 4W98A 5C0YA 3PUFA 1WHWA 4JV0A 3DGPB 3J81Y 2YNFA 4AQYF 3E8OA 4DUYJ 1TQLA 5IZHA 1X60A 3GU0A 1FW6A 3L2WA 4NL5A 4Q8FA 2D41A 2F4VF 3VAKA 4PUOA 1ZM4A 5M2PA 3SAHA 4OO1J 2WHOA 4X4NA 2ZC3A 2XGQA 4DB3A 3CCMS 1S1TB 3AB2B 2B9XA 3I31A 1FT8A 2UVRA 2GWKA 2VUGA 4CW7B 1X0FA 2XS5A 3K58A 3R6GB 3BM7A 4IO1A 5CE3A 3FKBA 3ZSWA 4ILHA 4QIWD 1WF1A 3NXZA 5J2QA 1MN9A 4C8YA 5D4NA 1JXBA 1TELA 2D9PA 2XY6A 1DTTA 4F2RA 3WNFA 4LBHA 3MURP 2GJFA 2GIRA 1S6PA 1HNIA 2EVZA 2J8SA 5HRSA 2P9NB 1YRXA 3ZZUA 1OWXA 3CJCA 4RNOA 3MAAB 2RQCA 3CETA 2R7QA 2OTJS 2ZDPA 3SUQA 4IZ9A 2V63A 4YDUC 1VC6A 5AJ3F 3WXLA 3GE1A 4DR6F 1HQUB 3KLIA 4B9UA 4K4VA 3JTNA 4IEEA 1NJIT 1ZTWA 3W61A 4B8AB 3RAMA 4KHUA 4KPCA 2OANA 3NNAA 3CE8A 5A0YA 5FROA 1Q16B 2DR8A 2ADCA 1K8AT 3NGSA 2V8PA 1XMOK 4ED3A 2BH1A 3EXCX 3KWIA 3HJFA 2EK6A 3DOLB 5KFZA 2NQPA 2YKAA 2E1PA 3DXBA 4FWRA 3TTFA 2NUUG 1JNZB 4NXMF 2D3UA 2HHTA 4IO9Q 3NS6A 4B1WB 2NSBA 4OPHA 1LWFA 1IKWB 5HLFA 3ZFVA 2MQQA 3SSRA 1WNEA 1VQLN 3J80O 4FYWB 4PKDB 6AT1B 3QICA 2XZTB 3KLIB 3LDLA 4JKGA 2XO6A 2UXDK 3UE2A 2GAGC 1DY3A 4BDYA 3CDAA 4D3GA 1DLOB 1S1UB 3CVKA 1T9TA 2E1RA 5C2CA 4DR1K 3D28A 4FL9A 3MAAA 4WPAA 2KTQA 3IBFB 4LFBK 5JVGL 4J8FA 1C0UB 2CQIA 2LLZA 3IWNC 5JMVA 3W2VB 4FVMA 1ZYQA 2X74A 4JV5K 1IKVA 2ZVSA 2DNNA 2YPYA 5C12A 1DTTB 5EX0A 5CZVA 2QKBA 1KQFB 2X1GA 2L3MA 4CO0A 2O67A 3UNYA 5K5MA 3E1YA 1JJHA 5C2GA 2VFVA 4M42A 1RDDA 2H65B 2DNHA 3AQPA 4F26A 1N36K 2EKNA 2PAVA 4OPAA 4JI2J 2E1AA 1TV6B 4JI6K 1VQNS 4Q7AA 4BRLA 3FGUA 1Y9OA 5ETTA 3CCJN 4PZVA 2D0AA 1RHKB 4G1PA 1HRHA 3G6XA 4M5IA 3FE1A 3RW6A 2ZITA 3CCLN 2XYGB 3P4UB 4QJVA 4BRHA 2FBVA 2JX2A 4U7UD 3PTWA 4M95A 2CDRB 5LSLA 4MK7A 5KFBA 4GC6A 4ANEA 1MWZA 3JS9A 2ASOA 3R5GA 3FSXA 4J90A 4DPTA 3T1YK 1URNA 3BZQA 3T1YJ 2GEMA 5B0DA 1N33F 4MK8A 3C66A 1RBVA 1NPPA 1RAAB 3O4WA 1YXQA 3ZX3A 3ZZZA 2Q97A 4CF9A 4FXWA 3HVAA 3D6TB 5BYRA 5A8WB 5HSPA 4F3OA 1AB8A 1S12A 2MQNA 1VK3A 2DFHA 1B64A 1X4CA 3MPVA 3NCPA 4DUZJ 2GZOA 4CM2A 3WC0A 5AQWA 3M30B 1V3RA 2R4FA 1VBXA 3HHKA 4ANCA 1T03A 3D68A 3O9RA 4ZP9A 4JRQA 3FK4A 4DMNA 3DLGB 5LM7E 1BXNA 4CJ5A 2NXUA 1IM6A 2VOOA 4PCQA 4B3SF 3V1RA 3GB0A 3EEQA 2N4DA 2BQRA 4YY3K 2A18A 4AHTA 3TZZA 2QV6A 2CGJA 2AU0A 1UA1A 4PXBA 5AQGA 2UXCK 4PYDA 1TL5A 4OHZA 1E3MA 2RE1A 4J2EA 4Y2MA 4Y2CA 1YITS 1Q81T 1WN7A 3OLBA 2ZHBA 4DPXA 5ADZA 4FLTA 2FGCA 2E7XA 4BDZA 4JKFA 2E6MA 4DKWA 2ROPA 1CULB 4CYUB 3PM9A 3MUTP 2EFVA 3AO3A 1KQGB 1I94J 2B51A 3W2WA 4ANDA 3DDKA 2O01C 4IOCL 2D3OR 4UOFA 2BJ7A 3TJ9A 4RO0A 4WK3A 3ZETB 5HBMB 2GELA 1MDUB 3MAQA 2DNOA 1PCAA 3THYB 3OYBA 3K8WA 2A41A 3I9ZA 3HF5A 1DKGD 5DETA 2R7VA 3L3CA 1WB9A 4PKHA 2QSFA 4BWJA 1Q0NA 4FYDA 3VQ4A 4C9DA 2B4UA 3JTOA 1OQ3A 5HO4A 1FHTA 4W5TA 4K5SA 3AT1B 4ZVQB 4YOXA 1ZA1B 1N6QB 4L74A 4K43A 1B0PA 2E5LK 4N77A 3VA0A 3SQ4A 3DLKA 1SJ4P 3KK1A 4OJ1A 4KGXB 2MSTA 4AHUA 5F8JA 5A8KA 3UN3A 3BO2A 5EWFA 4U7BA 1G2EA 4A8MP 4DR6K 4A8OA 4DR1F 3V6HA 4JEPA 3HDSA 1P9YA 3H46O 2NUBA 3OV7A 1BDGA 1LWEA 3US5A 5KFUA 2H3EB 2HHHK 3IXQA 2HHHJ 3UIQA 1GAOA 4DR2J 5FPNA 1YGYA 1IBMJ 3BY5A 1N34K 2ZOFA 1N34J 1IBMK 1Z05A 3HBTA 2GS8A 3MWTA 4RCHA 3C14B 3PDNA 5BN9A 5KFHA 4LBIA 4TU8A 3GIIA 3M8QB 3OTEA 2DH8A 4DSFA 2VG7B 3QJLA 2XLIA 4DQSA 1NGBA 1XQIA 2FZCB 1V4SA 2EFOA 4H54A 3M6UA 5KGWA 5L8RC 1N33J 3BF3A 1FK9A 2RE2A 1X3MA 2Y1RI 1FE4A 4P2SA 2UXBF 4NCGB 1WKLA 3ISZA 1VSMA 1VRTA 3GFXA 3QNWB 2HNDB 4IUFA 3JB9k 3O8MA 4ID8A 3AA2A 1X8DA 4ZVFA 4CLLA 4DFMA 2C22A 3NMAA 3I0RA 3DXMB 2ZVIA 3LPTA 2DFFA 2QLBB 1WSJA 3NL0A 1N54B 1XK8A 4C8ZA 2D4WA 4KI4A 1KQKA 1KOOA 1NWKA 1LFPA 1VQ5N 4NZ0A 4MKVA 3AVBA 3ENWA 3LP2A 3ENAA 2I5JB 3SJHA 3N5FA 5GIOA 3IGNA 3POTB 1SIZA 3PW4A 1S1UA 2PN6A 4DS5A 4BBYA 1S49A 3O4QA 1EB0A 3RAXA 1RT6A 1HBOA 2KXNB 2UUCF 2A2CA 4KTWA 2RDIA 4ER8A 4ES1A 1T3NA 3OYLA 2EI5A 4AM6A 2AW0A 3F41A 2XMJA 3NGDA 2LDYA 2VG5A 4CM0A 4JI3K 1F9HA 4FF2A 3FLCO 3TJAA 5TKYA 1QE1B 2PMWA 2W6LA 1VR6A 1PYSB 3KFWX 4I6YA 4MO5A 3RB6A 3J7ZO 1VISA 1UL3A 4JI2F 3QQCD 3CXCM 1WJ9A 3DRSA 3U9ZA 4YDDB 2HNDA 4F0MA 1NH7A 3R8YA 3ZTQA 4CE9A 3C65A 3T6BA 3MOZA 1Q8KA 4K42A 5AQTA 3DXKB 5H9FJ 4E0DA 1ZAXA 3D0PA 1M1KO 4QS9A 1P1TA 1D8ZA 2V8VA 2ZZNA 3PHEA 4PY5A 3QGGA 1NEEA 4BS2A 1VQPN 1OO0B 1FA0A 4HT7A 2VG7A 1MROB 2YX6A 2HSEB 5FD1A 1HBUA 2HVZA 5KI6A 3AVMA 3CGIA 4TQSA 1RTJB 2PE8A 2E8AA 2HBLA 1RT2B 2PI4A 4RPFA 4GKKK 4L6V3 2IPOB 2J7UA 2P9NA 3OBWA 3QINA 5H1SV 3PKMA 2HNZB 2G2OA 3LAMA 1H6KX 4I6MB 3C7NA 2DY9A 3PW0A 4QYZJ 3QLHB 2LEPA 1O5JA 1B0VA 8ATCB 4DUTA 2ZD1A 2VPZB 4BR2A 2Y0SD 4X66F 2B8QA 2KXFA 2XO7A 2NYHA 4FS1A 2ZH8A 4JI7F 1JXEA 4CNZA 2BJ1A 4HT5A 3D2FB 1YI2N 1UMJA 3IMXA 4WCEQ 3VQ8A 4RW6A 3AA4A 3BKUA 3Q2SC 4QOTA 3H5YA 4X65F 3W3SA 2YQ0A 2Q3SA 3R6MA 2AWZA 4P75A 3NLCA 2HGLA 4R79A 3ZO7A 1VC0A 4KHYA 3B8AX 2YX1A 1T8EA 2GHWA 3E01A 2AF6A 3CM6A 1RDUA 4BG8A 2MKCA 5JLHA 4BE1A 3CJKB 4W5OA 3DRYA 2QLXA 4H4MA 2JWKA 1SH3A 3ZLJA 4E89A 5HROA 3OL7A 3HO1A 3TAEA 4IR1A 3LL3A 1KQSM 3MN6A 4GNIA 2CNOB 1LCUA 5KT4A 3QFWA 2X1BA 3BSNA 1I3AA 3DM2A 3L95X 1V6HA 3WC2A 4G9ZA 1TL7B 2DO4A 1NHUA 3UDVA 2CA9A 3HHLC 4TYBA 3AV9A 5F8LA 3D6HB 3VPZA 4WFAL 2HS3A 4G1IA 1CULA 3VENA 3OL8A 4BRCA 3V2UC 5D78A 1W97L 4ISGA 3Q8VA 4YUDA 2V51B 3CJ1A 3IUCA 1DRZA 1SQGA 2XS2A 3G71N 5CZ2A 2X6SA 4JI0K 1X5TA 1P9QC 3LO3A 1U2RA 4IRCA 4JHDB 1N8RO 1K44A 1QVFR 3JAMU 3CCLS 1YJTA 3F0NA 3HD2A 3SSQA 4NEZA 3Q8RB 5HMZA 4EYIB 3V6JA 1AT1B 2N82B 4DL5A 2AJ2A 3HL8A 4BRMA 3Q8PB 1M5SA 2JZ5A 2HRTA 4LIRA 1KLNA 4HUGA 4DJBA 3KD5E 1YRUA 3N01A 3R5DA 2R8HA 1NGHA 5H1SQ 4OHYA 4YR3A 2VG6A 1WDDA 3D0HE 5DMRA 1UKUA 2E9RX 1PJ5A 2G0IA 1I39A 3UCZP 4FN5A 4WZMA 4DR5J 4CJSA 1RHMB 4O8UA 5D3GB 3CYMA 3DYAA 5LT5A 1V3ZA 4GW6A 3IR6B 1KTQA 1H72C 1CQNA 3RAQA 3LAKA 4OGEA 2WTUA 1JLCB 1MWKA 1QZ6A 3BH6B 3PIOL 4PWDA 4R25A 1ELOA 4P73A 2JVOA 4O4RA 1RT6B 3GG4A 3MM6A 4FZYA 4KFBA 3VGLA 3M8ZA 4C3LA 4ZK7M 2CNKB 4DX5A 3KNAA 3M3ZA 4I6WA 4Z7YA 1ZM9A 4L76A 1QTNB 2DHGA 2CZVC 3V9SA 1UWBB 4O3SA 3GSIA 4GVMA 4MO4A 2H51B 4NYOA 3T9ZA 4DV2F 4B1XB 1VQON 3NCRA 3GSDA 4WXWA 2ACMA 3IBWA 3BR8A 2JWNA 4KKOB 4NOHA 1QY7A 4I69A 4NRTA 5J1NA 3AY0A 4K4YA 3F5TA 5GVQA 4LUBA 3SIPB 2B3TB 2QWQA 1YBTA 3K8VA 2M88A 2YI1A 4UOCA 5D8HB 8AT1B 4OYMA 2OLWA 1BQMA 3A4TA 1EETB 2DIUA 5AQKA 1B99A 2HZCA 3VQ6A 3R9LA 5J2MB 2HAIA 1BWFO 1O0PA 3VQPA 3TPQA 4DR5F 3WHIA 2HQFA 4J9VA 3W5XA 3IFRA 3T5JA 1VFJA 3BBBA 3AGRA 2WONA 4B8CA 4IG3B 1TL3A 2YKMA 5G0RA 5IC4B 4BROA 3QT8A 5T41A 3DU6A 1S9GA 1QAIA 1H0HB 1YIJN 3OQ2A 2RS8A 2V9KA 3C8YA 4K0KJ 3I56N 1WNSA 3R1HA 4CI0B 2CH5A 1RTDB 1X1PA 5AQIA 2OTLN 1X4HA 3RBDA 3CD7A 4G3IA 4CP5A 1HBNA 1NKBA 2HEKA 2WSFC 1CBKA 4J9OA 3H90A 4OYAA 2E1YA 4Y1CA 1P8GA 4OHXA 1HJOA 1K8KA 5C2DA 4JS5A 1S0MA 4H03B 1EQMA 2PMZD 1CLQA 4CIGA 4K8XA 4NLYA 5KPRA 2APOA 2UXDF 5J1PA 1FERA 1RAEB 1TL1A 1ASUA 4JD2B 4MAKA 2HQGA 3DOLA 1FXDA 4K50A 3ZSOA 2QL7B 3G0ZA 2XZWA 4ZPTR 2ASJA 4R8UA 2FLLA 1VQMS 2B4PA 2IJNA 3NVMA 1VQKS 3MMCB 4KJIA 1HNXK 3RB0A 3I33A 2HYIB 2A1RA 2W7PA 5M1QA 3MWPA 2DNKA 2ROGA 2ZM6K 2Z1IA 4F0KA 3MN5A 2F3JA 1F21A 2LMIA 2W9BA 3KWMA 1S6QB 4CGGA 2O8DB 2AMCB 4BRPA 1FRMA 2CPEA 4OGCA 4UTGA 3QZ8A 3U02A 1NMDA 3BB5A 2OIHA 3OYFA 4NLPA 2VD3A 4P52A 2ZH2A 3RTVA 3U4LA 3FFKB 2FC9A 1T05B 5A6PA 1RADB 3CC7S 4YR2A 3CHWA 4E98A 4RUAA 3V81B 2GA7A 3UKRB 5KG7A 4YOUA 3EKSA 3C6UA 2MQPA 2RSQA 3GJQB 3TP2A 4FW1A 8RUCA 1L3UA 4JUZA 3UO0A 4TLRA 3I4HX 4F36A 4HUEA 2VBZA 4RNNA 1GMUA 3RSEB 1HBUB 5IC6B 1RUSA 3VEVA 3AVGA 4LR9A 4LF6F 5K14A 1R0AA 3THWB 2W9BB 2M2BA 1TU0B 3R27A 4EWTA 4FM0A 2D9OA 3O4NA 4NZ7A 4MIAA 2AP6A 1K8AO 3MZIA 9ATCB 2YTCA 1T0TV 3MWBA 1LWXA 2BKNA 3X1LB 2ZGZA 1TFWA 2XBPA 4L3QA 3KOAA 4OJ3A 3OYHA 5GADU 4F25A 1SJFA 5FDLA 1QE1A 5CHCB 3KLHA 4BRAA 1KVIA 3KHGA 2YWFA 1JLEA 3A8EA 1I6JA 2KJWA 1S1WB 2X7IA 3GJSB 4AD6A 4OFZA 3F56A 3CPWR 2FBTA 3R3TA 4F4AA 4Y0FA 1RT3B 4Q2LA 2QYCA 4C8KA 3H3NO 1VAZA 5ETMA 3POTA 1HNXJ 1N5QA 3B6OA 3EZUA 4HL9A 3CO9A 3U1LA 1NNEA 4WFNQ 4YHHF 3DU5A 1B4SA 3KK3A 1U2CA 1LW2A 3B6BA 5CYMA 4ED7A 3HHLD 4CGJA 1P27B 2FVCA 3CC4S 3M2RB 4FLZA 1NM1A 3L2VA 1D9AA 1NK4A 1YJWN 2WVDA 1QAXA 5FRMA 2FVQA 3HPHA 2IVOA 1Q9XA 1U45A 3QDKA 4N47A 4QS8A 4EP4A 1LQ9A 2ZH1A 2V69A 4BHQA 1CSJA 3BP8A 4DV4F 2GMJA 4BC4A 4M3WA 3HCXA 1LWEB 1DTQA 2ABYA 2V4JB 1WSIA 2P9LA 3M32B 3V81A 1GEHA 5HI7A 2RRBA 1VSJA 2AA4A 3NH1A 4CTAB 4IQXA 1M1GA 3T19A 3LGNA 2ZJRL 2PYJA 1N34F 1ILYA 1HMVB 5H9EK 4FYXB 4OX9F 2MKIA 3UKUA 4F3QA 3C2PA 2HFSA 2CZ4A 4OLOA 1IN0A 4CZLA 4EK2A 3NFAA 2W9AA 2E5LF 2L41A 4M63A 2DY4A 3IAM9 1N32F 3ULHA 1RWWB 2H4WB 2DD8S 2MZ1A 4R0JA 1S1XA 4CJLA 4CHQA 1E4FT 3QRRA 1X0PA 5AE3A 4DR2K 3M2UA 2LQ5A 2CUYA 3VA3A 2FY1A 2BXJA 5B0BA 2ETJA 3AVLA 3QEPA 2BRKA 2LQBA 4CD3A 3QSYB 1NBEB 3Q8QB 1JLGA 2V7YA 1Q82T 4FJIA 1E6YA 2GX8A 1SAZA 3VQ5A 4GVLA 3KLFA 3MR3A 1BG3A 4IFVB 5E26A 1FXLA 1WAJA 4MIBA 5F8NA 2WOMB 2CJYB 1VQ4S 5FPDA 3MOJB 2YQ1A 1WOQA 4QWBA 2VQFJ 4X4RA 1HI0P 3WIVA 3RZAA 4O0NA 2H5IB 3M2UB 4DN9A 3OFHA 3MDQA 3VQCA 4CJ7A 4PA1A 1UFWA 3WXIA 3J7YI 4MDAA 3HD1A 3SCXA 4EO8A 1S79A 4I2PA 2K3KA 1NU0A 3OHRA 4N41A 1XNRK 3M1VA 2O8FA 4J2BA 3DC2A 4CK3A 4QIVA 1B3TA 3CCEN 1WSGA 3IRXA 2XMAA 4WJBA 4C97A 5KAKA 1GXUA 4HTUA 3FZ2A 3GPAA 4EGLA 1GX5A 4JI2K 3E66A 2P51A 1BQNA 4I2QB 5HOOA 1TTHB 3TUIC 3AHPA 3O5BA 3D2EA 3O3LA 2J9DE 4J37A 3NY0A 2B5JB 3GJRB 3QWPA 1W9HA 2B9YA 2ZGYA 3W65A 3ET6B 2OZMA 4PQUB 2CQGA 1GLFO 1YJRA 1I94F 2HNYA 4DFKA 4YB1P 2QJ3A 2O4IA 4ED0A 3CF5Q 2AV5A 1Q8LA 1SH0A 4F7VA 3N4WA 5EOYA 4H0PA 3M8PB 4HI2A 4MKAA 3RU0A 4DL6A 1RCHA 4HHJA 3DOKA 4CF8A 1T94A 3J7YU 1T02A 5CYMB 5ETSA 1Q7LB 2X51A 4IQMA 1QQOA 2WSEC 2MZJA 2BKOA 2UVVA 2GVZA 2H9ZA 4ES3A 3DDNA 3MM6B 4ZCKA 1WC0A 2KG0A 1JX4A 1YQHA 5J2PA 3BDEA 4DUZF 3QSIA 4AILC 2ZWOA 4CECA 5LSOA 4YHHK 2BANB 1QQCA 2DRBA 1N5VA 4NLWA 4K7QA 1RAHB 1R3NA 2QFIA 2BBEA 1RT2A 2FVPA 1LXNA 4OYIA 3DLJA 4JI0F 1RHQB 4DR3F 3MM9B 2Q66A 1ZBSA 5DG8A 5FPMA 1EKRA 4GKJK 2EC2A 3HSGA 4J5OA 2F4FA 2KRRA 1JJ2M 2YWKA 4CFBA 1N36J 1NU4A 1NM2A 4YY3F 2YKNB 3ZZ0A 1XWLA 4LRAA 1FKAF 5ADXH 2VA2A 4ECRA 1RJJA 3H2LA 4MIWA 2NZ4A 2IY5B 2C3YA 3LF0A 2YHAA 4NO7A 3G6VA 2WVCA 1RISA 3N9UC 2AX1A 4KO0A 4XH5A 2BRLA 1IKVB 2CG8A 3A12A 1S72N 1CJVA 2AEFA 4LF1A 2EBEA 3NH0A 1MNEA 4A8KA 4QS7A 2L9NA 2O8BB 3KD1E 4JV5F 1T05A 2BEFA 1JLEB 2OELA 3ETMA 1EO1A 1QSYA 2MPUA 2AQ4A 3CF5L 4CEAA 3QESA 5IFMA 3P45B 5L38A 4O55A 2CPHA 4OYXA 3KJFB 5KG5A 2PMHA 2OUGA 2MKKA 4A2BA 2LP4A 4FWNA 5AZJB 3HT0A 2J9CA 4K4TA 3ZSZA 5K8OA 4QWCA 2Q3PA 1R8AA 4LVOP 4IDHA 1GLBG 3MD3A 1W7AA 2E6LA 4H0TB 2QRRA 2HHUA 4J9UE 2LQJA 1EKEA 4KT0C 2ZQBA 3ZNJ1 3AA8A 4LRBA 4IDKA 1R7IA 1BL3A 4DG1B 4CJ3A 4B3TF 3E3XA 2W2MP 3BGLA 2W8KA 3RSEA 4FLXA 1HR0K 1RBOB 1Y3JA 1SC4B 4CO4A 1M5HA 2DNLA 3AJ1A 5E3AA 2ATLA 3UDCA 1RU2A 1MWQA 5KFQA 1VQLS 3LWLA 5D15A 2E5GA 3ZX0A 1M1KT 1FEHA 4DU1A 1DQ8A 4PQAA 1U6FA 2F8HA 2MHNA 2OEJA 5BXIA 2VJVA 4DU7A 4DL2A 3QIPA 3H98A 5J1EB 2AP1A 4LF5K 3H2UB 4CO2A 1D5AA 2I9SA 1DBDA 1W2BR 1MROA 2MXYA 1RILA 3CJTA 4CGHA 5AR0A 3S1TA 5CD4H 2CAJA 2NRHA 4WF9Q 3SUOA 1EWQA 1I94K 3FSYA 2ZOMA 1RKIA 5IS2A 4I2PB 4BY9C 4X2BA 5AQOA 4F4KA 1CZ9A 2NXJA 3NE6A 4YOWA 3I0SB 2W7AA 3AD9C 1YT3A 4F2SA 4PUOB 1M1HA 2E4LA 2ZH3A 1P90A 1H2TZ 3HYFA 4IDKB 2YKPA 4DR5K 4LIWA 4B3SK 3NBPB 1N56A 4ZN1A 5C42A 1JL1A 4OZ3A 4AXJA 3CCQS 5C5JA 2VG5B 3BKTA 1W2IA 1WF0A 2XQCA 5DG9A 2VBYA 1TKZB 4J9QA 3HM8A 4EYHB 1C6VA 3OYEA 1HBNB 2RHSB 3IMQJ 4IH5A 1P1LA 3TW0A 3CMAN 1HWIA 2EG2A 3LDSA 3ZZYA 4DR3K 3VQSA 1TAUA 2BX6A 4LF8J 2G9OA 3L8BA 4EI2A 1TYQB 5T14A 3F73A 2UUAF 3LUYA 2YNGA 4WE1B 3LP2B 5CD4A 4HI1A 5CXTA 2CVEA 2QA4N 1GT8A 1XHXA 3PHTA 2AGPA 1VSEA 2QKKA 3HZEA 3I87A 2XY5A 1E6VA 3G82A 3N5BA 2CQ3A 3G86A 1NJXA 1DHMA 3SV4A 4FWKA 2KHCA 4ECVA 3UPFA 4QWDA 4FJJA 4ZVGA 2XHWA 2RILA 3GYGA 1A9NB 4IOXA 3KMQA 1WTBA 4FF1A 1L3TA 4USHA 4E1MA 2OSRA 3TTDA 3GG0A 5LMUK 2VG6B 3H08A 2ZUGA 3M6WA 3MM8A 4IFYA 4OYZA 3H5UA 3NAHA 1FJGJ 2D3ZA 3HKWA 2W1BA 1VBZA 4AQYK 3NP5A 2MY7A 1NLVA 4KKOA 4NYZA 4BCAA 4Z2XA 4YHHJ 3D2EB 1UETA 5KPTA 2BM0A 1T7PA 1XQSC 4HDHA 4LFBF 3PYEA 3O9UA 3H25A 3UNGC 5DDRC 1CG2A 4AHCA 2ZZMA 4LF5F 3LGMA 4RG8A 5JS2A 4WQ4C 2P9PB 3GYNA 2BDPA 4CFAA 4JHDA 3CCVN 2OJ3A 4N8NA 3B82A 3HSDA 3VVUA 4NLDA 1MU2A 1RXOB 2HLTA 3KG1A 2BOAA 1HNWF 1WEXA 4CZGA 3T9NA 1LKZA 4OKKA 5A8RB 4LBPA 2PFUA 3EDRB 3OFEA 3L3UA 1S1WA 1NJIO 1SS6A 4JI3F 1TR0A 2M5YA 4WTOB 5JVHQ 5D3GA 4AUKA 5KPZA 3AY9A 1D4XA 2FLOA 4ZPDA 4OYOA