2OPRB

Crystal structure of k101e mutant hiv-1 reverse transcriptase in complex with gw420867x.
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
426
structure length
400
Chain Sequence
b'ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFIPHPAGLEKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
molecule tags Transferase
source organism Hiv-1 m:b_hxb2r
publication title Relationship of Potency and Resilience to Drug Resistant Mutations for GW420867X Revealed by Crystal Structures of Inhibitor Complexes for Wild-Type, Leu100Ile, Lys101Glu, and Tyr188Cys Mutant HIV-1 Reverse Transcriptases.
pubmed doi rcsb
total genus 113
structure length 400
sequence length 426
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2oprB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oprB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oprB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2oprB03
1N48A 3QGHA 4R0EA 4YR0A 4ECYA 4RZRA 3RB0A 1RTHB 5KT7A 1LW2A 1XR6A 3N6LA 3QO9B 1T03B 2BE2A 3IG1B 5I3UA 4TN2A 3MECB 4H4OA 5HBMB 5KG1A 3DRRA 4RNHA 3PZPA 5DLGA 3KHLA 4IDKB 2IC3A 4NYZA 3KOAA 3PW5A 2V4RA 3KLFB 1JXLA 4KB7A 1IKWB 4NLWA 1IKWA 5F8IA 3MR6A 3IGVA 1RT5A 4I2QA 5J2QB 3NBPB 3KHRA 2GC8A 2ALZA 4ZVFA 3RB4A 3I0RB 3KLIB 4MH8A 3Q8QB 1HNIA 4NCGB 2E9ZA 3H5XA 4NCGA 2BE2B 3IG1A 5I3UB 1IKVB 3M8PB 4ZPAA 1TKTB 2C22A 5C24A 3GIJA 1MU2A 4IH6A 4H4MB 4ZP6A 4Q44A 2R8KA 5KG4A 3QZ7A 1JIHA 4M95A 4RNFA 2FVPA 2XI3A 4J9NA 3PJXA 3DOKA 4NLXA 1D1UA 4QW9A 2D41A 1S1WA 4PQUA 4I7FA 2V0NA 2VG5B 3Q8PB 3KMSA 3G6YA 3KK2B 4IQXA 4LQ3A 4O3NA 4IKAA 4PWDA 4U7CA 2YNGA 5D3GB 1T05A 1TVRB 4YMEA 3LAKA 1JLEB 3DRSB 4RNMA 5KFSA 1RTDA 4WZMA 3MEGB 2J6TA 4URQU 1FK9B 5DQHA 4QWEA 2D3UA 4J9OA 3KMQA 5HLFB 1NHUA 3KLVA 5HLFA 1RTIB 5T14A 4Y34A 4ZVHA 2BQUA 4WZQA 3HVTB 2JEIA 1EETB 1DTQB 4KFBB 3KK1B 3BSAA 2W9AA 5J2MB 3OSNA 3GIIA 4EBEA 5J2NB 2XWYA 4O44B 2C2RA 4K50A 3D28A 1LWEB 3GQCA 4DG1A 1NNDA 3GIMA 4ECSA 1S97A 1IKYB 4B3OB 4HKQA 3QIPA 1TV6A 4NRTA 1TV6B 2WTFA 3DLGB 4MK9A 1LWFB 1JLBB 4EYHB 1LWCB 5KFWA 3KLGB 3DYAB 2BR0A 3C6UB 2WRMA 4LSLB 2UVWA 1DTQA 4KFBA 1HPZB 3SFGA 5KG3A 2YNFB 1JLQA 4DL3A 4FBTA 2AGQA 5C24B 2ASJA 2RKIB 1S1VB 4MK7A 1RYRA 3KK2A 3HHKA 3N6NA 2CJQA 2ZKUA 3BREA 2YKNB 3FQLA 4K4UA 4Y2AA 4WYWA 2RDJA 2W9CA 1TQLA 4Y3CA 4ZPDA 5C5JA 4EO8A 3H5SA 1C0TA 3CDWA 4J9QA 1JLAB 3M9NB 2R8JA 4NLQA 3IS9B 5DGBA 1MU2B 2IC3B 4Q0BA 4MIBA 2B43A 2JEFA 5HP1B 3DRPB 4H4OB 1SH0A 2IAJB 1S0MA 3SFUA 2BQ3A 1HARA 3NBPA 4TYAA 4NRUA 2R8HA 5KT4A 3CDUA 4ED8A 1S9EA 1IKXA 5EWEA 1S9FA 4ZMMA 4KAIA 2OH2A 3IS9A 1TKZA 4O3QA 1EP4A 4QWAA 4LSLA 3G6XA 3MECA 5KFLA 4K4ZA 4RW9A 3IRXB 4NLDA 4F4YA 2ASLA 4KO0B 4IH7A 4RW7A 1JLBA 4IRDA 2OPSA 1HQEA 3KHHA 2YNHB 4ZPCA 3QIPB 3DRPA 1Z4UA 4ECUA 1JLGB 5C25A 4I2PB 5J2PB 5F9NA 5KT3A 1N5YA 4RNNA 2IA6A 3V6DA 1I6JA 5F8MA 1BQNA 3MTKA 4EO6A 4RUAA 2ILZA 3LP0A 3KLEA 1K1QA 4NLPA 3BQ2A 2JEJA 4Y2CA 1LWFA 4ED6A 4G1QB 2OPQB 3T5KA 3ITHA 3KHGA 1DTTA 4O4GA 1QUVA 3T19A 2B5JB 1RYSA 1RT7B 2VG6A 4WE1A 1TKXA 4JUZA 5KFEA 1CSJA 3LAMA 3LANA 2R8IA 4K4YA 3PVXA 2XGPA 4IRKA 1RT4A 1RT3A 4K4SA 2ILYA 3FRZA 3CJ2A 2JC0A 2XCPA 3M8QA 1MMLA 4I7FB 5KFAA 4Q43A 1LW0A 3LALA 4WFXA 2HNYB 2XI2A 1REVA 3Q8RB 4U6PA 4OL8A 4K4VA 4ZVEA 3UR0A 5DG9A 3MEDA 1HMVA 1VRUA 3Q8SB 1SUQB 5KG6A 5FDLA 1ZTTA 1TKTA 2ZE2A 2FVRA 2BANA 1HNVA 3QYYA 4JV0A 3H2LA 2YNHA 2AGOA 4O4GB 3ISND 2VG5A 4DL4A 3KK1A 1VRTB 2XCAA 3KK3A 5K14B 2HNZB 5KFXA 4IH5A 4TQRA 4KO0A 5KFOA 3OL7A 3T1AA 5HROB 1C1BA 3QGIA 3RAQA 4O3PA 3M8QB 1RT2B 3DRSA 3DLEB 3FSIA 2R2RA 2V4QA 5C42A 4ICLB 1C0UB 1RT1B 2XGQA 4H54A 2HAIA 1RTJB 2W9BA 1N56A 1T03A 1DTTB 2I1RA 1JLFA 4DEZA 1DLOB 5J1EA 3H5UA 2UVUA 4RW7B 2IAJA 1S6QB 5J2QA 1S1TA 3UDLA 2R2TA 3QIDA 2C28A 1S1VA 1ZTWA 3QZ8A 4FS1A 1J5OA 5KFZA 5KFMA 4DL7A 3DMJB 4ECZA 3E01B 2C2DA 2WONA 4RW6A 2FVSA 4NZ0A 4M94A 3KLGA 1HNIB 2F8EX 3PW2A 4K4WA 4ZHRB 1S9GA 3NGDA 3MR5A 5J1EB 2FJXA 4ZVGA 2W8KA 3OLBA 2AQ4A 3C6TB 2WHOA 1RT6A 4WFYA 4YQWA 1RTJA 4RNOA 5KG5A 4JV2A 5HP1A 2RKIA 3ICLA 4RW4B 3I5AA 4IFYB 5KFJA 2IM2A 4URGA 3E01A 1JLQB 2UUWA 3DMJA 5L9XA 3EPIA 4IDKA 3T5LA 5KFHA 4LQ9A 5KFTA 4WXOA 1REVB 5KFUA 1ZETA 2W9CB 3NMAA 1YVFA 4X2BA 3CJ0A 5KG2A 2AU0A 1BQMA 1U09A 4K4XA 3MEEB 3T5HA 4YR3A 3RB3A 2YKNA 4ECTA 2DPJA 3LP2A 4ID5A 2WOMB 1SH3A 2YNIA 3BGRB 2AX1A 4MK8A 1JLEA 5KFYA 2W9BB 4ECQA 4MKBA 5F9LA 4QWDA 4NLGA 3OHAA 4F50A 1C0UA 1RT1A 5FDLB 4O44A 4NLSA 4YR2A 3H59A 4EBCA 4F4XA 1EETA 3HVTA 4PQUB 1S48A 4ECWA 4FBUA 3DM2B 4RW8A 3DLKB 4J9MA 4KV8A 3DLKA 3KJVA 3SI8A 4TLRA 2HNZA 1LW0B 1TP7A 5DLFA 1S1XB 4J9KA 1C1CA 4KKOB 3QLHA 3V81A 2FJVA 4GC6A 3RAXA 2WOMA 5DG8A 3HKWA 4J9LA 1TVRA 3DOLB 3I0SA 3KLHA 3MEEA 4TQSA 1BQMB 3NAIA 1IKVA 4EBDA 1R0AA 5CYMB 3RBDA 5KT6A 2YNIB 3BGRA 1TL1B 2OPPA 4ID5B 3NKYA 5KG0A 4EEYA 3ITHB 3C6UA 3E51A 1HYSA 2HNDB 2R2UA 4KV8B 3KJVB 2FJWA 5KFPA 4J9RA 4IG3B 3TVKA 3OLAA 2WK4A 3GYNA 1TL3B 2IM3A 3HVAA 1RA6A 3PW7A 4ECXA 1KLMA 4LSNB 4B3OA 2IJFA 1N6QB 4NLVA 2BRLA 4TY8B 4IFYA 5KFBA 5EDWA 5DGAA 3RB6A 1JX4A 2E9RX 1IKXB 1S0NA 4O3RA 2RDIA 2W7PA 3MR3A 3G6VA 1FKPB 4ECVA 4MFBB 3DDKA 3RBEA 1RT6B 4TYBA 3LP2B 4QWCA 3MR2A 3T5JA 2FLLA 4G3IA 1RTHA 4O3SA 4PUOB 4ZHRA 5KFKA 3LP0B 3KLEB 2ZD1B 2ASDA 1S6PA 2QE5A 2I5JB 3BSCA 3FFIA 3PHEA 1OS5A 3KLFA 1QAJA 4WXWA 1XR7A 4RU9A 1DLOA 4R5PA 1KHVA 3OL6A 2J6UA 5EWFA 3OL9A 4ZP9A 1D0EA 5L1LA 1LW2B 3IGNA 3NAHA 3H4BA 1S9GB 5EWGA 3D5MA 5KFRA 1WNEA 4ICLA 3IRXA 3N6MA 1IM4A 1HQUB 2VG7A 5CYQB 4R8UA 4DL2A 3GV8B 2W7OA 3FFIB 5KFGA 3VQSA 2I5JA 3M9OB 2YKMA 2QV6A 1UWBA 5F8HA 4KBIA 2HNDA 2WB4A 2YNFA 5K14A 4XPCA 4F4WA 1TL1A 2OPPB 5HROA 1HNVB 3V4IB 5KT5A 2V9WA 3KK3B 4J9SA 3KLHB 4KE5A 4KHMA 3BQ1A 4TXSA 4RUCA 3DLGA 1RT5B 4I2QB 5L1IA 1NHVA 2FLNA 4MFBA 5F8LA 3EPGA 1FKPA 1TL3A 3QLHB 2R8GA 2BRKA 1FKOB 5DQIA 5C42B 3MEDB 1JLAA 3PR5B 1JLCB 3G86A 1HPZA 4ED1A 4IOBA 3V6JA 3FDSA 4KHRA 4ED0A 3QO9A 2J6SA 2D7SA 3BQ0A 4Q8EA 2BQRA 4DL5A 4MIAA 1TKXB 1VRTA 1RT7A 4WE1B 5L1JA 1S0OA 3DI6A 4KKOA 3V81B 1IKYA 2YNGB 1T05B 4ZP8A 2W8LA 2AGPA 3I0SB 2R2SA 1VRUB 5KFFA 5J2NA 4IR9A 5KFVA 5KFCA 3PW4A 1C1CB 3OSPA 3V6DB 2JLEA 2VA2A 3DYAA 4EYIB 3IN5A 2HMIB 3JSMB 2RF2A 1FKOA 5L1KA 3PJWA 3CJ5A 4RW4A 2UUTA 2UVVA 4ED2A 5F8GA 1FK9A 3CVKA 2CKWA 1S1UB 4GC7A 3DI6B 4O4RA 3ISNC 1RT3B 1RT4B 1SH2A 4H4MA 4TY9A 4URSA 4JV1A 5KG7A 3I5CA 2IBKA 4NLTA 2VG6B 2B5JA 1JLGA 3CIZA 3OL8A 2XC9A 2AX0A 2HWIA 5KFQA 4RW6B 4NLRA 4DL6A 3BSOA 2E9TA 3I0RA 3KLIA 1S1WB 4J9PA 1TKZB 3BJYA 2IJNA 3TQ1A 1UWBB 4KSEB 3GIKA 3I5BA 4MKAA 3TAMA 5CYQA 1S6PB 1EP4B 2GIQA 1S1TB 5F8JA 3C6TA 5DQGA 3CO9A 3JYTB 1KHWA 4PUOA 4NLYA 3DRRB 1T3NA 2B6AA 1QE1A 4XPEA 3H5YA 1QE1B 1RAJA 1N4LA 4NLOA 4Q45A 1HQEB 4O3OA 3MFIA 1N6QA 3FQKA 4LSNA 4TY8A 5KFNA 5DG7A 1J5OB 3DLEA 2OPRA 1C0TB 4K4TA 1C1BB 4WFZA 2VG7B 2HWHA 4Q0BB 2FVQA 3LP1B 4XO0A 3GV5B 4F4ZA 3JSMA 3H4DA 3H40A 2ATLA 1S9EB 3CDEA 4QW8A 3M8PA 2WCXA 4YP3A 5HBMA 3GILA 2B6AB 1R0AB 2JEGA 2BANB 1S6QA 5JUMA 4IG0B 2DPIA 1JLFB 2EC0A 1KLMB 1XR5A 3QGGA 1RDRA 1K1SA 2O5DA 4FS2A 4IG3A 2HNYA 1GX6A 3KNAA 1SV5B 4ECRA 3PW0A 1QAIA 2HMIA 1S10A 1RT2A 3OHBA 3UPFA 2AWZA 2D3ZA 2IM1A 1JLCA 1T94A 1LWCA 2FLPA 2IMWP 1JKHB 5I42B 3CJ3A 3JYTA 3DOLA 1SUQA 1HMVB 3CWJA 1S1UA 3TAMB 1S1XA 2ZE2B 4G1QA 4DG1B 1LWEA 4QPXA 3GV7B 4IFVB 3V6HA 3DM2A 4RW8B 1HYSB 2IM0A 4QWBA 3V6KA 5KFDA 2GIRA 4HYKA 5EUHA 5CYMA 3BR9A 4ED3A 4ED7A 2UVRA 2JC1A 5D3GA 4PWDB 2C2EA 3H98A 3HVWA 2YKMB 4ZPBA 4IR1A 4IRCA 3CJ4A 1S4FA 1RTDB 1C2PA 1RA7A 1HQUA 5KFIA 2OPQA 3UQSA 2OPSB 1JKHA 5I42A 4NLUA 5JXSA 4IG0A 4ZP7A 3M9MB 5F8NA 2RF2B 3MFHA 3V4IA 2FVCA 4RW9B 5J2MA 5KT2A 3DOKB 2VA3A 4R5PB 3EZUA 2WONB 1RTIA 1N5YB 4IFVA 1SV5A 3LP1A 1W25A 3NL0A 1S49A 3BSNA 4Q8FA 1BQNB 4I2PA 5J2PA 5C25B 1GX5A 3MEGA 4WYLA 2OPRB 3MF5A 4R8UB 2ZD1A 3PR4A
chains in the Genus database with same CATH superfamily
1N48A 1UWAA 2VPYB 1IUJA 1JNRB 2XTJP 4X4SA 5KT7A 2FTRA 1XR6A 2AJ0A 3ZFVA 2AD9A 2HHSA 1T03B 3HHLD 2OO4A 4H4OA 5HBMB 1WC4A 2C2NA 2FQQB 4K7QA 3R97A 1S77D 3SDEA 3K0JA 4HYKA 1ZPWX 4A8FA 2VFTA 4NYZA 2IC3A 2DHHA 3TZXA 4NA1A 1LFWA 2MYFA 3HK2A 2DXFA 4HI1A 3FMBA 2F5GA 3PRBA 5D4LA 3TEHB 4F3OA 2WAQD 4Y2IA 3KHRA 4LF6F 1SC3B 1LXNA 1GMVA 3GYGA 5CCLA 1T02A 2HQ3A 1L3TA 2ZJRQ 3K89A 2K2PA 1HNIA 4Y28C 4NCGB 3G71S 1NKCA 4NCGA 2RQ4A 1QSYA 4V19J 1Z2LA 1IJFB 2GVZA 2KVQE 2LQ5A 3R5AA 4OJGA 3PYDA 5C24A 2FYXA 1MU2A 3DN9A 4ZP6A 3UR3C 4DCJB 1R3NA 1RE1B 2R7QA 5KG4A 4UUXA 1DZ5A 2R8KA 4RNFA 2J7KA 2XI3A 1CJVB 3JQKA 2LEBA 3LF0A 4CM0A 3UN3A 2Y0SD 2AF6A 3Q8UA 3EGVA 6FD1A 4PQUA 4BCAA 4J9PA 2KDOA 3Q8PB 2V0NA 4PCQA 3KMSA 3KK2B 4CNZA 1DQAA 1HBUA 4BC9A 3VZIA 2OTJS 4DWIA 4JI3F 2QEXS 5L38A 1JLEB 1TL7A 4RNMA 4Y6IA 4WZMA 1F3FA 3MEGB 3UDEA 4J9OA 3WDOA 3GTYX 3CMQA 2BX6A 4DFMA 2F9JA 5HLFB 2CRLA 3I4HX 4LT6A 1RTIB 3I87A 3QATA 1JJCB 4Y34A 1IWAA 1HWIA 4ZVHA 3EDQB 4ANDA 1EETB 4X66F 4I6WA 2DNHA 1HI0P 2HHTA 4J9UE 1N34J 2XWYA 2HWTA 4O44B 2C2RA 1ZAWA 1LWEB 1FD8A 1RKIA 3HHLB 1NNDA 2RQMA 4B02A 4N5SA 3GIMA 2MB0B 1CQMA 3QIPA 1TV6A 3R6GB 2CNKB 4PABA 2DVIA 2QA2A 2MGZA 2JX2A 3CD6S 4GRSA 2X1GA 4C8NA 2BZ2A 2DEJA 2A2DA 4EYHB 1WHXA 1WOPA 1IBMJ 1XNRF 3O8WA 1PC5A 4N41A 1N54B 1KONA 2RQKA 3H7HB 1TL4A 2PIIA 3NS5A 2QZ8A 3SFGA 2BEFA 2MSTA 4BLGA 4K0KJ 1CJKB 1N0UA 1U8SA 3IP0A 5LSRA 2ASJA 2DR8A 3AD9C 4C8ZA 1S1VB 1RYRA 2YQ0A 3HHKA 1QVFR 2YKNB 2ROPA 2DNGA 4UT4A 4Y2AA 5M2PA 2B8PA 4P2FA 2EG2A 5F0WA 2XMAA 1HWLA 2W9CA 4U67Q 5C5JA 3JAMY 3BN7A 1JLAB 3M9NB 2HK2A 4DV4J 1Q82T 1VQKS 3D1OA 1R27B 2JEFA 4P6QA 2ZEJA 3U7JA 3PY8A 2GAHC 1B70B 3CNQP 4LF4J 3JSYA 5EWGA 3R1LA 4IOCQ 2XEXA 2QA1A 2L08A 2HBZB 5EHHA 3AXMA 4PKDB 2GVDA 1YJNS 2K3IA 2QX0A 3R7SB 2XSJA 3KDOA 1UFWA 1S9EA 5T7LB 4QBUA 4DV2F 1SJ1A 2OIHA 5A8RA 4LRFA 3M6VA 4CQ1A 1NSPA 3DCAA 4C0HA 4O3QA 4DUTA 4UOHA 7FDRA 3R5JB 4QWAA 3FGVA 1IBKF 1MN7A 1ZYQA 4LJMA 3G6XA 2HBQB 2PFDA 5L9NA 4RW9A 3P96A 1U6ZA 2DCUB 5E5NA 5GAHI 3OXLA 2QLJB 4IH7A 4I6YA 1KVJA 1VQ5S 1M90T 2OMOA 3K2YA 3KG4A 1HQEA 1N33J 4LF9J 3JB9k 2YNHB 4ZPCA 4BWJA 3QIPB 4PXDA 1JLGB 3NGUA 4DCPB 4YB6A 4CLFA 3ETMA 4UQTA 3UCGA 1OO0B 2OHDA 4P2SA 3PFEA 3QMQA 4NI2A 4RLEA 4N47A 2IA6A 4CO5A 2HHVA 5K5MA 3LGMA 2MKIA 1ZS6A 1V3ZA 2E29A 4ED5A 3CE8A 1RBLA 1SPBP 2QMUB 1RHRB 3GWCA 1HNXF 2ILZA 1X5SA 2KO1A 2VFVA 2VJUA 4JI1F 2OPQB 3T5KA 3ITHA 3KHGA 3A3PB 4OFZA 1NO8A 3SMZA 5DDRC 3T19A 1RYSA 2GO8A 4WE1A 1HBNB 2CQ0A 1TKXA 4MAKA 5IXUA 1MROB 3TAQA 4WFNQ 5DDPC 3DXBA 3PVXA 1FNMA 3DFEA 2XGPA 1XEZA 3QBCA 2HHPA 1SC1B 1AZSA 4I7FB 3TNVA 4Q43A 1H73A 4NOHA 1F3VA 5B0FA 1G3OA 4WFXA 2EI5A 1DQ8A 3ZTPA 4CT8A 4ZLNA 4I67A 3CULA 3BR8A 2BJ1A 2ZVSA 1CBKA 1YKWA 3GJTB 3L9ZA 4ZVEA 3LWMA 1NRKA 3C46A 1BE4A 4JI0F 3MEDA 1VRUA 4ER8A 5FDLA 2VU5A 2VDHA 2G4BA 4V19X 2M9KA 2DITA 3NGRA 2PFFB 3MAHA 1HNVA 3PRDA 3RR8A 1M1HA 3H2LA 2RRAA 2VG5A 3KK1A 2XCAA 2DD8S 3C19A 1LOUA 4HLBA 4TQRA 4LRCA 1I3OB 4DR4F 2BJ7A 3FRYA 2XMUA 3QGIA 4UF4A 4WTYA 3CC4S 4ZA1A 3DRSA 3DLEB 1U2RA 2J8SA 2DNZA 3BEGB 4TU8A 4ICLB 4B3MJ 5B08A 4QCLA 4H54A 2X3DA 2V2QA 3BKUA 3HHLC 1VK8A 4A8WA 2A10A 1N56A 3UNYA 1IBLJ 3OXGA 1FRIA 3DDIA 3VVUA 2UU9F 5KOWA 2DK2A 2NXCA 2YPZA 2YKPA 3AD8C 1JB0C 1S6QB 3MOZA 5J2QA 4FYWB 2IBOA 5LMUF 3UDLA 5HMZA 4PXBA 4E0DA 1P8GA 3EVOA 3N5FA 4LIWA 5KFZA 2FC8A 2N4CA 1OJ4A 3DMJB 2RE1A 4LBIA 3E01B 2Q1LA 2J7UA 4DMZA 5B09A 1UA1A 2VOPA 4DV1J 3KTQA 3PXGa 2FVSA 2KZZA 3N28A 1RBAA 2W01A 1VQ7S 2F8EX 4MYTA 2F3JA 4K4WA 4ZHRB 1U2CA 1S9GA 4DLGA 3MR5A 3OBIA 5GADI 1I51B 3BDEA 2F4VJ 1ZPVA 4MMOA 2WHOA 5D78A 1DURA 1RTJA 1K0TA 4QR1A 4HHUA 3T1YF 1CC8A 1KFSA 4RW4B 1FFSB 1GT8A 1K44A 2IM2A 4K2XA 3E01A 2E44A 2P9GA 3W60A 3GMGA 4DZDA 3N9UC 2QL5B 5KFTA 3MM9B 2QYCA 4WXOA 2YWEA 3D6FB 1GAOA 1YVFA 4X2BA 2UUBJ 1YLXA 2YKQA 3BKFA 5E3QA 1NJYA 3MEEB 4YR3A 2CJXB 2YKNA 2HGMA 2XNQA 3M30A 3KJNB 1S0VA 3ENWA 3IAM9 4AD6A 5KOXA 2D1CA 1RHUB 4JV5J 1E6YB 1Q16B 2DTJA 1B7FA 1RT1A 1TR0A 1HHTP 3TUPA 2YQ3A 2CPFA 5B0DA 4FZVA 1JXEA 3PX0A 3EGNA 3O5TB 1UP1A 1WC1A 2DR6A 4YOEA 2MZ1A 3PX4A 4FBUA 1L5UA 1F5BA 3DM2B 2V4JA 1P1TA 2VC0A 2VC1A 2OD4A 1RWOB 1TP7A 5DLFA 1DHMA 2HRTA 2KRRA 4X4NA 1C1CA 3V81A 4QIVA 4I6AA 3UI3A 2CJAA 2WOMA 3CW2C 3NP5A 5DG8A 4EWTA 1TVRA 1TAUA 4W98A 2EFNA 3KLHA 2FZCB 2GHVC 2SXLA 4Q2MA 1YWXA 4TQSA 1RKJA 4LFCJ 4ZJLA 1R0AA 3HT0A 1RHJB 4EEYA 5KG0A 1OY6A 1NMEB 1FF2A 3QFHA 3HHNB 2F63A 2LCWA 2QSFA 1O51A 1HYSA 2R2UA 4DR2F 2BKOA 1JJ4A 1UVMA 4UQGA 4IG3B 3HVAA 4KQZA 1XNQF 1RA6A 4ILLA 3J81Y 2HFOA 5CH7B 2BOPA 3RB6A 5EDWA 3MAAB 4IFYA 3IXQA 3M2UB 4EU0A 3C3LA 3QRRA 3QPIA 5FLXY 2RDIA 3HSDA 2IHR1 4DJBA 2W7PA 3G6VA 3TVZA 3DDKA 3UCUP 1WF1A 4M5DA 3MR2A 3MDFA 3T5JA 2ZM6J 4LF8J 2X1FA 3J80Y 2VQEF 4NX9A 2WZ1A 4PUOB 4E2FB 4DS4A 5KFKA 1X4BA 5GMDA 3B6BA 8AT1B 3BBFA 1YGYA 1RWKB 3KLFA 3M2VA 2GQCA 2Y8WA 2IVYA 3CO0P 3KXDA 4UTGA 1XMOJ 1Q7YT 2CNNB 5F3ZA 3OL9A 3SDEB 3D6HB 1PYTA 1HBOA 5ETLA 2F1FA 4ZKAA 3RBZA 4KRWA 3Q8YA 1HFEL 3L7OA 2JDJA 3IGNA 3LW5C 2RU9A 1Q8LA 3MAAA 3VZHA 4ZVOB 3I55S 2VKRA 1FWLA 4B9VA 1T0TV 3DU5A 2AIRB 1IM4A 2VG7A 5CYQB 1WELA 1WHVA 2ACYA 2E7WA 3B54A 2VKZG 4NZ6A 4WU3A 3TOQA 4EMDA 2YKMA 3NGTA 1NH8A 1PBUA 4O23A 3A13A 3W65A 3L95X 5F8HA 2MZRA 4ZPTR 2YNFA 3OXFA 3CCTA 1RABB 2RU3A 4F4WA 2H54B 1V5IB 3VCDA 1CVJA 1TL1A 2OPPB 1JK9B 1WF0A 2ACMA 2LQJA 4FN5A 4DUZF 3UDVA 4FYDA 5H9EJ 3OVSA 2J7WA 3OTOJ 3KLHB 4PEOA 3AB2B 4TXSA 2W2MP 3KWMA 2Z2YB 5D0GA 1Y5IB 2LXFA 2O3DA 4MFBA 1F5AA 2IMOA 4DBQA 1NSQA 4NMXA 2HVZA 2BRKA 5HATA 3B4MA 1XTZA 3G9CA 5DQIA 2XYPB 2GS8A 1JLCB 4DXLA 5HVHA 4ED1A 4LBHA 2V8GA 2W2PP 3V6JA 4LFBJ 1Z2ZA 4LRBA 4GVBB 5BR8J 1W7WA 2Q43A 2HEKA 3JSBA 2D7SA 4PPZA 5DZ7A 2AHOB 4DR5J 4E98A 2ALYB 2J6SA 4X4VA 1VRTA 3QRPA 3QNWB 3LO3A 2AZ1A 1VOMA 5HQLA 1OQ6A 3P45B 1KOHA 3V81B 1IKYA 1T05B 5MLCV 3R9LA 4QU7A 4JYAJ 4DV0J 2R2SA 3D6TB 5J2NA 5FD1A 4XTTA 4IR9A 2FY1A 4F25A 1OPIA 3HDSA 4G65A 3OSPA 2BVZA 1WTBA 4EYIB 4KGVB 3JSMB 3G82B 2F9DA 1L3KA 3M8SA 3PJWA 1UMJA 3GSIA 1D9AA 3GR1A 3CCVS 5F8GA 4YEAA 4UOFA 1XN9A 1S1UB 1ULRA 2DY1A 3TW0A 1FWKA 4O4RA 2LU1A 3EVMA 1WHWA 2QC3A 2XSFA 3FCVA 3IWXA 1TKDA 3G6ES 2ZUAA 4ANCA 3OTEA 2B5JA 1JLGA 3GB0A 2XC9A 2I38A 2HWIA 3FUYA 4WJBA 4B9UA 2YX4A 3MM9A 1HL6A 2YXLA 4DL6A 2Q79A 3I0RA 2E1PA 1XMQJ 1I5OB 4YFUA 1VHFA 2HGNA 2RB7A 2Y1LB 4RBTA 4MT1A 3SSSA 4DQSA 4PXCA 2ZFHA 2KFNA 2OMLA 2GIQA 3UNGC 3VAKA 2JLFA 2UV8A 5C2GA 1U1NA 2Y8YA 3K5OA 5F8JA 3JSRA 1SI9A 2DGVA 3HJVA 4HR2A 3TA0A 3IWNC 4M8LA 2B6AA 1QE1A 3H5YA 1QE1B 3M2RB 4Q45A 1U1OA 2PC6A 1EKSA 2B9YA 2CDQA 2CZ4A 2QL9B 3AJ2A 2KT3A 3QSIA 4X65J 1N6QA 3MMCA 4LSNA 3AY0A 4TY8A 5L8RC 4DF8A 5DG7A 4MIWA 4TKTA 4K4TA 2V2KA 3MCMA 1Y4ZB 2Q6BA 3PEJA 2IY5B 2VG7B 2XWXA 4C3MA 1HWKA 1NJIT 3Q2SC 1SKRA 4BS2A 3HJFA 4Z7CA 3PX6A 2QTWA 1OWXA 9ATCB 2M5YA 3CDEA 3GILA 2JEGA 2BANB 1SC4B 4C11B 2HHWA 3MCSA 3N4WA 1HIYA 2YWKA 1S6OA 1JLFB 4RO0A 1KLMB 2EC0A 3QT6A 4YHHJ 1XR5A 2CWXA 4ZVRB 2H1YA 2O5DA 4FS2A 3TX0A 4WCEQ 4OV6A 1CJKA 2KHCA 2P6SA 3P5TL 1SV5B 5ETOA 5T41A 1QAIA 1RWNB 1ZM3A 4A8XA 1S10A 1U6BA 1VISA 1VYAA 2J9DA 4GO7X 3UPFA 1HNXJ 1JLCA 2DBBA 1WEXA 2IDLA 3RTVA 1T94A 3R2DJ 2MQ8A 4DFPA 2BJ8A 3CJ3A 3JYTA 4WKRA 1X8DA 4U8YA 5E3RA 1U48A 1CS4A 3CWJA 2H48B 3TAMB 4B9NA 1RADB 2V34A 4I4BA 1N33F 4QPXA 3V6HA 2QN6B 4RW8B 2IM0A 1HYSB 2KN4A 5CA5A 2DO4A 1NK5A 2XHWA 2VICA 1V6HA 3E3XA 2P9CA 5ETNA 2GIRA 5AT1B 4ED7A 5HAOA 3BR9A 1TFWA 1VBKA 2JC1A 3ZZTA 2HBRB 4PWDB 3FVYA 2YKMB 3LPEA 3OTOF 1DARA 2WVFA 4NPOA 3QAUA 1YHQS 1W2BR 4IRCA 2A3JA 1CS4B 5KFIA 1VHIA 3T3FA 2OPQA 2V94A 1Q81T 4C8YA 4M5HA 3M4XA 2JOQA 4OJ3A 4HVZA 4A8MP 1UA0A 1HNZJ 4X4RA 2AJ1A 3CCES 3DOKB 1FWPA 1BMQB 1U8WA 2I8EA 2MXYA 1YITS 3V5RA 2C3PA 3LP1A 1X60A 4KPYA 3M2VB 4K5SA 3BSNA 4X64F 1YJ9S 4K5RA 4I2PA 5J2PA 3OR2A 1GX5A 4GKKF 3JTNA 4U8VA 4A8YA 2OPRB 2ZD1A 3GPAA 2OD6A 2XYHB 3QGHA 4ECYA 3OUYA 2Y9HA 3ELHA 3ZNUA 4RZRA 3F73A 3QO9B 1NCLA 3R6LB 3MECB 2F8HA 4IYQA 4P52A 3HT3A 1T9XA 2M4MA 2RQCA 5A76A 4W92B 2LA6A 4USUA 4OX8A 4C9DA 3WC2A 3PW5A 1FDNA 3KLFB 2XO6A 2ZHOA 4KB7A 4OYPA 2ATCB 3R5GA 1IKWA 4GKJJ 1RWPB 2IRUA 4ZCKA 3NCRA 4YDDB 1R6VA 2Z8QA 1RAIB 2B4UA 1Q95G 1WJ9A 2HRUA 2WB1D 3L09A 4MH8A 3RB4A 3WQPA 4RWWA 1ITPA 1N5TA 1SJQA 3R27A 1GTEA 4RKUC 2C22A 1H6KX 2K3KA 3ETOA 4H4MB 4B3SJ 2NREA 2O01C 2QFJA 2RRBA 3K5PA 3MD1A 9RUBA 4CO1A 4DR1J 2MLZA 2FVPA 1FE4A 2YVSA 3DDNA 4J9NA 3KKFA 2WBMA 4GKJF 1D1UA 1HBMA 4LVOP 4H4KC 2DGUA 1KS2A 2PGCA 4W90B 2WVCA 2MMYA 1IR1A 2NSBA 5IT0A 4NXNF 2X7IA 1FEEA 1FD2A 2YH0A 2W2OP 1X0FA 2DCLA 2V8HA 2HQCA 3M8WA 3P4UB 1HQ2A 4IKAA 4OI1A 4U7CA 2YNGA 5D3GB 2KL8A 1TVRB 4OHVA 3LAKA 1TUWA 3BZQA 1YRUA 1ZZFA 5C7PA 3DRSB 3G4SS 2EC2A 1RTDA 4KH0B 5HJXA 3K5NA 2A0FB 2W2NP 3TJAA 3MUMP 3KFWX 2J6TA 4EZ9A 1F9HA 3BYRA 2O67A 1SL0A 4USIA 3KLVA 5D4OA 5T14A 2AJQA 2QMWA 2JEIA 1BD6A 3KK1B 1X4DA 2YPYA 4WK1A 3NWGA 4ES3A 4PWWA 1SB6A 2E5JA 3I4PA 4EBEA 3BBBA 4RBVA 4K50A 3D28A 1SVDA 3GQCA 2QGFB 3BKTA 2I9SA 1PCAA 4TVAB 2QT7A 5IQQA 1IKYB 3OPKA 4B3OB 2DO0A 3RRKA 4HKQA 1RU2A 2W25A 2E5LJ 4CIOA 3CTRA 2LEPA 4R25A 2FHMA 3A8KA 1T3OA 1WKLA 4OV1A 1TUVA 4Q7AA 2UXBF 3K59A 3J7Z5 1NUEA 4YB1P 2BR0A 4LF6J 4LSLB 2HFSA 1HPZB 1GMUA 3PFOA 3W63A 5HQMA 1UAWA 4J91A 5C24B 3KUEA 5J1NA 1NHKL 2WBRA 3TP2A 2RKIB 3NOGA 3VV2B 2EG1A 3Q23A 2ZJPQ 3KK2A 3N6NA 1SL1A 2ADCA 2P2CB 2K7KA 3BREA 3FQLA 4XK8C 1G2EA 1F2HA 3TVYA 3V4MA 2FZKB 4ATNA 4WYWA 2RDJA 1KC8T 2BW2A 2VV5A 4ZPDA 5IWAF 2WSCC 4EO8A 1C0TA 4U96A 4J9QA 4QIGA 1T9VA 3PRVA 4P7TA 5D4PA 4ZCMA 1HBMB 1MU2B 2IC3B 2D3O1 2DRBA 2XM3A 3OFGA 5HP1B 2Z2MA 3C15A 1WWHA 2VFSA 1V3SA 3NGSA 4ZVPB 2XY7A 3RJMB 4NMLA 5D0EA 3VAMA 2MZQA 3QWUA 4HH1A 4DSLA 2ZHAA 2BQ3A 5DS7A 4LFAJ 1HARA 2J8AA 5G4DA 2NUUG 1DRZA 2OH2A 3NBPA 2HZAA 4HHJA 2QYGA 4P74A 1RUSA 5GAGI 1X9SA 1ZH5A 2B4PA 2ZH6A 1EHWA 1FXLA 1T95A 1VS3A 4ZMMA 2DH8A 4CH1A 1YJRA 3IS9A 4USMA 1NK4A 4ERDA 4WP8A 1MMNA 1Q79A 4EK2A 1KP6A 2B4OA 4NEYA 1IXKA 2W4PA 1Z1ZA 2IA0A 3AT1B 3PYFA 3OJUA 4K4ZA 1SJ4P 4DV1F 1K9MT 1OYDA 4RW7A 1JLBA 1PAEX 2GQQA 3GONA 3FZ2A 4PR6A 5L39A 3Q86A 1Y3JA 2ZBCA 4CLZA 2BV3A 3GSDA 1M5HA 1U1QA 1Z4UA 4B3SF 2Y1IA 5C25A 1NDKA 1OY8A 3G8TA 1K47A 2CPYA 3FZBA 3MM7B 2G2YA 5F9NA 1NDPA 4UOGA 4Z37A 4B3RF 1PKUA 5KT3A 4S0MA 3ZTQA 2KH9A 3FKBA 4F0KA 3V6DA 3RAMA 2Y3YA 1XWLA 1RHQB 3AD7C 5F8MA 1Q8BA 1AFJA 5CZVA 4FF2A 3KLEA 2FJBB 2JEJA 4Y2CA 1LWFA 2CG4A 4ED6A 1FTCA 2B9EA 3W8GA 1YBTA 1XMQF 4O4GA 4OI0A 1KVIA 5CD4H 2DISA 1SC6A 4C8LA 4QYRA 1RT7B 1SXLA 3GYXB 1U24A 5KFEA 3K8WA 4DSFA 1ROFA 1RT4A 1RT3A 2KYZA 2CIMA 3MUVP 4IRKA 4ENOA 3QRQA 3W2VB 3M8QA 1MMLA 5K20B 2YKAA 4JYAF 1WSRA 5B0GA 1X9MA 1NK9A 2BDPA 3PJ9A 1UPMB 2DKOB 2DR9A 1REVA 1R43A 5E3CA 4ZVQB 4OL8A 2W1BA 4K4VA 4DQPA 2HFNA 1HMVA 1CJTB 5A0YB 5KG6A 3Q8SB 2CQIA 2CPDA 1TKTA 4OJHA 3I9V9 3O6QA 2BANA 2KJWA 3P8BB 3G96A 4KJIA 1MWYA 3IBFB 4LIRA 2YNHA 3BGLA 4Y65A 5IM0B 2AGOA 2UUAF 1B64A 2QLBB 1KD1T 1BGXT 2CQGA 5K14B 1R8BA 4IH5A 3PV8A 3T1AA 2DNOA 4CTAB 4NCAA 1RT2B 1Q8KA 1YJTA 4YDXA 5C42A 1UJ5A 2J0XA 4DV0F 1RT1B 3NOCA 5A8RB 1KR4A 3NY0A 1J5EF 3UFCX 4J5OA 4L76A 2X1AA 3LWLA 3UD4P 3HZGA 2LLZA 3MR7A 4F04B 1JLFA 2KT5A 1WHYA 3AAWB 3AQPA 5D15A 2KG0A 5J1EA 3H5UA 3LOUA 4QIEA 2AJ4A 3CSKA 3PM9A 1MG7A 2OSRA 2U1AA 1F60B 2BOAA 2HS3A 4HT5A 1ZTWA 3QZ8A 3CIMA 4TNOA 3EJMA 3TWZA 2V2ZA 2OGUA 2NYIA 2Z2ZA 1UEVA 3UD3P 2L48A 2C2DA 2AYEA 1P27B 2CQDA 3HP6A 1IBKJ 2R3VA 4RW6A 1CULB 4NYOA 4WPAA 1O6XA 4M94A 1FDDA 2B3TB 2HRYA 2KYXA 4DR3J 4Y2KA 1HNIB 3PTWA 2EBEA 3V2UC 2DNPA 2ZDPA 5J1EB 1URRA 1C4CA 3EXCX 2Z57B 4KY3A 3NGDA 4BBYA 5GVQA 2AV5A 3FEZA 3MUTP 3C6TB 1RT6A 2EFVA 1KKHA 4KGZB 2GCFA 1WKKA 3HI9A 3T6JA 2P8IA 3L7PA 4CRJA 3I5AA 1HD1A 2DR5A 1RWWB 3EPIA 2KM8C 5L9XA 1JLQB 1FTRA 3DMJA 2ZNZA 4MJKA 4OMFG 4L73A 5KFHA 4UUWA 3T5LA 2FIUA 4RU2A 2HZVA 1VR6A 4FVCA 1REVB 1MW7A 1ZETA 2AEFA 3PIOQ 4KYZA 4AL7A 2KXHA 4K4XA 4ZLJA 3BPSP 4OHWA 3SSQA 4L72B 4LFAF 4ECTA 3LP2A 2YNIA 3BGRB 4P75A 5KFYA 1JLEA 1BWVA 3C14B 3C66A 4PYDA 3VR1A 3I56S 2YX7A 2Z58B 4QZVB 4QWDA 1HNWJ 1BC6A 2JJ4D 4F50A 5B0CA 5FDLB 3HKZD 4X4UA 3CXCR 4O44A 2ZBIA 4A8SA 1VCTA 4AQYF 2G0JA 4EBCA 4F4XA 2RVJA 5LJ3Y 1EETA 2B7CB 1QJHA 2ZH1A 4PQUB 1S48A 4ECWA 4RW8A 2E1AA 5E7OB 3KJVA 3DLKA 3MMAA 3SI8A 2LXIA 1PAUB 2HIYA 3CD0A 3LTOA 3ZC4A 4ZN1A 1VDHA 4CZCA 1CLFA 4PG7A 2FJVA 4Z7YA 1VQ8S 4GC6A 1NPPA 2VJVA 1FCAA 1X4FA 4M5IA 4J9LA 5M2UA 3DOLB 3CDAA 3CGIA 1RAHB 4ANEA 4OHZA 4B9LA 1TMJA 2JNJA 4X4PA 3HPOA 1NK6A 1XNQJ 3RBDA 1TL1B 2OPPA 4ID5B 4WTOB 2D9OA 3ITHB 3C6UA 2BXJA 3CMES 3ISZA 4DV5J 1XQIA 3K17A 4L3KA 3KJVB 3MMAB 3TARA 4EGLA 3TVKA 3OLAA 1WTFA 1TL3B 3PW7A 3ILIA 2E1RA 4ECXA 2UP1A 2UUBF 4XAKA 5KFBA 2H4WB 2E9RX 1Q1KA 1IKXB 2VPZB 1ACMB 1T9WA 3MR3A 4WP3A 1FKPB 2ASYA 2C2MB 4MFBB 4BHQA 3K5MA 2E5HA 1UJ6A 4OYBA 3LP2B 4TYBA 4QWCA 3BO4A 3FBBA 1FNXH 1RWVB 4NXMF 2CJ9A 2ZBRA 2CADA 4ZVTB 3OJSA 2E1MC 4JI8F 2ZD1B 1KN6A 1Q78A 3BSCA 3L3CA 1HI8A 3RU0A 3W8PA 1K8AT 4V1Ak 3R7NB 2RIJA 3D3CJ 4JV5F 1DLOA 1IWGA 3OL6A 3FCWA 1HR0F 2DNNA 3BO3A 3U02A 3M2RA 3M7VA 4X4OA 4DFJA 2BBEA 5L1LA 2MZSA 4MKVA 3W9HA 4CO4A 1B7YB 7FD1A 1PG5B 3SEOA 1QAXA 3THVA 3KJQB 2NZ4A 4DQQA 1X4EA 4DX7A 1HQUB 2HLTA 1BLUA 3TX8A 5RUBA 4ZVSB 3PO4A 3LGNA 3FFIB 4MTPA 5LL6d 2I5JA 5GAEU 1NPRA 3OW2R 2FB0A 3CB4A 3K8VA 5CZXA 2RDDA 4KGXB 2F4FA 5F3TA 2HNDA 2A18A 1NB7A 1WOOA 1JJHA 1UKUA 2GMJA 3BDPA 4FPIA 2F4VF 2Z30B 5HROA 1QAYA 2FHKA 3NWRA 5AJ3J 5KT5A 4N8NA 3KK3B 4AUKA 3ILOA 1KBRA 2KZMA 5L1IA 4Z2XA 1H7XA 5F8LA 2R7OA 4CM2A 1GK8A 1UCNA 2XY6A 1E6VA 4C4WA 3DHWC 2FY8A 3IMQJ 4LF1A 4C8OA 3GJQB 4YUDA 5C42B 1JLAA 3CJKB 1HPZA 5C2CA 4B9MA 3BGOP 4OYWA 2F8MA 3PO5A 2XS2A 4B3TJ 4ED0A 1WDTA 3GJRB 3GU0A 2ZZNA 3BQ0A 2BQRA 5E2QA 4ZN3A 3FBCA 1TTHB 3IA0A 5CQGA 3AOCA 1RT7A 3ET6A 4KHPF 2VFUA 4WFAQ 4ZP8A 2GO9A 1IR0A 1DAXA 1ZM9A 2GX8A 3O1LA 3BB5A 1QM9A 1YX2A 3FEYB 3NS7B 2OJ3A 1C1CB 1N5QA 2JLEA 2Y1RI 4KGKA 2AKWB 4DU8A 4X62F 2HVDA 3VAIA 2CQHA 1S72S 1APSA 2JHEA 1AUDA 2IYGA 3N01A 4RW4A 2R7WA 1A7GE 2UVVA 4DS5A 2CKWA 4J90A 3NXZA 4HTJA 4C6AA 1RT3B 1RT4B 4QIWD 4H4MA 4TY9A 2BJEA 2KRBA 2YWWA 4DU7A 4JV1A 4LFBF 2CG8A 3VGSA 2CQ1A 4LF7J 4FF4A 2VG6B 4EFAC 3OL8A 4ZPVR 2N3OA 1RP5A 1L3UA 5DJBA 4DR1F 3MM6A 5E0OA 1JNZB 5KFQA 2EBGA 3VQTA 1VBYA 1HHSA 2LYVA 5LSLA 3BJYA 2IJNA 3DLJA 3G8QA 4Q5VA 2Z0GA 3R5DA 2VQFF 2HGLA 3TQ1A 1N34F 4JI4J 3K57A 1BY9A 2A6MA 2E66A 4LBPA 5KTQA 5GAEI 4MKAA 3RUBL 3TAMA 2Z4PA 1M5VC 5CXTA 5CYQA 1EP4B 2OELA 2FLOA 2AZ3A 1H2TZ 2GW8A 3CO9A 4OYAA 4UZCA 4OX9F 3S6EA 5DQGA 1SJ3P 4NLYA 3I82A 2RH3A 3DRRB 3AHPA 3D1QA 8ATCB 1TZ0A 4XPEA 1T3NA 3SCJE 3WBZA 1NK0A 1RAJA 1WKJA 4QR2A 2B56A 2HS4A 4L74A 3X3UA 1MWQA 5HO4A 1UW4A 4TU7A 3S8SA 3FQKA 4QJVA 5G0RA 1HLWA 1PJ7A 1J5OB 3DLEA 3NMRA 2OPRA 3VAFA 2MQPA 5IV3A 4DR7F 1UVKA 3CDBA 1U49A 4Q0BB 2B0GA 2E5GA 2X1BA 1WNEA 2MY7A 3JSMA 4AXIA 2FC9A 2KG1A 2KI2A 2KT2A 3FBFA 2E5IA 2C3MA 1QSSA 2GVZB 2GHWA 2WCXA 1Y5NB 2LFVA 5GAGU 4YP3A 4DSIA 4F2RA 3SQGA 5A8KB 1S6QA 3HF5A 4IG0B 2XLJA 3EX7B 1PJ6A 4ITSA 3T1HJ 2ZZMA 4PWUA 1RDRA 2OEMA 2D9PA 2C3OA 2A6OA 1RSCA 4JI7J 3MMCB 3PW0A 2HMIA 2GJFA 4M5GA 3TI0A 3U1NA 1U6FA 3I32A 2VQFJ 4RWXA 4JI4F 2IMWP 3R2CJ 1G6BA 2EK1A 3DOLA 2MQOA 1RAAB 1SUQA 3SCIE 4PG5A 4DI6A 4DV6J 1FERA 2M0GB 1WI8A 1M5KC 2NPIA 1U1KA 5A6WA 2OEKA 2ZH9A 4G1QA 2L9NA 3GV7B 4IFVB 1YJWS 3DM2A 1SCJB 2AEMA 2RUGA 2V4JB 4QWBA 5D0HA 1H0HB 3W1YC 4FVMA 3VWSA 2DXEA 4PAAA 3NRBA 4HL9A 3NEKA 4FYVB 2CUYA 3D7SB 4BWMA 3VVTA 1LK7A 3W66A 4UZBA 5LMNJ 5D3GA 2C2EA 3CPWR 3HVWA 2FD2A 5HMXA 4XDCA 3CJ4A 2C2OB 1S4FA 4HDGA 1C2PA 1VC5A 2P6TA 3A12A 2NUHA 3Q83A 1EJ7L 1T9UA 3PCOB 3M30B 2KXFA 2RSQA 2ZWOA 3DHXA 4X84A 4IG0A 2B4VA 4ID8A 3M9MB 3G82A 2LQ9A 3BV8A 3KG0A 3MFHA 4RW9B 1SKSA 5EGYA 5KT2A 2VA3A 4FXDA 1XNRJ 2BMBA 1EX8A 2LDYA 1FDAA 1NJWA 1N5YB 1FA0A 1SV5A 1W25A 2RILA 3NL0A 1S49A 3OVBA 4Q8FA 2VH7A 4P7VA 4ZCLA 3VGVA 3MF5A 2IIHA 3ENVA 4R8UB 3IO1A 3ULHA 5HSPA 2VBYA 1U1PA 3KJFB 1T11A 4R0EA 4YR0A 1Q8IA 3AA8A 5GADU 1U1RA 4DSJA 2COLA 1X5OA 5K9FA 1N36J 3HD1A 3IG1B 2JVRA 1WC6A 1JQGA 5AE3A 5KG1A 3DRRA 3GLJA 4RNHA 5IQ6A 3PZPA 3H8YA 2QIFA 1NJXA 3KHLA 1WC0A 1VIXA 5AXLA 1SKWA 2VODA 4X4TA 1PILA 4JI5F 1JXLA 5ETPA 4I0WA 4IO1A 1VC6A 4NLWA 4NL5A 1RWMB 1HD0A 3IGVA 2NCKL 1FHTA 1J27A 2GC8A 2PD1A 4OZ3A 3BGUA 4KPCA 3TUIC 2V8VA 3I0RB 3OUYB 1MMDA 3AQOA 3Q8QB 2XMKA 3OFEA 4JI5J 2ZH8A 2BE2B 5I3UB 1NB2A 5H1SV 2BJDA 2MZTA 1CJUA 2NXNA 4LSZB 3UVJB 1NJZA 2UUCF 3W2WB 3SIPB 5BYSA 4B08A 1HWUA 3QZ7A 5CAAA 4F02A 2DGWA 2DHXA 4NLXA 2MKKA 2ZBQA 4NEZA 2DJWA 1WORA 4USTA 2ERRA 5DDOC 2D41A 3ENQA 5LOQA 2HFUA 4E8UA 1UJ4A 1FJ7A 1KDNA 2L41A 1NAQA 2LEAA 4C7QA 4O3NA 4DQIA 3MPWA 2I2YA 4PWDA 4DR4J 1V9OA 2I6WA 3N79A 2FGCA 3B78A 3S1TA 2V2VA 4ETZA 4OYIA 1IJEB 4URQU 1FK9B 1Y11A 4DPUA 4F0MA 2DHAA 1Q7LB 4CO3A 3MAQA 5IT9U 3KOAA 2V67A 4NASA 5HLFA 1BQXA 4AQYJ 1LNQA 2G2OA 2KFYA 3TAPA 2BQUA 3HVTB 4KFBB 1FNOA 1OQ3A 2G1DA 2VUGA 1AZSB 3BSAA 3PKMA 2J5AA 2GQ2A 3OSNA 5J2NB 3GIIA 4EUVA 4OYOA 4C3LA 4DG1A 2CQ2A 4HACA 4ECSA 1E6VB 3IBWA 2VBWA 1TV6B 2WTFA 2O66A 4XDDA 1LWFB 1JLBB 3MD3A 2XY5A 4QU6A 1LWCB 1S79A 2AYBA 5E33A 3DYAB 2P9EA 4FKYA 4GVBA 3C6UB 2WRMA 4GO5X 1RB0A 3G87A 1DTQA 2D69A 1FXDA 2ROGA 3D66A 3L4BC 3MTJA 3A1YG 3OT9A 4OZJA 4WIQA 5KG3A 3NLCA 3BGFA 3VF0B 6AT1B 4FBTA 2AGQA 4CLSA 4NCBA 5KAKA 3C2PA 3C8YA 2C2KB 5AXNA 3BO2A 1QSLA 4F36A 2DY9A 4MK7A 3UO0A 1FKAF 2QA4S 3GE9A 1UFKA 4HI2A 1EKRA 2W24A 2ZKUA 3GG0A 5I4MA 1OSCA 5HN0A 3OV7A 1VI7A 4P71A 1KVKA 1WG1A 2V69A 3D4JA 3ZZRA 4DZ6A 3UWTA 3TRGA 4A47A 2R7UA 4Y3CA 3A3NB 2APOA 3H5SA 3CDWA 2R8JA 3W61A 4NLQA 3IS9B 5F8NA 5DGBA 4PG6A 2XMJA 4Q0BA 2KXNB 2B43A 1SKUB 3TR5A 3ZO7A 2RHQB 4QPTA 4H4OB 1SH0A 2YWFA 2MQMA 5H9FK 3HM9A 1NSKL 1NKBA 2IAJB 3SCLE 2ZKTA 2CWKA 1UZDA 4TYAA 3Q2TC 4C0OC 4F2SA 4NRUA 4ILMA 2EEYA 5KT4A 1HW8A 3CDUA 2KJVA 4DX5A 1IKXA 5BXIA 4DR6J 2GAGC 3SCKE 2H5EA 2HVEA 1O8BA 2ZM6F 2FDNA 1WEYA 2N3LA 3G2XA 4LSLA 1RLDA 1PIEA 3J7YU 3HXMA 1S7HA 2BYCA 5KFLA 1NSAA 4NLDA 2ASLA 4USKA 4ZLLA 1N5VA 4C48A 5D6GA 1M1KT 2OPSA 3J80U 4IRDA 1WG5A 4DV4F 2V68A 3KHHA 3HSZA 2VHGA 3LH2S 2C2ZB 1ZA2B 3H25A 3W5ZA 1MROA 4RBUA 2NR0A 1RQ0A 5E3PA 1H38A 1N5YA 1WEZA 1EQMA 4DR7J 3QFWA 2ZNYA 4UW2A 3WX4A 4B9TA 3MPDA 4LF7F 1BQNA 4JI6F 2BJ9A 3MTKA 2H5IB 3B82A 4RUAA 3G8SA 3LP0A 2VONA 3FCHA 4FPRA 1M1GA 2MSSA 3BH6B 1NK7A 4CLTA 3W64A 1AA1B 1QUVA 2QFIA 3GIRA 2M2BA 3I31A 1RJJA 2WVEA 3FSYA 1L3VA 2XG8A 3UD5A 3J7A1 2VG6A 2CNOB 3O44A 4FNIA 5EX3A 1GH8A 2GIFA 2P5VA 3LAMA 2R8IA 4G1PA 2UUAJ 1FVQA 3FRZA 3EGZA 4AL5A 3CJ2A 2XCPA 2RJZA 2GGPB 3RBXA 1KOOA 4ZJOA 5KFAA 2DB1A 3I96A 4YY3J 3LALA 5B0EA 1DJ0A 4JP8A 2HNYB 2JRSA 2Z56B 3Q8RB 2QJ3A 5BJRA 5LJ5Y 5DDQC 4DV3J 3U1MA 3UVJA 2ZE2A 5HJYA 1F1BB 2DH7A 1YG0A 4JV0A 3B4DA 1SIZA 4M5MA 4B17A 3ZZOA 4USHA 3ISND 1VQYA 1S12A 2E1CA 3ET6B 4RUHA 2B8QA 4N77A 2MQQA 3OL7A 4KO0A 4X62J 2GMHA 5HROB 1S76D 1C1BA 4O3PA 3M8QB 2W4DA 1VK3A 3GFZA 2R2RA 2M8DB 5AJ3F 2DXDA 2OTLS 4G1IA 3CEDA 1RAOA 2XGQA 2ZWPA 1VQOS 1ZAXA 1IR2A 3FEXB 4LF5J 1TK5A 2EFOA 5D8HB 4OZ2A 3SQGB 3AOAA 1RTJB 4OYZA 5A8KA 4H4KA 1WF2A 3UDCA 1QVGR 3RRGA 2I1RA 4DOZA 4DEZA 2EWHA 4P2XA 2UXCJ 3OD2A 1DLOB 2GFFA 4RW7B 3SSRA 1T8EA 2IAJA 2MQNA 1X9WA 2LQBA 1YBAA 2MLXA 3IAS9 2R2TA 3QIDA 1W2IA 3GFHA 2EKYA 1S1VA 4PZVA 4FS1A 1T9TA 2VL1A 4OYMA 3M6XA 1LFPA 2N82B 5ETTA 1NLKL 2UXCF 3HZEA 2JVOA 2E9TA 3EICA 1HHQA 2QG9B 1FXRA 3MPVA 4NZ0A 4A8OA 5E41A 1EQ0A 5IOLA 2VBZA 3M05A 3PW2A 1VBXA 1L3SA 1D9FA 1GFWB 3BF4A 4ALZA 4ZVGA 2MGZB 2W8KA 4LRAA 1PYOB 2AQ4A 1AXQA 1N32F 2JSXA 4JV2A 5HP1A 4AYBD 2DGOA 4UOCA 3HO1A 2BA9A 2NXJA 3IFEA 2HQGA 2BKPA 1KRPA 4IDKA 3MM8B 4CH7A 4LQ9A 4D3HA 1SQEA 4O0IA 2XSJB 3THPA 4ES2A 1B0PA 3QT7A 2MTLA 2EFPA 3CJ0A 5IZHA 1F5CA 3H0PA 1U09A 3D1HA 5AXKA 3T5HA 4ELUA 5H9FJ 1QLNA 2FHJD 2Z2LA 4TU9A 2DPJA 2DNYA 1SH3A 3E2EA 2HAFA 2IFXA 4MK8A 2W9BB 4ECQA 1S99A 1PGZA 4B9SA 3C15B 4USWA 4LF4F 2CJBA 4ZVUB 3AFGA 1UTAA 5BR8F 1C0UA 2CDRB 4ELVA 2PI4A 1ZM4A 1WG4A 3F44A 3H59A 4CCHA 2MEWA 2YWHA 3FNNA 3HVTA 4FF3A 3D6MB 2PT0A 2XZTB 2WW4A 2N4DA 3MCOA 2HNZA 4TLRA 4F3MA 4U7UD 3P5BP 2EKNA 3DLHA 1S1XB 4M5KA 4WKYA 4KKOB 3QLHA 3OFFA 3ONQA 5LMNF 4J9KA 5DRKA 3J7ZT 2ZITA 1F2GA 1KQFB 3I0SA 4F26A 1BXNA 1VGYA 4OZ5A 4CO0A 4EBDA 2HK3A 3GCXP 5KT6A 2YNIB 3BGRA 2FZGB 3MURP 2D3OR 4I69A 1U0SA 2YQ1A 1KQSR 1S4EA 1U45A 1KQGB 5KFPA 1SIWB 1H3DA 4JI2F 3VALA 1QDUB 3TANA 2WVDA 3D0IE 1HI1A 1KLMA 2IJFA 4B3OA 2M88A 1N6QB 5DO2A 2BRLA 5G0RB 3RRHA 5DGAA 4X64J 1JX4A 1Y00A 3ADAC 1CC7A 1G7CB 2FHJA 2XHCA 4F7VA 4X4QA 4YR2A 2R9LA 4JI7F 2HHHJ 4O3RA 3BYPA 2FLLA 1PO6A 2EFQA 2M7SA 1AFIA 2NS1B 2RHSB 4DHVA 1R6YA 4N76A 4HH0A 1ZA1B 2L3MA 3SXLA 3LP0B 2ASDA 2QE5A 1VBZA 2I5JB 1URNA 2ZBPA 3RZAA 2HW3A 3PHEA 1OS5A 4M1KA 1QAJA 1SL2A 3OR1B 2XB2D 1XR7A 3WIUA 1NBEB 2PEBA 5JMNA 1AUSL 5EWFA 3OTBA 1HBUB 1FX2A 1D0EA 3MM6B 5EN1A 1JJ2R 2IRYA 4PG8A 1LW2B 1CPZA 1RI7A 3GCWP 4KTQA 5KFRA 3HD2A 3IRXA 3RW6A 2DGSA 1FJEB 1XMBA 2W7OA 3M9OB 5KFGA 3VQSA 4I1TA 3CCUS 1VQLS 2QV6A 4KH1B 5J1PA 2ROEA 1WOSA 2RUSA 1P1LA 4L75A 4A8QA 5K14A 2QSWA 4DQRA 3OTCA 4FDFA 5A2QU 1QTNB 3A4TA 4CTAA 4D3GA 1HNVB 2GHPA 3V4IB 3QSYB 3MCNA 1S57A 4W4MA 2XMWA 4J9SA 3D54A 4KHMA 3BQ1A 4DV6F 1NHVA 4LF2A 3EPGA 2LMIA 3EXYA 1TL3A 2MHEA 3L7UA 2ZH3A 1IBMF 2V9KA 3U27A 2R8GA 4NA2A 4DX6A 4QYZJ 2B9WA 4DPWA 3PR5B 3DRYA 2NSCA 3G86A 1S6UA 1V5VA 1FRMA 2AP6A 4OZLA 1UL3A 4GKKJ 3FDSA 1RBOB 2HQFA 4KGMA 3WIVA 2R7RA 3PG9A 3QO9A 1KTQA 4Q8EA 2HBYB 1KFDA 5ETQA 4ZJQA 4OX6A 4MIAA 1X4HA 3D68A 1EIYB 4WE1B 2ZVIA 5L1JA 3TA2A 1J5EJ 1S0OA 3DI6A 1Y5LB 2GZOA 2JWNA 3NGKA 1YJ7A 4KKOA 2E7VA 2EFGA 2YNGB 4I56A 2QMXA 4KR0B 3Q89A 2CPXA 1RLCL 4DPYA 4F4AA 1CJTA 3AODA 5KFFA 3D3BJ 4DSEA 1YZ6A 1AB8A 5KFVA 1OYEA 5KFCA 3PW4A 2F65A 3H2UB 3WC0A 2U2FA 2PMZD 3WHIA 3V6DB 3GFYA 4JI3J 2XZDB 5L1KA 1FKOA 3ILLA 3CJ5A 2AW0A 4NWBA 2ZH4A 2FPHX 1AT1B 2QRRA 4LUBA 3DI6B 3JTPA 3M8ZA 3PHTA 5I3PA 4LMZA 4ZK7M 2CVEA 4URSA 3I5CA 5LSOA 4NLTA 1XK8A 2PMWA 4JBCA 1KNZA 5IT9Y 2LP4A 4C0BA 1XERA 2IYIA 4GMKA 4I68A 4BC7A 4N56A 3MM5A 1U7LA 1FRLA 5IS2A 3PKYA 1A0OB 3HHEA 4NLRA 2HHXA 4WF9Q 1LK5A 2HG4A 3DC2A 2UUCJ 4OX9J 4ELTA 2BJ3A 1Q86T 4OI4A 4A8KA 2XS7A 1LQ9A 2ZH5A 4HT7A 1SBRA 2MJNA 3MGJA 4USVA 2CYYA 4OQJA 3Q8VA 1S1TB 2L9WA 3C6TA 3W9JA 3QT5A 3JYTB 2HYIB 3R7BB 5HQ8A 3ZXWA 5ETKA 2F40A 3US5A 3UW1A 4B3RJ 1M5SA 3O2IA 3S01A 3DKDA 3CCQS 1N4LA 4NLOA 2LU2A 1HBOB 1HQEB 3MHYA 1DY3A 5DM6Q 4O3OA 4CLLA 5JJBA 3MFIA 3JQMA 5KFNA 1C0TB 1YK9A 3QJLA 2XZWA 1UEUA 2XBPA 1FFWB 2HWHA 3DGPA 4WFZA 1N36F 2CJKA 5DETA 3LP1B 3DLBA 1U02A 4F4ZA 3H4DA 3T1HF 2ATLA 2MQLA 2MPUA 1VQ6S 1S9EB 2CVIA 2C3YA 3M8PA 5T7LA 4YY3F 5HBMA 1FRJA 2JL9A 3JXOA 1R0AB 3CC2S 3A8JA 5JUMA 4Y00A 3EYZA 1G4CA 2CZ9A 3HHDA 1XIQA 4P9SA 3DLLQ 3VGUA 1AYEA 3M32A 3QGGA 4MKYA 1K1SA 2POKA 1FJCA 3RG6A 4K2JA 4IG3A 3EM1A 2HNYA 1QTMA 1GX6A 5A2QY 3DOMB 3KNAA 2CPEA 3C16A 4RX6A 2PE8A 4PRFA 4MYUA 2HFZA 4CYUB 2UZAA 1UW9A 5LM7E 2AWZA 5ETRA 2KTQA 1GXLA 2JFKA 1R31A 2MHNA 4N7TA 1LWCA 4JI0J 2HVIA 1YRXA 3FBEA 5E3AA 3KUGA 4ZCIA 2W7AA 1JKHB 5I42B 3RGIA 1AW0A 4WP9A 1HMVB 1S59A 5A0YA 1N88A 2RRNA 3TZWA 3LGHA 1IQTA 2RT3A 3LUYA 4DG1B 3B8HA 3K7RA 2VFRA 4LF9F 3M6WA 1RWUA 4M5LA 3CCZA 3NCPA 2ZC3A 1VRQC 1KLNA 5KFDA 5KFMA 5EUHA 5CYMA 4ED3A 1XC9A 3M1VB 4AT1B 3H98A 1E6YA 2GGPA 4ZPBA 2UXBJ 1NZ8A 2XLKA 2H3EB 1Q5VA 1UVNA 1NM2A 2AJFE 4U95A 2H65B 3M8RA 1M5PC 4IOAQ 1O5JA 1OPZA 4ZP7A 1GMWD 3OTDA 2RF2B 3ZNJ1 3V4IA 1GMWA 2FVCA 3QAEA 5AE2A 4Y2MA 3VGTA 2V6AA 3ZZUA 2WVBA 1SQFA 3H20A 4CLWA 1HNWF 4R5PB 4PQAA 1FESA 2PDAA 3AA9A 4DR5F 2CPIA 2DIVA 4IFVA 1F6TA 2OFHX 5HVFA 3QJPA 2NLWA 4CLUA 2XQCA 3MEGA 4KT0C 3DRXA 2UXDJ 1RCOB 5D77A 4DL0C 2XS5A 4KHPJ 3D9BA 2I0XA 2W2QP 3FSXA 2GA7A 3RB0A 1RTHB 3QWPA 1LW2A 4WIIA 3PDNA 3N6LA 4QIFA 4CNYA 1I94J 4ILRA 2BE2A 5I3UA 3CD5A 4TN2A 1U1MA 1X4AA 3PYGA 1R8PA 5F0UA 4F67A 5DLGA 2LECA 1R7IA 4IDKB 2HS0A 2IRXA 3MM8A 2OI2A 4LFCF 1LV5A 3P6YC 2V4RA 3KG1A 3GR0A 3MMBB 1IKWB 3SQOP 1HWJA 3DNCA 4OZNA 3VTIA 4CH0S 7AT1B 5F8IA 3MR6A 1P9YA 2VQEJ 1RT5A 4I2QA 5J2QB 1Y3KA 3NBPB 2G0CA 3EE3A 4I64A 1Q0NA 4LR9A 4ZPWR 4ZVFA 2N7CA 3KLIB 2ALZA 2YH1A 1D9DA 2HHUA 4AFFA 3IRWP 4NXNJ 5B0AA 2E9ZA 3H5XA 3IG1A 3SZ2A 1IKVB 3M8PB 1V3RA 4ZPAA 4Y0FA 1N8RT 1TKTB 5MAOA 1UVJA 1K73T 2VF3A 1T9YA 2HURA 3GIJA 4IH6A 2ADBA 1RAGB 1MNEA 2PA3A 4Q44A 2OLWA 1RTZA 1QY7A 1JIHA 3J7YI 4M95A 1UVLA 4OLPA 1U1LA 3PJXA 4LR7A 3DOKA 1SJRA 2AT1B 1X7VA 4QW9A 1UVIA 1PJ5A 2HQDA 2WSFC 4J7CA 4X66J 1S1WA 3PYEA 2R7TA 4I7FA 4DUZJ 2VG5B 3W2VA 3G6YA 3J81j 1WSVA 4WWSA 2HHQA 1VIOA 4AE5A 2J0WA 2PO4A 4IQXA 4LQ3A 4HACB 5FJ4A 1T05A 1RAFB 1LWXA 1WUUA 2ZZTA 3CCWA 3T6BA 4YMEA 3IBCB 2HHHF 5KFSA 4UY8T 3H42A 4RJVA 4CLKA 5DQHA 4QWEA 2D3UA 3CJ8A 5IT4A 1B99A 1X31C 2QO3A 3KMQA 1NHUA 4P73A 1MSWD 2DT9A 3T41A 2K1RB 2Y1JA 1DTQB 1FO1A 2AMCB 5ITHA 1GQEA 2W9AA 1DQ9A 2X51A 2BABA 5J2MB 5F41A 3SV4A 1LEOA 2V5HG 2Y0BB 1S97A 3Q0AA 2NPFA 2XLIA 3C14A 4EZ6A 2MKCA 1LKZA 5I3QA 4NRTA 1TFYA 4DPTA 2EPIA 3DLGB 3R5CA 4MK9A 1U2FA 4F4KA 4NE9C 2MDAA 2DNMA 2OP5A 1HKAA 2KB2A 3CCRS 5KFWA 4DR3F 3KLGB 1K0VA 3POTB 3HFZB 2Q6CA 2VPXB 2UVWA 1VMBA 4KFBA 1BWEA 4DDFA 2YNFB 1FX4A 5B7WA 1HNZF 4PPDA 1JLQA 4DL3A 2M52A 5HANA 3W2WA 4XIUA 2DR7A 1NDLA 5K8OA 1YDLA 2HKEA 4LRDA 2CJQA 3QGPA 4CT9A 2EK6A 2GVDB 2AYGA 3AB4B 4K4UA 2H4YB 5A6PA 2ZDOA 2J0SD 4OYXA 1FJGF 8RUCA 1FT8A 2R4FA 5GAHU 2VASA 3R8YA 1XJWB 4YHHF 1RAEB 1TQLA 3OVAA 1VQMS 1YRTA 1FRHA 3D0GE 2MZJA 2E5LF 2YY3A 4ETXA 4MIBA 2CPZA 2MY8A 2HVHA 3QJJA 3NNHA 3DRPB 4FNHA 4DUYF 2G13A 3TO8A 1PSDA 4NZ7A 1S0MA 3SFUA 3T1YJ 3EVWA 4OX7A 3CCMS 4C11A 5BYQA 1TU0B 2H9ZA 2R8HA 1RK8A 1FE0A 4ED8A 3TJ9A 3WX8A 1RU1A 5EWEA 2KKHA 1ZAVA 5FIIA 1S9FA 2K8GA 1P9QC 2A2CA 4KAIA 2YTCA 1UFLA 3I6PA 3MPYA 1TKZA 5M2RA 1EP4A 3ZTOA 3TZZA 1YIJS 4NXMJ 3IR6B 2PEHA 3ENAA 3IM8A 2YKOA 3R5BA 3MECA 3CUNA 1VC0A 3IRXB 1OY9A 3GG1A 5LT5A 2V8DA 4KO0B 2VZ9A 4F4YA 1VQ9S 4JI1J 4UY85 3HSJA 4ECVA 2VDIA 1Q53A 1U25A 3DRPA 4HTIA 4ECUA 3WZ0A 2KFZA 3A8IA 4I2PB 5J2PB 1ZM2A 3OR2B 3J7AN 4DV5F 3ZZYA 2AYMA 2OAUA 1IBLF 2UU9J 1UPPA 3N5BA 4RNNA 1T7PA 1YZ7A 1RACB 4F8RA 1I6JA 4U7UK 2Q66A 3NS6A 5ETMA 4EO6A 2FGOA 4X65F 2CFXA 4NLPA 5L46A 1K1QA 5U47A 1YBUA 4HHHA 2BKNA 3BQ2A 2DEIA 3MZIA 5CABA 3P49B 4G1QB 4FYYB 1DTTA 2DNRA 1VQSA 5IM0A 4P72A 1TL7B 2KM8B 3NNCA 2B5JB 2DH9A 4JUZA 1ZBTA 3EWGA 4P10A 5IC4B 1CSJA 2DHGA 3LANA 4K4YA 4K4SA 2QL7B 4JOUA 1U0HB 2ILYA 4GVLA 1FDBA 1TAQA 2JC0A 2VD3A 3A3OB 4ZIWA 2BM1A 5HVGA 1UZHA 1UEKA 4JI6J 2OSQA 3MMJA 1LW0A 2J0QD 3UCZP 1O0PA 2N7YA 1PBAA 2XI2A 2Q3PA 4PG4A 3T9NA 3TEGA 4ZIVA 1HR0J 2QLXA 2C1EB 3KDNA 3TUZC 4U6PA 1NDCA 1Y7PA 2BW7A 3UR0A 5DG9A 5CD4A 1SUQB 2HFVA 2IVMA 4ZDNA 4B3MF 5HMYA 1ZTTA 3CJRA 4FXWA 4DFKA 1B3TA 2FVRA 4CO2A 2FUG9 3QYYA 5K8MA 1WC5A 1TUGB 3AH6A 4O4GB 1EAYC 4DL4A 2CA9A 4DSKA 1VRTB 1N52B 2HLUA 1NZAA 3KK3A 2V63A 2HNZB 1J2VA 5KFXA 1MWZA 5KFOA 2JLGA 4DUYJ 1Q4RA 3CJTA 3ZZPA 2L9DA 4DLEA 1CQNA 2F7VA 4WK3A 4ZLPA 4DV2J 1H2UX 3RAQA 3DXSX 3MXHP 2JZ5A 3FSIA 3PEHA 4L6V3 4YB5A 2V4QA 2OKQA 2G2ZA 2V8PA 1C0UB 3LPYA 3F0NA 2ZOMA 3KUHA 2HAIA 1ICEB 4F0HA 5IWAJ 2NQPA 1MLAA 2M8HA 1OSDA 3J81U 2W9BA 3FMWA 3VAGA 1T03A 1DTTB 2LQ8A 4CDIA 2VOOA 1GTHA 2M3DA 2OUGA 1FJGJ 2BE9B 1IQZA 3FC9A 3I9ZA 2UVUA 3CD7A 3BS9A 2DRAA 1S1TA 1KTVA 4M5JA 5ETVA 2HZCA 4FXVA 3CCSS 1EZZB 2C28A 1CEZA 1D09B 1J5OA 1PYSB 4DL7A 4ECZA 1R0CB 3PIPQ 4CI0B 2WONA 1GNKA 2NXUA 4DPOA 1Y10A 2DNQA 1WDDA 3W7BA 1NK8A 4M5DB 3ZTRA 1VQ4S 1B4SA 2CNLB 3KLGA 2FJAB 1VJQA 2R7VA 2CPJA 1FI4A 2G9OA 3IWLA 2FJXA 1GEHA 4QYZK 3OLBA 4F3QA 2LDIA 3HCXA 5JVHQ 3H2VE 4WFYA 4YQWA 1FVSA 2LKZA 1H2VZ 3UN5A 5KG5A 1YJUA 4RNOA 2RKIA 3ICLA 3MMBA 1UETA 1NU4A 3M8YA 4G6VB 1KQKA 4IFYB 4A46A 5KFJA 4URGA 3VAJA 3NMAA 2UUWA 3OFHA 5A8WB 3JAMU 1Y9OA 5KFUA 2K1RA 3JTOA 2W9CB 1ZZNA 2UXDF 4QOTA 1BHNA 2MKHA 2ZOGA 5KG2A 1VQNS 2AU0A 1BQMA 1H98A 4JB8B 4IUFA 2LXUA 3RB3A 4DCOB 2HSEB 5CHCB 5FLXU 4ID5A 2WOMB 1GXTA 1N5SA 1RHMB 2AX1A 2GNKA 5SZTA 1XMOF 4LF8F 4MKBA 4DPXA 1DFDA 5F9LA 3TQEA 3EGWB 3OHAA 4NLGA 2ABYA 4B3TF 4M5NA 3VAHA 1KSPA 1A6LA 4NLSA 2R7XA 2PI5A 1X5TA 1U26A 2O1PA 2RS8A 3NCQA 3QQCD 2G0IA 4YB7A 1WC3A 5HI7A 4CP5A 1YJVA 4OHYA 4WZQA 4R0JA 2QLFB 3DLKB 4J9MA 4KV8A 4ZITA 1D8ZA 3GJSB 3T9ZA 1W26A 1HW9A 1LW0B 2OFGX 3SBMA 3K58A 5JVGQ 3EMTA 1NH7A 2XMMA 2X3GA 2XMTA 2XULA 4PXEA 4RUBA 3RAXA 3HKWA 2ZUGA 4LR8A 3MEEA 2VPWB 1BQMB 1CJUB 1QD1A 3NAIA 1IKVA 1D3WA 5ADZA 3TZYA 5CYMB 3NKYA 3SV3A 3CC7S 1FEHA 3E51A 3CF5Q 2HNDB 5GMEA 2CQBA 3RYLA 4KV8B 3O3LA 2V50A 3U1LA 4CLYA 3CCJS 2FJWA 2A1BA 5CCMA 4J9RA 1R8HA 2J9DE 2WK4A 3GYNA 2IM3A 2VB6A 2DGQA 2BM0A 2EVZA 4P2MA 1R0BG 2BUNA 5AXMA 4LSNB 4TY8B 3IM9A 4NLVA 3W5XA 2ZH2A 4K0KF 3QT8A 1GXUA 1WI6A 3TUJC 3CCLS 2MKJA 4A4JA 1S0NA 2MKYA 2VBXA 3A8EA 4WU2A 1RT6B 1RGVA 3RBEA 1IVZA 4G3IA 2IJRA 1RTHA 4O3SA 4CYUA 3IR7B 4ZHRA 3JQJA 3KLEB 1NXIA 1MN9A 1S6PA 3FFIA 1LXJA 4QR0A 4ED4A 4WXWA 4FF1A 4OZ0A 3S7RA 4RU9A 4BDPA 2ZOFA 3MM7A 4R5PA 1KHVA 3UE2A 2J6UA 3RR7A 1JWWA 3EUNA 3MPUB 4ZP9A 1EB0A 4K8RA 4AXJA 2DIUA 2AJ2A 3NAHA 3H4BA 1S9GB 1VJWA 2NXEA 2QLWA 2YX1A 4ICLA 3D5MA 3HFVA 3N6MA 3ZZZA 2KU7A 4R8UA 5LXRA 5LMUJ 3R3TA 3DGPB 1OIAA 2HIQA 3GV8B 4DL2A 3BPDA 4FYXB 4DF4A 3AJDA 3NNAA 3EZ5A 2GJIA 1YTYA 3X1LB 1UWBA 2W4CA 3MOJB 4RPFA 4KBIA 3TYTA 1XBWA 4XPCA 2IPOB 2WB4A 1N32J 1OMSA 3N0VA 1TMMA 2IVFB 4L3NA 3LQVA 3CMAS 1H72C 1ELOA 2YBVA 3MM5B 2DHSA 3E8OA 3NG8A 2CQ3A 2GV1A 1PC4A 3UN2A 2RMLA 4A48A 3HVRA 3EDRB 5K8PA 2V9WA 1EARA 3M2UA 4KE5A 1B0TA 3AOBA 2MJUA 3IC1A 1HA1A 1X5PA 3DLGA 1RT5B 4I2QB 2ZC4A 5ETSA 5CYJA 4RUCA 4C2MA 3D2WA 3CJSA 1FKPA 3W9IA 3QLHB 1JMTA 3GP9A 4RR5A 5THWA 3PACA 3ZZ0A 1B0VA 2WSEC 2RD5C 5IC6B 2J76E 2FLNA 1FKOB 2M70A 4DV7J 3MEDB 1SJFA 4EI2A 3AJ1A 4WBFA 4IOBA 1H7WA 4DV3F 6FDRA 2RS2A 4KHRA 2AEJA 3POTA 4DN9A 5HMWA 1R8AA 4ZS6A 3RW7A 4DL5A 1TKXB 3HLUA 2YWGA 3M32B 3ZTSA 3KNGA 1U47A 4LF5F 4JI8J 2XO7A 2W8LA 2B7BB 2AGPA 3I0SB 2HQIA 1VRUB 2H5JB 4HDHA 2MKSA 4C98A 3MEKA 1NKEA 4O0NA 1QUPA 3VHQA 4AL6A 2VA2A 3DYAA 1F9EB 3IN5A 2HMIB 1R8CA 2RF2A 2DRDA 4DX8H 1FRXA 2FJDB 2K7JA 2R42A 2UUTA 1S5ZA 4ED2A 1FK9A 1CJVA 3CVKA 1H74A 3BBCA 1TK0A 1ZOTA 4GC7A 4YS2A 3ISNC 1X4GA 4LREA 1U0HA 2IDEA 4K59A 1SH2A 3W62A 1VLOA 3AXKA 2FJEB 1VQPS 2E7XA 5KG7A 5EX0A 3W5YA 2IBKA 4JI2J 1HBNA 3CIZA 2CPHA 5BYRA 5HK4A 1KEKA 2AX0A 4OI2A 2CJYB 2DGXA 2GMLA 3IR5B 2NYHA 4RW6B 1CULA 2CXEA 3P3DA 1RCXB 3KLIA 4C3KA 1S1WB 3BSOA 1TKZB 1P6TA 4OIXA 1FFGB 2DNKA 2FHOB 1BUXA 3F41A 1UWBB 4KSEB 4OJ1A 1G1XA 1F9FA 3I5BA 3GIKA 2G1HA 3HSGA 1S6PB 4C97A 2XYGB 1DBDA 2KVIA 2J9CA 5GMKa 2PMHA 5SUHA 1KHWA 2LVWA 3M6UA 1CG2A 4PUOA 4OLOA 3R1HA 1JXVA 5IFMA 1YSJA 2C3UA 4M63A 3Q24A 2OEJA 1TL5A 2JH3A 2CQ4A 3H90A 3GFXA 4DR6F 4ZOSA 5DZ6A 1RISA 3C16B 3OR1A 4DN0A 2BE7D 1WD6A 3HFKA 3D0HE 2ZH7A 2JFDA 5LXYA 1C1BB 1N0VC 2RAQA 1I94F 2FVQA 4XO0A 1M0SA 4RL1A 2KHDA 3GV5B 3LA0A 2B51A 2H51B 3H40A 2HPUA 3MWBA 5HL7Q 1IM6A 1RZMA 3D67A 4QW8A 1REGX 4IO9Q 1I1GA 2B6AB 1IN0A 4OI6A 2PA8D 1WACA 2CZVC 2PSZA 5D0RA 5B0BA 2DPIA 4IQMA 4NA3A 4OZ1A 1U4BA 3SYZA 4C8MA 2QA4G 1C4AA 3DGVA 1VFJA 3CJQA 1NEEA 2BACA 1SQGA 1KWMA 3EZOA 3KYLA 1RXOB 2DYAA 3M1VA 4HEA9 1S7IA 4USJC 4ECRA 3BN4A 1RT2A 4U9RA 2CQPA 3OHBA 4N8OA 2EW9A 3JS9A 3W3SA 1YQHA 2D74B 2D3ZA 2IM1A 3BM7A 3PNIA 3CJKA 1R89A 4FKXA 2XNRA 2EXUA 4PYAA 3BH7B 2C42A 2FLPA 2RNEA 3FJ2A 4OI3A 3TJ8A 2DGTA 2XMVA 4DR2J 3HMJG 1RHKB 4LVNP 2NZCA 1S1UA 1VLYA 4J9VA 4QQBA 1M5OC 4NYPA 2CAJA 1S1XA 2ZE2B 1RWXB 1X0PA 1IBCB 2B9XA 3MI7X 3TA1A 1LWEA 3HHLA 4ES1A 2ZHBA 2J9EA 2WW8A 4J37A 2UV8G 4DV7F 1YI2S 2VIHA 1TK8A 2R7SA 5H9EK 4C8KA 4WFBQ 2DNLA 3GZ7A 3OQ2A 3V6KA 1A9NB 4FP9A 3K5LA 2UVRA 4YN3B 4KC5A 4IR1A 1TELA 1Y0HA 1X4CA 3F56A 1RTDB 1RA7A 2ZJQQ 1HQUA 3THTA 4CWBA 3ILJA 4KIAA 3CT9A 3UQSA 2OPSB 1JKHA 5I42A 4NLUA 4Q2LA 5JXSA 1NPKA 4TLQA 3Q22A 1D8YA 5IV4A 2CQCA 2MLYA 1FRKA 5AE1A 5DM7Q 5J2MA 2K06A 2PN6A 5D4NA 3EZUA 5A8WA 2WONB 5K8NA 4NI2B 1RTIA 4CLPA 1Q5YA 2GJ2A 3DOMA 1AROP 3FK4A 4OHXA 1F0XA 3HULA 1BQNB 5C25B 4WYLA 3HX9A 3DU6A 2LA4A 3PR4A
chains in the Genus database with same CATH topology
1N48A 2VPYB 1IUJA 1JNRB 4X4SA 5KT7A 2FTRA 1XR6A 2AJ0A 3ZFVA 2HHSA 1T03B 3HHLD 2OO4A 4H4OA 5HBMB 3K0JA 1S77D 3SDEA 4A8FA 1ZPWX 2VFTA 4NYZA 2IC3A 4NA1A 1LFWA 2MYFA 3HK2A 4HI1A 3FMBA 3PRBA 5D4LA 4F3OA 2WAQD 4Y2IA 3KHRA 4LF6F 1LXNA 5CCLA 1L3TA 1T02A 2HQ3A 2ZJRQ 2K2PA 1HNIA 4Y28C 4NCGB 3G71S 1NKCA 4NCGA 2RQ4A 1QSYA 4V19J 1Z2LA 1IJFB 2LQ5A 3R5AA 4OJGA 5C24A 1MU2A 3DN9A 4ZP6A 3UR3C 1R3NA 5KG4A 2R7QA 1DZ5A 4UUXA 2R8KA 4RNFA 2J7KA 2XI3A 2LEBA 3LF0A 2Y0SD 2AF6A 6FD1A 4PQUA 4BCAA 2KDOA 3Q8PB 2V0NA 4PCQA 3KMSA 3KK2B 4CNZA 1DQAA 1HBUA 4BC9A 3VZIA 2OTJS 4DWIA 4JI3F 2QEXS 5L38A 1JLEB 4RNMA 4Y6IA 4WZMA 3MEGB 4J9OA 3WDOA 4DFMA 2F9JA 5HLFB 2CRLA 3I4HX 4LT6A 1RTIB 3I87A 4Y34A 5CH7B 4ZVHA 4X66F 1HWIA 1HI0P 1EETB 4I6WA 2DNHA 2HHTA 2XWYA 2HWTA 4O44B 2C2RA 1ZAWA 1LWEB 1FD8A 1RKIA 3HHLB 1NNDA 2RQMA 4B02A 4N5SA 3GIMA 2MB0B 1CQMA 3QIPA 1TV6A 2DVIA 2QA2A 2MGZA 2JX2A 3CD6S 4C8NA 2X1GA 4EYHB 2BZ2A 2A2DA 1WHXA 1XNRF 3O8WA 1PC5A 4N41A 1N54B 1KONA 2RQKA 1TL4A 2PIIA 3NS5A 2QZ8A 3SFGA 2MSTA 1U8SA 1N0UA 5LSRA 2DR8A 2ASJA 4C8ZA 1S1VB 1RYRA 3HHKA 1QVFR 2YKNB 2ROPA 2DNGA 4Y2AA 5M2PA 2EG2A 5F0WA 1HWLA 2W9CA 4U67Q 5C5JA 3JAMY 3BN7A 1JLAB 3M9NB 1Q82T 1VQKS 3D1OA 1R27B 2JEFA 4P6QA 3U7JA 3PY8A 3JSYA 3R1LA 4IOCQ 2XEXA 2QA1A 2L08A 5EHHA 4PKDB 1YJNS 2K3IA 2XSJA 1UFWA 1S9EA 5T7LB 4QBUA 4DV2F 1SJ1A 2OIHA 5A8RA 4CQ1A 3M6VA 3DCAA 4C0HA 4O3QA 7FDRA 4QWAA 3FGVA 1IBKF 1ZYQA 4LJMA 3G6XA 5L9NA 4RW9A 3P96A 1U6ZA 2DCUB 5E5NA 5GAHI 3OXLA 4IH7A 1KVJA 4I6YA 1VQ5S 1M90T 2OMOA 3K2YA 3KG4A 1HQEA 3JB9k 2YNHB 4ZPCA 4BWJA 3QIPB 4PXDA 1JLGB 4YB6A 4UQTA 3UCGA 1OO0B 4P2SA 4N47A 3PFEA 3QMQA 4RLEA 2IA6A 4CO5A 2HHVA 5K5MA 3LGMA 2MKIA 1V3ZA 2E29A 4ED5A 3CE8A 3GWCA 1HNXF 2ILZA 1X5SA 2KO1A 2VFVA 4JI1F 2OPQB 3T5KA 3ITHA 3KHGA 4OFZA 1NO8A 3SMZA 5DDRC 3T19A 1RYSA 2GO8A 4WE1A 1HBNB 2CQ0A 1TKXA 4MAKA 5IXUA 1MROB 3TAQA