2OQ7A

The crystal structure of jmjd2a complexed with ni and n-oxalylglycine
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
346
structure length
346
Chain Sequence
b'NPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing histone demethylation protein 3A
publication title Crystal structures of histone demethylase JMJD2A reveal basis for substrate specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 108
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2oq7A01
3N9LA 5FZBA 3ZPOA 5FY9A 4D6RA 5F2SA 5FYMA 5FP7A 5IVBA 3OPTA 4GD4A 2GP3A 5A3NA 5FXZA 2OQ6A 2XDVA 4EYUA 2WWJA 5ANQA 5FZFA 5FZ7A 5FZKA 5A7NA 5FXWA 3OPWA 5FY0A 2OS2A 2YU1A 4CCKA 4V2WA 4Y4RA 5F3EA 2YPDA 4GJYA 5FV3A 5FZOA 5FY7A 4QXHA 5FYTA 4DO0A 3U4SA 5IVJA 5LW9A 3K3NA 4NUBA 4ASKA 4GJZA 4IGQA 5FYCA 5FZ8A 4BISA 4TN7A 3LD8A 5F3GA 4QX7A 5FPLA 5A7WB 5IVCA 2XXZA 5FZ9A 5FYZA 2Q8CA 5F3IA 5FP4A 5A7PA 5FZCA 5F5AA 5FJKA 5FY8A 5CEHA 5IW0A 5FZ3A 5FPAA 5LY2A 5IVYA 3PU3A 5A7SA 4E4HA 3KVBA 5FUNA 5FPUA 4XDPA 3N9MA 2YBSA 3PUSA 2Q8DA 5F32A 3KV4A 5FZAA 5FJHA 5FZ6A 3AVRA 2GP5A 4QXBA 4QU1A 5E6HA 4LITA 2W2IA 2XUEA 2VD7A 5F3CA 5FZHA 5IWFA 5A7WA 4CCLA 4CCJA 4CCOA 3U78A 5FYUA 3K2OA 5LWBA 4QXCA 5LY1A 4QWNA 3N9OA 5FZLA 4AAPA 4HONA 4URAA 5FXVA 2YBKA 5FZ1A 2WWUA 5FYSA 5A80A 5FP3A 2Q8EA 4CSWA 5FPVA 5FYIA 3ZLIA 3DXTA 3KV6A 4HOOA 4GAZA 4LXLA 4AI9A 5F5IA 5K4LA 4CCNA 4EZ4A 3KV5A 4D6QA 4BU2A 4IGOA 3KVAA 5FZMA 5FWJA 5A3WA 3AL5A 5FZGA 2YU2A 5FZIA 5IVVA 4EZHA 5FZDA 5FZ4A 4QX8A 5FP9A 3PUQA 5A7OA 1VRBA 3N9PA 5FYBA 5FY1A 4DIQA 5IVEA 5F5CA 2OT7A 2YBPA 4C8DA 4LIVA 5A7QA 5FY5A 3PTRB 5FZ0A 3K3OA 5KR7A 4UF0B 5FPBA 3PUAA 3PDQA 5F2WA 2P5BA 3KV9A 3AVSA 5FP8A 3N9NA 5IVFA 3DXUA 3RVHA 5FXXA 4D6SA 5FWEA 5FY4A 5A1LA 2OX0A 5A1FA 5FYYA 5F37A 4LIUA 3NJYA 3LDBA 3PURA 4V2VA 5ISLA 4BXFA 4Y3OA 5F39A 2PXJA 3PU8A 4IGPA 5FZEA 4XDOA 4CUGA 4Y33A 2XMLA 5FZOB 2OQ7A 5FUPA 5FYVA 3N9QA 4CCMA 3UYJA 5A3TA 5FYHA 3AL6A 5FBJA 4UF0A 5A3PA
chains in the Genus database with same CATH superfamily
2FHRA 2ZMNA 4GB31 2GMMA 2OZ6A 1YQCA 4A45A 1G8WA 4ZS2A 2ET7A 3W20A 1ZBE3 3E1F1 1W8OA 4Y22A 5A3NA 4OLLA 2XPJA 4K21A 2VZPA 1WLCA 1L7QA 5DAXA 2FCVA 1W6NB 2LROA 2WS92 3T3YA 4CCKA 3H1YA 4XF1A 4Z2WA 1RVF2 2ZGMA 4YNIA 2FDIA 2DVGA 5FZOA 4GA9A 3CZJA 1OUXA 1H9PA 4CCEA 4E4SA 4HVOA 1JYIA 2V5DA 1GQGA 1KD7A 1XNTA 3HPNA 3I59B 5FZ8A 1TNRA 2HWB3 1CONA 3HBKA 4XBLA 4COUA 1C1LA 1OKOA 5J48A 4BQXA 3I2JA 1RUJ3 3LIGA 5F5AA 3UGGA 2PMWB 3I2OA 3LA3A 3WP5A 1OVPA 5A32A 3TEZA 2ATFA 1SLLA 5IVYA 5JI7A 2R063 2KA3A 1HIXA 3WXPA 1AX2A 2J1UA 4WVZA 4DPNA 2Y6HA 1LECA 3OF1A 1VLNA 5SV8A 3JBG3 4CTEA 1VIWB 3NAPA 4BQ4A 4YZ1A 5A6YA 1W28A 5CFCC 2WFF3 1VMFA 2ZX3A 2CHHA 3V56A 4QX2A 4CDQB 4CCDA 1YQ5A 2YC4A 1W8UA 1VBD3 3M3CA 3SLIA 3THCA 3CL1A 4AK3A 1TME2 2WZPP 5FZHA 4BLIA 2VQTA 2AACA 3NO8A 2R042 3H8UA 3OYWA 2CWSA 5IK8A 4O61A 3GBGA 3MO4A 1HXS2 2EXKA 4SBVA 4XEZA 1UMIA 5IATA 1W9TA 1DZTA 1JYTA 3D3AA 4UFIA 5FZLA 3ZN6A 4P5YA 4WVWA 2Q1MA 2IXCA 1BKZA 2CV6A 2ZHKA 3KGLA 1R091 2XB6C 1OQ1A 1LR5A 2BFUL 4PF1A 2PHTA 2Y6FA 2ID4A 4YGEA 3IAPA 2RG4A 1ZRIA 2LS6A 4LUMA 5ACA2 5JWPA 4MADA 4CXXA 4EN7B 4IGOA 2BJSA 4JGZB 4DUWA 1N1VA 1RUD1 2ZGTA 1UZYA 3ZVXA 1H8TA 1VRBA 3M1HA 5EWSA 4MXVA 5K7PA 5EYXA 2XJPA 3OEAA 3BU0A 1QXPA 5LBCA 1EV13 1GWLA 1STMA 5DAQA 1NX9A 4UF0B 1IS3A 4Z1VA 4CDWB 4TLGA 1VBC1 4QPIB 2XHNA 2R071 2J7MA 3PDQA 3RJ2X 2GMEA 3UK9A 2VGDA 3O1MA 1VRH1 1AUYA 3HR9A 4JV4A 4NHKA 4WM8B 3HBZA 3O12A 3PJYA 4JQTA 2NP0A 2QQWA 1UYXA 1Z78A 4YZ4A 5JIAA 3VBOA 3RZKA 1Y7BA 3PIGA 2OKXA 3DYMA 4BZ4A 1V6KA 3VHRA 2JB4A 1QXRA 4JZRA 4S2HA 1Z7S1 1F5FA 3H1MA 5BNPA 1OQDA 4CVUA 2B7YA 3OBAA 3D82A 3FUOA 3WV6A 2ORXA 2ZAHA 4AZZA 3E6DA 3I2DA 3PVBB 3NJVA 3MHZA 5T54A 3ZSJA 1BK0A 2R7EB 2Y26A 3AK0A 3M8LA 2WKKA 3U14A 4AQ6A 3RZGA 1OF4A 2IXHA 2XQRA 3K48A 5FLHA 3DN7A 1HB1A 1AR61 1X9TA 4EYUA 4XUPA 1WCSA 2WWJA 3NV3A 3VKLA 2QZ2A 3KQ4B 4I30A 4N53B 4E2GA 1PVC2 2ZS6B 4CP2A 1K45A 3IDEA 1US3A 3NKTA 5DAWA 1JU4A 3WP6A 3U4SA 2A71A 1GZ9A 4FPGA 1O7FA 4L11A 4CA9A 1HV1A 1R1A3 2QTWB 3ZFEB 1YFUA 2RM23 3D5OA 1YCIA 2VZRA 5F5QA 5AVPA 1AL21 4PBOA 5EZWA 1Y3TA 3B7MA 4A44A 4QHZA 4XIOA 4XIKA 5LRRA 4CEYB 1CN1A 1IPJA 4NHMA 4XJ9A 1IG0A 4DZGA 2CTVA 3ZXEA 1MS9A 4B7KA 1OFSA 1U5XA 4Q0UA 4AR2A 4A7KA 5DUVA 3ZSKA 3WG2A 1RJ8A 4IETA 2ZHNA 1MZEA 1ASJ2 2IXLA 4XW3A 4Y1UA 4IE4A 5FZ6A 2Z5WA 1UYPA 2G4IA 4Q4V3 3HN3A 4IEOA 1UY3A 1ODNA 2WZEA 4JCKA 1CJDA 4OQ9A 3GYDA 4CDXA 3JXSA 1CX4A 3MF9A 1LHWA 5L9VA 1A34A 1YQ2A 3HIFA 4KU7A 3U10A 3V0BA 2ZGKA 4R52A 1QKQA 4QWNA 1VBB3 2BERA 4PCRA 2B4KA 4LBQD 3T2PA 2YBKA 1RUF1 3DV8A 1UZWA 2Q1ZB 1YJKA 5FP3A 5HPOA 3P5BA 3RJRA 4ASMB 3TAYA 4LQRA 5DPNA 1OVSA 4N8MA 4Q0QA 2C1FA 3PLQA 4NHXA 1UY1A 1VMHA 3ZSLA 5J36A 1AR83 1JI6A 2XVKA 5HCBA 3WQBA 4OVEA 1E5HA 1W8TA 2B5HA 2JICA 1RMU1 2CYFA 2ZX2A 3ELNA 5C5TA 3RZMA 2RS12 2BPA2 5FP9A 1XSRA 1CIWA 2HWF1 3IB3A 3K4DA 5GZDA 1H4HA 4J1XA 4H3WA 1U5ZA 1BVVA 3LE0A 3KF5A 2AEZA 4LIVA 5AC91 1J59A 4I01A 4E4DX 4Q8LA 3RMYA 2EXJA 3WDTA 2WBKA 4OZXA 3MPBA 4NHYA 4BJ0A 1O8PA 2C5DA 3J7NA 4S2FA 3VBFA 1D2SA 4KNCA 2XVLA 4FTBA 5FMBA 1XNCA 4JX0A 1QF3A 5A1LA 1BXHA 4BK4A 3LEGA 1UYYA 4DY3A 2JB8A 2HKXA 3PURA 4MHUA 3NMBA 5ISLA 4FPJA 4E8DA 1O8SA 1E5RA 3NVCA 3SQOA 2W0XA 1JZ2A 1DGWA 2WNEA 4MVTA 1OC1A 1V6MA 2A7AA 2OUHA 2E31A 3NL1A 2IC1A 2UU8A 2Q1FA 1UQXA 5LEKA 1QJU2 1POV3 4K1YA 4M3CB 2N7GA 1RJ7A 1GU3A 3A22A 2VQ0A 4JKKA 1RUNA 1ZYBA 5JSOA 1HXS3 1RXFA 1ZZ7A 1FOD3 2X29A 3HT1A 3VHOA 5CISA 1ONAA 4XE9A 5A3LA 1KRIA 1OXCA 2HWB1 1REDA 4L99A 5JCTA 2PAKA 2XUMA 4I3GA 5GLUA 4H7LA 1U5IA 3DPRC 4KG0A 3Q9OA 2HWC1 4YWAA 5HCAA 5FZKA 3RSJA 2JG9C 4K8FA 4YW4A 2R061 1HRI2 5CZKA 4NIDA 2B8MA 1AF9A 2OYZA 5ACA3 3FZ3A 5FYTA 4DO0A 1JUIA 1QOOA 2TEPA 3SH3A 1H0BA 5I8YA 3B01A 2C4XA 3KZ4C 4OI2A 5FPLA 4LBLA 1QH7A 4AF9A 3KS7A 3QD6A 1A8MA 3KGZA 3ZYGA 5IK4A 3WX5A 4LA2A 1XU2A 2EXHA 1G9BA 1UPIA 5BNNB 1DQ0A 2W1SA 3LA2A 1WMXA 2BNMA 2FZ2A 1W6NA 4N43C 1RXGA 1YNAA 1WA4A 3B69A 4PI2A 5C3RA 1OBNA 4RN5A 4MGZE 5FZAA 1VBA1 4YM2A 1QDOA 4CP1A 3BIWE 3I59A 2CNAA 2WDBA 2XUEA 3DL3A 3ST7A 4AFCA 4LJHA 1R092 4C1WA 4CCLA 2ZTNA 1NA1C 3NSTA 4UFLA 3WF2A 2YUEA 2Z69A 5A3MA 1G9AA 3B00A 5GKAC 3ECQA 3O1UA 1H1MA 3ZXAC 1ZZ9A 2EXIA 4HKLA 3HNMA 2G9GA 2WT0A 1JU3A 4IEUA 2WSVA 2XQXA 1AJOA 2VZSA 1AYM3 1EV11 1WA6X 3CU7A 4HOOA 2ORZA 1QJX2 1ULOA 2HBTA 2XBO3 4QM9A 4MXWB 2B45X 2CL2A 3AYDA 1PM7A 4MGSA 5FO9B 3GJAA 4CDQA 4Q26A 2DVFA 3WW4A 5K0UB 1DFQA 3E5UA 3AYEA 1VBC2 4OHVA 4BQ2A 2R072 4F8AA 1CX1A 5A7OA 3SEEA 3UT0A 5F5CA 3EJKA 5DAVA 2QJVA 1LOFC 4XHBA 1UY0A 1XE7A 5FY5A 3JQWA 2G1MA 4IV1C 1X9PA 1HJGA 4OYUA 5JOYA 3H9AA 1NCQC 2GALA 5FPBA 4UW5A 4DS0A 3GBWA 1JH5A 5CG8A 3AMHA 1SLBA 4COYA 4QQOA 5JXHA 1I5PA 2X09A 3VUOA 1SDDB 5FFOC 4BYYA 3KB5A 5BV6A 1BBT3 1QJY3 2JDAA 3WR0A 2IXKA 5C3SA 3LOIA 4CZSA 3TN93 2ZOEB 3BTAA 4NIIA 4XUTA 3MGUA 5H9SA 2ILMA 2XHKA 4JDMA 3RQ0A 3WUDA 1B35B 3ZFFC 5HI0A 4JGZA 4E27A 5J1XA 1N1SA 4AEJA 3P3NA 2P4EA 2WL1A 1C28A 1LGBA 4OUEA 4XXAA 1YJLA 1SLIA 2TNFA 5FPZA 2V4VA 4JHTA 5E88A 1DYKA 1RUH3 3DCQA 5FYVA 4R9CA 3VGIA 3I3EA 3DYOA 1GMMA 3OBRA 4HKWA 4P9YA 4QQ2A 3RDIA 4UF0A 3WOGA 3OEBA 1GANA 3FFZA 3Q8BA 4QGMA 3AX4A 1Y9QA 2DCJA 4QPIA 5FY9A 5EYYA 2D3PA 1MEC2 5FYMA 1R1A1 2GN7A 4ARYA 4WM8A 2VOWA 2VL4A 2DFCA 3WDXA 5FXZA 1UPSA 2ZEYA 4OZOA 4A7YA 5ANQA 3GGLA 3WHUA 2D7FA 1NY71 2RDRA 4QMAA 1F8VA 2OS2A 1FATA 1MPXA 1AL22 2XLGA 4KGQA 5FV3A 4EE2A 2DCKA 4TLFA 2JIGA 2VBDA 3MV01 4LKFA 3WF0A 1W0OA 2DURA 3CO2A 1PGL2 4QX7A 2A6VA 3NNGA 3MPPG 4YVSC 3I49A 1ACCA 1DZRA 2XGXA 2W87A 4I09A 3VKMA 4QX1A 5FJKA 4E4ZA 4META 5EXOA 1I6XA 1WLWA 4PI0A 1O3QA 1W8FA 2W91A 2ZZJA 3JUUA 5FUNA 3B02A 1S0DA 4KWLA 4N53A 4AVAA 5A33B 4UWDA 1CVNA 1VBB1 4P14A 3NRUA 1ULGA 4AGVA 3DKQA 3WP4A 4NO4A 4XF4A 5FOJB 4XJ8A 2AREA 4B1MA 3IDCB 4A6OA 3POYA 1SPPA 1JHNA 2D5HA 4N9HA 2JDHA 5EQUA 1RUF2 3OGGA 2WNOA 5IWFA 5FQ0B 1AR81 4Q4X3 3ZFEA 3I2KA 1XOYA 2DWRA 3B9CA 4KU8A 4FO9A 4Q4Y2 5C9AC 5FREA 3BPSA 2BTVC 4Q27A 1QJU3 1RVF1 1UL9A 2WA4A 3ACHA 3FFQA 3N9OA 1KFUL 3U37A 2R30A 4L9BA 1RMU2 5H9PA 3AKRA 3LOBA 4QQLA 3ZXGA 2VULA 2W3JA 2Z42A 2VMEA 4S2DA 2XJUA 4CXYA 1KS5A 5CKMA 4EROA 2OZJA 3JZVA 5FZMA 5FWJA 4ZZ8A 3OCPA 5SV5A 5BNOC 1UWWA 2ETEA 2VCCA 3T0AA 1W8NA 4FAHA 2VAUA 1HRI3 2H6CA 3VV1A 5BPXA 2RJLA 2YBPA 1IG3A 4QKBA 5I8SA 4AVBA 1UX7A 2XVGA 5EJ3A 5FZ0A 4CPBD 2WLPA 4YW6A 4XOGA 1W05A 1ZBE2 2E7AA 1LB2A 3BGAA 1JZ3A 2ZGQA 2D6KA 1W3VA 2J1VA 1DHKB 1UOGA 4D7SA 4LEJA 4E2QA 4YRDA 2ZACA 1POV1 2WNVC 1TME1 3LF7A 3PL0A 3AP9A 4UFJA 5FXXA 3ZXDA 1ENSA 4QKNA 1HXS1 1FOD1 1NAEA 4BB3A 3DPRB 4M00A 3NNJA 1GBGA 2Y6LA 3OGSA 4YW2A 3AP7A 4FOVA 4FPYA 2Y33A 5DUXA 3WNKA 4C90A 3KWVA 5I91A 1Y4WA 2YROA 5FZEA 3IN9A 3USSA 3POGA 1L7LA 3K4AA 1BMV2 2RS53 2Q30A 2VMGA 1RUJ2 1Q5OA 2BBAA 3HT2A 4Q0VA 4BWOA 5CU1A 5GLVA 2LW8A 5ACA1 2B42B 2E51A 4IE0A 4UBGA 2W1QA 4AI0A 1ZREA 1DBNA 2R062 1T6BX 5F8PA 5FP7A 3W5MA 1QWRA 2HLEA 4HBNA 3OY8B 4UW3A 2DCTA 3FLRA 1F4HA 4AEDC 3JBG2 1OH4A 4XDQA 5FO8B 3AZZA 1X33A 2VVEA 2WFF2 2AENA 4N90A 5C8CC 1U5YA 3OGVA 1QNWA 4BQ5A 1M4WA 1UD1A 1FNYA 1VBD2 2ZGRA 1LKNA 1R1ZA 4W6WA 3LDRA 1OA3A 5J37A 2YFUA 3VBUC 3A0KA 4HL0A 5DDJ3 1W6PB 2VU9A 3WDVA 3K3NA 4LBQB 4M3CA 4RGKA 4YARA 3POJA 3H8RA 3RZLA 4OHYA 3I2IA 4LNVA 5F6LB 4RS5C 5FZCA 2WT2A 5CEHA 3K51A 1PMIA 2X5IB 1REEA 1VBE3 1CZVA 1Q8PA 1SBEA 3JB4C 5DMYA 4QGLA 2WSUA 1WCUA 1D4M2 4LE4A 1W6MB 3J8F3 5ERLA 4C1XA 1WBLA 4NWVA 1SLCA 4FI9A 1D7PM 3KV4A 3M3EA 4LKSA 4X6RB 4LT5A 1ENRA 1D0GA 1UU5A 1H4GA 1F31A 3CJIC 2UURA 4DXSA 3QLQA 4A42A 4D7YA 2XBO1 3C7FA 2PTMA 1W0PA 4Y5SA 1OA2A 1EV12 5LA9A 2JWPA 5FYUA 4CP9B 2LRPA 3CLPA 5D1IA 1W99A 2QFEA 2VZUA 3AJYA 3DF0A 3GCXA 3URFA 5C5UA 1OSGA 1UKRA 4HVRA 4YGBA 4IV1B 3WNNA 1WCKA 5EFUA 1NCQB 5BNNA 4PQ9A 5FYSA 3H7YA 3SMHA 1WBFA 5FKBA 1WMFA 1UCXA 3AMMA 1CZTA 4EN0A 2BWCA 4JGYB 4YW3A 3RZHA 3KVAA 5FMOL 3ZXLA 5FDBA 4HPKB 1ZM1A 4R4ZA 3TN91 2MNGA 1K3IA 1UU4A 4LHNA 4FPFA 3KM5A 3RI9A 4ATFA 4FPKA 4EJRA 1OF3A 1RUC3 2ARXA 2FZ1A 1LEDA 1W2AX 2H0BA 4BK5A 4QD2A 2Y0OA 3PJQA 1BQPA 2QQVA 3B94A 1RUH1 4MO3M 2VOKA 3BIEA 4AVSA 4DRRA 2BOJA 2BW8A 2XLFA 4ZU7A 4IDZA 4FAGA 3VKNA 3DXUA 2QQUA 2RDQA 3J26N 4MXWA 5FWEA 2HWE3 1F15A 5K0UA 2DVBA 5KHHA 3NV4A 4XFFA 2B9VA 2QQNA 5GJ6A 5GZFA 1JOBA 1VAKA 3JB8A 1BZWA 4Y1YA 5KBFA 1PK6B 5FUPA 2BGOA 2ENRA 2D6MA 2VH9A 2XJRA 3F2ZA 4P9WA 2RM22 4SLIA 2LALA 2PHXA 1MQTC 4LO5B 2IWGB 5A3PA 4LK7A 4R9DA 1LOBA 1GLHA 1WW5A 2W46A 1RC6A 1W39A 2RS33 4K20A 2GC3A 2JKBA 5LBBA 5IVBA 3OPTA 1DDLA 2O14A 2UYBA 3MIFA 3OBTA 4Q8KA 1NOVA 3O0WA 5FZFA 1B35A 3G6JB 5CBLA 4JRAA 4L92A 4XURA 4G4FA 4A3ZA 2W1WA 4HK8A 2UY9A 4LA3A 4KMQA 5A7NA 1HN1A 1OOPB 4Q4V2 3WINE 4CU7A 4IW3A 2P6CA 5FY7A 4C91A 1OI6A 2A70A 5FMOS 1DQ5A 5HCFA 1AX0A 1SQ4A 1IKPA 2OW4A 5LW9A 3EHKA 4GMP3 4XFCA 1DLLA 3V65A 2V5YA 4K6BA 1SBFA 3H3ZA 3Q8CA 4JTOA 4NROA 1HW5A 5T5OA 3I3BA 1VBB2 2VY0A 2LUWA 3VZMA 3PNAA 4ASLA 2CAUA 4I3PA 4P9LA 4ONUA 2FD8A 3FX3A 3T30A 2PYTA 3EO6A 1AR82 1AVBA 2EVXA 2XG3A 4XJUA 1QJU1 3U0ZA 3PUSA 3ME2A 3ZN5A 1J3QA 1AZDA 4COWA 4DUVA 5F32A 3ASIA 1GQHA 2F6BA 2WYSA 3AVRA 4MV2A 4UAPA 3WD5A 4AQSA 1G9CA 1F2NA 3UNPA 2AZ5A 2NLRA 1H6YA 5BNOB 3OUIA 4WZFA 5DQ0A 3BU7A 3R4SA 3H3UA 4ZXEA 2CU5A 1IKQA 3NV1A 4DY5A 1GKBA 1PGSA 3OTFA 2I74A 1HRI1 3WNLA 2VMFA 4V1PA 1EPWA 5FZ1A 5T50A 3WCSA 3O1RA 1NE6A 5A33A 2FBEA 2C24A 1MACA 2WNVB 1PM4A 4PBPA 5JMCA 4X6QB 3LEKA 2D6OX 2TBVA 4AI1A 1NXMA 4HANA 4RHV2 3E97A 2FDJA 4YGDA 1UXZA 2PFWA 1OURA 4YG6A 5FQ0A 2JE8A 3H0OA 4QDQA 4QX8A 5LBEA 3ZFGC 5FY1A 1MVQA 2BEOA 1J1TA 3C7GA 3KCXA 3WW1A 4CEYA 4BQWA 1HQWA 3VKFC 5A7QA 3RMXA 1FOD2 3SXWA 4BE3A 4NRMA 5JLVA 1X36A 2C6SA 2A1XA 2RS51 3L2YA 1HX6A 2UYAA 3HQRA 3VBRB 1PX3A 3PMSA 4AEDB 2NMOA 3HQUA 1IQDC 3NJYA 3RI8A 2KR2A 1D4M3 4AVTA 2QQOA 3AZYA 4XACA 2XR4A 1WW7A 2H6BA 2R0FA 4XILA 1GNYA 3KD4A 1QEXA 5JIUA 3PU8A 2VW0A 2FCTA 5J7MA 2WO3A 5L19A 3VBUB 2RMU3 2ZX0A 3UYJA 1QJX1 1E5SA 1OUSA 3INAA 2YC0A 2BNOA 4CU6A 2W95A 2VMCA 3QOPA 4FSJA 1O5LA 5T3NA 3A21A 5DXDA 4K7JA 5DDJ1 4ARXA 4W6YA 1HRV3 3O14A 2R0HA 2GC1A 1SFNA 2XDVA 1QOTA 3DPRA 4YZ3A 2GSYA 1VBE1 3PHMA 1BCXA 2X8KA 4PF5A 4KWKA 1KDKA 1NCRB 5F3EA 3ZYFA 2VUDA 4QXHA 3J8F1 1VB2A 3VZJA 4BMBA 1EP0A 3SH5A 3CJIB 4CRQA 4AFBA 4XF9A 3M7AA 3WDYA 1BEV3 4Y24A 5GM0A 1XYPA 3C8XA 1G7YA 3TNPB 1VMJA 2C9KA 2HH9A 3WF4A 4FFFA 1SG3A 4XYXA 3WW2A 5GZGA 5FY8A 4MGQA 2WFPA 4UOJA 5KHKA 1W9WA 5FKCA 3OY8A 4LOTA 1IOAA 1TNFA 1AYM2 2YPJA 2HEWF 5EJZB 1POQA 3PU3A 4FXKB 3VD7A 3AKSA 2XBO2 3ALQA 1YWKA 3LA7A 2VXRA 4YVWC 3QBQA 5JZGB 1GNHA 2DDUA 1HQNA 2UY8A 1WLDA 1E5IA 3GZTB 4JQRA 1W6QB 4MUVA 2BFUS 5FUIA 4DOUA 2Y60A 1OPOA 1QJEA 1YXWA 1J1LA 1LRHA 3D0JA 1MEC1 4RR3C 1BVP1 5APAA 1W6PA 2A75A 3CEWA 4AEKA 1K42A 2VD7A 1OH3A 3TB0A 5L9BA 4NIAA 1AXYA 1LOGA 1CAWB 1RHI3 1X8MA 4JKLA 4RGAA 4E8CA 1QJFA 3I7DA 4DUXA 2VM9A 4IEQA 4XPVA 2XL9A 1IQAA 2X5IA 4ORFA 3GBFA 3IM0A 2QDRA 2RDSA 4J6GA 2W08A 1BBT2 1QJY2 1XYOA 4LBJA 5L9RA 4YSFA 4Z92B 1RUC1 5A80A 5CB7A 3TN92 3MDPA 5FPVA 2PLV3 1DQ2A 1FAYA 1JUHA 4AI8A 1QDCA 4XUNA 1PGL1 4B4PA 2I2SA 4M3CE 1FXZA 5I0SA 5LEJA 4D6QA 5IK7A 3ZDVA 3WQ1A 1SLAA 5FZGA 1RUH2 5FZIA 1JOPA 3SKVA 4FVVA 3KCYA 4ZU4A 2HWE1 4MGIE 2E7TA 4CP9A 4QB2A 2PAEA 2D5FA 5HV0A 4LPLA 1OD3A 2D3SA 3ZPYA 3RZJA 3KLSA 3ETQA 1JYVA 3K3OA 4IV1A 2ZGUA 3TBDA 4AGRA 4KL1A 1BJQA 1NCQA 5AVAA 4LULA 2ZMKA 4RFT0 3WVJA 3HD8B 3RZZA 4UT5A 1GFF2 2F17A 2HJIA 2WO7A 3AVSA 5FP8A 4JVAA 2ARBA 1GP4A 2JJ6A 1VJ2A 4Q4Y1 2OX0A 2F4PA 4JGYA 2X05A 2D98A 2CGNA 3SCGA 1G9DA 1S0BA 5KXBA 1CR7A 1W03A 1I9RA 2OPKA 2RS31 2XONA 1KS4A 3ETPA 3MEPA 4HPKA 5FOBB 2PA7A 5CVRA 1JZ6A 2ZABA 2WABA 2YGMA 4QX5A 2PHWA 2QZ3A 4XQDA 5HBAA 4QHOA 3DYPA 3C7HA 1H1IA 4FFGA 3ZOIA 4BA6A 1H9WA 4XJAA 1KGYA 3VBSC 1YI9A 3ES4A 1EAH3 4O7XA 4AHXA 4Y20B 1C3HA 3GJBA 3IMMA 4GMP1 4ES9A 1S0IA 5L7OC 2VC9A 1GQPA 2VUCA 2XH6A 1F4AA 2IZWA 2JDYA 3AKQA 3E5QA 4UFKA 5FK7A 2XKOA 5A3UA 5DG1A 2VOVA 4KG8A 4C0HA 3J7MA 1ZRFA 1DF0A 4HFSA 3KT7A 3KT1A 4LHSA 1UOBA 1ZBE1 1JTZX 1UN1A 3IDBB 1PK6A 1ZBA2 2JXAA 1DQ4A 2JENA 4D69A 4Q4X2 3BPZA 1O59A 2YY1A 4RHV3 4AQTA 1VB4A 1DGWX 3WY6A 1IZ3A 2LTNA 5A7WB 1AR93 1CWPA 2VTXJ 4PHZA 5C4WC 1DCSA 2IFRA 5IVCA 3BUCA 4WM7C 5A7PA 4GWJA 4B8EA 3GHNA 3THPA 5FZ3A 4XQ4A 3VB9A 1NYWA 2GNMA 3O0VA 1HKDA 3MLJA 5EHDA 4NIGA 1GSLA 1BMV1 3ZXJA 5EIYB 3LFMA 1RUJ1 3S0MA 1DU3D 1O91A 3VD5A 1OOPA 5JMOA 2C9AA 3OJBA 2FDKA 4Q5OA 4HN1A 5EPAA 5CFDC 1CIYA 2JEMA 4QPYA 2PELA 4R9AA 4JDOA 5CFCB 1CGPA 1RYYA 4FFIA 1H8TC 2DVDA 2WNUA 2WIIB 3D8CA 3VZOA 3JBG1 2YGLA 4HSLA 1QU0A 1NZIA 4CCJA 3ZFGB 2EF6A 2WFF1 1PVXA 4RQPC 4ZPIA 5EP9A 1U12A 2ZEZA 4TTGA 5LA0A 1X7NA 1VBD1 3WEZA 1C4RA 1ZZCA 2YG0A 2GAUA 1XU1A 2SBAA 3HQXA 4LBKA 4LHLA 4XAAA 4BXSV 5C3QA 2BGPA 5LA2A 3WUCA 3GCWA 3H3LA 3OOXA 3UJQA 2QCSB 1OLMA 3VN4A 3AFGA 4LBOA 2BVVA 4LXLA 2VTFA 2WZR2 3KV5A 4L0PA 3FLPA 1JW6A 1MZ6A 4YFWA 1YFXA 5BNPC 1N1YA 2YU2A 5IVVA 2RS52 5FZDA 4KQ7A 5BNOA 5CAZA 1RITA 3BCWA 1D4M1 2ZPXA 5IVEA 1O4YA 1AR73 4RD7A 4K3UA 4W65A 3B3QE 1V00A 3IWZA 4XZUG 4IEYA 1W0NA 2ZHMA 2OXBA 3OD0A 4YFZA 3RRDA 2Y6KA 2FCUA 2GH2A 2NM1A 2RMU1 1OPMA 4P9GA 3CQOA 3WP3A 3EMRA 2P5BA 1H6XA 1SBDA 1W2OA 2ET1A 2WNVA 3VL8A 4ATEA 5IVFA 5KHJA 5D2AA 3ZYIB 3IMNA 3NJXA 2GNBA 4FP2A 4NPLA 5FYYA 5I0UA 4EWAA 1HRV1 4GIQA 3LZZA 1WD3A 1CZSA 4N7IA 5DDJ2 3T2OA 4M4RA 1QNYA 3LPGA 1IPSA 5HXMA 2W94A 3B5LB 4FQ4A 3AKTA 3ENRA 5A3TA 1S0FA 2R16A 4RSUA 4OULA 3J4UH 2O8QA 3EBRA 3N9LA 4AW7A 1VBE2 2OUJA 1SHWB 1C8M3 5I0DA 1W9FA 3ZPOA 2CGPA 1W90A 2Q5TA 4BMEA 3D4KA 2KXLA 1R64A 5FMCA 1XNBA 1RL3A 1VR3A 1ULDA 2AH2A 3J8F2 3VBRA 4B3NA 1RUE3 1W8ZA 4JHZA 2BWAA 3POIA 4AEDA 4W50A 1C5IA 4NJ4A 2I45A 3WG1A 2J1SA 2YZ4A 1WW6A 1XXNA 4UW6A 5T5LA 1DQ6A 1UOFA 2XLAA 5G04L 1XNAA 1F35A 4BCUA 4P00B 3IIIA 5F6KA 3RS6A 2D43A 4JKMA 4PLOA 4IGQA 3C7EA 5F3GA 3T1MA 4FP3A 4X8NA 4CCCA 2DTWA 5C3PA 4CDWA 4NMIA 3OPZA 4HLTA 3GALA 4TYSA 5ABJC 2VZQA 1RHI1 3MUZ1 1PNFA 1QIQA 2WT1A 3AXDA 4K9SA 3WQ0A 4E2SA 2RM21 2ZGSA 1XNDA 5DZFA 2MPFA 1VPHA 3QACA 3KHCA 3IDAA 1NCRA 3T0BA 3HMYA 2HWD3 1JYNA 2DV9A 1UX6A 2D97A 3CJIA 4G3YC 4QU1A 5BUVA 3POWA 2XL7A 3GDBA 1RUG3 1RUC2 3WQ7A 3BI3A 2JDZA 1PO22 3MIBA 3T1LA 1N1TA 5D8AC 4I2OA 1COV3 4NWWA 2PQSA 4Q4V1 1Q56A 4S2GA 3FBYA 3CHXA 2E6VA 3T2TA 4WVMB 2HYXA 3VBFC 3MIDA 5JZGA 1ZX5A 2VOTA 4CSWA 1UIKA 4LTAA 2B46X 2HWE2 2XJTA 5E89A 3N3HA 1W6QA 1YQ8A 4QB6A 2BRTA 2ZKNA 3NV2A 2DCYA 4XUQA 5D21A 5F5IA 5K4LA 3MFCA 3N35A 1RUI3 1BYHA 1GYKA 2IFWA 3GHMA 3ES1A 3OUHA 2ADEA 2X10A 4Q1RA 3WG4A 1EUUA 1W8HA 4IUGA 1EUTA 1MS8A 1UO9A 3E6BA 5IJRA 3AMQA 1O6UA 2VBBA 4HKOA 1PNGA 1CAWA 2VMIA 1X50A 2R1BA 4RGGA 1AYN3 1ZBA3 3DGTA 1RIRA 4QHBA 4ZKTB 2DTYA 1WCDJ 4OUSA 5C8WA 4FPHA 5JSPA 2RS32 4DB5A 2ZGOA 3VBSB 3RGBA 4MG2A 5JUVA 3PUAA 3UGFA 1MVEA 2IXJA 1ENQA 1GOFA 4IEZA 3N9NA 5L7OB 1AX1A 3DUIA 5CKQA 3RWKX 3VZKA 4DINB 3FHAA 1PIV3 4XTPA 1EAH1 3O1PA 5FMDA 4N7UA 4XFGA 1AHSA 2GU9A 3LDBA 4Y1ZA 2D6PA 4V2VA 4YYOA 2AUYA 1DQ1A 1FPN2 2ZXQA 5F39A 4Z07A 1UMZA 1RINA 2RJ2A 3ACFA 2VUAA 4IGPA 4P5HA 3T0DA 4IEPA 2UWAA 1GOHA 5F1RA 4FCAA 3UETA 3UGHA 3H7JA 2VECA 5KC5A 3P3PA 3WW3A 4AI3A 2GH8A 3R05A 5T5PA 4XF3A 5C4WB 4XXPA 2E53A 1GR3A 2YXSA 4RHV1 4WM7B 5T52A 5JPMB 1YEWA 1S0GA 1AR91 1UY4A 2GP3A 2JDNA 3A7QA 4AFDA 1YI7A 4HK9A 1TQ5A 5FZ7A 4HVQA 1OA4A 5H9RA 4CYDA 4G9SB 1K12A 1TMF3 3NNLA 5FXWA 4ZXKA 1ULPA 4K40A 4Y4RA 4OHXA 1KJRA 1GUIA 3VDDC 2HEYF 2WZR3 5LB6A 1REFA 2JECA 1QY4A 1LOCA 2JG9B 5CFDB 1JYXA 2DVAA 1DP0A 2JE7A 1R082 5KXDA 1H8TB 2VNGA 3AP4A 3LD8A 4CUAA 4J25A 4XCAA 1HDKA 1VAVA 1VALA 4YPJA 3WG3A 3GZEA 2UWBA 5FYZA 1IS6A 4Y20A 1JZ7A 1WGPA 4RQPB 4KBBA 4HXCA 1GZCA 1IGOA 1LU1A 1J83A 4Y1XA 4XFIA 4Q1PA 3W9AA 4YM3A 4Y5Z0 1V6OA 1CJPA 3KVBA 1KXGA 4YW5A 4Z2AA 2CDOA 3IZOA 1JN2P 4UFHA 4CDQC 3FE5A 4CDUC 5B4XA 1RTVA 2PHLA 3FUQA 2KD7A 4QDSA 4N43B 1PMJX 1APNA 3DKWA 3OUJA 5FJHA 1JMUB 3LPFA 1YLLA 3SHRA 4OUMA 4P9IA 3E6CC 3FWEA 4NAMA 2RV9A 5A7WA 1T6GC 4TZDA 1H2MA 2E33A 3HJRA 3THTA 1DLCA 1Y9GA 2FMDA 2QQMA 4NHLA 4ZU5A 1YO8A 3VZLA 5JOZA 4W6XA 1IS4A 3CDZB 1NKGA 1ND3C 4QXKA 4N9IA 1NA1B 5LWBA 3W21A 1XPWA 3U1XA 1XRUA 1YUDA 2WQZC 4Y26A 1G86A 2XWBB 1RUD3 1PMHX 4DXRA 2Q8EA 5A1AA 4GXLA 3UKNA 5FLJA 3MBWA 4JGZC 3ZMNA 3HWJA 4LO6B 2JG8C 1XQNA 5CFCA 2IXIA 4ET7A 5FCCA 2RMU2 3M3OA 2WQ4A 1AYM1 3QH6A 3SCFA 2V72A 4OHZA 4FBFA 3ZFGA 5A6QA 3UKTA 3ZYBA 1VRH3 4I0WB 2EAKA 3SKJE 3UL2A 1NG0A 3AMNA 1UKGA 3M70A 3OB8A 4XBQA 3WF3A 5FR3A 1HRV2 1JYWA 4PQQA 4XJZA 3B93A 3IAQA 5J3UA 2DBNA 4MGKE 1N47A 1D2QA 4ZONA 5F2WA 3H42B 2VNVA 1JXNA 3KV9A 1SZBA 3Q8EA 1MS5A 3C2UA 4MOAA 4P9JA 3MIEA 4MGYE 3IBMA 2NPIA 4HSJA 1UZZA 2ADDA 4LLFA 4GWNA 3ZN4A 3ZYHA 1OLQA 3PIJA 3ZFFB 1FMD3 1MS4A 1BBT1 1QJY1 4XDOA 3WZ1A 2BOIA 4KGGA 1BEV2 5E1RA 3T4VA 2J22A 4B7EA 1OLME 2L9LA 3O5SA 5IFPA 1LAJA 1U0AA 3UV9A 1PO23 2Z2SB 2V73A 3AYCA 2QUOA 4OI1A 1S0EA 5F2SA 4D6RA 3J9SA 1YRZA 4GALA 4IEXA 1ULFA 3MIHA 1H2LA 5AFBA 5ABJB 4NIHA 2J1EA 4PDWC 2A6YA 2BVBA 3SCHA 3BKZA 2CGOA 2W39A 2YC2A 3MW4A 3CF6E 2G9ZA 3UESA 4V2WA 1G6NA 1KEXA 4AVCA 1ZRRA 3B9IA 5FRAA 1RHI2 3FL7A 1H1AA 1LEMA 3VD9A 5FYCA 3D6EA 4TN7A 4IV3C 1X82A 2HWD1 3ITQA 2CDPA 1OQEA 2A3XA 5FZ9A 1QGLA 4CEYC 3S30A 1Y9MA 3KCCA 4XMIA 4BDVB 1N3QA 2QKDA 3LDKA 5D8AB 3W58A 4YVSB 1ND2C 1RUG1 3AMPA 1S4CA 2PLV2 3O0XA 5JI9A 2J1AA 4COVA 3RWNA 1W9SA 3WHTA 3HNBM 5JVVA 3I2FA 4BQYA 5FO7B 1NLQA 3VDBA 2VZ1A 1OFNA 1ZA4A 2JE9A 3NJZA 3A0NA 2RR13 2YMZA 1DIWA 3J7HA 4EWDA 1AJKA 3HOBA 1UIJA 5DN2A 5CADA 3I54A 3K77A 5E6HA 5IYYA 1FPN3 2EIDA 4XHXA 2MEV3 2DCZA 4YM0A 3GF6A 3G7DA 4AEMA 1RUI1 2Z4FA 4M3CF 4QDRA 3AP6A 1ZZBA 2QQPA 4GWIA 2VQAA 3PTYA 4XF0A 1UW8A 4AI2A 3JU9A 5C9AB 1W9YA 2O1QA 2VQUA 1ZBA1 2K46A 2YDEA 3LSDA 4H2AA 4Q4X1 3ACGA 2QQIA 2K0GA 1TG7A 3VBHC 1PZ9A 2HWF3 2VXJA 3MW2A 5C3OA 3PVOA 2JDUA 1QHDA 3AZWA 4Q0PA 4QPGC 3ACIA 2UWCA 1SDWA 5A3WA 4WVVA 3LIHA 4GZ9A 2JDPA 4DXZA 1PIV1 1UYZA 2GDFA 5KHIA 4H55A 2AEYA 3N9PA 5E8AA 4CXWA 1QQP3 4XETA 3PUHA 1SACA 4QXCA 1EAH2 5GZEA 4C8DA 2IVJA 1R083 1OD5A 1SCRA 1J3PA 4WVMA 2HEVF 5CIRA 2E63A 2BDRA 4AL9A 1SEFA 4D6SA 2A6WA 4YG0A 3MICA 3I3QA 5K8SA 4LMFA 2W9XA 4FTSA 4BQ3A 2BV4A 2P3YA 5FTTC 5GLTA 3R0RA 4FPOB 3U75A 4BOWA 4IE7A 1LODA 3SISA 3BOPA 3AM2A 4U2AA 3FHIB 4FOWA 4CUGA 3O1SA 1H2NA 4WV8A 3VDDB 3FLTA 4AAXA 1AR92 1ZNPA 2E9QA 2WZ8A 2Y34A 3MFAA 1TMF1 5HCHA 2P34A 2EIGA 3ATGA 4GH4C 1PX4A 1YIPA 4FFHA 4BM8A 4NR1A 2WZR1 4Y1VA 3VBSA 2P37A 2VZVA 2HWC3 1NZCA 2YB7A 3FHQA 3ZKYA 1AXZA 1W06A 2VBPA 1MR5A 2ZEWA 3R6SA 3I2HA 5L7OA 4GD4A 2A73B 2VOXA 5I0RA 4QT6A 2OVUA 2O8OA 2KM2A 1CAXB 2OQ6A 1UAIA 2BGCA 4IQPA 3T08A 4C0BA 4HN0A 5C70A 3PVEA 1Q3EA 3NNMA 2ZX4A 4YGCA 2D93A 2JD4A 2R1DA 4IEWA 5IAVA 1PGW2 2GMPA 2R32A 2YYOA 4CDUB 5C8CB 2YPDA 4QPWA 1Q43A 3Q8FA 4LO8A 1YFWA 5C71A 4I02A 3BTZA 4KWUA 2RVAA 3RFRA 5BXXA 2NYYA 4JAAA 4NUBA 4GJZA 2WQ8A 3HN1A 1Q8OA 4FT8A 2VPVA 3S57A 3K75B 5C4WA 5JOXA 2W47A 4AHYA 1LHVA 2J1RA 2Q8CA 4WM7A 5KXCA 5T55A 1MS1A 3LCPA 5J98B 3ZYRA 5BNNC 1J58A 5JR7B 1ND3B 5FPAA 1VBA3 4RS5B 2VVDA 4QU2A 1HQLA 1FYUA 3QH7A 1J84A 3LFIA 4LUKA 5LCWL 1HV0A 3GNEA 1LOAA 2WAOA 4PIYA 3AP5A 1V9U2 3USUB 4PLNA 2JG9A 5CFDA 2JG8B 3WF1A 3BB6A 5EV7A 2GP5A 4QXBA 3BODA 4UW4A 2NN8A 4LKEA 4DEVA 1GICA 1AR72 3IIAA 4EN6B 3TEYA 3K46A 2ZKLA 4RQPA 4CUCA 5FLIA 4NRPA 3K2OA 2A3YA 4ZS3A 3GZUC 4XFBA 3UJOA 5LY1A 5GLZA 4Y5TA 5FXVA 3AC0A 4AFMA 1DYOA 3FBMA 2E7QA 1N3OA 4QX0A 2ZZQA 3SITA 4LLOA 4X8PA 4AE2A 4DNYA 5BYNA 5K0UC 4P02B 4NOTA 1GOGA 4HETA 3H8XA 4N43A 3W59A 1CAUB 2VNRA 5B2GB 3ZIXA 3ILRA 4CU8A 1C8NA 4EZHA 2PHRA 1GP6A 1XE0A 4D3WA 1JBCA 2Z79A 4LBQA 1K5MC 5FYBA 1WMDA 1PO13 4JRLA 1C8M2 1FMD1 1NA1A 2WO2A 1LULA 4O9GA 2DYCA 3ZM8A 1IS5A 2FDGA 4XVHA 3I3DA 1H30A 4B29A 2QE3A 1LGCA 1EPZA 1RUE2 2LM3A 2ZJCA 4CEWC 3MZHA 2GC0A 4XUOA 1B35C 3FJSA 1IPKA 2WR9A 1W6MA 2AYHA 4Q29A 5FY4A 4DFSA 1LCLA 1PO21 5A1FA 1W2TA 5F37A 5IT6A 3VDAA 4PDWB 4KI5M 5LK5A 3SC7X 1VAMA 4EWEA 5A6XA 1UOJA 3MI8A 3N7JA 3ON7A 3U07A 3S5AA 4M0NA 1CPNA 3JD73 4YLZA 2ARAA 1SPPB 5DZEA 3ZO0B 3O1TA 4KBZA 1IHMA 5DG2A 2Y6JA 2VVFA 4HG6B 4DEQA 5FBJA 4IL7A 3GM8A 3AXEA 1LOFA 2IUWA 3EB7A 4JC1A 4IV3B 1GNZA 2BNNA 2D6LX 1MQTB 1ULEA 3KHBA 2NZ9A 4IESA 1Q8SA 3VL9A 3DECA 3NQHA 3POSA 4KWJA 1FI2A 1ND2B 2DUOA 2VE1A 4NE9A 1W6OB 5IUQA 4EV0A 2CWMA 4A4AA 3ZSMA 3ZYPA 2HWD2 2J1TA 1GZWB 3ZFFA 3N7MA 4YM1A 5C7GA 4IERA 4OI4A 3EQEA 1RUG2 2QVSB 3ZSEA 1TE1B 4AFAA 1WUVA 3THDA 4HT1T 2WJSA 3MYXA 2RR11 4MZUA 3U4XA 1COV2 1UMHA 2J42A 4U36A 4D8MA 1XBFA 2RHPA 1SFYA 2DBIA 1CPMA 4BH9A 4PLMA 4AXOA 4JDNA 4Z82A 1FPN1 4ITCA 4YG3A 4HMZA 2P1BA 3OD4A 2MEV1 5H9QA 3WNOA 4FPEA 4Q4W2 1C57A 2C26A 5ABJA 5JAXA 5A7SA 4E4HA 3KSCA 2P3JA 1QH6A 3MUY1 5FPUA 3TEWA 2O0OA 3PVNA 1AL0G 5LA1A 1RUI2 1UY2A 1L7RA 3NAPC 2A6XA 2JDKA 3VBHB 5C6CA 1JZ8A 2PAMA 3NNFA 2Q8DA 4DMIA 4A2UA 1K5JA 2RJKA 4QPGB 2WS93 4QAWA 1YIFA 1LHOA 1AYN2 1MS3A 1RVF3 2XOMA 5F7UA 4GKYA 4L97A 3RYPA 4CCOA 3ACLA 4A7ZA 3LQCA 1CESA 3U78A 1LOEA 5KHGA 5D8AA 4YVSA 4IXLA 3ZMOA 4LBNA 1CAVB 1NXD1 1CQ9A 2DUQA 2QQKA 3CZUA 4OFGA 3UKVA 1QQP1 1PIV2 3BTYA 4DQAA 1R081 4WZCA 3KV6A 4XJWA 2VG9A 4BIOA 4OQ8A 3ROUA 3WLUA 2Q0AA 4GB32 4LKDA 4BIFA 1O4ZA 4BU2A 1D0HA 1TVGA 1UNBA 1WWYA 4XTMA 3FN9A 4EN8B 2GZWA 2VNOA 4KH9A 4D94A 1PZ7A 5FZ4A 3WSOA 4F3JA 3E5XA 2B9UA 5BY5A 1E57A 1XNKA 3KQRA 1I3HA 1TME3 5JPNB 3CJXA 2VZOA 2R043 4GH4B 5C9AA 1BK1A 3S5QA 3N7KA 5FPXA 3WT3A 1I5ZA 3WDWA 3OGJA 2ES3A 4R8HA 4BLJA 4COZA 5JXJA 4GMP0 4GWMA 3BTXA 1WD4A 3N4MA 1YHFA 2VW2A 1TMF2 1T2XA 4RYDA 3VBOC 4F83A 4LIUA 4FOYA 2QDNA 2VZ3A 3HAGA 3LB9A 5KC6A 3WDUA 1SFPA 2HBUA 4QB1A 1PZ8A 3ZR6A 1EY2A 5LBFA 2D6NA 1W3XA 2P2KA 3BN6A 3A4UA 4Y33A 2GN3A 1V9U3 1HN0A 2XMLA 4AGGA 4QX3A 3C7OA 4FPCA 4AYUA 2VUJA 3OBZA 1LESA 2WN3A 4LHKA 4LO7A 3M2MA 4F7ZA 1JODA 2OPWA 3MW3A 3OGRA 5FZBA 2BYVE 3W5NA 3MLKA 2GNDA 2R49A 2I07B 1Q8VA 1YYNA 2ZHLA 1XJAA 2A3WA 1UZ0A 2OIIA 1W2UA 1ZRCA 2VJXA 1ZZ8A 4NPMA 5DAPA 1S1AA 4LE3A 1CD3G 1Y43B 4QKFA 4MYEA 2WAAA 2PHUA 4LOSA 5K9YA 4XC9A 3J7LA 3POEA 3WNPA 5AFEA 3I8TA 1US2A 2EIBA 3VDDA 5IFTA 5JOWA 3IPVB 2BUKA 2BQPA 2B39A 1M06G 3ZIWA 3VDCA 1LNSA 4BISA 1I1EA 2PN5A 2R6QA 3SEPA 4B1LA 4O9EA 2X5IC 2XXZA 2ZAAA 4MSVA 5FP4A 4R9BA 2V09A 4URTA 2ZGPA 2AGSA 2BU9A 4XABA 2H0VA 1LHUA 1V6LA 1RUD2 2PHDA 4I0BA 4L8QA 1S0CA 3ZX7A 1GV9A 1FV2A 2Y8KA 3M3QA 1ZVFA 1CAXA 1BEV1 3ORJA 5E16A 5ANNA 3N9MA 1RUOA 2YBSA 2WO1A 1OHFA 4YVWB 1DZQA 4CDUA 5A70A 5C8CA 5DUWA 5J09A 5L36A 4FOQA 3SH4A 2AR6A 1JS9A 4PIZA 2PHFA 2CY6A 1PVC3 5JXGA 1JHJA 3VBUA 1VRH2 3T2QA 1G9FA 1XC6A 3GZAA 4RR3B 4CDXC 2XKPA 4Q2FA 1ALYA 3ABZA 1K5MB 3ZYJB 1GP5A 1NT0A 1WW4A 2EALA 4GKXA 1ND3A 1A3KA 1DGRN 4RS5A 1Z7S2 1SLTA 1NLSA 1DYPA 1SCSA 4UI9L 4A41A 1PO11 5FK8A 4HZFA 3TOJA 3ZLIA 4CEWB 4JGYC 1XE8A 2V4AA 4GAZA 4AOCA 1URXA 2EIEA 3S7IA 4EZ4A 3USUA 1WCQA 1FMD2 2JKXA 2JG8A 4A3XA 3R4DB 1D4VB 1TZOA 3PMEA 1N3PA 1ASJ3 1BHGA 3LAGA 2PLV1 5CYYA 3TYJA 2YV8A 3CBNA 3O1VA 2FMYA 4ES8A 3PUQA 1AR62 2WRAA 3KT4A 1KITA 2OT7A 4LK6A 4NRQA 3V0AB 4EN9B 3JCIA 1O3RA 3JD71 2W5FA 5FBZA 4TWTA 1ODMA 3AZVA 3LGRA 2EICA 1ST8A 5LRSA 5CA6A 2K9ZA 5F9TA 4UYBA 4LBMA 1WLTA 4P08A 3EYPA 2W1UA 4GULA 1O4TA 4Y22B 4Z8BA 3RVHA 2DFBA 3LWCA 3PUIA 4Q4W3 4QGNA 1LENA 1CAUA 1ZRDA 4QQHA 1OMIA 1MZFA 4AVVA 1XSQA 4Y3OA 1KJLA 4PT6A 1PK6C 2G19A 1L3JA 1Z0HA 2Y38A 4CPBA 4WBBA 3LEIA 1NQJA 3H50A 5HXVA 5FZOB 5LATA 1A78A 4AHWA 2P3IA 1ENXA 4BPZA 2X53S 2RS13 3LSEA 2HYKA 5M0TA 3MIGA 3C3VA 5GZCA 2WLQA 4BHPA 1HLCA 1TEIA 4OCTA 1XB9A 3RG0A 2D40A 5A32B 2QQJA 5IAXA 4Q0SA 4FPLA 1OOPC 1DG6A 4PDWA 2RR12 2WC2A 1NE4A 4W8JA 3Q8AA 3K4ZA 3AKPA 2VMHA 3FMGA 3A23A 3NAPB 3MLLA 2YU1A 5FY0A 5B4NA 2DU0A 2MEV2 2XJVA 1JOJA 3CMGA 4GJYA 4GB33 2WNUC 4JTNA 5FIXA 1S2BA 2Y64A 1YC61 4XZPA 4ASKA 3L2HA 5C33A 1WMEA 4MLOA 2WN2A 2XJSA 4IV3A 3OYWB 2WS91 1MQTA 3APBA 5F3IA 1J3RA 2YFZA 4YW7A 1Q8QA 1FNZA 1VP6A 2DUPA 3NWKA 4NPRA 1ND2A 1MZ5A 5FAXA 4CU9A 2A5ZA 1W6OA 3ZN6B 2VCBA 4PIXA 4XBNA 2FQPA 1F9KA 1S0JA 1V0AA 2HWF2 5I8TA 4FTEA 3CNAA 2G9FA 4XDPA 3HNYM 1H8VA 2ZBJA 5BNQA 1GZWA 5AC92 3AYAA 5GLWA 1B09A 3VKOA 3P6BA 2GNTA 2VO5A 3RNSA 3FC0A 2E32A 2DU1A 2PQQA 2RE9A 5LASA 1HB2A 2W2IA 4LITA 5L73A 4OHWA 4YZ2A 1QQP2 1UXXX 5CKNA 1KFXL 1ULCA 1MS0A 5JDBA 2NMNA 1HJFA 2D44A 5GALA 4RA0A 2Q8OA 1UZVA 3LEMA 1PGW1 2EAAA 2VCAA 5I0TA 2ARCA 2WUHA 3O7OA 4HONA 5DZGA 3BVCA 4ISRA 2SLIA 1YFYA 1A6CA 5FYIA 2R041 4XQWA 2WA3A 5KXEA 3QCWA 3BYWA 3VBHA 3ZR5A 4UFMA 3ZXFA 4CCNA 3H8OA 2JD9A 2VMDA 3POFA 4QPGA 4XAEA 3VBOB 3S6PA 4AWDA 4M0HA 5EJ1B 1A8DA 4XFAA 4MH0E 2HWB2 3RYRA 3OSDA 1LTEA 4UXAA 4CE8A 5BNPB 2VR4A 4ZHNA 3TWIA 1AXKA 1O5UA 4P9XA 3RYKA 2HWC2 2IVIB 2VW1A 2XWJB 1R093 1C1FA 3IKWA 3L9JT 2YHJA 5IK5A 1CAVA 4LORA 5IHRA 5KR7A 3IT8A 3I3MA 1V9U1 3NKGA 5CNAA 4K1ZA 4INDA 2P17A 2JX9A 3OG2A 1NQDA 4O65A 3VBRC 4B4RA 5HV4A 2ERFA 4QKDA 2WINB 1AR71 1GZTA 2W68A 1ZA7A 3BOWA 4QM8A 2QBXA 4R4XA 1LJ7A 2CAVA 2BP6A 2ZA9A 1FX5A 1POV0 1QJX3 2D3RA 4H14A 4BXFA 4Y4YA 2C0ZA 2TUNA 2PXJA 3X29B 1FT9A 1V6JA 3NW4A 3I2GA 5DUUA 3WNMA 3ZXKA 4MGTA 2EA7A 3EXUA 4ISQA 1VBC3 1BLZA 4IEVA 3POBA 4M4PA 2R073 1QOSA 2VTXA 5FYHA 3AL6A 4GH4A 4NN0A 5CG9A 1X8EA 4CDWC 5F3CA 3HEIA 1O3TA 1SMVA 4GQ7A 3KF3A 1RB8G 1S55A 4QPIC 1VBA2 1LU2A 3U11A 1DGRA 3VD3A 3ZDSA 1OKQA 1OT5A 2MHFA 2VCMA 2Y6GA 1UU6A 3V64A 3BALA 1W2NA 4WM8C 4B4QA 4NVPA 2GC2A 1Z7S3 2JIJA 2K2SA 1PHMA 4RFRB 4YZ5A 1C8M1 1LGNA 1NCRC 3CIHA 1HB3A 1YQ6A 3OPWA 1DGLA 2A6ZA 4CP0A 5DABA 2P3KA 3M3IA 1H2KA 4OI0A 4NAOA 4IE6A 1RUE1 3MV11 4TXWA 1GWMA 3VLBB 3VHNA 4MX3A 5IVJA 3JQXA 3T4HB 2QQLA 3ILFA 2OA2A 1FV3A 2RDNA 4CDXB 3VZNA 3R4UA 4AHZA 1AR63 4M01A 4DRVA 1JZ5A 2WYFA 2BBVA 1PVC1 3MF6A 1S2KA 1EYBA 3V0BB 1S2EA 3T09A 1QXJA 5IW0A 4XFHA 3HVDA 5JZGC 3N36A 4W4ZA 5LY2A 1MEC3 2BZDA 3RPQA 1WZXA 4BQ1A 1ZZ6A 3WCRA 5G05L 4N53C 5T5JA 4LR4A 3O1OA 2W92A 1W8WA 4EQVA 3N7LA 3P1IA 1HB4A 1UF2C 4FQZA 2WWSA 2ZEXA 1C5HA 3IPVA 2Y0IA 2ZGLA 2XJQA 3AB0A 2Q4SA 4CUBA 1AL23 1NUKA 1XYNA 3ZFEC 1PO12 1V6NA 4E9KA 3D0SA 2NQYA 2DF7A 3AFKA 1V70A 5A6ZA 4AQ2A 1V6IA 1ASJ1 3LKJA 2E26A 1KDMA 2W52A 4FXGB 4AAPA 4URAA 2AC1A 2ZCWA 2WWUA 1OLRA 1NLRA 3SNMA 1JZ4A 1QMJA 2P6HA 3DXTA 4YW1A 3VBFB 4IE5A 1O3SA 1COV1 4OMCA 4YVWA 1RGSA 4AI9A 4D0QA 1P8JA 2ZMLA 2ZGNA 3ILNA 3JD72 5JXIA 4J1WA 4XCBA 4D7TA 4A6SA 3AL5A 5TSWA 5KWRA 4Q4W1 5I93A 1R1A2 3S7EA 4RR3A 1W04A 1F5JA 2FDHA 4L2NA 3H1WA 3I4IA 2QNKA 4DIQA 1K5MA 3VHPA 1RUF3 4TSVA 4DXTA 1NY72 4UBHA 3PTRB 4Q4Y3 5JR2A 1LHNA 3KMHA 4MHRA 2FDFA 1VE0A 4XMAA 3TRSB 5LZ6A 5J96B 2RS11 4ZZ5A 1AYN1 4H7MA 4LO4B 1QJZA 4CEWA 1WKYA 1JYCA 1KQRA 1RMU3 4QQPA 4ZY9A 3DEMA 3F95A 4RL7A 3WNXA 2CSGA 2ZX1A 5AC93 3GXUA 4PJYA 3AJZA 5A3OA 3VD4A 5JSRA 3AZXA 2JDMA 4K8RB 2VZTA 4OMDA 2OQ7A 3ZKUA 3CKHA 5LK7B 3N9QA 3V0AA 1GWKA 2WNUB 3M4FA 4CCMA 3TNQA 3TEXA 4I0AA 3I97A 4AG4A 2F4LA
chains in the Genus database with same CATH topology
3N9LA 5FZBA 3ZPOA 5FY9A 4D6RA 5F2SA 5FYMA 5FP7A 5IVBA 3OPTA 4GD4A 2GP3A 5A3NA 5FXZA 2OQ6A 2XDVA 4EYUA 2WWJA 5ANQA 5FZFA 5FZ7A 5FZKA 5A7NA 5FXWA 3OPWA 5FY0A 2OS2A 2YU1A 4CCKA 4V2WA 4Y4RA 5F3EA 2YPDA 4GJYA 5FV3A 5FZOA 5FY7A 4QXHA 5FYTA 4DO0A 3U4SA 5IVJA 5LW9A 3K3NA 4NUBA 4ASKA 4GJZA 4IGQA 5FYCA 5FZ8A 4BISA 4TN7A 3LD8A 5F3GA 4QX7A 5FPLA 5A7WB 5IVCA 2XXZA 5FZ9A 5FYZA 2Q8CA 5F3IA 5FP4A 5A7PA 5FZCA 5F5AA 5FJKA 5FY8A 5CEHA 5IW0A 5FZ3A 5FPAA 5LY2A 5IVYA 3PU3A 5A7SA 4E4HA 3KVBA 5FUNA 5FPUA 4XDPA 3N9MA 2YBSA 3PUSA 2Q8DA 5F32A 3KV4A 5FZAA 5FJHA 5FZ6A 3AVRA 2GP5A 4QXBA 4QU1A 5E6HA 4LITA 2W2IA 2XUEA 2VD7A 5F3CA 5FZHA 5IWFA 5A7WA 4CCLA 4CCJA 4CCOA 3U78A 5FYUA 3K2OA 5LWBA 4QXCA 5LY1A 4QWNA 3N9OA 5FZLA 4AAPA 4HONA 4URAA 5FXVA 2YBKA 5FZ1A 2WWUA 5FYSA 5A80A 5FP3A 2Q8EA 4CSWA 5FPVA 5FYIA 3ZLIA 3DXTA 3KV6A 4HOOA 4GAZA 4LXLA 4AI9A 5F5IA 5K4LA 4CCNA 4EZ4A 3KV5A 4D6QA 4BU2A 4IGOA 3KVAA 5FZMA 5FWJA 5A3WA 3AL5A 5FZGA 2YU2A 5FZIA 5IVVA 4EZHA 5FZDA 5FZ4A 4QX8A 5FP9A 3PUQA 5A7OA 1VRBA 3N9PA 5FYBA 5FY1A 4DIQA 5IVEA 5F5CA 2OT7A 2YBPA 4C8DA 4LIVA 5A7QA 5FY5A 3PTRB 5FZ0A 3K3OA 5KR7A 4UF0B 5FPBA 3PUAA 3PDQA 5F2WA 2P5BA 3KV9A 3AVSA 5FP8A 3N9NA 5IVFA 3DXUA 3RVHA 5FXXA 4D6SA 5FWEA 5FY4A 5A1LA 2OX0A 5A1FA 5FYYA 5F37A 4LIUA 3NJYA 3LDBA 3PURA 4V2VA 5ISLA 4BXFA 4Y3OA 5F39A 2PXJA 3PU8A 4IGPA 5FZEA 4XDOA 4CUGA 4Y33A 2XMLA 5FZOB 2OQ7A 5FUPA 5FYVA 3N9QA 4CCMA 3UYJA 5A3TA 5FYHA 3AL6A 5FBJA 4UF0A 5A3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9L A;  5FZB A;  3ZPO A;  5FY9 A;  4D6R A;  5F2S A;  5FYM A;  5FP7 A;  5IVB A;  3OPT A;  4GD4 A;  2GP3 A;  5A3N A;  5FXZ A;  2OQ6 A;  2XDV A;  4EYU A;  2WWJ A;  5ANQ A;  5FZF A;  5FZ7 A;  5FZK A;  5A7N A;  5FXW A;  3OPW A;  5FY0 A;  2OS2 A;  2YU1 A;  4CCK A;  4V2W A;  4Y4R A;  5F3E A;  2YPD A;  4GJY A;  5FV3 A;  5FZO A;  5FY7 A;  4QXH A;  5FYT A;  4DO0 A;  3U4S A;  5IVJ A;  5LW9 A;  3K3N A;  4NUB A;  4ASK A;  4GJZ A;  4IGQ A;  5FYC A;  5FZ8 A;  4BIS A;  4TN7 A;  3LD8 A;  5F3G A;  4QX7 A;  5FPL A;  5A7W B;  5IVC A;  2XXZ A;  5FZ9 A;  5FYZ A;  2Q8C A;  5F3I A;  5FP4 A;  5A7P A;  5FZC A;  5F5A A;  5FJK A;  5FY8 A;  5CEH A;  5IW0 A;  5FZ3 A;  5FPA A;  5LY2 A;  5IVY A;  3PU3 A;  5A7S A;  4E4H A;  3KVB A;  5FUN A;  5FPU A;  4XDP A;  3N9M A;  2YBS A;  3PUS A;  2Q8D A;  5F32 A;  3KV4 A;  5FZA A;  5FJH A;  5FZ6 A;  3AVR A;  2GP5 A;  4QXB A;  4QU1 A;  5E6H A;  4LIT A;  2W2I A;  2XUE A;  2VD7 A;  5F3C A;  5FZH A;  5IWF A;  5A7W A;  4CCL A;  4CCJ A;  4CCO A;  3U78 A;  5FYU A;  3K2O A;  5LWB A;  4QXC A;  5LY1 A;  4QWN A;  3N9O A;  5FZL A;  4AAP A;  4HON A;  4URA A;  5FXV A;  2YBK A;  5FZ1 A;  2WWU A;  5FYS A;  5A80 A;  5FP3 A;  2Q8E A;  4CSW A;  5FPV A;  5FYI A;  3ZLI A;  3DXT A;  3KV6 A;  4HOO A;  4GAZ A;  4LXL A;  4AI9 A;  5F5I A;  5K4L A;  4CCN A;  4EZ4 A;  3KV5 A;  4D6Q A;  4BU2 A;  4IGO A;  3KVA A;  5FZM A;  5FWJ A;  5A3W A;  3AL5 A;  5FZG A;  2YU2 A;  5FZI A;  5IVV A;  4EZH A;  5FZD A;  5FZ4 A;  4QX8 A;  5FP9 A;  3PUQ A;  5A7O A;  1VRB A;  3N9P A;  5FYB A;  5FY1 A;  4DIQ A;  5IVE A;  5F5C A;  2OT7 A;  2YBP A;  4C8D A;  4LIV A;  5A7Q A;  5FY5 A;  3PTR B;  5FZ0 A;  3K3O A;  5KR7 A;  4UF0 B;  5FPB A;  3PUA A;  3PDQ A;  5F2W A;  2P5B A;  3KV9 A;  3AVS A;  5FP8 A;  3N9N A;  5IVF A;  3DXU A;  3RVH A;  5FXX A;  4D6S A;  5FWE A;  5FY4 A;  5A1L A;  2OX0 A;  5A1F A;  5FYY A;  5F37 A;  4LIU A;  3NJY A;  3LDB A;  3PUR A;  4V2V A;  5ISL A;  4BXF A;  4Y3O A;  5F39 A;  2PXJ A;  3PU8 A;  4IGP A;  5FZE A;  4XDO A;  4CUG A;  4Y33 A;  2XML A;  5FZO B;  2OQ7 A;  5FUP A;  5FYV A;  3N9Q A;  4CCM A;  3UYJ A;  5A3T A;  5FYH A;  3AL6 A;  5FBJ A;  4UF0 A;  5A3P A; 
#chains in the Genus database with same CATH topology
 2FHR A;  2ZMN A;  4GB3 1;  2GMM A;  2OZ6 A;  1YQC A;  4A45 A;  1G8W A;  4ZS2 A;  2ET7 A;  3W20 A;  1ZBE 3;  3E1F 1;  1W8O A;  4Y22 A;  5A3N A;  4OLL A;  2XPJ A;  4K21 A;  2VZP A;  1WLC A;  1L7Q A;  5DAX A;  2FCV A;  1W6N B;  2LRO A;  2WS9 2;  3T3Y A;  4CCK A;  3H1Y A;  4XF1 A;  4Z2W A;  1RVF 2;  2ZGM A;  4YNI A;  2FDI A;  2DVG A;  5FZO A;  4GA9 A;  3CZJ A;  1OUX A;  1H9P A;  4CCE A;  4E4S A;  4HVO A;  1JYI A;  2V5D A;  1GQG A;  1KD7 A;  1XNT A;  3HPN A;  3I59 B;  5FZ8 A;  1TNR A;  2HWB 3;  1CON A;  3HBK A;  4XBL A;  4COU A;  1C1L A;  1OKO A;  5J48 A;  4BQX A;  3I2J A;  1RUJ 3;  3LIG A;  5F5A A;  3UGG A;  2PMW B;  3I2O A;  3LA3 A;  3WP5 A;  1OVP A;  5A32 A;  3TEZ A;  2ATF A;  1SLL A;  5IVY A;  5JI7 A;  2R06 3;  2KA3 A;  1HIX A;  3WXP A;  1AX2 A;  2J1U A;  4WVZ A;  4DPN A;  2Y6H A;  1LEC A;  3OF1 A;  1VLN A;  5SV8 A;  3JBG 3;  4CTE A;  1VIW B;  3NAP A;  4BQ4 A;  4YZ1 A;  5A6Y A;  1W28 A;  5CFC C;  2WFF 3;  1VMF A;  2ZX3 A;  2CHH A;  3V56 A;  4QX2 A;  4CDQ B;  4CCD A;  1YQ5 A;  2YC4 A;  1W8U A;  1VBD 3;  3M3C A;  3SLI A;  3THC A;  3CL1 A;  4AK3 A;  1TME 2;  2WZP P;  5FZH A;  4BLI A;  2VQT A;  2AAC A;  3NO8 A;  2R04 2;  3H8U A;  3OYW A;  2CWS A;  5IK8 A;  4O61 A;  3GBG A;  3MO4 A;  1HXS 2;  2EXK A;  4SBV A;  4XEZ A;  1UMI A;  5IAT A;  1W9T A;  1DZT A;  1JYT A;  3D3A A;  4UFI A;  5FZL A;  3ZN6 A;  4P5Y A;  4WVW A;  2Q1M A;  2IXC A;  1BKZ A;  2CV6 A;  2ZHK A;  3KGL A;  1R09 1;  2XB6 C;  1OQ1 A;  1LR5 A;  2BFU L;  4PF1 A;  2PHT A;  2Y6F A;  2ID4 A;  4YGE A;  3IAP A;  2RG4 A;  1ZRI A;  2LS6 A;  4LUM A;  5ACA 2;  5JWP A;  4MAD A;  4CXX A;  4EN7 B;  4IGO A;  2BJS A;  4JGZ B;  4DUW A;  1N1V A;  1RUD 1;  2ZGT A;  1UZY A;  3ZVX A;  1H8T A;  1VRB A;  3M1H A;  5EWS A;  4MXV A;  5K7P A;  5EYX A;  2XJP A;  3OEA A;  3BU0 A;  1QXP A;  5LBC A;  1EV1 3;  1GWL A;  1STM A;  5DAQ A;  1NX9 A;  4UF0 B;  1IS3 A;  4Z1V A;  4CDW B;  4TLG A;  1VBC 1;  4QPI B;  2XHN A;  2R07 1;  2J7M A;  3PDQ A;  3RJ2 X;  2GME A;  3UK9 A;  2VGD A;  3O1M A;  1VRH 1;  1AUY A;  3HR9 A;  4JV4 A;  4NHK A;  4WM8 B;  3HBZ A;  3O12 A;  3PJY A;  4JQT A;  2NP0 A;  2QQW A;  1UYX A;  1Z78 A;  4YZ4 A;  5JIA A;  3VBO A;  3RZK A;  1Y7B A;  3PIG A;  2OKX A;  3DYM A;  4BZ4 A;  1V6K A;  3VHR A;  2JB4 A;  1QXR A;  4JZR A;  4S2H A;  1Z7S 1;  1F5F A;  3H1M A;  5BNP A;  1OQD A;  4CVU A;  2B7Y A;  3OBA A;  3D82 A;  3FUO A;  3WV6 A;  2ORX A;  2ZAH A;  4AZZ A;  3E6D A;  3I2D A;  3PVB B;  3NJV A;  3MHZ A;  5T54 A;  3ZSJ A;  1BK0 A;  2R7E B;  2Y26 A;  3AK0 A;  3M8L A;  2WKK A;  3U14 A;  4AQ6 A;  3RZG A;  1OF4 A;  2IXH A;  2XQR A;  3K48 A;  5FLH A;  3DN7 A;  1HB1 A;  1AR6 1;  1X9T A;  4EYU A;  4XUP A;  1WCS A;  2WWJ A;  3NV3 A;  3VKL A;  2QZ2 A;  3KQ4 B;  4I30 A;  4N53 B;  4E2G A;  1PVC 2;  2ZS6 B;  4CP2 A;  1K45 A;  3IDE A;  1US3 A;  3NKT A;  5DAW A;  1JU4 A;  3WP6 A;  3U4S A;  2A71 A;  1GZ9 A;  4FPG A;  1O7F A;  4L11 A;  4CA9 A;  1HV1 A;  1R1A 3;  2QTW B;  3ZFE B;  1YFU A;  2RM2 3;  3D5O A;  1YCI A;  2VZR A;  5F5Q A;  5AVP A;  1AL2 1;  4PBO A;  5EZW A;  1Y3T A;  3B7M A;  4A44 A;  4QHZ A;  4XIO A;  4XIK A;  5LRR A;  4CEY B;  1CN1 A;  1IPJ A;  4NHM A;  4XJ9 A;  1IG0 A;  4DZG A;  2CTV A;  3ZXE A;  1MS9 A;  4B7K A;  1OFS A;  1U5X A;  4Q0U A;  4AR2 A;  4A7K A;  5DUV A;  3ZSK A;  3WG2 A;  1RJ8 A;  4IET A;  2ZHN A;  1MZE A;  1ASJ 2;  2IXL A;  4XW3 A;  4Y1U A;  4IE4 A;  5FZ6 A;  2Z5W A;  1UYP A;  2G4I A;  4Q4V 3;  3HN3 A;  4IEO A;  1UY3 A;  1ODN A;  2WZE A;  4JCK A;  1CJD A;  4OQ9 A;  3GYD A;  4CDX A;  3JXS A;  1CX4 A;  3MF9 A;  1LHW A;  5L9V A;  1A34 A;  1YQ2 A;  3HIF A;  4KU7 A;  3U10 A;  3V0B A;  2ZGK A;  4R52 A;  1QKQ A;  4QWN A;  1VBB 3;  2BER A;  4PCR A;  2B4K A;  4LBQ D;  3T2P A;  2YBK A;  1RUF 1;  3DV8 A;  1UZW A;  2Q1Z B;  1YJK A;  5FP3 A;  5HPO A;  3P5B A;  3RJR A;  4ASM B;  3TAY A;  4LQR A;  5DPN A;  1OVS A;  4N8M A;  4Q0Q A;  2C1F A;  3PLQ A;  4NHX A;  1UY1 A;  1VMH A;  3ZSL A;  5J36 A;  1AR8 3;  1JI6 A;  2XVK A;  5HCB A;  3WQB A;  4OVE A;  1E5H A;  1W8T A;  2B5H A;  2JIC A;  1RMU 1;  2CYF A;  2ZX2 A;  3ELN A;  5C5T A;  3RZM A;  2RS1 2;  2BPA 2;  5FP9 A;  1XSR A;  1CIW A;  2HWF 1;  3IB3 A;  3K4D A;  5GZD A;  1H4H A;  4J1X A;  4H3W A;  1U5Z A;  1BVV A;  3LE0 A;  3KF5 A;  2AEZ A;  4LIV A;  5AC9 1;  1J59 A;  4I01 A;  4E4D X;  4Q8L A;  3RMY A;  2EXJ A;  3WDT A;  2WBK A;  4OZX A;  3MPB A;  4NHY A;  4BJ0 A;  1O8P A;  2C5D A;  3J7N A;  4S2F A;  3VBF A;  1D2S A;  4KNC A;  2XVL A;  4FTB A;  5FMB A;  1XNC A;  4JX0 A;  1QF3 A;  5A1L A;  1BXH A;  4BK4 A;  3LEG A;  1UYY A;  4DY3 A;  2JB8 A;  2HKX A;  3PUR A;  4MHU A;  3NMB A;  5ISL A;  4FPJ A;  4E8D A;  1O8S A;  1E5R A;  3NVC A;  3SQO A;  2W0X A;  1JZ2 A;  1DGW A;  2WNE A;  4MVT A;  1OC1 A;  1V6M A;  2A7A A;  2OUH A;  2E31 A;  3NL1 A;  2IC1 A;  2UU8 A;  2Q1F A;  1UQX A;  5LEK A;  1QJU 2;  1POV 3;  4K1Y A;  4M3C B;  2N7G A;  1RJ7 A;  1GU3 A;  3A22 A;  2VQ0 A;  4JKK A;  1RUN A;  1ZYB A;  5JSO A;  1HXS 3;  1RXF A;  1ZZ7 A;  1FOD 3;  2X29 A;  3HT1 A;  3VHO A;  5CIS A;  1ONA A;  4XE9 A;  5A3L A;  1KRI A;  1OXC A;  2HWB 1;  1RED A;  4L99 A;  5JCT A;  2PAK A;  2XUM A;  4I3G A;  5GLU A;  4H7L A;  1U5I A;  3DPR C;  4KG0 A;  3Q9O A;  2HWC 1;  4YWA A;  5HCA A;  5FZK A;  3RSJ A;  2JG9 C;  4K8F A;  4YW4 A;  2R06 1;  1HRI 2;  5CZK A;  4NID A;  2B8M A;  1AF9 A;  2OYZ A;  5ACA 3;  3FZ3 A;  5FYT A;  4DO0 A;  1JUI A;  1QOO A;  2TEP A;  3SH3 A;  1H0B A;  5I8Y A;  3B01 A;  2C4X A;  3KZ4 C;  4OI2 A;  5FPL A;  4LBL A;  1QH7 A;  4AF9 A;  3KS7 A;  3QD6 A;  1A8M A;  3KGZ A;  3ZYG A;  5IK4 A;  3WX5 A;  4LA2 A;  1XU2 A;  2EXH A;  1G9B A;  1UPI A;  5BNN B;  1DQ0 A;  2W1S A;  3LA2 A;  1WMX A;  2BNM A;  2FZ2 A;  1W6N A;  4N43 C;  1RXG A;  1YNA A;  1WA4 A;  3B69 A;  4PI2 A;  5C3R A;  1OBN A;  4RN5 A;  4MGZ E;  5FZA A;  1VBA 1;  4YM2 A;  1QDO A;  4CP1 A;  3BIW E;  3I59 A;  2CNA A;  2WDB A;  2XUE A;  3DL3 A;  3ST7 A;  4AFC A;  4LJH A;  1R09 2;  4C1W A;  4CCL A;  2ZTN A;  1NA1 C;  3NST A;  4UFL A;  3WF2 A;  2YUE A;  2Z69 A;  5A3M A;  1G9A A;  3B00 A;  5GKA C;  3ECQ A;  3O1U A;  1H1M A;  3ZXA C;  1ZZ9 A;  2EXI A;  4HKL A;  3HNM A;  2G9G A;  2WT0 A;  1JU3 A;  4IEU A;  2WSV A;  2XQX A;  1AJO A;  2VZS A;  1AYM 3;  1EV1 1;  1WA6 X;  3CU7 A;  4HOO A;  2ORZ A;  1QJX 2;  1ULO A;  2HBT A;  2XBO 3;  4QM9 A;  4MXW B;  2B45 X;  2CL2 A;  3AYD A;  1PM7 A;  4MGS A;  5FO9 B;  3GJA A;  4CDQ A;  4Q26 A;  2DVF A;  3WW4 A;  5K0U B;  1DFQ A;  3E5U A;  3AYE A;  1VBC 2;  4OHV A;  4BQ2 A;  2R07 2;  4F8A A;  1CX1 A;  5A7O A;  3SEE A;  3UT0 A;  5F5C A;  3EJK A;  5DAV A;  2QJV A;  1LOF C;  4XHB A;  1UY0 A;  1XE7 A;  5FY5 A;  3JQW A;  2G1M A;  4IV1 C;  1X9P A;  1HJG A;  4OYU A;  5JOY A;  3H9A A;  1NCQ C;  2GAL A;  5FPB A;  4UW5 A;  4DS0 A;  3GBW A;  1JH5 A;  5CG8 A;  3AMH A;  1SLB A;  4COY A;  4QQO A;  5JXH A;  1I5P A;  2X09 A;  3VUO A;  1SDD B;  5FFO C;  4BYY A;  3KB5 A;  5BV6 A;  1BBT 3;  1QJY 3;  2JDA A;  3WR0 A;  2IXK A;  5C3S A;  3LOI A;  4CZS A;  3TN9 3;  2ZOE B;  3BTA A;  4NII A;  4XUT A;  3MGU A;  5H9S A;  2ILM A;  2XHK A;  4JDM A;  3RQ0 A;  3WUD A;  1B35 B;  3ZFF C;  5HI0 A;  4JGZ A;  4E27 A;  5J1X A;  1N1S A;  4AEJ A;  3P3N A;  2P4E A;  2WL1 A;  1C28 A;  1LGB A;  4OUE A;  4XXA A;  1YJL A;  1SLI A;  2TNF A;  5FPZ A;  2V4V A;  4JHT A;  5E88 A;  1DYK A;  1RUH 3;  3DCQ A;  5FYV A;  4R9C A;  3VGI A;  3I3E A;  3DYO A;  1GMM A;  3OBR A;  4HKW A;  4P9Y A;  4QQ2 A;  3RDI A;  4UF0 A;  3WOG A;  3OEB A;  1GAN A;  3FFZ A;  3Q8B A;  4QGM A;  3AX4 A;  1Y9Q A;  2DCJ A;  4QPI A;  5FY9 A;  5EYY A;  2D3P A;  1MEC 2;  5FYM A;  1R1A 1;  2GN7 A;  4ARY A;  4WM8 A;  2VOW A;  2VL4 A;  2DFC A;  3WDX A;  5FXZ A;  1UPS A;  2ZEY A;  4OZO A;  4A7Y A;  5ANQ A;  3GGL A;  3WHU A;  2D7F A;  1NY7 1;  2RDR A;  4QMA A;  1F8V A;  2OS2 A;  1FAT A;  1MPX A;  1AL2 2;  2XLG A;  4KGQ A;  5FV3 A;  4EE2 A;  2DCK A;  4TLF A;  2JIG A;  2VBD A;  3MV0 1;  4LKF A;  3WF0 A;  1W0O A;  2DUR A;  3CO2 A;  1PGL 2;  4QX7 A;  2A6V A;  3NNG A;  3MPP G;  4YVS C;  3I49 A;  1ACC A;  1DZR A;  2XGX A;  2W87 A;  4I09 A;  3VKM A;  4QX1 A;  5FJK A;  4E4Z A;  4MET A;  5EXO A;  1I6X A;  1WLW A;  4PI0 A;  1O3Q A;  1W8F A;  2W91 A;  2ZZJ A;  3JUU A;  5FUN A;  3B02 A;  1S0D A;  4KWL A;  4N53 A;  4AVA A;  5A33 B;  4UWD A;  1CVN A;  1VBB 1;  4P14 A;  3NRU A;  1ULG A;  4AGV A;  3DKQ A;  3WP4 A;  4NO4 A;  4XF4 A;  5FOJ B;  4XJ8 A;  2ARE A;  4B1M A;  3IDC B;  4A6O A;  3POY A;  1SPP A;  1JHN A;  2D5H A;  4N9H A;  2JDH A;  5EQU A;  1RUF 2;  3OGG A;  2WNO A;  5IWF A;  5FQ0 B;  1AR8 1;  4Q4X 3;  3ZFE A;  3I2K A;  1XOY A;  2DWR A;  3B9C A;  4KU8 A;  4FO9 A;  4Q4Y 2;  5C9A C;  5FRE A;  3BPS A;  2BTV C;  4Q27 A;  1QJU 3;  1RVF 1;  1UL9 A;  2WA4 A;  3ACH A;  3FFQ A;  3N9O A;  1KFU L;  3U37 A;  2R30 A;  4L9B A;  1RMU 2;  5H9P A;  3AKR A;  3LOB A;  4QQL A;  3ZXG A;  2VUL A;  2W3J A;  2Z42 A;  2VME A;  4S2D A;  2XJU A;  4CXY A;  1KS5 A;  5CKM A;  4ERO A;  2OZJ A;  3JZV A;  5FZM A;  5FWJ A;  4ZZ8 A;  3OCP A;  5SV5 A;  5BNO C;  1UWW A;  2ETE A;  2VCC A;  3T0A A;  1W8N A;  4FAH A;  2VAU A;  1HRI 3;  2H6C A;  3VV1 A;  5BPX A;  2RJL A;  2YBP A;  1IG3 A;  4QKB A;  5I8S A;  4AVB A;  1UX7 A;  2XVG A;  5EJ3 A;  5FZ0 A;  4CPB D;  2WLP A;  4YW6 A;  4XOG A;  1W05 A;  1ZBE 2;  2E7A A;  1LB2 A;  3BGA A;  1JZ3 A;  2ZGQ A;  2D6K A;  1W3V A;  2J1V A;  1DHK B;  1UOG A;  4D7S A;  4LEJ A;  4E2Q A;  4YRD A;  2ZAC A;  1POV 1;  2WNV C;  1TME 1;  3LF7 A;  3PL0 A;  3AP9 A;  4UFJ A;  5FXX A;  3ZXD A;  1ENS A;  4QKN A;  1HXS 1;  1FOD 1;  1NAE A;  4BB3 A;  3DPR B;  4M00 A;  3NNJ A;  1GBG A;  2Y6L A;  3OGS A;  4YW2 A;  3AP7 A;  4FOV A;  4FPY A;  2Y33 A;  5DUX A;  3WNK A;  4C90 A;  3KWV A;  5I91 A;  1Y4W A;  2YRO A;  5FZE A;  3IN9 A;  3USS A;  3POG A;  1L7L A;  3K4A A;  1BMV 2;  2RS5 3;  2Q30 A;  2VMG A;  1RUJ 2;  1Q5O A;  2BBA A;  3HT2 A;  4Q0V A;  4BWO A;  5CU1 A;  5GLV A;  2LW8 A;  5ACA 1;  2B42 B;  2E51 A;  4IE0 A;  4UBG A;  2W1Q A;  4AI0 A;  1ZRE A;  1DBN A;  2R06 2;  1T6B X;  5F8P A;  5FP7 A;  3W5M A;  1QWR A;  2HLE A;  4HBN A;  3OY8 B;  4UW3 A;  2DCT A;  3FLR A;  1F4H A;  4AED C;  3JBG 2;  1OH4 A;  4XDQ A;  5FO8 B;  3AZZ A;  1X33 A;  2VVE A;  2WFF 2;  2AEN A;  4N90 A;  5C8C C;  1U5Y A;  3OGV A;  1QNW A;  4BQ5 A;  1M4W A;  1UD1 A;  1FNY A;  1VBD 2;  2ZGR A;  1LKN A;  1R1Z A;  4W6W A;  3LDR A;  1OA3 A;  5J37 A;  2YFU A;  3VBU C;  3A0K A;  4HL0 A;  5DDJ 3;  1W6P B;  2VU9 A;  3WDV A;  3K3N A;  4LBQ B;  4M3C A;  4RGK A;  4YAR A;  3POJ A;  3H8R A;  3RZL A;  4OHY A;  3I2I A;  4LNV A;  5F6L B;  4RS5 C;  5FZC A;  2WT2 A;  5CEH A;  3K51 A;  1PMI A;  2X5I B;  1REE A;  1VBE 3;  1CZV A;  1Q8P A;  1SBE A;  3JB4 C;  5DMY A;  4QGL A;  2WSU A;  1WCU A;  1D4M 2;  4LE4 A;  1W6M B;  3J8F 3;  5ERL A;  4C1X A;  1WBL A;  4NWV A;  1SLC A;  4FI9 A;  1D7P M;  3KV4 A;  3M3E A;  4LKS A;  4X6R B;  4LT5 A;  1ENR A;  1D0G A;  1UU5 A;  1H4G A;  1F31 A;  3CJI C;  2UUR A;  4DXS A;  3QLQ A;  4A42 A;  4D7Y A;  2XBO 1;  3C7F A;  2PTM A;  1W0P A;  4Y5S A;  1OA2 A;  1EV1 2;  5LA9 A;  2JWP A;  5FYU A;  4CP9 B;  2LRP A;  3CLP A;  5D1I A;  1W99 A;  2QFE A;  2VZU A;  3AJY A;  3DF0 A;  3GCX A;  3URF A;  5C5U A;  1OSG A;  1UKR A;  4HVR A;  4YGB A;  4IV1 B;  3WNN A;  1WCK A;  5EFU A;  1NCQ B;  5BNN A;  4PQ9 A;  5FYS A;  3H7Y A;  3SMH A;  1WBF A;  5FKB A;  1WMF A;  1UCX A;  3AMM A;  1CZT A;  4EN0 A;  2BWC A;  4JGY B;  4YW3 A;  3RZH A;  3KVA A;  5FMO L;  3ZXL A;  5FDB A;  4HPK B;  1ZM1 A;  4R4Z A;  3TN9 1;  2MNG A;  1K3I A;  1UU4 A;  4LHN A;  4FPF A;  3KM5 A;  3RI9 A;  4ATF A;  4FPK A;  4EJR A;  1OF3 A;  1RUC 3;  2ARX A;  2FZ1 A;  1LED A;  1W2A X;  2H0B A;  4BK5 A;  4QD2 A;  2Y0O A;  3PJQ A;  1BQP A;  2QQV A;  3B94 A;  1RUH 1;  4MO3 M;  2VOK A;  3BIE A;  4AVS A;  4DRR A;  2BOJ A;  2BW8 A;  2XLF A;  4ZU7 A;  4IDZ A;  4FAG A;  3VKN A;  3DXU A;  2QQU A;  2RDQ A;  3J26 N;  4MXW A;  5FWE A;  2HWE 3;  1F15 A;  5K0U A;  2DVB A;  5KHH A;  3NV4 A;  4XFF A;  2B9V A;  2QQN A;  5GJ6 A;  5GZF A;  1JOB A;  1VAK A;  3JB8 A;  1BZW A;  4Y1Y A;  5KBF A;  1PK6 B;  5FUP A;  2BGO A;  2ENR A;  2D6M A;  2VH9 A;  2XJR A;  3F2Z A;  4P9W A;  2RM2 2;  4SLI A;  2LAL A;  2PHX A;  1MQT C;  4LO5 B;  2IWG B;  5A3P A;  4LK7 A;  4R9D A;  1LOB A;  1GLH A;  1WW5 A;  2W46 A;  1RC6 A;  1W39 A;  2RS3 3;  4K20 A;  2GC3 A;  2JKB A;  5LBB A;  5IVB A;  3OPT A;  1DDL A;  2O14 A;  2UYB A;  3MIF A;  3OBT A;  4Q8K A;  1NOV A;  3O0W A;  5FZF A;  1B35 A;  3G6J B;  5CBL A;  4JRA A;  4L92 A;  4XUR A;  4G4F A;  4A3Z A;  2W1W A;  4HK8 A;  2UY9 A;  4LA3 A;  4KMQ A;  5A7N A;  1HN1 A;  1OOP B;  4Q4V 2;  3WIN E;  4CU7 A;  4IW3 A;  2P6C A;  5FY7 A;  4C91 A;  1OI6 A;  2A70 A;  5FMO S;  1DQ5 A;  5HCF A;  1AX0 A;  1SQ4 A;  1IKP A;  2OW4 A;  5LW9 A;  3EHK A;  4GMP 3;  4XFC A;  1DLL A;  3V65 A;  2V5Y A;  4K6B A;  1SBF A;  3H3Z A;  3Q8C A;  4JTO A;  4NRO A;  1HW5 A;  5T5O A;  3I3B A;  1VBB 2;  2VY0 A;  2LUW A;  3VZM A;  3PNA A;  4ASL A;  2CAU A;  4I3P A;  4P9L A;  4ONU A;  2FD8 A;  3FX3 A;  3T30 A;  2PYT A;  3EO6 A;  1AR8 2;  1AVB A;  2EVX A;  2XG3 A;  4XJU A;  1QJU 1;  3U0Z A;  3PUS A;  3ME2 A;  3ZN5 A;  1J3Q A;  1AZD A;  4COW A;  4DUV A;  5F32 A;  3ASI A;  1GQH A;  2F6B A;  2WYS A;  3AVR A;  4MV2 A;  4UAP A;  3WD5 A;  4AQS A;  1G9C A;  1F2N A;  3UNP A;  2AZ5 A;  2NLR A;  1H6Y A;  5BNO B;  3OUI A;  4WZF A;  5DQ0 A;  3BU7 A;  3R4S A;  3H3U A;  4ZXE A;  2CU5 A;  1IKQ A;  3NV1 A;  4DY5 A;  1GKB A;  1PGS A;  3OTF A;  2I74 A;  1HRI 1;  3WNL A;  2VMF A;  4V1P A;  1EPW A;  5FZ1 A;  5T50 A;  3WCS A;  3O1R A;  1NE6 A;  5A33 A;  2FBE A;  2C24 A;  1MAC A;  2WNV B;  1PM4 A;  4PBP A;  5JMC A;  4X6Q B;  3LEK A;  2D6O X;  2TBV A;  4AI1 A;  1NXM A;  4HAN A;  4RHV 2;  3E97 A;  2FDJ A;  4YGD A;  1UXZ A;  2PFW A;  1OUR A;  4YG6 A;  5FQ0 A;  2JE8 A;  3H0O A;  4QDQ A;  4QX8 A;  5LBE A;  3ZFG C;  5FY1 A;  1MVQ A;  2BEO A;  1J1T A;  3C7G A;  3KCX A;  3WW1 A;  4CEY A;  4BQW A;  1HQW A;  3VKF C;  5A7Q A;  3RMX A;  1FOD 2;  3SXW A;  4BE3 A;  4NRM A;  5JLV A;  1X36 A;  2C6S A;  2A1X A;  2RS5 1;  3L2Y A;  1HX6 A;  2UYA A;  3HQR A;  3VBR B;  1PX3 A;  3PMS A;  4AED B;  2NMO A;  3HQU A;  1IQD C;  3NJY A;  3RI8 A;  2KR2 A;  1D4M 3;  4AVT A;  2QQO A;  3AZY A;  4XAC A;  2XR4 A;  1WW7 A;  2H6B A;  2R0F A;  4XIL A;  1GNY A;  3KD4 A;  1QEX A;  5JIU A;  3PU8 A;  2VW0 A;  2FCT A;  5J7M A;  2WO3 A;  5L19 A;  3VBU B;  2RMU 3;  2ZX0 A;  3UYJ A;  1QJX 1;  1E5S A;  1OUS A;  3INA A;  2YC0 A;  2BNO A;  4CU6 A;  2W95 A;  2VMC A;  3QOP A;  4FSJ A;  1O5L A;  5T3N A;  3A21 A;  5DXD A;  4K7J A;  5DDJ 1;  4ARX A;  4W6Y A;  1HRV 3;  3O14 A;  2R0H A;  2GC1 A;  1SFN A;  2XDV A;  1QOT A;  3DPR A;  4YZ3 A;  2GSY A;  1VBE 1;  3PHM A;  1BCX A;  2X8K A;  4PF5 A;  4KWK A;  1KDK A;  1NCR B;  5F3E A;  3ZYF A;  2VUD A;  4QXH A;  3J8F 1;  1VB2 A;  3VZJ A;  4BMB A;  1EP0 A;  3SH5 A;  3CJI B;  4CRQ A;  4AFB A;  4XF9 A;  3M7A A;  3WDY A;  1BEV 3;  4Y24 A;  5GM0 A;  1XYP A;  3C8X A;  1G7Y A;  3TNP B;  1VMJ A;  2C9K A;  2HH9 A;  3WF4 A;  4FFF A;  1SG3 A;  4XYX A;  3WW2 A;  5GZG A;  5FY8 A;  4MGQ A;  2WFP A;  4UOJ A;  5KHK A;  1W9W A;  5FKC A;  3OY8 A;  4LOT A;  1IOA A;  1TNF A;  1AYM 2;  2YPJ A;  2HEW F;  5EJZ B;  1POQ A;  3PU3 A;  4FXK B;  3VD7 A;  3AKS A;  2XBO 2;  3ALQ A;  1YWK A;  3LA7 A;  2VXR A;  4YVW C;  3QBQ A;  5JZG B;  1GNH A;  2DDU A;  1HQN A;  2UY8 A;  1WLD A;  1E5I A;  3GZT B;  4JQR A;  1W6Q B;  4MUV A;  2BFU S;  5FUI A;  4DOU A;  2Y60 A;  1OPO A;  1QJE A;  1YXW A;  1J1L A;  1LRH A;  3D0J A;  1MEC 1;  4RR3 C;  1BVP 1;  5APA A;  1W6P A;  2A75 A;  3CEW A;  4AEK A;  1K42 A;  2VD7 A;  1OH3 A;  3TB0 A;  5L9B A;  4NIA A;  1AXY A;  1LOG A;  1CAW B;  1RHI 3;  1X8M A;  4JKL A;  4RGA A;  4E8C A;  1QJF A;  3I7D A;  4DUX A;  2VM9 A;  4IEQ A;  4XPV A;  2XL9 A;  1IQA A;  2X5I A;  4ORF A;  3GBF A;  3IM0 A;  2QDR A;  2RDS A;  4J6G A;  2W08 A;  1BBT 2;  1QJY 2;  1XYO A;  4LBJ A;  5L9R A;  4YSF A;  4Z92 B;  1RUC 1;  5A80 A;  5CB7 A;  3TN9 2;  3MDP A;  5FPV A;  2PLV 3;  1DQ2 A;  1FAY A;  1JUH A;  4AI8 A;  1QDC A;  4XUN A;  1PGL 1;  4B4P A;  2I2S A;  4M3C E;  1FXZ A;  5I0S A;  5LEJ A;  4D6Q A;  5IK7 A;  3ZDV A;  3WQ1 A;  1SLA A;  5FZG A;  1RUH 2;  5FZI A;  1JOP A;  3SKV A;  4FVV A;  3KCY A;  4ZU4 A;  2HWE 1;  4MGI E;  2E7T A;  4CP9 A;  4QB2 A;  2PAE A;  2D5F A;  5HV0 A;  4LPL A;  1OD3 A;  2D3S A;  3ZPY A;  3RZJ A;  3KLS A;  3ETQ A;  1JYV A;  3K3O A;  4IV1 A;  2ZGU A;  3TBD A;  4AGR A;  4KL1 A;  1BJQ A;  1NCQ A;  5AVA A;  4LUL A;  2ZMK A;  4RFT 0;  3WVJ A;  3HD8 B;  3RZZ A;  4UT5 A;  1GFF 2;  2F17 A;  2HJI A;  2WO7 A;  3AVS A;  5FP8 A;  4JVA A;  2ARB A;  1GP4 A;  2JJ6 A;  1VJ2 A;  4Q4Y 1;  2OX0 A;  2F4P A;  4JGY A;  2X05 A;  2D98 A;  2CGN A;  3SCG A;  1G9D A;  1S0B A;  5KXB A;  1CR7 A;  1W03 A;  1I9R A;  2OPK A;  2RS3 1;  2XON A;  1KS4 A;  3ETP A;  3MEP A;  4HPK A;  5FOB B;  2PA7 A;  5CVR A;  1JZ6 A;  2ZAB A;  2WAB A;  2YGM A;  4QX5 A;  2PHW A;  2QZ3 A;  4XQD A;  5HBA A;  4QHO A;  3DYP A;  3C7H A;  1H1I A;  4FFG A;  3ZOI A;  4BA6 A;  1H9W A;  4XJA A;  1KGY A;  3VBS C;  1YI9 A;  3ES4 A;  1EAH 3;  4O7X A;  4AHX A;  4Y20 B;  1C3H A;  3GJB A;  3IMM A;  4GMP 1;  4ES9 A;  1S0I A;  5L7O C;  2VC9 A;  1GQP A;  2VUC A;  2XH6 A;  1F4A A;  2IZW A;  2JDY A;  3AKQ A;  3E5Q A;  4UFK A;  5FK7 A;  2XKO A;  5A3U A;  5DG1 A;  2VOV A;  4KG8 A;  4C0H A;  3J7M A;  1ZRF A;  1DF0 A;  4HFS A;  3KT7 A;  3KT1 A;  4LHS A;  1UOB A;  1ZBE 1;  1JTZ X;  1UN1 A;  3IDB B;  1PK6 A;  1ZBA 2;  2JXA A;  1DQ4 A;  2JEN A;  4D69 A;  4Q4X 2;  3BPZ A;  1O59 A;  2YY1 A;  4RHV 3;  4AQT A;  1VB4 A;  1DGW X;  3WY6 A;  1IZ3 A;  2LTN A;  5A7W B;  1AR9 3;  1CWP A;  2VTX J;  4PHZ A;  5C4W C;  1DCS A;  2IFR A;  5IVC A;  3BUC A;  4WM7 C;  5A7P A;  4GWJ A;  4B8E A;  3GHN A;  3THP A;  5FZ3 A;  4XQ4 A;  3VB9 A;  1NYW A;  2GNM A;  3O0V A;  1HKD A;  3MLJ A;  5EHD A;  4NIG A;  1GSL A;  1BMV 1;  3ZXJ A;  5EIY B;  3LFM A;  1RUJ 1;  3S0M A;  1DU3 D;  1O91 A;  3VD5 A;  1OOP A;  5JMO A;  2C9A A;  3OJB A;  2FDK A;  4Q5O A;  4HN1 A;  5EPA A;  5CFD C;  1CIY A;  2JEM A;  4QPY A;  2PEL A;  4R9A A;  4JDO A;  5CFC B;  1CGP A;  1RYY A;  4FFI A;  1H8T C;  2DVD A;  2WNU A;  2WII B;  3D8C A;  3VZO A;  3JBG 1;  2YGL A;  4HSL A;  1QU0 A;  1NZI A;  4CCJ A;  3ZFG B;  2EF6 A;  2WFF 1;  1PVX A;  4RQP C;  4ZPI A;  5EP9 A;  1U12 A;  2ZEZ A;  4TTG A;  5LA0 A;  1X7N A;  1VBD 1;  3WEZ A;  1C4R A;  1ZZC A;  2YG0 A;  2GAU A;  1XU1 A;  2SBA A;  3HQX A;  4LBK A;  4LHL A;  4XAA A;  4BXS V;  5C3Q A;  2BGP A;  5LA2 A;  3WUC A;  3GCW A;  3H3L A;  3OOX A;  3UJQ A;  2QCS B;  1OLM A;  3VN4 A;  3AFG A;  4LBO A;  2BVV A;  4LXL A;  2VTF A;  2WZR 2;  3KV5 A;  4L0P A;  3FLP A;  1JW6 A;  1MZ6 A;  4YFW A;  1YFX A;  5BNP C;  1N1Y A;  2YU2 A;  5IVV A;  2RS5 2;  5FZD A;  4KQ7 A;  5BNO A;  5CAZ A;  1RIT A;  3BCW A;  1D4M 1;  2ZPX A;  5IVE A;  1O4Y A;  1AR7 3;  4RD7 A;  4K3U A;  4W65 A;  3B3Q E;  1V00 A;  3IWZ A;  4XZU G;  4IEY A;  1W0N A;  2ZHM A;  2OXB A;  3OD0 A;  4YFZ A;  3RRD A;  2Y6K A;  2FCU A;  2GH2 A;  2NM1 A;  2RMU 1;  1OPM A;  4P9G A;  3CQO A;  3WP3 A;  3EMR A;  2P5B A;  1H6X A;  1SBD A;  1W2O A;  2ET1 A;  2WNV A;  3VL8 A;  4ATE A;  5IVF A;  5KHJ A;  5D2A A;  3ZYI B;  3IMN A;  3NJX A;  2GNB A;  4FP2 A;  4NPL A;  5FYY A;  5I0U A;  4EWA A;  1HRV 1;  4GIQ A;  3LZZ A;  1WD3 A;  1CZS A;  4N7I A;  5DDJ 2;  3T2O A;  4M4R A;  1QNY A;  3LPG A;  1IPS A;  5HXM A;  2W94 A;  3B5L B;  4FQ4 A;  3AKT A;  3ENR A;  5A3T A;  1S0F A;  2R16 A;  4RSU A;  4OUL A;  3J4U H;  2O8Q A;  3EBR A;  3N9L A;  4AW7 A;  1VBE 2;  2OUJ A;  1SHW B;  1C8M 3;  5I0D A;  1W9F A;  3ZPO A;  2CGP A;  1W90 A;  2Q5T A;  4BME A;  3D4K A;  2KXL A;  1R64 A;  5FMC A;  1XNB A;  1RL3 A;  1VR3 A;  1ULD A;  2AH2 A;  3J8F 2;  3VBR A;  4B3N A;  1RUE 3;  1W8Z A;  4JHZ A;  2BWA A;  3POI A;  4AED A;  4W50 A;  1C5I A;  4NJ4 A;  2I45 A;  3WG1 A;  2J1S A;  2YZ4 A;  1WW6 A;  1XXN A;  4UW6 A;  5T5L A;  1DQ6 A;  1UOF A;  2XLA A;  5G04 L;  1XNA A;  1F35 A;  4BCU A;  4P00 B;  3III A;  5F6K A;  3RS6 A;  2D43 A;  4JKM A;  4PLO A;  4IGQ A;  3C7E A;  5F3G A;  3T1M A;  4FP3 A;  4X8N A;  4CCC A;  2DTW A;  5C3P A;  4CDW A;  4NMI A;  3OPZ A;  4HLT A;  3GAL A;  4TYS A;  5ABJ C;  2VZQ A;  1RHI 1;  3MUZ 1;  1PNF A;  1QIQ A;  2WT1 A;  3AXD A;  4K9S A;  3WQ0 A;  4E2S A;  2RM2 1;  2ZGS A;  1XND A;  5DZF A;  2MPF A;  1VPH A;  3QAC A;  3KHC A;  3IDA A;  1NCR A;  3T0B A;  3HMY A;  2HWD 3;  1JYN A;  2DV9 A;  1UX6 A;  2D97 A;  3CJI A;  4G3Y C;  4QU1 A;  5BUV A;  3POW A;  2XL7 A;  3GDB A;  1RUG 3;  1RUC 2;  3WQ7 A;  3BI3 A;  2JDZ A;  1PO2 2;  3MIB A;  3T1L A;  1N1T A;  5D8A C;  4I2O A;  1COV 3;  4NWW A;  2PQS A;  4Q4V 1;  1Q56 A;  4S2G A;  3FBY A;  3CHX A;  2E6V A;  3T2T A;  4WVM B;  2HYX A;  3VBF C;  3MID A;  5JZG A;  1ZX5 A;  2VOT A;  4CSW A;  1UIK A;  4LTA A;  2B46 X;  2HWE 2;  2XJT A;  5E89 A;  3N3H A;  1W6Q A;  1YQ8 A;  4QB6 A;  2BRT A;  2ZKN A;  3NV2 A;  2DCY A;  4XUQ A;  5D21 A;  5F5I A;  5K4L A;  3MFC A;  3N35 A;  1RUI 3;  1BYH A;  1GYK A;  2IFW A;  3GHM A;  3ES1 A;  3OUH A;  2ADE A;  2X10 A;  4Q1R A;  3WG4 A;  1EUU A;  1W8H A;  4IUG A;  1EUT A;  1MS8 A;  1UO9 A;  3E6B A;  5IJR A;  3AMQ A;  1O6U A;  2VBB A;  4HKO A;  1PNG A;  1CAW A;  2VMI A;  1X50 A;  2R1B A;  4RGG A;  1AYN 3;  1ZBA 3;  3DGT A;  1RIR A;  4QHB A;  4ZKT B;  2DTY A;  1WCD J;  4OUS A;  5C8W A;  4FPH A;  5JSP A;  2RS3 2;  4DB5 A;  2ZGO A;  3VBS B;  3RGB A;  4MG2 A;  5JUV A;  3PUA A;  3UGF A;  1MVE A;  2IXJ A;  1ENQ A;  1GOF A;  4IEZ A;  3N9N A;  5L7O B;  1AX1 A;  3DUI A;  5CKQ A;  3RWK X;  3VZK A;  4DIN B;  3FHA A;  1PIV 3;  4XTP A;  1EAH 1;  3O1P A;  5FMD A;  4N7U A;  4XFG A;  1AHS A;  2GU9 A;  3LDB A;  4Y1Z A;  2D6P A;  4V2V A;  4YYO A;  2AUY A;  1DQ1 A;  1FPN 2;  2ZXQ A;  5F39 A;  4Z07 A;  1UMZ A;  1RIN A;  2RJ2 A;  3ACF A;  2VUA A;  4IGP A;  4P5H A;  3T0D A;  4IEP A;  2UWA A;  1GOH A;  5F1R A;  4FCA A;  3UET A;  3UGH A;  3H7J A;  2VEC A;  5KC5 A;  3P3P A;  3WW3 A;  4AI3 A;  2GH8 A;  3R05 A;  5T5P A;  4XF3 A;  5C4W B;  4XXP A;  2E53 A;  1GR3 A;  2YXS A;  4RHV 1;  4WM7 B;  5T52 A;  5JPM B;  1YEW A;  1S0G A;  1AR9 1;  1UY4 A;  2GP3 A;  2JDN A;  3A7Q A;  4AFD A;  1YI7 A;  4HK9 A;  1TQ5 A;  5FZ7 A;  4HVQ A;  1OA4 A;  5H9R A;  4CYD A;  4G9S B;  1K12 A;  1TMF 3;  3NNL A;  5FXW A;  4ZXK A;  1ULP A;  4K40 A;  4Y4R A;  4OHX A;  1KJR A;  1GUI A;  3VDD C;  2HEY F;  2WZR 3;  5LB6 A;  1REF A;  2JEC A;  1QY4 A;  1LOC A;  2JG9 B;  5CFD B;  1JYX A;  2DVA A;  1DP0 A;  2JE7 A;  1R08 2;  5KXD A;  1H8T B;  2VNG A;  3AP4 A;  3LD8 A;  4CUA A;  4J25 A;  4XCA A;  1HDK A;  1VAV A;  1VAL A;  4YPJ A;  3WG3 A;  3GZE A;  2UWB A;  5FYZ A;  1IS6 A;  4Y20 A;  1JZ7 A;  1WGP A;  4RQP B;  4KBB A;  4HXC A;  1GZC A;  1IGO A;  1LU1 A;  1J83 A;  4Y1X A;  4XFI A;  4Q1P A;  3W9A A;  4YM3 A;  4Y5Z 0;  1V6O A;  1CJP A;  3KVB A;  1KXG A;  4YW5 A;  4Z2A A;  2CDO A;  3IZO A;  1JN2 P;  4UFH A;  4CDQ C;  3FE5 A;  4CDU C;  5B4X A;  1RTV A;  2PHL A;  3FUQ A;  2KD7 A;  4QDS A;  4N43 B;  1PMJ X;  1APN A;  3DKW A;  3OUJ A;  5FJH A;  1JMU B;  3LPF A;  1YLL A;  3SHR A;  4OUM A;  4P9I A;  3E6C C;  3FWE A;  4NAM A;  2RV9 A;  5A7W A;  1T6G C;  4TZD A;  1H2M A;  2E33 A;  3HJR A;  3THT A;  1DLC A;  1Y9G A;  2FMD A;  2QQM A;  4NHL A;  4ZU5 A;  1YO8 A;  3VZL A;  5JOZ A;  4W6X A;  1IS4 A;  3CDZ B;  1NKG A;  1ND3 C;  4QXK A;  4N9I A;  1NA1 B;  5LWB A;  3W21 A;  1XPW A;  3U1X A;  1XRU A;  1YUD A;  2WQZ C;  4Y26 A;  1G86 A;  2XWB B;  1RUD 3;  1PMH X;  4DXR A;  2Q8E A;  5A1A A;  4GXL A;  3UKN A;  5FLJ A;  3MBW A;  4JGZ C;  3ZMN A;  3HWJ A;  4LO6 B;  2JG8 C;  1XQN A;  5CFC A;  2IXI A;  4ET7 A;  5FCC A;  2RMU 2;  3M3O A;  2WQ4 A;  1AYM 1;  3QH6 A;  3SCF A;  2V72 A;  4OHZ A;  4FBF A;  3ZFG A;  5A6Q A;  3UKT A;  3ZYB A;  1VRH 3;  4I0W B;  2EAK A;  3SKJ E;  3UL2 A;  1NG0 A;  3AMN A;  1UKG A;  3M70 A;  3OB8 A;  4XBQ A;  3WF3 A;  5FR3 A;  1HRV 2;  1JYW A;  4PQQ A;  4XJZ A;  3B93 A;  3IAQ A;  5J3U A;  2DBN A;  4MGK E;  1N47 A;  1D2Q A;  4ZON A;  5F2W A;  3H42 B;  2VNV A;  1JXN A;  3KV9 A;  1SZB A;  3Q8E A;  1MS5 A;  3C2U A;  4MOA A;  4P9J A;  3MIE A;  4MGY E;  3IBM A;  2NPI A;  4HSJ A;  1UZZ A;  2ADD A;  4LLF A;  4GWN A;  3ZN4 A;  3ZYH A;  1OLQ A;  3PIJ A;  3ZFF B;  1FMD 3;  1MS4 A;  1BBT 1;  1QJY 1;  4XDO A;  3WZ1 A;  2BOI A;  4KGG A;  1BEV 2;  5E1R A;  3T4V A;  2J22 A;  4B7E A;  1OLM E;  2L9L A;  3O5S A;  5IFP A;  1LAJ A;  1U0A A;  3UV9 A;  1PO2 3;  2Z2S B;  2V73 A;  3AYC A;  2QUO A;  4OI1 A;  1S0E A;  5F2S A;  4D6R A;  3J9S A;  1YRZ A;  4GAL A;  4IEX A;  1ULF A;  3MIH A;  1H2L A;  5AFB A;  5ABJ B;  4NIH A;  2J1E A;  4PDW C;  2A6Y A;  2BVB A;  3SCH A;  3BKZ A;  2CGO A;  2W39 A;  2YC2 A;  3MW4 A;  3CF6 E;  2G9Z A;  3UES A;  4V2W A;  1G6N A;  1KEX A;  4AVC A;  1ZRR A;  3B9I A;  5FRA A;  1RHI 2;  3FL7 A;  1H1A A;  1LEM A;  3VD9 A;  5FYC A;  3D6E A;  4TN7 A;  4IV3 C;  1X82 A;  2HWD 1;  3ITQ A;  2CDP A;  1OQE A;  2A3X A;  5FZ9 A;  1QGL A;  4CEY C;  3S30 A;  1Y9M A;  3KCC A;  4XMI A;  4BDV B;  1N3Q A;  2QKD A;  3LDK A;  5D8A B;  3W58 A;  4YVS B;  1ND2 C;  1RUG 1;  3AMP A;  1S4C A;  2PLV 2;  3O0X A;  5JI9 A;  2J1A A;  4COV A;  3RWN A;  1W9S A;  3WHT A;  3HNB M;  5JVV A;  3I2F A;  4BQY A;  5FO7 B;  1NLQ A;  3VDB A;  2VZ1 A;  1OFN A;  1ZA4 A;  2JE9 A;  3NJZ A;  3A0N A;  2RR1 3;  2YMZ A;  1DIW A;  3J7H A;  4EWD A;  1AJK A;  3HOB A;  1UIJ A;  5DN2 A;  5CAD A;  3I54 A;  3K77 A;  5E6H A;  5IYY A;  1FPN 3;  2EID A;  4XHX A;  2MEV 3;  2DCZ A;  4YM0 A;  3GF6 A;  3G7D A;  4AEM A;  1RUI 1;  2Z4F A;  4M3C F;  4QDR A;  3AP6 A;  1ZZB A;  2QQP A;  4GWI A;  2VQA A;  3PTY A;  4XF0 A;  1UW8 A;  4AI2 A;  3JU9 A;  5C9A B;  1W9Y A;  2O1Q A;  2VQU A;  1ZBA 1;  2K46 A;  2YDE A;  3LSD A;  4H2A A;  4Q4X 1;  3ACG A;  2QQI A;  2K0G A;  1TG7 A;  3VBH C;  1PZ9 A;  2HWF 3;  2VXJ A;  3MW2 A;  5C3O A;  3PVO A;  2JDU A;  1QHD A;  3AZW A;  4Q0P A;  4QPG C;  3ACI A;  2UWC A;  1SDW A;  5A3W A;  4WVV A;  3LIH A;  4GZ9 A;  2JDP A;  4DXZ A;  1PIV 1;  1UYZ A;  2GDF A;  5KHI A;  4H55 A;  2AEY A;  3N9P A;  5E8A A;  4CXW A;  1QQP 3;  4XET A;  3PUH A;  1SAC A;  4QXC A;  1EAH 2;  5GZE A;  4C8D A;  2IVJ A;  1R08 3;  1OD5 A;  1SCR A;  1J3P A;  4WVM A;  2HEV F;  5CIR A;  2E63 A;  2BDR A;  4AL9 A;  1SEF A;  4D6S A;  2A6W A;  4YG0 A;  3MIC A;  3I3Q A;  5K8S A;  4LMF A;  2W9X A;  4FTS A;  4BQ3 A;  2BV4 A;  2P3Y A;  5FTT C;  5GLT A;  3R0R A;  4FPO B;  3U75 A;  4BOW A;  4IE7 A;  1LOD A;  3SIS A;  3BOP A;  3AM2 A;  4U2A A;  3FHI B;  4FOW A;  4CUG A;  3O1S A;  1H2N A;  4WV8 A;  3VDD B;  3FLT A;  4AAX A;  1AR9 2;  1ZNP A;  2E9Q A;  2WZ8 A;  2Y34 A;  3MFA A;  1TMF 1;  5HCH A;  2P34 A;  2EIG A;  3ATG A;  4GH4 C;  1PX4 A;  1YIP A;  4FFH A;  4BM8 A;  4NR1 A;  2WZR 1;  4Y1V A;  3VBS A;  2P37 A;  2VZV A;  2HWC 3;  1NZC A;  2YB7 A;  3FHQ A;  3ZKY A;  1AXZ A;  1W06 A;  2VBP A;  1MR5 A;  2ZEW A;  3R6S A;  3I2H A;  5L7O A;  4GD4 A;  2A73 B;  2VOX A;  5I0R A;  4QT6 A;  2OVU A;  2O8O A;  2KM2 A;  1CAX B;  2OQ6 A;  1UAI A;  2BGC A;  4IQP A;  3T08 A;  4C0B A;  4HN0 A;  5C70 A;  3PVE A;  1Q3E A;  3NNM A;  2ZX4 A;  4YGC A;  2D93 A;  2JD4 A;  2R1D A;  4IEW A;  5IAV A;  1PGW 2;  2GMP A;  2R32 A;  2YYO A;  4CDU B;  5C8C B;  2YPD A;  4QPW A;  1Q43 A;  3Q8F A;  4LO8 A;  1YFW A;  5C71 A;  4I02 A;  3BTZ A;  4KWU A;  2RVA A;  3RFR A;  5BXX A;  2NYY A;  4JAA A;  4NUB A;  4GJZ A;  2WQ8 A;  3HN1 A;  1Q8O A;  4FT8 A;  2VPV A;  3S57 A;  3K75 B;  5C4W A;  5JOX A;  2W47 A;  4AHY A;  1LHV A;  2J1R A;  2Q8C A;  4WM7 A;  5KXC A;  5T55 A;  1MS1 A;  3LCP A;  5J98 B;  3ZYR A;  5BNN C;  1J58 A;  5JR7 B;  1ND3 B;  5FPA A;  1VBA 3;  4RS5 B;  2VVD A;  4QU2 A;  1HQL A;  1FYU A;  3QH7 A;  1J84 A;  3LFI A;  4LUK A;  5LCW L;  1HV0 A;  3GNE A;  1LOA A;  2WAO A;  4PIY A;  3AP5 A;  1V9U 2;  3USU B;  4PLN A;  2JG9 A;  5CFD A;  2JG8 B;  3WF1 A;  3BB6 A;  5EV7 A;  2GP5 A;  4QXB A;  3BOD A;  4UW4 A;  2NN8 A;  4LKE A;  4DEV A;  1GIC A;  1AR7 2;  3IIA A;  4EN6 B;  3TEY A;  3K46 A;  2ZKL A;  4RQP A;  4CUC A;  5FLI A;  4NRP A;  3K2O A;  2A3Y A;  4ZS3 A;  3GZU C;  4XFB A;  3UJO A;  5LY1 A;  5GLZ A;  4Y5T A;  5FXV A;  3AC0 A;  4AFM A;  1DYO A;  3FBM A;  2E7Q A;  1N3O A;  4QX0 A;  2ZZQ A;  3SIT A;  4LLO A;  4X8P A;  4AE2 A;  4DNY A;  5BYN A;  5K0U C;  4P02 B;  4NOT A;  1GOG A;  4HET A;  3H8X A;  4N43 A;  3W59 A;  1CAU B;  2VNR A;  5B2G B;  3ZIX A;  3ILR A;  4CU8 A;  1C8N A;  4EZH A;  2PHR A;  1GP6 A;  1XE0 A;  4D3W A;  1JBC A;  2Z79 A;  4LBQ A;  1K5M C;  5FYB A;  1WMD A;  1PO1 3;  4JRL A;  1C8M 2;  1FMD 1;  1NA1 A;  2WO2 A;  1LUL A;  4O9G A;  2DYC A;  3ZM8 A;  1IS5 A;  2FDG A;  4XVH A;  3I3D A;  1H30 A;  4B29 A;  2QE3 A;  1LGC A;  1EPZ A;  1RUE 2;  2LM3 A;  2ZJC A;  4CEW C;  3MZH A;  2GC0 A;  4XUO A;  1B35 C;  3FJS A;  1IPK A;  2WR9 A;  1W6M A;  2AYH A;  4Q29 A;  5FY4 A;  4DFS A;  1LCL A;  1PO2 1;  5A1F A;  1W2T A;  5F37 A;  5IT6 A;  3VDA A;  4PDW B;  4KI5 M;  5LK5 A;  3SC7 X;  1VAM A;  4EWE A;  5A6X A;  1UOJ A;  3MI8 A;  3N7J A;  3ON7 A;  3U07 A;  3S5A A;  4M0N A;  1CPN A;  3JD7 3;  4YLZ A;  2ARA A;  1SPP B;  5DZE A;  3ZO0 B;  3O1T A;  4KBZ A;  1IHM A;  5DG2 A;  2Y6J A;  2VVF A;  4HG6 B;  4DEQ A;  5FBJ A;  4IL7 A;  3GM8 A;  3AXE A;  1LOF A;  2IUW A;  3EB7 A;  4JC1 A;  4IV3 B;  1GNZ A;  2BNN A;  2D6L X;  1MQT B;  1ULE A;  3KHB A;  2NZ9 A;  4IES A;  1Q8S A;  3VL9 A;  3DEC A;  3NQH A;  3POS A;  4KWJ A;  1FI2 A;  1ND2 B;  2DUO A;  2VE1 A;  4NE9 A;  1W6O B;  5IUQ A;  4EV0 A;  2CWM A;  4A4A A;  3ZSM A;  3ZYP A;  2HWD 2;  2J1T A;  1GZW B;  3ZFF A;  3N7M A;  4YM1 A;  5C7G A;  4IER A;  4OI4 A;  3EQE A;  1RUG 2;  2QVS B;  3ZSE A;  1TE1 B;  4AFA A;  1WUV A;  3THD A;  4HT1 T;  2WJS A;  3MYX A;  2RR1 1;  4MZU A;  3U4X A;  1COV 2;  1UMH A;  2J42 A;  4U36 A;  4D8M A;  1XBF A;  2RHP A;  1SFY A;  2DBI A;  1CPM A;  4BH9 A;  4PLM A;  4AXO A;  4JDN A;  4Z82 A;  1FPN 1;  4ITC A;  4YG3 A;  4HMZ A;  2P1B A;  3OD4 A;  2MEV 1;  5H9Q A;  3WNO A;  4FPE A;  4Q4W 2;  1C57 A;  2C26 A;  5ABJ A;  5JAX A;  5A7S A;  4E4H A;  3KSC A;  2P3J A;  1QH6 A;  3MUY 1;  5FPU A;  3TEW A;  2O0O A;  3PVN A;  1AL0 G;  5LA1 A;  1RUI 2;  1UY2 A;  1L7R A;  3NAP C;  2A6X A;  2JDK A;  3VBH B;  5C6C A;  1JZ8 A;  2PAM A;  3NNF A;  2Q8D A;  4DMI A;  4A2U A;  1K5J A;  2RJK A;  4QPG B;  2WS9 3;  4QAW A;  1YIF A;  1LHO A;  1AYN 2;  1MS3 A;  1RVF 3;  2XOM A;  5F7U A;  4GKY A;  4L97 A;  3RYP A;  4CCO A;  3ACL A;  4A7Z A;  3LQC A;  1CES A;  3U78 A;  1LOE A;  5KHG A;  5D8A A;  4YVS A;  4IXL A;  3ZMO A;  4LBN A;  1CAV B;  1NXD 1;  1CQ9 A;  2DUQ A;  2QQK A;  3CZU A;  4OFG A;  3UKV A;  1QQP 1;  1PIV 2;  3BTY A;  4DQA A;  1R08 1;  4WZC A;  3KV6 A;  4XJW A;  2VG9 A;  4BIO A;  4OQ8 A;  3ROU A;  3WLU A;  2Q0A A;  4GB3 2;  4LKD A;  4BIF A;  1O4Z A;  4BU2 A;  1D0H A;  1TVG A;  1UNB A;  1WWY A;  4XTM A;  3FN9 A;  4EN8 B;  2GZW A;  2VNO A;  4KH9 A;  4D94 A;  1PZ7 A;  5FZ4 A;  3WSO A;  4F3J A;  3E5X A;  2B9U A;  5BY5 A;  1E57 A;  1XNK A;  3KQR A;  1I3H A;  1TME 3;  5JPN B;  3CJX A;  2VZO A;  2R04 3;  4GH4 B;  5C9A A;  1BK1 A;  3S5Q A;  3N7K A;  5FPX A;  3WT3 A;  1I5Z A;  3WDW A;  3OGJ A;  2ES3 A;  4R8H A;  4BLJ A;  4COZ A;  5JXJ A;  4GMP 0;  4GWM A;  3BTX A;  1WD4 A;  3N4M A;  1YHF A;  2VW2 A;  1TMF 2;  1T2X A;  4RYD A;  3VBO C;  4F83 A;  4LIU A;  4FOY A;  2QDN A;  2VZ3 A;  3HAG A;  3LB9 A;  5KC6 A;  3WDU A;  1SFP A;  2HBU A;  4QB1 A;  1PZ8 A;  3ZR6 A;  1EY2 A;  5LBF A;  2D6N A;  1W3X A;  2P2K A;  3BN6 A;  3A4U A;  4Y33 A;  2GN3 A;  1V9U 3;  1HN0 A;  2XML A;  4AGG A;  4QX3 A;  3C7O A;  4FPC A;  4AYU A;  2VUJ A;  3OBZ A;  1LES A;  2WN3 A;  4LHK A;  4LO7 A;  3M2M A;  4F7Z A;  1JOD A;  2OPW A;  3MW3 A;  3OGR A;  5FZB A;  2BYV E;  3W5N A;  3MLK A;  2GND A;  2R49 A;  2I07 B;  1Q8V A;  1YYN A;  2ZHL A;  1XJA A;  2A3W A;  1UZ0 A;  2OII A;  1W2U A;  1ZRC A;  2VJX A;  1ZZ8 A;  4NPM A;  5DAP A;  1S1A A;  4LE3 A;  1CD3 G;  1Y43 B;  4QKF A;  4MYE A;  2WAA A;  2PHU A;  4LOS A;  5K9Y A;  4XC9 A;  3J7L A;  3POE A;  3WNP A;  5AFE A;  3I8T A;  1US2 A;  2EIB A;  3VDD A;  5IFT A;  5JOW A;  3IPV B;  2BUK A;  2BQP A;  2B39 A;  1M06 G;  3ZIW A;  3VDC A;  1LNS A;  4BIS A;  1I1E A;  2PN5 A;  2R6Q A;  3SEP A;  4B1L A;  4O9E A;  2X5I C;  2XXZ A;  2ZAA A;  4MSV A;  5FP4 A;  4R9B A;  2V09 A;  4URT A;  2ZGP A;  2AGS A;  2BU9 A;  4XAB A;  2H0V A;  1LHU A;  1V6L A;  1RUD 2;  2PHD A;  4I0B A;  4L8Q A;  1S0C A;  3ZX7 A;  1GV9 A;  1FV2 A;  2Y8K A;  3M3Q A;  1ZVF A;  1CAX A;  1BEV 1;  3ORJ A;  5E16 A;  5ANN A;  3N9M A;  1RUO A;  2YBS A;  2WO1 A;  1OHF A;  4YVW B;  1DZQ A;  4CDU A;  5A70 A;  5C8C A;  5DUW A;  5J09 A;  5L36 A;  4FOQ A;  3SH4 A;  2AR6 A;  1JS9 A;  4PIZ A;  2PHF A;  2CY6 A;  1PVC 3;  5JXG A;  1JHJ A;  3VBU A;  1VRH 2;  3T2Q A;  1G9F A;  1XC6 A;  3GZA A;  4RR3 B;  4CDX C;  2XKP A;  4Q2F A;  1ALY A;  3ABZ A;  1K5M B;  3ZYJ B;  1GP5 A;  1NT0 A;  1WW4 A;  2EAL A;  4GKX A;  1ND3 A;  1A3K A;  1DGR N;  4RS5 A;  1Z7S 2;  1SLT A;  1NLS A;  1DYP A;  1SCS A;  4UI9 L;  4A41 A;  1PO1 1;  5FK8 A;  4HZF A;  3TOJ A;  3ZLI A;  4CEW B;  4JGY C;  1XE8 A;  2V4A A;  4GAZ A;  4AOC A;  1URX A;  2EIE A;  3S7I A;  4EZ4 A;  3USU A;  1WCQ A;  1FMD 2;  2JKX A;  2JG8 A;  4A3X A;  3R4D B;  1D4V B;  1TZO A;  3PME A;  1N3P A;  1ASJ 3;  1BHG A;  3LAG A;  2PLV 1;  5CYY A;  3TYJ A;  2YV8 A;  3CBN A;  3O1V A;  2FMY A;  4ES8 A;  3PUQ A;  1AR6 2;  2WRA A;  3KT4 A;  1KIT A;  2OT7 A;  4LK6 A;  4NRQ A;  3V0A B;  4EN9 B;  3JCI A;  1O3R A;  3JD7 1;  2W5F A;  5FBZ A;  4TWT A;  1ODM A;  3AZV A;  3LGR A;  2EIC A;  1ST8 A;  5LRS A;  5CA6 A;  2K9Z A;  5F9T A;  4UYB A;  4LBM A;  1WLT A;  4P08 A;  3EYP A;  2W1U A;  4GUL A;  1O4T A;  4Y22 B;  4Z8B A;  3RVH A;  2DFB A;  3LWC A;  3PUI A;  4Q4W 3;  4QGN A;  1LEN A;  1CAU A;  1ZRD A;  4QQH A;  1OMI A;  1MZF A;  4AVV A;  1XSQ A;  4Y3O A;  1KJL A;  4PT6 A;  1PK6 C;  2G19 A;  1L3J A;  1Z0H A;  2Y38 A;  4CPB A;  4WBB A;  3LEI A;  1NQJ A;  3H50 A;  5HXV A;  5FZO B;  5LAT A;  1A78 A;  4AHW A;  2P3I A;  1ENX A;  4BPZ A;  2X53 S;  2RS1 3;  3LSE A;  2HYK A;  5M0T A;  3MIG A;  3C3V A;  5GZC A;  2WLQ A;  4BHP A;  1HLC A;  1TEI A;  4OCT A;  1XB9 A;  3RG0 A;  2D40 A;  5A32 B;  2QQJ A;  5IAX A;  4Q0S A;  4FPL A;  1OOP C;  1DG6 A;  4PDW A;  2RR1 2;  2WC2 A;  1NE4 A;  4W8J A;  3Q8A A;  3K4Z A;  3AKP A;  2VMH A;  3FMG A;  3A23 A;  3NAP B;  3MLL A;  2YU1 A;  5FY0 A;  5B4N A;  2DU0 A;  2MEV 2;  2XJV A;  1JOJ A;  3CMG A;  4GJY A;  4GB3 3;  2WNU C;  4JTN A;  5FIX A;  1S2B A;  2Y64 A;  1YC6 1;  4XZP A;  4ASK A;  3L2H A;  5C33 A;  1WME A;  4MLO A;  2WN2 A;  2XJS A;  4IV3 A;  3OYW B;  2WS9 1;  1MQT A;  3APB A;  5F3I A;  1J3R A;  2YFZ A;  4YW7 A;  1Q8Q A;  1FNZ A;  1VP6 A;  2DUP A;  3NWK A;  4NPR A;  1ND2 A;  1MZ5 A;  5FAX A;  4CU9 A;  2A5Z A;  1W6O A;  3ZN6 B;  2VCB A;  4PIX A;  4XBN A;  2FQP A;  1F9K A;  1S0J A;  1V0A A;  2HWF 2;  5I8T A;  4FTE A;  3CNA A;  2G9F A;  4XDP A;  3HNY M;  1H8V A;  2ZBJ A;  5BNQ A;  1GZW A;  5AC9 2;  3AYA A;  5GLW A;  1B09 A;  3VKO A;  3P6B A;  2GNT A;  2VO5 A;  3RNS A;  3FC0 A;  2E32 A;  2DU1 A;  2PQQ A;  2RE9 A;  5LAS A;  1HB2 A;  2W2I A;  4LIT A;  5L73 A;  4OHW A;  4YZ2 A;  1QQP 2;  1UXX X;  5CKN A;  1KFX L;  1ULC A;  1MS0 A;  5JDB A;  2NMN A;  1HJF A;  2D44 A;  5GAL A;  4RA0 A;  2Q8O A;  1UZV A;  3LEM A;  1PGW 1;  2EAA A;  2VCA A;  5I0T A;  2ARC A;  2WUH A;  3O7O A;  4HON A;  5DZG A;  3BVC A;  4ISR A;  2SLI A;  1YFY A;  1A6C A;  5FYI A;  2R04 1;  4XQW A;  2WA3 A;  5KXE A;  3QCW A;  3BYW A;  3VBH A;  3ZR5 A;  4UFM A;  3ZXF A;  4CCN A;  3H8O A;  2JD9 A;  2VMD A;  3POF A;  4QPG A;  4XAE A;  3VBO B;  3S6P A;  4AWD A;  4M0H A;  5EJ1 B;  1A8D A;  4XFA A;  4MH0 E;  2HWB 2;  3RYR A;  3OSD A;  1LTE A;  4UXA A;  4CE8 A;  5BNP B;  2VR4 A;  4ZHN A;  3TWI A;  1AXK A;  1O5U A;  4P9X A;  3RYK A;  2HWC 2;  2IVI B;  2VW1 A;  2XWJ B;  1R09 3;  1C1F A;  3IKW A;  3L9J T;  2YHJ A;  5IK5 A;  1CAV A;  4LOR A;  5IHR A;  5KR7 A;  3IT8 A;  3I3M A;  1V9U 1;  3NKG A;  5CNA A;  4K1Z A;  4IND A;  2P17 A;  2JX9 A;  3OG2 A;  1NQD A;  4O65 A;  3VBR C;  4B4R A;  5HV4 A;  2ERF A;  4QKD A;  2WIN B;  1AR7 1;  1GZT A;  2W68 A;  1ZA7 A;  3BOW A;  4QM8 A;  2QBX A;  4R4X A;  1LJ7 A;  2CAV A;  2BP6 A;  2ZA9 A;  1FX5 A;  1POV 0;  1QJX 3;  2D3R A;  4H14 A;  4BXF A;  4Y4Y A;  2C0Z A;  2TUN A;  2PXJ A;  3X29 B;  1FT9 A;  1V6J A;  3NW4 A;  3I2G A;  5DUU A;  3WNM A;  3ZXK A;  4MGT A;  2EA7 A;  3EXU A;  4ISQ A;  1VBC 3;  1BLZ A;  4IEV A;  3POB A;  4M4P A;  2R07 3;  1QOS A;  2VTX A;  5FYH A;  3AL6 A;  4GH4 A;  4NN0 A;  5CG9 A;  1X8E A;  4CDW C;  5F3C A;  3HEI A;  1O3T A;  1SMV A;  4GQ7 A;  3KF3 A;  1RB8 G;  1S55 A;  4QPI C;  1VBA 2;  1LU2 A;  3U11 A;  1DGR A;  3VD3 A;  3ZDS A;  1OKQ A;  1OT5 A;  2MHF A;  2VCM A;  2Y6G A;  1UU6 A;  3V64 A;  3BAL A;  1W2N A;  4WM8 C;  4B4Q A;  4NVP A;  2GC2 A;  1Z7S 3;  2JIJ A;  2K2S A;  1PHM A;  4RFR B;  4YZ5 A;  1C8M 1;  1LGN A;  1NCR C;  3CIH A;  1HB3 A;  1YQ6 A;  3OPW A;  1DGL A;  2A6Z A;  4CP0 A;  5DAB A;  2P3K A;  3M3I A;  1H2K A;  4OI0 A;  4NAO A;  4IE6 A;  1RUE 1;  3MV1 1;  4TXW A;  1GWM A;  3VLB B;  3VHN A;  4MX3 A;  5IVJ A;  3JQX A;  3T4H B;  2QQL A;  3ILF A;  2OA2 A;  1FV3 A;  2RDN A;  4CDX B;  3VZN A;  3R4U A;  4AHZ A;  1AR6 3;  4M01 A;  4DRV A;  1JZ5 A;  2WYF A;  2BBV A;  1PVC 1;  3MF6 A;  1S2K A;  1EYB A;  3V0B B;  1S2E A;  3T09 A;  1QXJ A;  5IW0 A;  4XFH A;  3HVD A;  5JZG C;  3N36 A;  4W4Z A;  5LY2 A;  1MEC 3;  2BZD A;  3RPQ A;  1WZX A;  4BQ1 A;  1ZZ6 A;  3WCR A;  5G05 L;  4N53 C;  5T5J A;  4LR4 A;  3O1O A;  2W92 A;  1W8W A;  4EQV A;  3N7L A;  3P1I A;  1HB4 A;  1UF2 C;  4FQZ A;  2WWS A;  2ZEX A;  1C5H A;  3IPV A;  2Y0I A;  2ZGL A;  2XJQ A;  3AB0 A;  2Q4S A;  4CUB A;  1AL2 3;  1NUK A;  1XYN A;  3ZFE C;  1PO1 2;  1V6N A;  4E9K A;  3D0S A;  2NQY A;  2DF7 A;  3AFK A;  1V70 A;  5A6Z A;  4AQ2 A;  1V6I A;  1ASJ 1;  3LKJ A;  2E26 A;  1KDM A;  2W52 A;  4FXG B;  4AAP A;  4URA A;  2AC1 A;  2ZCW A;  2WWU A;  1OLR A;  1NLR A;  3SNM A;  1JZ4 A;  1QMJ A;  2P6H A;  3DXT A;  4YW1 A;  3VBF B;  4IE5 A;  1O3S A;  1COV 1;  4OMC A;  4YVW A;  1RGS A;  4AI9 A;  4D0Q A;  1P8J A;  2ZML A;  2ZGN A;  3ILN A;  3JD7 2;  5JXI A;  4J1W A;  4XCB A;  4D7T A;  4A6S A;  3AL5 A;  5TSW A;  5KWR A;  4Q4W 1;  5I93 A;  1R1A 2;  3S7E A;  4RR3 A;  1W04 A;  1F5J A;  2FDH A;  4L2N A;  3H1W A;  3I4I A;  2QNK A;  4DIQ A;  1K5M A;  3VHP A;  1RUF 3;  4TSV A;  4DXT A;  1NY7 2;  4UBH A;  3PTR B;  4Q4Y 3;  5JR2 A;  1LHN A;  3KMH A;  4MHR A;  2FDF A;  1VE0 A;  4XMA A;  3TRS B;  5LZ6 A;  5J96 B;  2RS1 1;  4ZZ5 A;  1AYN 1;  4H7M A;  4LO4 B;  1QJZ A;  4CEW A;  1WKY A;  1JYC A;  1KQR A;  1RMU 3;  4QQP A;  4ZY9 A;  3DEM A;  3F95 A;  4RL7 A;  3WNX A;  2CSG A;  2ZX1 A;  5AC9 3;  3GXU A;  4PJY A;  3AJZ A;  5A3O A;  3VD4 A;  5JSR A;  3AZX A;  2JDM A;  4K8R B;  2VZT A;  4OMD A;  2OQ7 A;  3ZKU A;  3CKH A;  5LK7 B;  3N9Q A;  3V0A A;  1GWK A;  2WNU B;  3M4F A;  4CCM A;  3TNQ A;  3TEX A;  4I0A A;  3I97 A;  4AG4 A;  2F4L A; 
#chains in the Genus database with same CATH homology
 3N9L A;  5FZB A;  3ZPO A;  5FY9 A;  4D6R A;  5F2S A;  5FYM A;  5FP7 A;  5IVB A;  3OPT A;  4GD4 A;  2GP3 A;  5A3N A;  5FXZ A;  2OQ6 A;  2XDV A;  4EYU A;  2WWJ A;  5ANQ A;  5FZF A;  5FZ7 A;  5FZK A;  5A7N A;  5FXW A;  3OPW A;  5FY0 A;  2OS2 A;  2YU1 A;  4CCK A;  4V2W A;  4Y4R A;  5F3E A;  2YPD A;  4GJY A;  5FV3 A;  5FZO A;  5FY7 A;  4QXH A;  5FYT A;  4DO0 A;  3U4S A;  5IVJ A;  5LW9 A;  3K3N A;  4NUB A;  4ASK A;  4GJZ A;  4IGQ A;  5FYC A;  5FZ8 A;  4BIS A;  4TN7 A;  3LD8 A;  5F3G A;  4QX7 A;  5FPL A;  5A7W B;  5IVC A;  2XXZ A;  5FZ9 A;  5FYZ A;  2Q8C A;  5F3I A;  5FP4 A;  5A7P A;  5FZC A;  5F5A A;  5FJK A;  5FY8 A;  5CEH A;  5IW0 A;  5FZ3 A;  5FPA A;  5LY2 A;  5IVY A;  3PU3 A;  5A7S A;  4E4H A;  3KVB A;  5FUN A;  5FPU A;  4XDP A;  3N9M A;  2YBS A;  3PUS A;  2Q8D A;  5F32 A;  3KV4 A;  5FZA A;  5FJH A;  5FZ6 A;  3AVR A;  2GP5 A;  4QXB A;  4QU1 A;  5E6H A;  4LIT A;  2W2I A;  2XUE A;  2VD7 A;  5F3C A;  5FZH A;  5IWF A;  5A7W A;  4CCL A;  4CCJ A;  4CCO A;  3U78 A;  5FYU A;  3K2O A;  5LWB A;  4QXC A;  5LY1 A;  4QWN A;  3N9O A;  5FZL A;  4AAP A;  4HON A;  4URA A;  5FXV A;  2YBK A;  5FZ1 A;  2WWU A;  5FYS A;  5A80 A;  5FP3 A;  2Q8E A;  4CSW A;  5FPV A;  5FYI A;  3ZLI A;  3DXT A;  3KV6 A;  4HOO A;  4GAZ A;  4LXL A;  4AI9 A;  5F5I A;  5K4L A;  4CCN A;  4EZ4 A;  3KV5 A;  4D6Q A;  4BU2 A;  4IGO A;  3KVA A;  5FZM A;  5FWJ A;  5A3W A;  3AL5 A;  5FZG A;  2YU2 A;  5FZI A;  5IVV A;  4EZH A;  5FZD A;  5FZ4 A;  4QX8 A;  5FP9 A;  3PUQ A;  5A7O A;  1VRB A;  3N9P A;  5FYB A;  5FY1 A;  4DIQ A;  5IVE A;  5F5C A;  2OT7 A;  2YBP A;  4C8D A;  4LIV A;  5A7Q A;  5FY5 A;  3PTR B;  5FZ0 A;  3K3O A;  5KR7 A;  4UF0 B;  5FPB A;  3PUA A;  3PDQ A;  5F2W A;  2P5B A;  3KV9 A;  3AVS A;  5FP8 A;  3N9N A;  5IVF A;  3DXU A;  3RVH A;  5FXX A;  4D6S A;  5FWE A;  5FY4 A;  5A1L A;  2OX0 A;  5A1F A;  5FYY A;  5F37 A;  4LIU A;  3NJY A;  3LDB A;  3PUR A;  4V2V A;  5ISL A;  4BXF A;  4Y3O A;  5F39 A;  2PXJ A;  3PU8 A;  4IGP A;  5FZE A;  4XDO A;  4CUG A;  4Y33 A;  2XML A;  5FZO B;  2OQ7 A;  5FUP A;  5FYV A;  3N9Q A;  4CCM A;  3UYJ A;  5A3T A;  5FYH A;  3AL6 A;  5FBJ A;  4UF0 A;  5A3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...