2OQ7A

The crystal structure of jmjd2a complexed with ni and n-oxalylglycine
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
346
structure length
346
Chain Sequence
b'NPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing histone demethylation protein 3A
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Crystal structures of histone demethylase JMJD2A reveal basis for substrate specificity.
pubmed doi rcsb
total genus 108
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2oq7A01
5A80A 4AI9A 2Q8CA 5FV3A 4IGOA 5LY1A 5A3NA 5FZOA 4GD4A 5FYIA 4QU1A 5F3IA 4CCMA 1VRBA 3LD8A 4GJYA 4EYUA 2XMLA 4QXHA 4D6SA 3PDQA 3K3OA 3NJYA 5FYUA 5A1FA 5IVJA 3PU3A 3OPWA 3N9PA 4QXCA 3ZLIA 4LIVA 4V2VA 4CCOA 3DXTA 5LW9A 5FBJA 2GP5A 4Y33A 4C8DA 5FWEA 5FXWA 2PXJA 5FUPA 4DIQA 3N9QA 5FXXA 2Q8EA 4D6QA 2OT7A 5LWBA 2W2IA 4E4HA 4BXFA 5FP3A 3PUAA 5FY5A 5IVBA 5A7OA 4QWNA 5FZIA 5FPAA 2YU2A 5F3EA 2GP3A 5A7QA 3K3NA 5ANQA 5FY0A 4HONA 4GAZA 3AVRA 5FZDA 3PTRB 2YBSA 5IW0A 3PUSA 5FZ7A 3UYJA 5FP8A 3LDBA 4CCJA 5FZ8A 4ASKA 5F2WA 4Y4RA 5A7PA 4XDPA 5FZ1A 5F37A 5FP9A 5FY9A 2WWUA 5FJKA 3U78A 3PURA 4IGQA 5FYTA 5FXZA 5A7WB 2Q8DA 2YPDA 4XDOA 5F3CA 5FZBA 2P5BA 5FZCA 5FZHA 3ZPOA 3KV4A 5A3TA 2XXZA 5FZGA 4UF0A 5FYVA 5FZ0A 3K2OA 5FYSA 5IVEA 5FYHA 5FZ3A 5FZEA 4EZHA 4CCLA 4BISA 4D6RA 5F32A 5FZFA 4AAPA 5A3WA 5FWJA 2XUEA 3OPTA 5FJHA 4DO0A 4LITA 3AL5A 4Y3OA 5FPVA 4IGPA 5E6HA 5IWFA 5LY2A 3RVHA 2VD7A 5FP4A 4LXLA 3N9LA 5IVVA 5FZKA 3DXUA 4HOOA 4CCKA 5FY4A 4BU2A 5FZMA 5IVCA 5FYMA 2YBKA 2OS2A 5FPUA 5FZ6A 5F5IA 5FXVA 5FY7A 3N9OA 5K4LA 3AL6A 5A7NA 3KVBA 5F2SA 4NUBA 5FZOB 4TN7A 3KV9A 5FZLA 4CUGA 5F39A 2XDVA 4CCNA 3N9MA 5A7SA 5A3PA 2OQ7A 4GJZA 5ISLA 3KVAA 5A7WA 5IVFA 2YU1A 3PUQA 4UF0B 2YBPA 3KV5A 5FZ9A 4QXBA 5F3GA 5FYCA 4V2WA 3AVSA 5FY1A 5FPLA 5FZ4A 4QX8A 5FUNA 5FPBA 4CSWA 4QX7A 5FP7A 5CEHA 5A1LA 4LIUA 3PU8A 5FZAA 5F5CA 2OX0A 5FYBA 5FYYA 2WWJA 4EZ4A 3KV6A 5IVYA 3N9NA 5FYZA 5KR7A 5FY8A 2OQ6A 4URAA 3U4SA 5F5AA
chains in the Genus database with same CATH superfamily
2XJVA 5KHGA 4TZDA 2BOJA 4HG6B 3KQRA 4Z2WA 1YQ8A 1UOFA 2RJLA 4D7TA 5HI0A 2J42A 1XYOA 1QQP1 1IKPA 3AYEA 4CCMA 1D0GA 1YHFA 4GJYA 1O5LA 4RQPC 5AVAA 4YZ2A 4MXVA 4P9JA 4UFIA 3W21A 1OKOA 2QBXA 1CAXB 2YC2A 4HVRA 3P1IA 4QB1A 2LS6A 2AC1A 3BODA 1SLTA 4AE2A 1HW5A 4IV1B 1RUNA 1OOPB 5KHIA 1UU4A 1FI2A 3ZSLA 2YG0A 4UFKA 2XWJB 2DYCA 2ZMLA 1F4AA 3FBMA 4PIYA 4M3CB 2VVDA 1F31A 4YZ1A 3VDDA 1COV3 4XFBA 2WO7A 1OUXA 3K3NA 2NPIA 2BRTA 1GNZA 4GAZA 3VBRA 2BJSA 1JZ2A 1J3PA 2O1QA 3JCIA 1LOAA 5T5OA 1AYN1 1ZRRA 2UWBA 3VBFC 1QJFA 3OJBA 2RG4A 4GH4A 1YI9A 2WKKA 1OLQA 5EZWA 2W1UA 4RSUA 1SFPA 2MEV3 1OH3A 4XJZA 4YW5A 1DP0A 2HKXA 4S2HA 4BK5A 1US2A 3LFIA 2Z42A 2BGOA 1GLHA 4Y1UA 4FPLA 1WKYA 1ND2B 1PO13 4QM9A 2AH2A 1C1LA 4RHV3 3U10A 3CKHA 3AMQA 3LPGA 4UF0A 3D4KA 3SH3A 3ZXKA 5CG8A 2PELA 3M1HA 5JMOA 1OLMA 3IPVA 5J3UA 2EVXA 3GXUA 3ZYBA 1IPSA 2C9AA 2DTWA 4CCLA 4BB3A 4RR3A 3ZIXA 1OVSA 4NIDA 3BOWA 2B9VA 3BN6A 1MPXA 5CVRA 4G9SB 3SLIA 5E16A 2IFWA 4B4RA 5LA2A 4LXLA 1P8JA 4LO5B 1WBLA 2ZHLA 4XUTA 1ND3C 4IV3B 3SISA 4DEVA 4OI0A 5BNPB 5FYMA 4CDXB 4FQZA 2I2SA 3K77A 3WQ1A 3VZJA 1ZX5A 2RR12 3OGVA 4NUBA 5DDJ3 3U1XA 5C5TA 1UZ0A 1W8NA 2JKXA 2XBO3 1IGOA 4ZKTB 2BBVA 4YARA 3ZVXA 2WQ8A 2GC2A 4YGBA 3I2OA 5IJRA 1UMHA 5JMCA 1RUD1 2UWCA 5K0UA 3NKGA 3BTAA 2DWRA 2WT2A 2YFZA 1STMA 3KF3A 3PMSA 4MGKE 1DZQA 3CHXA 1AJOA 2OPKA 3D5OA 1B35B 2VPVA 5C3PA 3ZR6A 4IXLA 4IV1A 4Z92B 4AHZA 3IN9A 2BW8A 3BVCA 4JDOA 3CIHA 4XDQA 1LHOA 5E89A 4P5YA 4Y5SA 2WWJA 1F8VA 2VO5A 4H14A 4IE4A 3EBRA 2VBPA 2VY0A 5CFCC 1C8M2 2RS52 4IEPA 2WN3A 4KGGA 5A6YA 1RHI3 3R4UA 2L9LA 4NJ4A 1DLCA 2XVLA 4JKLA 4HPKB 1JBCA 4KWJA 1WCQA 1LRHA 3O14A 3RWKX 4C0BA 4XUNA 4R4ZA 1W9SA 2WO2A 3PVEA 4P9XA 5A3NA 4KWLA 1ZBE2 1PO11 2A6ZA 1C8NA 1ODNA 2FD8A 4HLTA 3GCWA 4LHLA 4CDXA 1UPSA 2XOMA 3GZEA 2HWE1 2LALA 1HRI1 5ERLA 2G19A 1PGL1 4JGZA 1ZZ8A 3PDQA 5HCFA 3HQRA 2F4PA 4I0BA 4XXPA 1VBA1 2Q5TA 4I0AA 4KMQA 5GLUA 1W9YA 3O1MA 2FCVA 3M3IA 1Q3EA 2XJPA 2ET1A 3IDEA 4O9GA 4OHWA 3TNPB 2ILMA 4GH4B 4Y33A 5FXWA 1XU1A 4CU6A 5FQ0A 2EIBA 5IK4A 1GWKA 1YFYA 1RUH2 2DVDA 3IPVB 4JHTA 3WDYA 1JYTA 1PMJX 5C8CA 1NKGA 3ACFA 2A6YA 2EAAA 5FY5A 4EN9B 1W04A 1X8EA 2WNVA 1LNSA 3B69A 4GQ7A 5IAVA 4KI5M 5D2AA 1VP6A 4MSVA 4W6WA 4ASLA 2DVAA 5CAZA 5FY0A 2FZ2A 3H1MA 3TN92 2PLV3 4MYEA 4NAOA 1OH4A 5FP8A 2UU8A 5D8AB 4ASKA 4CCJA 4DPNA 1TME1 2HYKA 2ZZQA 4XF9A 5F37A 1XOYA 1W9WA 3ORJA 4XOGA 4QPGC 2Y8KA 2ZBJA 3ILNA 4YM1A 4HK9A 4QMAA 2P34A 4PBOA 1W03A 3PHMA 3H8XA 2C4XA 2GNTA 4Y1VA 5L7OA 5DABA 2BU9A 5A3UA 1HJGA 5FZCA 3W58A 1BLZA 1NCQB 2E33A 1KEXA 1QH6A 3HNYM 3ENRA 4LMFA 2R7EB 5FYHA 5I8TA 2YROA 1YUDA 3DYPA 4YFZA 5DN2A 1DQ6A 4BISA 5JZGC 1UOJA 3KGLA 4AGGA 4GALA 1R1A3 4M0HA 3G7DA 1NQJA 4AEDC 5JXGA 5HXVA 3AMMA 5C3OA 1E5SA 4D3WA 3RZMA 2I45A 5C7GA 1KDKA 4YVWB 4CEYA 3FWEA 4ZHNA 2P4EA 1LJ7A 2BGCA 2OS2A 2Y6KA 5T55A 4WM7B 1OXCA 2VXRA 2WNVB 4XILA 1QH7A 1PO21 4JQRA 1XE8A 2FCTA 2RDQA 1PVXA 3DPRB 3KSCA 1ULEA 5EJ3A 1UYPA 4DXTA 2NQYA 2RE9A 5IVFA 5LCWL 4K1ZA 4K3UA 3BTXA 4CEWA 5H9RA 2WFPA 2ZX2A 3WZ1A 1X82A 2R30A 4QXBA 1NY71 3QLQA 3T30A 3I3QA 5FPLA 1L7RA 4PBPA 4B3NA 4CU9A 2Y6HA 4QHBA 1CJDA 1O8SA 4DMIA 3NJVA 1XXNA 4QX7A 3MLLA 3UT0A 4LTAA 2JX9A 4YVSA 2K2SA 2G9FA 5FZAA 5FYBA 1UZWA 1J83A 1H4HA 2V5DA 4COWA 4AEJA 2G4IA 2BUKA 1AL23 4MO3M 4TLGA 4BYYA 1PM4A 3MI8A 4NR1A 5T5PA 4CTEA 1W6QB 1U0AA 3H3UA 1G9CA 2WFF2 3M4FA 4EQVA 5AC92 3U4XA 4DNYA 4PF1A 3M3OA 3VKFC 1JHJA 2ZEYA 4NPLA 5DAWA 4I0WB 3UNPA 1QDCA 1R081 3PIJA 4CUAA 5FIXA 2Y33A 2ZA9A 4N43C 1D0HA 2RR11 1TVGA 1AX2A 1PGSA 2QDNA 2ZGLA 2AREA 3K3OA 1J1LA 2ZAHA 1W6NA 4LJHA 3N9PA 4NPRA 1O6UA 5BNOB 2VH9A 1BK1A 3MEPA 2BEOA 4IUGA 4W8JA 1WWYA 2QE3A 3MLJA 2PXJA 1F9KA 2Z2SB 3CQOA 1Y3TA 4RS5C 1XNTA 4K8FA 4YWAA 2B46X 4CEWB 1OLRA 1R1ZA 3T08A 5LWBA 1YI7A 5DUWA 2Q4SA 4FPCA 4FAGA 1M4WA 2RS33 5FZIA 4NMIA 1MACA 1PGW2 1PVC3 3FC0A 4OFGA 4R9DA 4Z1VA 3WF3A 5LEJA 1V6LA 3H9AA 3ZFGB 3IWZA 5F2WA 1RJ7A 4Q26A 4YW7A 5J09A 1PO12 3U78A 1WMDA 1ZBE3 5AC91 3NNJA 1H8TC 1QY4A 4CDQC 4FTEA 3RRDA 5JDBA 1VMFA 3EHKA 5CU1A 3T4HB 5FYSA 1RUI3 3B01A 4XW3A 2DCKA 2ZABA 5FPZA 4EN7B 4PDWC 3MIGA 3NVCA 5F32A 5ACA3 3FMGA 4Y22A 5JVVA 3LA7A 2B39A 3VKLA 1ZZCA 3AL5A 4EWDA 3ZXAC 2F6BA 2WSUA 4BHPA 5DQ0A 3ATGA 3FJSA 3H8RA 2G9GA 3NV1A 2EXIA 2KM2A 3POYA 4QQLA 5H9QA 5IVCA 2W0XA 1B35A 5HCHA 3LGRA 3ZFFC 5FZ6A 2R073 4IW3A 4CRQA 3ZO0B 4LLOA 1W0NA 5JAXA 4AYUA 1CAVA 3E97A 2B42B 5IHRA 2Y0OA 3WG3A 4CCNA 1F15A 1TME2 3E1F1 1XNKA 1YCIA 3KVAA 3KT4A 3RFRA 5FTTC 2JDYA 4XJ9A 3LA3A 1RIRA 4NIAA 1X9PA 5FZ9A 5FR3A 1ZA7A 3HNMA 3AKSA 5BXXA 1CAXA 3MO4A 4LHKA 3URFA 2ZGKA 4OHVA 2PAEA 1VIWB 4I30A 5LA1A 4HZFA 1G9BA 4LBNA 1C1FA 4CEWC 4O9EA 3AYCA 4ZU5A 1CN1A 4OHYA 3WHUA 5ABJC 1WLWA 3ETPA 3I54A 1CQ9A 3N7JA 3PU8A 3AXEA 1VB4A 4LBLA 1T6BX 4XE9A 4Y26A 1RJ8A 2OX0A 2VC9A 3C2UA 4KGQA 2PTMA 4ES8A 1JZ8A 3OUIA 1DGWA 3MIDA 5C8CB 3FHIB 4L97A 3J8F3 5FOJB 3WV6A 3R0RA 2A6VA 4SBVA 4MOAA 4DINB 4EE2A 5J48A 2JDUA 3T0AA 1JOBA 3E6DA 3WF1A 2FDFA 1QOTA 1ENXA 2E53A 2RMU3 5EIYB 4RGKA 1I6XA 3LZZA 3OY8A 2QQUA 3PMEA 3PVOA 3F2ZA 5FZOA 5IYYA 1GNHA 4LUMA 2CAUA 3DPRA 3CJIC 3OBTA 4JC1A 4UFLA 4XUPA 1XU2A 3VL8A 2WZR3 3SXWA 3DL3A 3IM0A 2NM1A 3NJYA 1RUE3 5GJ6A 2WNOA 1QHDA 1IS3A 4F7ZA 4MGZE 3VBUB 2P3KA 1Y9MA 3O0XA 1URXA 2PHWA 4N53C 4C8DA 4AI3A 1TNRA 5FUPA 1DFQA 1RUH3 1ZZ7A 1RYYA 4GMP3 1HXS1 2FDIA 3I8TA 1W8TA 4Q1PA 1GBGA 1CWPA 1KQRA 2ZHKA 4BXFA 2D6NA 2OUHA 2WBKA 2P37A 3I3MA 4L11A 1ENSA 1NCQA 5C4WC 2V5YA 1YC61 3IAQA 1TG7A 3RYPA 2A3YA 3PTRB 2RS13 1JU4A 2VZOA 3LA2A 4Q2FA 4YG6A 3UESA 3RZLA 3ZDSA 1UZVA 1AR62 1UYYA 3DPRC 3MHZA 2MHFA 1NCRB 1POV3 4QPIC 4HVQA 1C8M3 4TYSA 2AUYA 3UJQA 5C70A 3MFAA 1LEMA 3T09A 2WA4A 1WMFA 4L92A 4LBMA 2D98A 4RYDA 5CZKA 3JB8A 1PIV3 1J1TA 1GOFA 2EALA 4BQ4A 4BCUA 2WDBA 5A3TA 2QFEA 5M0TA 2HWC3 3O1OA 3VN4A 1W8WA 1COV1 1XYPA 1JZ6A 3GZTB 2FDKA 2IVJA 3IBMA 5GZGA 4W65A 1W6PA 4A6OA 4KNCA 1AZDA 3HBKA 4QPWA 4EZHA 1W06A 4D6RA 2OIIA 2GMMA 2DF7A 3J9SA 3MV01 4AAPA 3WUDA 1ULGA 1QWRA 1YIFA 5LY2A 3AZYA 1HRV1 1TZOA 1D4M3 2WIIB 1XE0A 2WQZC 1GMMA 3T0BA 4QX1A 1NUKA 1TQ5A 1Z7S3 2F17A 5FZMA 5DPNA 3A0KA 5AFBA 4A4AA 1MS5A 1RUJ2 3NAPA 1UD1A 3CLPA 1XNCA 3WNXA 2VMGA 1FNYA 2E7TA 3CEWA 4Q4Y3 2LUWA 4Y24A 4GZ9A 1ND2A 2IXKA 4AQSA 2EA7A 4LEJA 5IK5A 3ZFFA 3OEAA 4LO6B 2A75A 4DRRA 4MHRA 2TUNA 4WM8C 5F3GA 3CU7A 2V72A 4OUSA 2ZZJA 1TMF3 5C5UA 2BERA 1EY2A 4P00B 4Q4W2 3V0AB 1NYWA 2R0FA 1O4TA 1AUYA 3HQXA 3N9NA 5FWJA 5AC93 5C3SA 1HRI2 1VR3A 1OFNA 3RG0A 1DGLA 3MIHA 4AI8A 3KGZA 4QDRA 2UYAA 1VBA2 1LECA 1LCLA 5IK8A 4GD4A 4UW3A 2VMEA 3WINE 4S2GA 2WAOA 3KB5A 2WZPP 1RXFA 1E5IA 5KWRA 5JWPA 4OMDA 5AVPA 5KHJA 2NZ9A 1SACA 1JUIA 1SQ4A 2LRPA 3BU7A 3K4AA 3MDPA 4XJAA 1AX0A 2IFRA 4FOVA 1GZTA 2D6OX 4A7KA 5CBLA 2D97A 5JOXA 4YGCA 4M0NA 2V4AA 4FQ4A 2YYOA 1RINA 1V6OA 5LW9A 4ISRA 4WVWA 3BI3A 1AHSA 1EUTA 1NE4A 4XIOA 1AR71 5ACA1 2X05A 2YHJA 5I0TA 4RS5A 3IDAA 4B7EA 3GDBA 1BQPA 4W6XA 1ULPA 2GSYA 1PMHX 2ZCWA 3OD0A 3S57A 1GYKA 5F3EA 3RPQA 5FMBA 2WRAA 5IUQA 1YWKA 3OF1A 5EYXA 3BKZA 5JSOA 3WD5A 2MNGA 3DUIA 1TEIA 3AVRA 1KD7A 4XF0A 2VJXA 5FZ7A 3UYJA 2DVBA 3S7IA 3KQ4B 4N43A 1O3TA 4AI1A 3I3EA 4NE9A 5C9AB 2ET7A 4XQWA 2Y0IA 4JRLA 3IDBB 2PQQA 1OKQA 1NA1A 4E2GA 5LBFA 4Q29A 2CWSA 3B9IA 4XQ4A 4NAMA 4RQPB 3O1PA 2VTFA 3GYDA 5LATA 1Q5OA 5F3CA 1K3IA 2JG8C 4Q0SA 1WD3A 2VTXA 4Q4W3 3RNSA 4XFGA 4XJ8A 5C6CA 4S2FA 3SMHA 4ARXA 2JDAA 1QXPA 3O0WA 4XXAA 2BFUS 4Y1YA 3AKPA 4Q4X1 3OYWA 5CADA 3OPTA 2WAAA 2OUJA 3ZFFB 2Y26A 3CZJA 1IG3A 3POIA 2W92A 1HXS2 1OSGA 1OVPA 4CXWA 4J6GA 4Z2AA 2A1XA 1I9RA 2VL4A 4FT8A 4HOOA 2PHLA 3FUOA 3AZZA 3MF9A 4L0PA 4EN6B 1Q43A 4N7UA 2ZGOA 3HJRA 5FPUA 4WZFA 1SMVA 2HWD2 1ASJ2 1OC1A 2HWF1 2BOIA 5A33B 5J37A 4A7YA 3AJYA 4TN7A 5FZOB 3VBFB 1CIYA 2P6HA 5BNNC 4CUGA 1OMIA 3CZUA 3N9MA 3SEPA 1NZCA 1LHVA 4XF1A 2YU1A 4INDA 5A32B 2CSGA 1UNBA 3DN7A 4GWJA 4NHYA 1BMV2 2DTYA 2OYZA 3F95A 1HIXA 2NN8A 4I02A 1QJU3 5FY1A 3WLUA 1WD4A 5EYYA 1OQ1A 3MW3A 1O4YA 1JZ5A 4GKYA 5GZDA 3B93A 1JYCA 1V0AA 1GP5A 3VKNA 1UIKA 2FBEA 3VBOB 3VZOA 5A1LA 3O1RA 4BE3A 3VD3A 3BPZA 3WDTA 1Q8SA 4YZ5A 4BQXA 2JDKA 3ZFGA 2FHRA 1UMIA 3I3DA 3VDCA 2A5ZA 5CYYA 2E26A 4KBZA 4AVCA 1HRV2 3CJXA 4ZS2A 4NHXA 1VAKA 2OXBA 4O61A 5L7OC 1O3QA 3ZXEA 2MEV2 2WYFA 1SCRA 2OPWA 3B5LB 2Q8CA 5JI7A 1CAVB 4JX0A 4Q0UA 5EV7A 4YPJA 4J25A 4LORA 1EV12 5A6QA 3LFMA 5BNNB 2W9XA 5FPXA 3RZGA 1ZRFA 4I3PA 1O5UA 4PDWA 2RDSA 1RUF3 2OW4A 1ASJ1 3LIHA 1VBC1 3OCPA 1MZ6A 2ARCA 1YJLA 1F35A 2C0ZA 2R063 3DECA 2KR2A 1PGW1 3P5BA 1VE0A 3ZYFA 3HT2A 3N9QA 5C33A 3MFCA 3JD72 1XB9A 2XJTA 2ZTNA 3GZAA 3GHNA 2HEWF 3V0BB 1FYUA 2AYHA 2ZEZA 2E31A 4MGYE 1SCSA 4AK3A 1WA4A 3CO2A 1UU6A 3OTFA 1ASJ3 4RR3C 1RB8G 2JE8A 5LZ6A 1JH5A 3VBRC 3Q8EA 2VCCA 5ANQA 4UWDA 4QX2A 2RR13 5DDJ2 4K1YA 2YBSA 3AC0A 2QQMA 1G86A 1RUG3 3PUSA 4RL7A 3WP4A 1RC6A 2DVFA 5I0SA 3I2KA 4IERA 5A7PA 3THTA 2GZWA 2DVGA 5FZ1A 1GU3A 3M3EA 3JBG1 3ZPYA 3L2YA 5FP9A 2JIGA 2IWGB 3NO8A 2BQPA 4LBJA 5FYTA 1XPWA 2HEYF 1QU0A 5LBCA 2RMU2 1BZWA 2P5BA 4A45A 5CFDC 1DBNA 4CP0A 1G8WA 4BIOA 5I0UA 2A3WA 3JUUA 1OD5A 4IQPA 1HX6A 2RDRA 2BVVA 4QX3A 1EUUA 2G1MA 3N35A 4I3GA 1JYIA 1ZRCA 1BBT1 2QQNA 2DFCA 4LKDA 1A8DA 1ZYBA 4TXWA 4XAEA 3VD9A 4HXCA 3DYOA 1D2QA 1DZTA 1RL3A 2XLGA 4CDWA 2GNMA 1AR72 1J58A 2R0HA 2P3YA 3AP9A 5CFCB 1R083 2JEMA 3SITA 1NOVA 2PAMA 3VBHA 3ZSJA 4XUOA 1O3SA 4NHLA 3FLTA 2CGNA 4DUXA 2VW0A 3IMMA 4E4ZA 1S4CA 4Z07A 1KFUL 3JB4C 1K12A 1EP0A 1FV2A 2WT0A 1FOD1 1C3HA 1NX9A 4GWMA 3R4DB 4HK8A 4LQRA 1VPHA 1UF2C 3BOPA 4DUVA 1N1TA 4RQPA 1O59A 4Y1XA 2ORXA 1D4VB 3AMHA 2EAKA 4NRQA 1NLRA 3WY6A 2JDHA 2H6CA 2VZ1A 3RJ2X 3UETA 3JBG2 1EAH2 5CFDB 2A7AA 2N7GA 5JIAA 2RVAA 3KHCA 1WBFA 2RDNA 2WZR1 1REDA 3PJYA 4YZ4A 2Q1FA 5FP7A 4UW6A 3GJBA 4YRDA 1HN1A 1RUD2 4MVTA 3FFQA 1RUG2 3MZHA 2PLV2 2VNRA 2BWAA 4XJWA 1JZ4A 5A70A 3I7DA 1J84A 1PO23 4IEWA 5A80A 4ONUA 1OUSA 1A3KA 1HQLA 1AR63 2R49A 2W08A 4XCBA 1PZ9A 4XBNA 2P1BA 4Y20B 2VU9A 5EJZB 2D3SA 3VZKA 3E6BA 5F1RA 2VZSA 1GNYA 3RMXA 3WW3A 4JCKA 1V9U3 1U12A 1JOJA 2VZPA 3FLRA 4XPVA 3PU3A 5LRSA 3BIEA 3EQEA 3OGRA 1U5XA 1KJLA 4V2VA 1BMV1 1F2NA 1KDMA 4DXRA 2VXJA 4UW5A 2Z79A 4A42A 1QJY1 3LB9A 1UY3A 1W6OA 3K46A 5FFOC 1XYNA 4OHZA 1H1IA 3NV4A 4H7LA 5L9VA 3PUAA 4AEDB 1SLLA 1ZBA3 2Q30A 3A0NA 1SEFA 2RJKA 3GJAA 5A7OA 4CCCA 5A1AA 5F6KA 1JXNA 4F83A 4MHUA 4IV3C 2YB7A 4FO9A 3RWNA 3I2JA 4NOTA 1RUJ3 2GALA 4P9IA 2EXKA 4YLZA 4KL1A 1DQ4A 1U5YA 3ALQA 4C1WA 1FMD1 4XC9A 3W20A 5A33A 3KLSA 2A6XA 5I8YA 2XHNA 4UYBA 4AVVA 2ZX0A 1GQHA 1JS9A 4N43B 1VBD2 4MZUA 5CKQA 4E8DA 2WABA 4QDSA 3W59A 1W0OA 2PFWA 2QNKA 2E32A 3T3YA 4CYDA 3N4MA 5FZ0A 1Q8QA 1S2EA 1V6IA 2OKXA 3TEXA 2VUJA 5IVEA 1UX7A 2R16A 3FZ3A 1GKBA 5FZ3A 4CP2A 2UWAA 4COUA 4RS5B 3D3AA 4C1XA 3VDDC 2PN5A 4RGAA 3OB8A 4M4PA 2QVSB 3ZM8A 1DQ5A 3RVHA 4ASMB 5KBFA 3RZZA 1WW7A 3RI9A 2LROA 3OBZA 3WP5A 2NLRA 1PK6B 2ADDA 4XHBA 5FY4A 4DY3A 3VUOA 1MS1A 3ZN4A 1QQP2 1VMHA 3M70A 3O1SA 4Q4Y1 4QKNA 5FY7A 2HWB3 2FDHA 1H6XA 4K21A 1TNFA 2H0VA 1XNAA 4YVSC 5K7PA 5E1RA 1AL21 5ABJA 1DZRA 5CKMA 2RM22 4JVAA 2IXHA 1HXS3 3PUQA 1MS4A 3POGA 4UF0B 1NXMA 1UZZA 1VAMA 5FCCA 3KV5A 1QJX1 2W68A 1KS5A 2GH2A 4N53B 5EP9A 4XF4A 1UX6A 1SLBA 1AR81 1CAWB 3B9CA 3OOXA 4RFT0 5LK5A 4AXOA 4EROA 4OI4A 5FUNA 5TSWA 3AM2A 5L7OB 3UKNA 2VAUA 3WSOA 4GA9A 3HMYA 4Q8LA 3AX4A 1OURA 1Z0HA 4FXGB 1WCDJ 2ZAAA 1OF4A 4ZS3A 5FK7A 5FO9B 3EJKA 4RHV1 4QB6A 3AK0A 4QXKA 3WHTA 1D2SA 1S55A 5KR7A 2VCMA 3CJIB 3ASIA 4YW4A 1YO8A 4YM0A 5SV5A 3VLBB 4G3YC 1DYOA 3N7LA 4D94A 1VALA 3LIGA 3QCWA 3ITQA 1PHMA 2P3JA 5IFPA 3BTZA 1QJZA 1DYPA 5LY1A 2JB4A 2ORZA 1R092 1ZZBA 1GWMA 2JECA 4AFAA 3L9JT 3ZXJA 3IIIA 3C7EA 3WNOA 1LGNA 2XL9A 3RS6A 1EYBA 3WW2A 3IT8A 2XMLA 2VMHA 2VNOA 2BNNA 2PHXA 3KZ4C 1IOAA 1VLNA 1G9DA 3AXDA 4OUEA 5F8PA 1RUC1 2R061 1H8TA 4N90A 5FMCA 1LHWA 1ULCA 2GP5A 2PHDA 1OA3A 1OPOA 3NJXA 3MUY1 5FBJA 5FWEA 5DZFA 2Y6GA 5GLTA 4DIQA 1MQTA 2GNBA 2BVBA 1S0EA 3JBG3 3BGAA 3PIGA 4K20A 2WS92 2XG3A 4COYA 2OA2A 1H2NA 5A3OA 3UKVA 2VTXJ 4RGGA 1FMD3 3VBOC 2D3PA 3ZMNA 1MS9A 3D82A 5LB6A 3ZSMA 2ZKNA 3FHAA 4HN0A 4DQAA 1HQNA 1ND3B 1H1MA 1SZBA 5K9YA 4D0QA 4BIFA 1J59A 4XMAA 1QNWA 1RMU1 2BGPA 2A73B 1G7YA 1H8TB 1WGPA 1WW4A 2PQSA 4XTMA 3W5NA 1LB2A 1UXXX 4K7JA 1S0DA 2Q1ZB 3ZXDA 2WNUC 1X33A 4PIZA 2TNFA 2ZMNA 5LRRA 4JGZB 1HB3A 4XF3A 4LPLA 1AYM1 3AFGA 1QDOA 4CA9A 2AGSA 1MZEA 1RUI1 2Q8DA 4UBGA 3S6PA 4AGRA 4PI2A 3S7EA 3VDDB 2B4KA 3INAA 2PHTA 4Q0VA 5LEKA 1PIV2 3VBSC 3HNBM 3ZYIB 1VBD1 2JDNA 2W47A 1BKZA 2QKDA 3NV2A 1W0PA 2V73A 3T1MA 3ZXLA 5H9PA 1G9AA 1VJ2A 2JDPA 4X6QB 4WVMA 1T2XA 1W2UA 5FJHA 3NSTA 3ZSEA 1NCRA 4JDNA 4IGPA 3RMYA 1KGYA 2VD7A 5A3LA 4P14A 2BP6A 4PIXA 5FO7B 4CCKA 1YYNA 2VOTA 1DGRN 2C5DA 3B94A 5EWSA 3VL9A 1IS5A 5A3MA 4GMP1 2C1FA 3T0DA 2WC2A 5KXBA 1Y7BA 3AL6A 4I01A 4FPFA 2O14A 2CU5A 4A41A 4CU8A 3WNNA 4BPZA 5JI9A 3VHRA 5FLIA 2SBAA 2YGLA 4XQDA 5HCBA 4Y22B 5JUVA 3BCWA 4Q4Y2 1W3XA 2ES3A 2CTVA 1I1EA 2J22A 1SG3A 2JXAA 4XEZA 4CP9B 2YBPA 1RVF2 2IXJA 3DYMA 4LHSA 3DGTA 3WDXA 3WP3A 1W8OA 1VMJA 5BNPA 1GSLA 1RTVA 2VM9A 3TEWA 1FV3A 4FPGA 3QH6A 1LENA 1UKRA 1RUD3 2FQPA 1C8M1 1UU5A 3OGJA 5FRAA 1IQDC 2WLPA 3SC7X 3VZNA 2DUPA 5KHKA 1W8HA 5I93A 2IXIA 4LT5A 3KV6A 3NQHA 3FHQA 3POEA 1IPKA 3PJQA 5IVYA 5HPOA 2DURA 2BZDA 2XHKA 2XLAA 3VBHC 4AHXA 1PK6C 1M06G 2XJUA 1CAUA 1J3QA 3ACIA 5FV3A 1FPN2 2CNAA 4C91A 5FMDA 2XB6C 1Q8VA 3H3ZA 4LHNA 5DZEA 2Q0AA 4M3CA 3OG2A 4LKEA 1K5JA 3C8XA 3ZYGA 4JV4A 2RJ2A 4PLOA 1YEWA 2YZ4A 1JYXA 1IQAA 2BWCA 1O7FA 1UMZA 4XACA 1VAVA 3ES4A 4KQ7A 4CVUA 4FPKA 1AVBA 3M3CA 4MGQA 4W6YA 3KT7A 1IS4A 3AYDA 2R071 5JR2A 5KC6A 1LOFA 2VZTA 3ES1A 4FP3A 5CKNA 3LWCA 4OI2A 1Z7S2 3TN91 3NKTA 2RV9A 4YZ3A 3WNPA 1Y9GA 2WYSA 2FDGA 3J7NA 5IVBA 5D21A 1V00A 3AKRA 4EV0A 3TNQA 3U37A 4P9WA 4E2QA 3W9AA 1W6OB 1CR7A 1K42A 4JKMA 2YY1A 2HBUA 3AZXA 3I2GA 5FZDA 4JTOA 2XJSA 3PTYA 1GFF2 2R041 4A2UA 2FMYA 1CX1A 4M3CE 2YFUA 1AL0G 4ZY9A 3M3QA 1ZREA 2K9ZA 1LOFC 1GP6A 1G6NA 1LGCA 1JODA 5FY9A 3J7HA 3Q8FA 1RMU3 3T1LA 5D8AC 3I2FA 3HQUA 3LF7A 5JZGB 2DFBA 1DHKB 4TTGA 4FAHA 1AR61 2C24A 5DAPA 2ZKLA 2P2KA 3WF4A 4JGZC 4NO4A 2V09A 1GZWB 3L2HA 5T50A 3NNFA 1OOPC 1JYWA 1RUC2 3ILFA 2AZ5A 1EPZA 2K46A 2QQOA 3B02A 3UL2A 5C9AA 5GKAC 1BHGA 1PX3A 5IAXA 3N3HA 1VBE3 4M4RA 3B7MA 1LU2A 2E9QA 3Q9OA 5FPVA 2XJQA 1FOD2 5IWFA 5C8CC 1MR5A 2P6CA 5IVVA 4AFMA 1QQP3 3USSA 5I0DA 3A22A 4Q8KA 4MGIE 5K4LA 4BQ2A 4OQ9A 3RQ0A 2DV9A 2KD7A 4XETA 1E5RA 1GR3A 1GZWA 1CPNA 2VBDA 5A7SA 4FBFA 5B4NA 2YGMA 4CDXC 4B8EA 3O12A 3ELNA 4JQTA 4YFWA 2ZGPA 1CESA 2FZ1A 2TBVA 2NMNA 4CDQB 2X5IC 1RHI2 1VBA3 1PZ8A 1UL9A 1W6NB 4Y5Z0 4WM8A 3WG2A 4X8NA 5IATA 2VZVA 2VOKA 2BNMA 2ZGMA 1V6JA 1SLIA 2VBBA 1ZZ6A 3ZXGA 3VHNA 4E2SA 2VE1A 5JPMB 4JZRA 4BQWA 3HBZA 5FYYA 3SCFA 2XVGA 1CJPA 1X8MA 2WO1A 2XKPA 3CF6E 4JDMA 5EQUA 2WL1A 3V56A 3T2QA 2Q1MA 1JOPA 4XFCA 4BLIA 1OLME 2VMFA 2XJRA 1VBB3 1HRV3 3MIFA 3NMBA 2QUOA 3RSJA 3SQOA 3WDWA 2R6QA 1WMXA 4IGOA 1W90A 3WQ0A 4E8CA 2E7AA 1DF0A 4TSVA 5C8WA 2XKOA 4QU1A 1QEXA 1ZBA1 2HEVF 5CIRA 3WDUA 1VRBA 1VBD3 3VV1A 1FPN1 1WLTA 4LK7A 3HN3A 1NG0A 4GXLA 3O0VA 4EYUA 2D3RA 3H42B 1DQ1A 3NRUA 2XONA 4MV2A 4META 4NWVA 1AR92 4MH0E 2VZ3A 1U5ZA 2JG8A 1O4ZA 1DIWA 1US3A 1WCSA 3BYWA 4CCOA 4GB32 1HKDA 2CY6A 3S5AA 1Q8PA 3TB0A 5JOZA 4HPKA 2DU1A 1ND3A 1NA1C 2ZOEB 3SCGA 3T2PA 1FMD2 1IG0A 4YM2A 1W9TA 4UBHA 2W2IA 1Q8OA 1UPIA 4R9AA 2EICA 2WZ8A 1AYN3 4DEQA 1IHMA 1XJAA 2WR9A 1MEC1 4QWNA 4QT6A 2W46A 4N8MA 5ANNA 1MQTB 1W2NA 5EHDA 1A34A 3Q8AA 2D6MA 3H8OA 5ACA2 3CNAA 2CDPA 3VD4A 5FZ8A 1LR5A 2BV4A 3NJZA 1NY72 1WW5A 3WP6A 4EN8B 2W3JA 1J3RA 1S1AA 2OVUA 3QACA 3VBRB 1FPN3 3R4SA 4QGMA 4XFHA 4LBKA 2UY9A 3PURA 4IGQA 4JTNA 3WVJA 5HCAA 4UOJA 3PVBB 4N9HA 1JZ3A 1RUE1 2HWC1 4Q4V2 3ZPOA 3RZHA 2YMZA 5FZGA 1R093 1CIWA 4MADA 3WOGA 4NWWA 5BNQA 1TME3 5BUVA 3LEIA 1OFSA 1ENQA 1RITA 2C9KA 4IV1C 5FZEA 2GN3A 1CGPA 4BJ0A 5DG1A 1GWLA 3J8F2 3FN9A 4I09A 3K4ZA 2XUEA 4HN1A 1AR91 2AR6A 3K75B 1GANA 3R6SA 2WNVC 4DO0A 4M3CF 5C3QA 1LOGA 3C7GA 3KT1A 5HV0A 1OPMA 2WLQA 3UK9A 5K0UC 3C7HA 3D0SA 1R082 4IDZA 1REEA 1U5IA 1WCKA 1UO9A 1YNAA 1W05A 1YQ5A 2QJVA 2IXLA 3FFZA 2V4VA 4IEOA 4R52A 4XABA 1QJX2 2P17A 4C0HA 4IE7A 4LBQA 4LA2A 2O0OA 1S0GA 2JENA 4UI9L 2BPA2 1NAEA 1W6MB 2AEZA 1X50A 1BEV2 3FUQA 3MW4A 2VUCA 1SFYA 3MLKA 4FOYA 3I49A 4TWTA 1WLDA 1B09A 2W39A 4BM8A 3C7OA 5BV6A 2J7MA 1G9FA 2VMDA 3UKTA 3WG1A 2CWMA 3NNMA 1UY1A 4HSLA 2JKBA 3TEZA 2C26A 2XLFA 2KXLA 4HANA 5JZGA 4CSWA 1DYKA 3DV8A 1LHNA 2D93A 1RHI1 5CEHA 2HJIA 4J1WA 2HYXA 1R091 1WUVA 3LOIA 3MYXA 4D7SA 4BOWA 2QQVA 2IC1A 5FYZA 5JOYA 5FY8A 4QHZA 4XIKA 4URAA 4TLFA 3H50A 4YNIA 1SDWA 1C5HA 3ZX7A 3U11A 5K0UB 4FTBA 2X53S 5EPAA 1HV1A 4IE0A 3SH4A 5G04L 4NHMA 5F9TA 5FO8B 3O5SA 1KXGA 2D6PA 2IUWA 1NCRC 2EXJA 2EF6A 3A23A 3RGBA 1H9WA 5JR7B 3JQXA 4A7ZA 4Z8BA 1GUIA 3RZKA 1SBDA 3ZKUA 1MS3A 3S30A 1UW8A 2WS91 1NA1B 5LBBA 3V0AA 1CAWA 2VGDA 2ZX3A 3HAGA 4WVVA 3RYRA 4QXCA 4CE8A 4KWUA 2E51A 3D6EA 2JG9B 1VRH1 1L7LA 3BPSA 1BEV1 1D4M2 3HVDA 1L3JA 1ZM1A 4D6QA 3H7JA 4K6BA 3UJOA 3WG4A 1E57A 3VZMA 3TAYA 3AKTA 3VZLA 3OGGA 2RS11 2WT1A 3VBUC 4AFBA 1GP4A 1SHWB 3WCRA 1RUJ1 2YU2A 4IL7A 1CPMA 5E8AA 3VD7A 1XRUA 1LOBA 4FOQA 5BY5A 4IV3A 4RN5A 4IEUA 1BCXA 3UGGA 3FLPA 1KJRA 2ZXQA 4U36A 2JE7A 1WZXA 5IK7A 4QX0A 3GHMA 4WVZA 1DGWX 2RS53 4FFHA 1QJY3 2W1QA 1K5MB 1OBNA 3E5UA 3LEGA 4UT5A 4ZONA 4ZXEA 2O8QA 1HB1A 4CDUC 1W28A 3LSDA 4XVHA 4AL9A 1EAH3 2Z4FA 1PK6A 1SLAA 3A7QA 4KU7A 5L19A 4WBBA 4XDOA 3SCHA 3UGFA 2HWE2 1S0IA 1YXWA 2XXZA 3E6CC 3AKQA 1IPJA 4LBQB 4QKFA 3K2OA 1N47A 1JZ7A 2R1DA 1L7QA 3C7FA 1E5HA 5EFUA 1FNZA 3ZYJB 2X10A 2F4LA 3IB3A 2HBTA 1BJQA 5ABJB 4PQ9A 1PZ7A 1W6MA 2RMU1 3OUHA 4Y3OA 1ZRIA 1QMJA 2QQJA 4AWDA 2BNOA 2PYTA 1LOCA 1VRH2 2YPJA 3GZUC 1PGL2 2J1UA 3J8F1 3MICA 5FMOL 1REFA 2W52A 4OVEA 1AXKA 1BBT2 1VBC3 2ARXA 4QQOA 1AR83 2C6SA 2D6KA 3NNLA 3ABZA 2MPFA 2RS12 2BDRA 1LTEA 4IEXA 1RUC3 2HWB2 4OCTA 2CDOA 2A70A 1Z78A 4AHYA 2NP0A 2BBAA 2GAUA 2PHRA 2OQ7A 1CD3G 2QDRA 2VECA 2WQ4A 3N7MA 3PNAA 2ETEA 4Y5TA 4E4DX 3GM8A 4R4XA 3RDIA 4WVMB 5FDBA 1O3RA 2FMDA 1PO22 1V70A 5C3RA 3B3QE 4QGLA 1OT5A 1MZ5A 4LOTA 2QCSB 4J1XA 1R1A2 4IE6A 1HDKA 4Q4W1 1UY2A 3ZIWA 3KF5A 4A3ZA 2HWC2 4Q4V1 4AQ2A 2ARBA 2ZHNA 4DFSA 2CHHA 1LODA 1OOPA 4D7YA 4IE5A 3TEYA 1GQPA 4CDWB 3AZWA 3BALA 4GMP0 4Q5OA 4OHXA 4Q1RA 3ZMOA 1PX4A 4FPJA 3ZFEA 1Q56A 1BVVA 1OF3A 2J1AA 3KCYA 4XFFA 2XPJA 5IFTA 4KBBA 1C5IA 1JUHA 3EMRA 4ZZ8A 4G4FA 1YLLA 1ULFA 1Y4WA 3NV3A 1WMEA 4B4PA 3IMNA 4X8PA 2VOWA 5E88A 2E63A 4B7KA 2XGXA 1H9PA 1PM7A 1PMIA 3TOJA 1ALYA 1WCUA 3IZOA 5FYIA 3WUCA 4IESA 3ZN6B 4HKWA 1CZTA 4Z82A 1H30A 1COV2 1QJX3 2YC0A 3LD8A 3OUJA 5A6XA 4P08A 4O65A 1ND2C 2HH9A 4LBQD 3OSDA 4DUWA 4QXHA 1AR93 1LULA 3HD8B 1QNYA 2W1WA 4NROA 3WQBA 5CFDA 3ZLIA 3U0ZA 4DB5A 1W2TA 2DBNA 3T2OA 3KWVA 3DXTA 2H6BA 3V64A 4B4QA 2BTVC 4QPGA 4LBOA 1AYN2 3PUHA 1MVQA 4QGNA 5JLVA 2QQWA 1DU3D 1XNBA 4AFCA 1D4M1 1JMUB 3USUB 2D40A 3OD4A 3K48A 1UY0A 4FPOB 5JSRA 3ILRA 4N7IA 4XURA 4ET7A 4ZPIA 3VBHB 1S2BA 3VBSA 3ZYPA 3VBUA 1OD3A 3CJIA 2ZGQA 1RUOA 4CDQA 3JZVA 4KH9A 3TBDA 2D7FA 5C4WB 5IT6A 4CXYA 1NE6A 4GIQA 1VBB2 2YPDA 4P9GA 1W8FA 3AP5A 3ON7A 3WCSA 1A8MA 1ST8A 3NNGA 3H7YA 4B1LA 1SLCA 2VUDA 3CBNA 3H0OA 2AENA 2VQAA 1ULDA 3NWKA 1HQWA 1ZRDA 3LCPA 4KWKA 1QXRA 5L9BA 3O7OA 1GZCA 4YYOA 2R32A 4P5HA 3WF2A 3WX5A 1UWWA 3VHPA 3FL7A 3N36A 4QM8A 5EXOA 2UURA 2VR4A 4GB33 4XYXA 3KCXA 3X29B 2GMEA 4JGYC 2VCAA 3KS7A 3AMPA 4YM3A 4AGVA 4LKFA 2YBKA 1W39A 2W5FA 3K51A 4UXAA 4NRPA 2D6LX 2RHPA 3ZDVA 1RGSA 1CONA 1POV0 3DKWA 4ITCA 4Y20A 5F2SA 5LK7B 4AI0A 3KV9A 2XDVA 3AJZA 3HOBA 4GJZA 4AEKA 3WNKA 3I59B 1GV9A 1QJU1 2Y34A 3U14A 3QOPA 1OHFA 2IZWA 3EYPA 2GH8A 4MLOA 2DUQA 3KHBA 4LE3A 4QU2A 1N3PA 4AR2A 4FOWA 4H2AA 5FYCA 1W8ZA 3V0BA 4P9YA 2DCTA 2B45X 2ZGTA 4WZCA 4PT6A 2QQKA 2HWE3 2QZ2A 4PQQA 5FPBA 4HT1T 3ACGA 4H55A 4FTSA 5BNNA 4L9BA 3AP6A 4X6RB 1VB2A 3JXSA 4Q4V3 4EN0A 2E7QA 2IVIB 5JIUA 3BTYA 1AJKA 2VOXA 5JPNB 3MGUA 4CEYC 4CUBA 1PNGA 4FPEA 4XZUG 2B9UA 2EIEA 2XWBB 4YVWC 1NQDA 5B4XA 4PJYA 1TMF2 1X9TA 2VQTA 3U75A 2QQIA 2YDEA 3IIAA 5F3IA 4GB31 4HKOA 4HKLA 4AZZA 2W87A 2JWPA 2ID4A 1T6GC 3AP7A 2HWB1 1YQ2A 3J7MA 4SLIA 4AQTA 5G05L 1RUH1 4FP2A 2A6WA 3Q8BA 2WJSA 3M2MA 4JHZA 3SH5A 4HSJA 3WR0A 4ZZ5A 1NCQC 3NL1A 1MEC2 1FOD3 4H7MA 1QOOA 4LOSA 1HB2A 3VBOA 1GOGA 1QJU2 4BH9A 4OQ8A 5GLVA 2J1RA 5FMOS 1BEV3 1H0BA 2OT7A 3LE0A 4MX3A 3E5XA 3HEIA 1HJFA 1X36A 2Y60A 5GZEA 2HWD1 1H6YA 2HWF2 3ETQA 3LOBA 2J1VA 4DXZA 3IDCB 2ZGRA 4JGYB 1IS6A 3BU0A 1MS0A 2GDFA 3S0MA 4DRVA 1LKNA 3LPFA 2R043 5F7UA 1RUE2 1AYM3 2CL2A 2BYVE 2WZEA 1AR73 4GULA 4NRMA 2D5FA 2GN7A 4RR3B 4DS0A 4LO4B 3A4UA 4QB2A 4AEMA 4C90A 1V9U1 2OZ6A 2P3IA 3M7AA 4B29A 4HETA 1DQ2A 2G9ZA 3I4IA 5FXZA 2JDZA 5A7WB 3VHOA 3ZYRA 3ZXFA 4AVAA 4CDUA 1RMU2 4MUVA 1OA2A 4CPBD 2QQLA 1SDDB 2VW1A 3WNMA 5T52A 4LULA 3MIEA 4Q0PA 4H3WA 1VBB1 2A71A 4FPHA 1RUG1 5DUXA 4LA3A 2PLV1 4XMIA 1YFXA 2MEV1 5GZCA 3V65A 1N3OA 1N1VA 5E6HA 3EXUA 5FP4A 1JW6A 2O8OA 4YVSB 4FXKB 1N1YA 5FZKA 3KMHA 1S0CA 4ATFA 4BU2A 5KXEA 1I5ZA 1XSQA 4Q27A 5L9RA 2DCYA 2PA7A 4YW1A 4QQHA 5FKCA 3N9OA 5GM0A 4CZSA 3H1YA 2WUHA 5FBZA 2XBO2 5CA6A 2BFUL 4BQ3A 3BUCA 5HV4A 2ZHMA 4HBNA 4LLFA 4CCEA 4XCAA 5ISLA 1GOHA 1FAYA 4R8HA 3RJRA 5BNPC 4LR4A 1BXHA 3AZVA 1B35C 3THDA 4IEZA 3S5QA 2ZX4A 2B7YA 1CAUB 2XVKA 1SBEA 1UOBA 4OULA 5I91A 2CYFA 4XBQA 5KXCA 4NIIA 5HXMA 2J1TA 4PF5A 4COZA 3KD4A 4Y1ZA 4AW7A 2A3XA 1W2OA 5DDJ1 2Z5WA 1C4RA 1A78A 1EV13 1H8VA 1UN1A 2ARAA 3OGSA 4E4SA 4EZ4A 4COVA 1YRZA 2XH6A 4WV8A 2E6VA 3THPA 5CG9A 2X29A 2YC4A 1AXYA 3U4SA 1ODMA 3POSA 1DLLA 1APNA 2ZMKA 4DXSA 5K8SA 4FSJA 3FX3A 4WM7C 4XFAA 3APBA 3GBFA 1CX4A 4OMCA 4QPIB 3ZN5A 4MGSA 2Z69A 3USUA 3WDVA 1BYHA 1V6NA 3JD73 4OYUA 1ACCA 2RS32 3K4DA 3SKVA 1DGRA 3I97A 4XJUA 2DDUA 4A6SA 2VZQA 4L8QA 4CP1A 3O1TA 4D6SA 2XL7A 3MPBA 3VGIA 5KXDA 4QAWA 5A1FA 3I3BA 1UCXA 1FXZA 4LIVA 5D8AA 4XZPA 3OBRA 3AYAA 2VVEA 4ORFA 3RI8A 2EXHA 2YV8A 4NN0A 5EJ1B 3UV9A 2SLIA 1W8UA 1A6CA 2VULA 5DAXA 4CDWC 4QPIA 2GU9A 2QZ3A 4R9CA 4AF9A 2X09A 2WNUA 1RUF2 4QKDA 4YW2A 5C9AC 4HVOA 4ATEA 4QPGB 3WQ7A 2ZX1A 2Y38A 4PLMA 3THCA 2HWD3 2PAKA 4Q4X3 2YXSA 4NHKA 1AL22 4ZXKA 1XNDA 4XBLA 4YGDA 2RM21 4Y4RA 5KHHA 2W94A 4EWAA 5J96B 1VBE2 4FFGA 3P3NA 2NYYA 2W95A 1HRI3 2JDMA 3J26N 3PVNA 2FDJA 5GZFA 3IKWA 1W2AX 3PL0A 4MGTA 2GNDA 1QKQA 5C71A 2PHUA 2ZGSA 4NIHA 2VNGA 2DCJA 1GICA 5LA0A 1JTZX 4EWEA 4MXWB 2DCZA 4YG0A 5FZBA 4CXXA 5FZHA 3POFA 1LOEA 1QOSA 1RXGA 2ZS6B 2Q8OA 4N53A 4QX5A 1EV11 5CB7A 2RS31 3LEMA 3ZKYA 5I0RA 1UOGA 2RM23 4CUCA 2LTNA 4IEYA 2WO3A 3VB9A 2WNEA 1Y9QA 3B00A 4LK6A 5FZFA 3PUIA 5LA9A 2W91A 5A32A 1C57A 2XQRA 1UY4A 2UYBA 3POWA 4FI9A 3ZFEB 1SBFA 3CL1A 4RFRB 4BWOA 2J1SA 2X5IA 3CMGA 4HMZA 3TYJA 4MXWA 3QD6A 5T54A 2ERFA 2XR4A 3J4UH 4M00A 3N7KA 3SKJE 4FPYA 4UFHA 2JICA 1F4HA 4AI2A 3ZFEC 3ZOIA 1DDLA 1PNFA 3ZSKA 3POJA 5FZLA 1S2KA 1ENRA 4EJRA 5F6LB 5A7WA 4CDUB 4JRAA 4XFIA 4URTA 2XBO1 3VKOA 1LGBA 2VVFA 4AVBA 2R062 5JXJA 3E5QA 1YFWA 5I8SA 3HIFA 1H1AA 3LKJA 1VBE1 5JOWA 4V2WA 2J1EA 4QPYA 3ST7A 1X7NA 2I07B 2KA3A 1S0BA 3H3LA 3IAPA 3O1VA 2AEYA 4CPBA 4QX8A 4BMBA 1BBT3 1UQXA 5DZGA 3AMNA 4FCAA 3QBQA 1YFUA 1CZVA 4LIUA 4NPMA 1YQCA 2IXCA 5JXIA 3HPNA 4Q4X2 3GBGA 4WM8B 2EIDA 1FT9A 4XAAA 5J98B 3R05A 4E9KA 3LDRA 3TRSB 2VMIA 2ADEA 2OQ6A 4PLNA 1IKQA 1YJKA 2Y6FA 4CU7A 2XUMA 1QIQA 5DUVA 4AEDA 4RD7A 1K45A 4W50A 1GZ9A 3ME2A 1UZYA 2PHFA 3LEKA 2YUEA 4K40A 2R1BA 3CDZB 4YSFA 1JHNA 4JAAA 3GALA 1XBFA 4AAXA 3HN1A 1KRIA 1I5PA 3OPWA 2XQXA 2PMWB 4DOUA 5H9SA 1DQ0A 1ZBE1 1LAJA 1KS4A 3ZR5A 4I2OA 2JE9A 1MS8A 5JXHA 4OZOA 1VBC2 3I2IA 4XUQA 4JGYA 5FXXA 3ROUA 1W6PB 1N1SA 1BVP1 4HL0A 4BA6A 4FFFA 5CISA 4MG2A 3OY8B 5LBEA 1EAH1 5APAA 4KU8A 4ZU4A 2JG9C 3M8LA 4PCRA 5FPAA 1JI6A 1PVC1 3D8CA 3LDKA 2TEPA 2GP3A 1F5JA 5A7QA 2WZR2 3WEZA 3ZYHA 2DU0A 4HONA 4PI0A 2ZGNA 5C4WA 1S0JA 1OQDA 2NMOA 3ACLA 3U07A 3JU9A 5BNOA 5T5JA 3O1UA 2JG9A 1CZSA 1DCSA 1H2LA 3GCXA 4NVPA 3GNEA 1KFXL 1FATA 4AI9A 2UY8A 4E27A 1UYXA 5FLHA 1RVF1 4XTPA 4IEVA 4BLJA 3VKMA 1XQNA 3T2TA 3J7LA 1MVEA 1IZ3A 1NT0A 3I59A 2VOVA 5FKBA 5DMYA 1YIPA 3LAGA 1POV1 4DY5A 4R9BA 3KV4A 4AQ6A 1YQ6A 3QH7A 3P3PA 5B2GB 1H2KA 5FYVA 2H0BA 4RHV2 3OBAA 3KCCA 4AOCA 1JYNA 1OQEA 2JB8A 3LQCA 4YG3A 4F8AA 4ISQA 4DZGA 5A3WA 1RVF3 2DBIA 3DKQA 2D44A 2WINB 4LITA 1DG6A 2WS93 1LU1A 1ZA4A 1ZVFA 1H4GA 3JD71 4QD2A 3AFKA 3RYKA 3AB0A 3N9LA 3T4VA 3DXUA 1MQTC 4RA0A 5JSPA 5J36A 2HLEA 1RUF1 4W4ZA 5FAXA 1WLCA 5FXVA 5CFCA 2K0GA 1OI6A 1ULOA 4KG8A 2OZJA 1FX5A 5A7NA 4A44A 2HWF3 4GWNA 1WA6X 2VUAA 1KITA 1XE7A 3FE5A 2AACA 4QQ2A 3ECQA 3OEBA 4OZXA 3NAPC 2WFF3 2VZRA 3A21A 5KC5A 4OUMA 2CV6A 1AF9A 4LKSA 4S2DA 4ARYA 2ZEWA 5D1IA 4AFDA 4BK4A 3I2HA 4O7XA 4F3JA 3MV11 3AVSA 3MUZ1 2B8MA 3KM5A 4KG0A 4LE4A 4QDQA 5GLWA 5GLZA 1UIJA 2ATFA 3HT1A 4AHWA 2CGPA 5A6ZA 1Z7S1 4LO7A 1QJEA 3OPZA 1R64A 5DAQA 3VDBA 1TMF1 4L99A 5F5CA 1N3QA 2VG9A 1I3HA 1HN0A 1UYZA 3DF0A 2R042 2QTWB 2CAVA 3ACHA 1SFNA 3MPPG 5SV8A 2GC1A 4BQ1A 1AYM2 4P02B 4BXSV 1HV0A 5DAVA 1BK0A 2ZACA 2ZEXA 3RZJA 2JJ6A 4D69A 2DUOA 1K5MC 2Y64A 1AXZA 1H2MA 1ONAA 1W99A 3D0JA 3DCQA 5DG2A 1S0FA 4IEQA 4UFMA 2WFF1 2VMCA 4CCDA 5FYUA 2Y6JA 2R072 5IVJA 1HLCA 5HBAA 1HB4A 1UAIA 3VBSB 3TN93 4UAPA 4NIGA 1SPPB 4Q0QA 5DXDA 1MZFA 5F5QA 4OLLA 4PDWB 3MF6A 2Q8EA 4YW3A 4IETA 4ZU7A 3FBYA 4E4HA 4GKXA 5FP3A 4QHOA 3ZN6A 1AR82 3HR9A 2GC0A 1JN2P 4AVTA 3MIBA 4FVVA 1W6QA 4GH4C 5FQ0B 3LSEA 3BB6A 4N9IA 5FUIA 3VBFA 1V9U2 3C3VA 1TE1B 4BZ4A 4CEYB 2W1SA 4LNVA 5IW0A 3W5MA 4P9LA 2ENRA 1W3VA 3LDBA 1SPPA 1UKGA 1ZNPA 1O91A 2JG8B 1POQA 2VW2A 1CVNA 1C28A 4FFIA 4XDPA 4LO8A 2WN2A 4YGEA 2VQ0A 3BIWE 1D7PM 2LW8A 1VRH3 3SNMA 2GC3A 3WT3A 2WWUA 5FJKA 3WF0A 4YVWA 3VDAA 2VQUA 2X8KA 1QGLA 2WA3A 3OYWB 4U2AA 5FK8A 4BDVB 2EIGA 4YW6A 2WNUB 5AFEA 3SHRA 3HWJA 1V6KA 3EB7A 3P6BA 3WW1A 5BNOC 4UW4A 1WW6A 5FOBB 3H8UA 2JD9A 1O8PA 2WSVA 5BPXA 1GQGA 1Y43B 2WWSA 1V6MA 3MW2A 5CNAA 5GALA 3TWIA 5J1XA 1QXJA 3EO6A 5L73A 4BQYA 3UGHA 1F5FA 2RS51 1QJY2 2ZGUA 4WM7A 4PHZA 2D5HA 3WXPA 1QF3A 1LHUA 1EPWA 2VNVA 2ZJCA 4XHXA 3SEEA 2GMPA 1JU3A 1PVC2 1ZBA2 3I2DA 5F5IA 3AP4A 4JKKA 3VD5A 2D43A 4UFJA 3PLQA 4LUKA 3ZFGC 1MEC3 2VZUA 3KVBA 4D8MA 3Q8CA 5BYNA 5F39A 1UXZA 2CGOA 5T3NA 5A3PA 1NLQA 4M01A 3DEMA 1NZIA 5FREA 3WNLA 4QKBA 3MBWA 5JCTA 2JIJA 3H1WA 2VCBA 5LASA 5L36A 4Y4YA 5T5LA 3WW4A 2Y6LA 4L2NA 3POBA 1AX1A 2QQPA 4AVSA 1K5MA 4OI1A 4B1MA 1XC6A 4K9SA 4AG4A 5FLJA 4BMEA 1OA4A 5DUUA 5FZ4A 1NLSA 3NW4A 1XSRA 2FCUA 3NAPB 1JYVA 4ES9A 2JD4A 2I74A 1RUI2 1ZZ9A 1LESA 3JQWA 1NXD1 3GF6A 2ZPXA 3G6JB 4GWIA 4HFSA 4K8RB 4BQ5A 2X5IB 1R1A1 4V1PA 4A3XA 1PIV1 4QQPA 1LEDA 3GBWA 5J7MA 3GGLA 2LM3A 2B5HA 4CP9A 1W9FA 5F5AA
chains in the Genus database with same CATH topology
5A80A 4AI9A 2Q8CA 5FV3A 4IGOA 5LY1A 5A3NA 5FZOA 4GD4A 5FYIA 4QU1A 5F3IA 4CCMA 1VRBA 3LD8A 4GJYA 4EYUA 2XMLA 4QXHA 4D6SA 3PDQA 3K3OA 3NJYA 5FYUA 5A1FA 5IVJA 3PU3A 3OPWA 3N9PA 4QXCA 3ZLIA 4LIVA 4V2VA 4CCOA 3DXTA 5LW9A 5FBJA 2GP5A 4Y33A 4C8DA 5FWEA 5FXWA 2PXJA 5FUPA 4DIQA 3N9QA 5FXXA 2Q8EA 4D6QA 2OT7A 5LWBA 2W2IA 4E4HA 4BXFA 5FP3A 3PUAA 5FY5A 5IVBA 5A7OA 4QWNA 5FZIA 5FPAA 2YU2A 5F3EA 2GP3A 5A7QA 3K3NA 5ANQA 5FY0A 4HONA 4GAZA 3AVRA 5FZDA 3PTRB 2YBSA 5IW0A 3PUSA 5FZ7A 3UYJA 5FP8A 3LDBA 4CCJA 5FZ8A 4ASKA 5F2WA 4Y4RA 5A7PA 4XDPA 5FZ1A 5F37A 5FP9A 5FY9A 2WWUA 5FJKA 3U78A 3PURA 4IGQA 5FYTA 5FXZA 5A7WB 2Q8DA 2YPDA 4XDOA 5F3CA 5FZBA 2P5BA 5FZCA 5FZHA 3ZPOA 3KV4A 5A3TA 2XXZA 5FZGA 4UF0A 5FYVA 5FZ0A 3K2OA 5FYSA 5IVEA 5FYHA 5FZ3A 5FZEA 4EZHA 4CCLA 4BISA 4D6RA 5F32A 5FZFA 4AAPA 5A3WA 5FWJA 2XUEA 3OPTA 5FJHA 4DO0A 4LITA 3AL5A 4Y3OA 5FPVA 4IGPA 5E6HA 5IWFA 5LY2A 3RVHA 2VD7A 5FP4A 4LXLA 3N9LA 5IVVA 5FZKA 3DXUA 4HOOA 4CCKA 5FY4A 4BU2A 5FZMA 5IVCA 5FYMA 2YBKA 2OS2A 5FPUA 5FZ6A 5F5IA 5FXVA 5FY7A 3N9OA 5K4LA 3AL6A 5A7NA 3KVBA 5F2SA 4NUBA 5FZOB 4TN7A 3KV9A 5FZLA 4CUGA 5F39A 2XDVA 4CCNA 3N9MA 5A7SA 5A3PA 2OQ7A 4GJZA 5ISLA 3KVAA 5A7WA 5IVFA 2YU1A 3PUQA 4UF0B 2YBPA 3KV5A 5FZ9A 4QXBA 5F3GA 5FYCA 4V2WA 3AVSA 5FY1A 5FPLA 5FZ4A 4QX8A 5FUNA 5FPBA 4CSWA 4QX7A 5FP7A 5CEHA 5A1LA 4LIUA 3PU8A 5FZAA 5F5CA 2OX0A 5FYBA 5FYYA 2WWJA 4EZ4A 3KV6A 5IVYA 3N9NA 5FYZA 5KR7A 5FY8A 2OQ6A 4URAA 3U4SA 5F5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A80 A;  4AI9 A;  2Q8C A;  5FV3 A;  4IGO A;  5LY1 A;  5A3N A;  5FZO A;  4GD4 A;  5FYI A;  4QU1 A;  5F3I A;  4CCM A;  1VRB A;  3LD8 A;  4GJY A;  4EYU A;  2XML A;  4QXH A;  4D6S A;  3PDQ A;  3K3O A;  3NJY A;  5FYU A;  5A1F A;  5IVJ A;  3PU3 A;  3OPW A;  3N9P A;  4QXC A;  3ZLI A;  4LIV A;  4V2V A;  4CCO A;  3DXT A;  5LW9 A;  5FBJ A;  2GP5 A;  4Y33 A;  4C8D A;  5FWE A;  5FXW A;  2PXJ A;  5FUP A;  4DIQ A;  3N9Q A;  5FXX A;  2Q8E A;  4D6Q A;  2OT7 A;  5LWB A;  2W2I A;  4E4H A;  4BXF A;  5FP3 A;  3PUA A;  5FY5 A;  5IVB A;  5A7O A;  4QWN A;  5FZI A;  5FPA A;  2YU2 A;  5F3E A;  2GP3 A;  5A7Q A;  3K3N A;  5ANQ A;  5FY0 A;  4HON A;  4GAZ A;  3AVR A;  5FZD A;  3PTR B;  2YBS A;  5IW0 A;  3PUS A;  5FZ7 A;  3UYJ A;  5FP8 A;  3LDB A;  4CCJ A;  5FZ8 A;  4ASK A;  5F2W A;  4Y4R A;  5A7P A;  4XDP A;  5FZ1 A;  5F37 A;  5FP9 A;  5FY9 A;  2WWU A;  5FJK A;  3U78 A;  3PUR A;  4IGQ A;  5FYT A;  5FXZ A;  5A7W B;  2Q8D A;  2YPD A;  4XDO A;  5F3C A;  5FZB A;  2P5B A;  5FZC A;  5FZH A;  3ZPO A;  3KV4 A;  5A3T A;  2XXZ A;  5FZG A;  4UF0 A;  5FYV A;  5FZ0 A;  3K2O A;  5FYS A;  5IVE A;  5FYH A;  5FZ3 A;  5FZE A;  4EZH A;  4CCL A;  4BIS A;  4D6R A;  5F32 A;  5FZF A;  4AAP A;  5A3W A;  5FWJ A;  2XUE A;  3OPT A;  5FJH A;  4DO0 A;  4LIT A;  3AL5 A;  4Y3O A;  5FPV A;  4IGP A;  5E6H A;  5IWF A;  5LY2 A;  3RVH A;  2VD7 A;  5FP4 A;  4LXL A;  3N9L A;  5IVV A;  5FZK A;  3DXU A;  4HOO A;  4CCK A;  5FY4 A;  4BU2 A;  5FZM A;  5IVC A;  5FYM A;  2YBK A;  2OS2 A;  5FPU A;  5FZ6 A;  5F5I A;  5FXV A;  5FY7 A;  3N9O A;  5K4L A;  3AL6 A;  5A7N A;  3KVB A;  5F2S A;  4NUB A;  5FZO B;  4TN7 A;  3KV9 A;  5FZL A;  4CUG A;  5F39 A;  2XDV A;  4CCN A;  3N9M A;  5A7S A;  5A3P A;  2OQ7 A;  4GJZ A;  5ISL A;  3KVA A;  5A7W A;  5IVF A;  2YU1 A;  3PUQ A;  4UF0 B;  2YBP A;  3KV5 A;  5FZ9 A;  4QXB A;  5F3G A;  5FYC A;  4V2W A;  3AVS A;  5FY1 A;  5FPL A;  5FZ4 A;  4QX8 A;  5FUN A;  5FPB A;  4CSW A;  4QX7 A;  5FP7 A;  5CEH A;  5A1L A;  4LIU A;  3PU8 A;  5FZA A;  5F5C A;  2OX0 A;  5FYB A;  5FYY A;  2WWJ A;  4EZ4 A;  3KV6 A;  5IVY A;  3N9N A;  5FYZ A;  5KR7 A;  5FY8 A;  2OQ6 A;  4URA A;  3U4S A;  5F5A A; 
#chains in the Genus database with same CATH topology
 2XJV A;  5KHG A;  4TZD A;  2BOJ A;  4HG6 B;  3KQR A;  4Z2W A;  1YQ8 A;  1UOF A;  2RJL A;  4D7T A;  5HI0 A;  2J42 A;  1XYO A;  1QQP 1;  1IKP A;  3AYE A;  4CCM A;  1D0G A;  1YHF A;  4GJY A;  1O5L A;  4RQP C;  5AVA A;  4YZ2 A;  4MXV A;  4P9J A;  4UFI A;  3W21 A;  1OKO A;  2QBX A;  1CAX B;  2YC2 A;  4HVR A;  3P1I A;  4QB1 A;  2LS6 A;  2AC1 A;  3BOD A;  1SLT A;  4AE2 A;  1HW5 A;  4IV1 B;  1RUN A;  1OOP B;  5KHI A;  1UU4 A;  1FI2 A;  3ZSL A;  2YG0 A;  4UFK A;  2XWJ B;  2DYC A;  2ZML A;  1F4A A;  3FBM A;  4PIY A;  4M3C B;  2VVD A;  1F31 A;  4YZ1 A;  3VDD A;  1COV 3;  4XFB A;  2WO7 A;  1OUX A;  3K3N A;  2NPI A;  2BRT A;  1GNZ A;  4GAZ A;  3VBR A;  2BJS A;  1JZ2 A;  1J3P A;  2O1Q A;  3JCI A;  1LOA A;  5T5O A;  1AYN 1;  1ZRR A;  2UWB A;  3VBF C;  1QJF A;  3OJB A;  2RG4 A;  4GH4 A;  1YI9 A;  2WKK A;  1OLQ A;  5EZW A;  2W1U A;  4RSU A;  1SFP A;  2MEV 3;  1OH3 A;  4XJZ A;  4YW5 A;  1DP0 A;  2HKX A;  4S2H A;  4BK5 A;  1US2 A;  3LFI A;  2Z42 A;  2BGO A;  1GLH A;  4Y1U A;  4FPL A;  1WKY A;  1ND2 B;  1PO1 3;  4QM9 A;  2AH2 A;  1C1L A;  4RHV 3;  3U10 A;  3CKH A;  3AMQ A;  3LPG A;  4UF0 A;  3D4K A;  3SH3 A;  3ZXK A;  5CG8 A;  2PEL A;  3M1H A;  5JMO A;  1OLM A;  3IPV A;  5J3U A;  2EVX A;  3GXU A;  3ZYB A;  1IPS A;  2C9A A;  2DTW A;  4CCL A;  4BB3 A;  4RR3 A;  3ZIX A;  1OVS A;  4NID A;  3BOW A;  2B9V A;  3BN6 A;  1MPX A;  5CVR A;  4G9S B;  3SLI A;  5E16 A;  2IFW A;  4B4R A;  5LA2 A;  4LXL A;  1P8J A;  4LO5 B;  1WBL A;  2ZHL A;  4XUT A;  1ND3 C;  4IV3 B;  3SIS A;  4DEV A;  4OI0 A;  5BNP B;  5FYM A;  4CDX B;  4FQZ A;  2I2S A;  3K77 A;  3WQ1 A;  3VZJ A;  1ZX5 A;  2RR1 2;  3OGV A;  4NUB A;  5DDJ 3;  3U1X A;  5C5T A;  1UZ0 A;  1W8N A;  2JKX A;  2XBO 3;  1IGO A;  4ZKT B;  2BBV A;  4YAR A;  3ZVX A;  2WQ8 A;  2GC2 A;  4YGB A;  3I2O A;  5IJR A;  1UMH A;  5JMC A;  1RUD 1;  2UWC A;  5K0U A;  3NKG A;  3BTA A;  2DWR A;  2WT2 A;  2YFZ A;  1STM A;  3KF3 A;  3PMS A;  4MGK E;  1DZQ A;  3CHX A;  1AJO A;  2OPK A;  3D5O A;  1B35 B;  2VPV A;  5C3P A;  3ZR6 A;  4IXL A;  4IV1 A;  4Z92 B;  4AHZ A;  3IN9 A;  2BW8 A;  3BVC A;  4JDO A;  3CIH A;  4XDQ A;  1LHO A;  5E89 A;  4P5Y A;  4Y5S A;  2WWJ A;  1F8V A;  2VO5 A;  4H14 A;  4IE4 A;  3EBR A;  2VBP A;  2VY0 A;  5CFC C;  1C8M 2;  2RS5 2;  4IEP A;  2WN3 A;  4KGG A;  5A6Y A;  1RHI 3;  3R4U A;  2L9L A;  4NJ4 A;  1DLC A;  2XVL A;  4JKL A;  4HPK B;  1JBC A;  4KWJ A;  1WCQ A;  1LRH A;  3O14 A;  3RWK X;  4C0B A;  4XUN A;  4R4Z A;  1W9S A;  2WO2 A;  3PVE A;  4P9X A;  5A3N A;  4KWL A;  1ZBE 2;  1PO1 1;  2A6Z A;  1C8N A;  1ODN A;  2FD8 A;  4HLT A;  3GCW A;  4LHL A;  4CDX A;  1UPS A;  2XOM A;  3GZE A;  2HWE 1;  2LAL A;  1HRI 1;  5ERL A;  2G19 A;  1PGL 1;  4JGZ A;  1ZZ8 A;  3PDQ A;  5HCF A;  3HQR A;  2F4P A;  4I0B A;  4XXP A;  1VBA 1;  2Q5T A;  4I0A A;  4KMQ A;  5GLU A;  1W9Y A;  3O1M A;  2FCV A;  3M3I A;  1Q3E A;  2XJP A;  2ET1 A;  3IDE A;  4O9G A;  4OHW A;  3TNP B;  2ILM A;  4GH4 B;  4Y33 A;  5FXW A;  1XU1 A;  4CU6 A;  5FQ0 A;  2EIB A;  5IK4 A;  1GWK A;  1YFY A;  1RUH 2;  2DVD A;  3IPV B;  4JHT A;  3WDY A;  1JYT A;  1PMJ X;  5C8C A;  1NKG A;  3ACF A;  2A6Y A;  2EAA A;  5FY5 A;  4EN9 B;  1W04 A;  1X8E A;  2WNV A;  1LNS A;  3B69 A;  4GQ7 A;  5IAV A;  4KI5 M;  5D2A A;  1VP6 A;  4MSV A;  4W6W A;  4ASL A;  2DVA A;  5CAZ A;  5FY0 A;  2FZ2 A;  3H1M A;  3TN9 2;  2PLV 3;  4MYE A;  4NAO A;  1OH4 A;  5FP8 A;  2UU8 A;  5D8A B;  4ASK A;  4CCJ A;  4DPN A;  1TME 1;  2HYK A;  2ZZQ A;  4XF9 A;  5F37 A;  1XOY A;  1W9W A;  3ORJ A;  4XOG A;  4QPG C;  2Y8K A;  2ZBJ A;  3ILN A;  4YM1 A;  4HK9 A;  4QMA A;  2P34 A;  4PBO A;  1W03 A;  3PHM A;  3H8X A;  2C4X A;  2GNT A;  4Y1V A;  5L7O A;  5DAB A;  2BU9 A;  5A3U A;  1HJG A;  5FZC A;  3W58 A;  1BLZ A;  1NCQ B;  2E33 A;  1KEX A;  1QH6 A;  3HNY M;  3ENR A;  4LMF A;  2R7E B;  5FYH A;  5I8T A;  2YRO A;  1YUD A;  3DYP A;  4YFZ A;  5DN2 A;  1DQ6 A;  4BIS A;  5JZG C;  1UOJ A;  3KGL A;  4AGG A;  4GAL A;  1R1A 3;  4M0H A;  3G7D A;  1NQJ A;  4AED C;  5JXG A;  5HXV A;  3AMM A;  5C3O A;  1E5S A;  4D3W A;  3RZM A;  2I45 A;  5C7G A;  1KDK A;  4YVW B;  4CEY A;  3FWE A;  4ZHN A;  2P4E A;  1LJ7 A;  2BGC A;  2OS2 A;  2Y6K A;  5T55 A;  4WM7 B;  1OXC A;  2VXR A;  2WNV B;  4XIL A;  1QH7 A;  1PO2 1;  4JQR A;  1XE8 A;  2FCT A;  2RDQ A;  1PVX A;  3DPR B;  3KSC A;  1ULE A;  5EJ3 A;  1UYP A;  4DXT A;  2NQY A;  2RE9 A;  5IVF A;  5LCW L;  4K1Z A;  4K3U A;  3BTX A;  4CEW A;  5H9R A;  2WFP A;  2ZX2 A;  3WZ1 A;  1X82 A;  2R30 A;  4QXB A;  1NY7 1;  3QLQ A;  3T30 A;  3I3Q A;  5FPL A;  1L7R A;  4PBP A;  4B3N A;  4CU9 A;  2Y6H A;  4QHB A;  1CJD A;  1O8S A;  4DMI A;  3NJV A;  1XXN A;  4QX7 A;  3MLL A;  3UT0 A;  4LTA A;  2JX9 A;  4YVS A;  2K2S A;  2G9F A;  5FZA A;  5FYB A;  1UZW A;  1J83 A;  1H4H A;  2V5D A;  4COW A;  4AEJ A;  2G4I A;  2BUK A;  1AL2 3;  4MO3 M;  4TLG A;  4BYY A;  1PM4 A;  3MI8 A;  4NR1 A;  5T5P A;  4CTE A;  1W6Q B;  1U0A A;  3H3U A;  1G9C A;  2WFF 2;  3M4F A;  4EQV A;  5AC9 2;  3U4X A;  4DNY A;  4PF1 A;  3M3O A;  3VKF C;  1JHJ A;  2ZEY A;  4NPL A;  5DAW A;  4I0W B;  3UNP A;  1QDC A;  1R08 1;  3PIJ A;  4CUA A;  5FIX A;  2Y33 A;  2ZA9 A;  4N43 C;  1D0H A;  2RR1 1;  1TVG A;  1AX2 A;  1PGS A;  2QDN A;  2ZGL A;  2ARE A;  3K3O A;  1J1L A;  2ZAH A;  1W6N A;  4LJH A;  3N9P A;  4NPR A;  1O6U A;  5BNO B;  2VH9 A;  1BK1 A;  3MEP A;  2BEO A;  4IUG A;  4W8J A;  1WWY A;  2QE3 A;  3MLJ A;  2PXJ A;  1F9K A;  2Z2S B;  3CQO A;  1Y3T A;  4RS5 C;  1XNT A;  4K8F A;  4YWA A;  2B46 X;  4CEW B;  1OLR A;  1R1Z A;  3T08 A;  5LWB A;  1YI7 A;  5DUW A;  2Q4S A;  4FPC A;  4FAG A;  1M4W A;  2RS3 3;  5FZI A;  4NMI A;  1MAC A;  1PGW 2;  1PVC 3;  3FC0 A;  4OFG A;  4R9D A;  4Z1V A;  3WF3 A;  5LEJ A;  1V6L A;  3H9A A;  3ZFG B;  3IWZ A;  5F2W A;  1RJ7 A;  4Q26 A;  4YW7 A;  5J09 A;  1PO1 2;  3U78 A;  1WMD A;  1ZBE 3;  5AC9 1;  3NNJ A;  1H8T C;  1QY4 A;  4CDQ C;  4FTE A;  3RRD A;  5JDB A;  1VMF A;  3EHK A;  5CU1 A;  3T4H B;  5FYS A;  1RUI 3;  3B01 A;  4XW3 A;  2DCK A;  2ZAB A;  5FPZ A;  4EN7 B;  4PDW C;  3MIG A;  3NVC A;  5F32 A;  5ACA 3;  3FMG A;  4Y22 A;  5JVV A;  3LA7 A;  2B39 A;  3VKL A;  1ZZC A;  3AL5 A;  4EWD A;  3ZXA C;  2F6B A;  2WSU A;  4BHP A;  5DQ0 A;  3ATG A;  3FJS A;  3H8R A;  2G9G A;  3NV1 A;  2EXI A;  2KM2 A;  3POY A;  4QQL A;  5H9Q A;  5IVC A;  2W0X A;  1B35 A;  5HCH A;  3LGR A;  3ZFF C;  5FZ6 A;  2R07 3;  4IW3 A;  4CRQ A;  3ZO0 B;  4LLO A;  1W0N A;  5JAX A;  4AYU A;  1CAV A;  3E97 A;  2B42 B;  5IHR A;  2Y0O A;  3WG3 A;  4CCN A;  1F15 A;  1TME 2;  3E1F 1;  1XNK A;  1YCI A;  3KVA A;  3KT4 A;  3RFR A;  5FTT C;  2JDY A;  4XJ9 A;  3LA3 A;  1RIR A;  4NIA A;  1X9P A;  5FZ9 A;  5FR3 A;  1ZA7 A;  3HNM A;  3AKS A;  5BXX A;  1CAX A;  3MO4 A;  4LHK A;  3URF A;  2ZGK A;  4OHV A;  2PAE A;  1VIW B;  4I30 A;  5LA1 A;  4HZF A;  1G9B A;  4LBN A;  1C1F A;  4CEW C;  4O9E A;  3AYC A;  4ZU5 A;  1CN1 A;  4OHY A;  3WHU A;  5ABJ C;  1WLW A;  3ETP A;  3I54 A;  1CQ9 A;  3N7J A;  3PU8 A;  3AXE A;  1VB4 A;  4LBL A;  1T6B X;  4XE9 A;  4Y26 A;  1RJ8 A;  2OX0 A;  2VC9 A;  3C2U A;  4KGQ A;  2PTM A;  4ES8 A;  1JZ8 A;  3OUI A;  1DGW A;  3MID A;  5C8C B;  3FHI B;  4L97 A;  3J8F 3;  5FOJ B;  3WV6 A;  3R0R A;  2A6V A;  4SBV A;  4MOA A;  4DIN B;  4EE2 A;  5J48 A;  2JDU A;  3T0A A;  1JOB A;  3E6D A;  3WF1 A;  2FDF A;  1QOT A;  1ENX A;  2E53 A;  2RMU 3;  5EIY B;  4RGK A;  1I6X A;  3LZZ A;  3OY8 A;  2QQU A;  3PME A;  3PVO A;  3F2Z A;  5FZO A;  5IYY A;  1GNH A;  4LUM A;  2CAU A;  3DPR A;  3CJI C;  3OBT A;  4JC1 A;  4UFL A;  4XUP A;  1XU2 A;  3VL8 A;  2WZR 3;  3SXW A;  3DL3 A;  3IM0 A;  2NM1 A;  3NJY A;  1RUE 3;  5GJ6 A;  2WNO A;  1QHD A;  1IS3 A;  4F7Z A;  4MGZ E;  3VBU B;  2P3K A;  1Y9M A;  3O0X A;  1URX A;  2PHW A;  4N53 C;  4C8D A;  4AI3 A;  1TNR A;  5FUP A;  1DFQ A;  1RUH 3;  1ZZ7 A;  1RYY A;  4GMP 3;  1HXS 1;  2FDI A;  3I8T A;  1W8T A;  4Q1P A;  1GBG A;  1CWP A;  1KQR A;  2ZHK A;  4BXF A;  2D6N A;  2OUH A;  2WBK A;  2P37 A;  3I3M A;  4L11 A;  1ENS A;  1NCQ A;  5C4W C;  2V5Y A;  1YC6 1;  3IAQ A;  1TG7 A;  3RYP A;  2A3Y A;  3PTR B;  2RS1 3;  1JU4 A;  2VZO A;  3LA2 A;  4Q2F A;  4YG6 A;  3UES A;  3RZL A;  3ZDS A;  1UZV A;  1AR6 2;  1UYY A;  3DPR C;  3MHZ A;  2MHF A;  1NCR B;  1POV 3;  4QPI C;  4HVQ A;  1C8M 3;  4TYS A;  2AUY A;  3UJQ A;  5C70 A;  3MFA A;  1LEM A;  3T09 A;  2WA4 A;  1WMF A;  4L92 A;  4LBM A;  2D98 A;  4RYD A;  5CZK A;  3JB8 A;  1PIV 3;  1J1T A;  1GOF A;  2EAL A;  4BQ4 A;  4BCU A;  2WDB A;  5A3T A;  2QFE A;  5M0T A;  2HWC 3;  3O1O A;  3VN4 A;  1W8W A;  1COV 1;  1XYP A;  1JZ6 A;  3GZT B;  2FDK A;  2IVJ A;  3IBM A;  5GZG A;  4W65 A;  1W6P A;  4A6O A;  4KNC A;  1AZD A;  3HBK A;  4QPW A;  4EZH A;  1W06 A;  4D6R A;  2OII A;  2GMM A;  2DF7 A;  3J9S A;  3MV0 1;  4AAP A;  3WUD A;  1ULG A;  1QWR A;  1YIF A;  5LY2 A;  3AZY A;  1HRV 1;  1TZO A;  1D4M 3;  2WII B;  1XE0 A;  2WQZ C;  1GMM A;  3T0B A;  4QX1 A;  1NUK A;  1TQ5 A;  1Z7S 3;  2F17 A;  5FZM A;  5DPN A;  3A0K A;  5AFB A;  4A4A A;  1MS5 A;  1RUJ 2;  3NAP A;  1UD1 A;  3CLP A;  1XNC A;  3WNX A;  2VMG A;  1FNY A;  2E7T A;  3CEW A;  4Q4Y 3;  2LUW A;  4Y24 A;  4GZ9 A;  1ND2 A;  2IXK A;  4AQS A;  2EA7 A;  4LEJ A;  5IK5 A;  3ZFF A;  3OEA A;  4LO6 B;  2A75 A;  4DRR A;  4MHR A;  2TUN A;  4WM8 C;  5F3G A;  3CU7 A;  2V72 A;  4OUS A;  2ZZJ A;  1TMF 3;  5C5U A;  2BER A;  1EY2 A;  4P00 B;  4Q4W 2;  3V0A B;  1NYW A;  2R0F A;  1O4T A;  1AUY A;  3HQX A;  3N9N A;  5FWJ A;  5AC9 3;  5C3S A;  1HRI 2;  1VR3 A;  1OFN A;  3RG0 A;  1DGL A;  3MIH A;  4AI8 A;  3KGZ A;  4QDR A;  2UYA A;  1VBA 2;  1LEC A;  1LCL A;  5IK8 A;  4GD4 A;  4UW3 A;  2VME A;  3WIN E;  4S2G A;  2WAO A;  3KB5 A;  2WZP P;  1RXF A;  1E5I A;  5KWR A;  5JWP A;  4OMD A;  5AVP A;  5KHJ A;  2NZ9 A;  1SAC A;  1JUI A;  1SQ4 A;  2LRP A;  3BU7 A;  3K4A A;  3MDP A;  4XJA A;  1AX0 A;  2IFR A;  4FOV A;  1GZT A;  2D6O X;  4A7K A;  5CBL A;  2D97 A;  5JOX A;  4YGC A;  4M0N A;  2V4A A;  4FQ4 A;  2YYO A;  1RIN A;  1V6O A;  5LW9 A;  4ISR A;  4WVW A;  3BI3 A;  1AHS A;  1EUT A;  1NE4 A;  4XIO A;  1AR7 1;  5ACA 1;  2X05 A;  2YHJ A;  5I0T A;  4RS5 A;  3IDA A;  4B7E A;  3GDB A;  1BQP A;  4W6X A;  1ULP A;  2GSY A;  1PMH X;  2ZCW A;  3OD0 A;  3S57 A;  1GYK A;  5F3E A;  3RPQ A;  5FMB A;  2WRA A;  5IUQ A;  1YWK A;  3OF1 A;  5EYX A;  3BKZ A;  5JSO A;  3WD5 A;  2MNG A;  3DUI A;  1TEI A;  3AVR A;  1KD7 A;  4XF0 A;  2VJX A;  5FZ7 A;  3UYJ A;  2DVB A;  3S7I A;  3KQ4 B;  4N43 A;  1O3T A;  4AI1 A;  3I3E A;  4NE9 A;  5C9A B;  2ET7 A;  4XQW A;  2Y0I A;  4JRL A;  3IDB B;  2PQQ A;  1OKQ A;  1NA1 A;  4E2G A;  5LBF A;  4Q29 A;  2CWS A;  3B9I A;  4XQ4 A;  4NAM A;  4RQP B;  3O1P A;  2VTF A;  3GYD A;  5LAT A;  1Q5O A;  5F3C A;  1K3I A;  2JG8 C;  4Q0S A;  1WD3 A;  2VTX A;  4Q4W 3;  3RNS A;  4XFG A;  4XJ8 A;  5C6C A;  4S2F A;  3SMH A;  4ARX A;  2JDA A;  1QXP A;  3O0W A;  4XXA A;  2BFU S;  4Y1Y A;  3AKP A;  4Q4X 1;  3OYW A;  5CAD A;  3OPT A;  2WAA A;  2OUJ A;  3ZFF B;  2Y26 A;  3CZJ A;  1IG3 A;  3POI A;  2W92 A;  1HXS 2;  1OSG A;  1OVP A;  4CXW A;  4J6G A;  4Z2A A;  2A1X A;  1I9R A;  2VL4 A;  4FT8 A;  4HOO A;  2PHL A;  3FUO A;  3AZZ A;  3MF9 A;  4L0P A;  4EN6 B;  1Q43 A;  4N7U A;  2ZGO A;  3HJR A;  5FPU A;  4WZF A;  1SMV A;  2HWD 2;  1ASJ 2;  1OC1 A;  2HWF 1;  2BOI A;  5A33 B;  5J37 A;  4A7Y A;  3AJY A;  4TN7 A;  5FZO B;  3VBF B;  1CIY A;  2P6H A;  5BNN C;  4CUG A;  1OMI A;  3CZU A;  3N9M A;  3SEP A;  1NZC A;  1LHV A;  4XF1 A;  2YU1 A;  4IND A;  5A32 B;  2CSG A;  1UNB A;  3DN7 A;  4GWJ A;  4NHY A;  1BMV 2;  2DTY A;  2OYZ A;  3F95 A;  1HIX A;  2NN8 A;  4I02 A;  1QJU 3;  5FY1 A;  3WLU A;  1WD4 A;  5EYY A;  1OQ1 A;  3MW3 A;  1O4Y A;  1JZ5 A;  4GKY A;  5GZD A;  3B93 A;  1JYC A;  1V0A A;  1GP5 A;  3VKN A;  1UIK A;  2FBE A;  3VBO B;  3VZO A;  5A1L A;  3O1R A;  4BE3 A;  3VD3 A;  3BPZ A;  3WDT A;  1Q8S A;  4YZ5 A;  4BQX A;  2JDK A;  3ZFG A;  2FHR A;  1UMI A;  3I3D A;  3VDC A;  2A5Z A;  5CYY A;  2E26 A;  4KBZ A;  4AVC A;  1HRV 2;  3CJX A;  4ZS2 A;  4NHX A;  1VAK A;  2OXB A;  4O61 A;  5L7O C;  1O3Q A;  3ZXE A;  2MEV 2;  2WYF A;  1SCR A;  2OPW A;  3B5L B;  2Q8C A;  5JI7 A;  1CAV B;  4JX0 A;  4Q0U A;  5EV7 A;  4YPJ A;  4J25 A;  4LOR A;  1EV1 2;  5A6Q A;  3LFM A;  5BNN B;  2W9X A;  5FPX A;  3RZG A;  1ZRF A;  4I3P A;  1O5U A;  4PDW A;  2RDS A;  1RUF 3;  2OW4 A;  1ASJ 1;  3LIH A;  1VBC 1;  3OCP A;  1MZ6 A;  2ARC A;  1YJL A;  1F35 A;  2C0Z A;  2R06 3;  3DEC A;  2KR2 A;  1PGW 1;  3P5B A;  1VE0 A;  3ZYF A;  3HT2 A;  3N9Q A;  5C33 A;  3MFC A;  3JD7 2;  1XB9 A;  2XJT A;  2ZTN A;  3GZA A;  3GHN A;  2HEW F;  3V0B B;  1FYU A;  2AYH A;  2ZEZ A;  2E31 A;  4MGY E;  1SCS A;  4AK3 A;  1WA4 A;  3CO2 A;  1UU6 A;  3OTF A;  1ASJ 3;  4RR3 C;  1RB8 G;  2JE8 A;  5LZ6 A;  1JH5 A;  3VBR C;  3Q8E A;  2VCC A;  5ANQ A;  4UWD A;  4QX2 A;  2RR1 3;  5DDJ 2;  4K1Y A;  2YBS A;  3AC0 A;  2QQM A;  1G86 A;  1RUG 3;  3PUS A;  4RL7 A;  3WP4 A;  1RC6 A;  2DVF A;  5I0S A;  3I2K A;  4IER A;  5A7P A;  3THT A;  2GZW A;  2DVG A;  5FZ1 A;  1GU3 A;  3M3E A;  3JBG 1;  3ZPY A;  3L2Y A;  5FP9 A;  2JIG A;  2IWG B;  3NO8 A;  2BQP A;  4LBJ A;  5FYT A;  1XPW A;  2HEY F;  1QU0 A;  5LBC A;  2RMU 2;  1BZW A;  2P5B A;  4A45 A;  5CFD C;  1DBN A;  4CP0 A;  1G8W A;  4BIO A;  5I0U A;  2A3W A;  3JUU A;  1OD5 A;  4IQP A;  1HX6 A;  2RDR A;  2BVV A;  4QX3 A;  1EUU A;  2G1M A;  3N35 A;  4I3G A;  1JYI A;  1ZRC A;  1BBT 1;  2QQN A;  2DFC A;  4LKD A;  1A8D A;  1ZYB A;  4TXW A;  4XAE A;  3VD9 A;  4HXC A;  3DYO A;  1D2Q A;  1DZT A;  1RL3 A;  2XLG A;  4CDW A;  2GNM A;  1AR7 2;  1J58 A;  2R0H A;  2P3Y A;  3AP9 A;  5CFC B;  1R08 3;  2JEM A;  3SIT A;  1NOV A;  2PAM A;  3VBH A;  3ZSJ A;  4XUO A;  1O3S A;  4NHL A;  3FLT A;  2CGN A;  4DUX A;  2VW0 A;  3IMM A;  4E4Z A;  1S4C A;  4Z07 A;  1KFU L;  3JB4 C;  1K12 A;  1EP0 A;  1FV2 A;  2WT0 A;  1FOD 1;  1C3H A;  1NX9 A;  4GWM A;  3R4D B;  4HK8 A;  4LQR A;  1VPH A;  1UF2 C;  3BOP A;  4DUV A;  1N1T A;  4RQP A;  1O59 A;  4Y1X A;  2ORX A;  1D4V B;  3AMH A;  2EAK A;  4NRQ A;  1NLR A;  3WY6 A;  2JDH A;  2H6C A;  2VZ1 A;  3RJ2 X;  3UET A;  3JBG 2;  1EAH 2;  5CFD B;  2A7A A;  2N7G A;  5JIA A;  2RVA A;  3KHC A;  1WBF A;  2RDN A;  2WZR 1;  1RED A;  3PJY A;  4YZ4 A;  2Q1F A;  5FP7 A;  4UW6 A;  3GJB A;  4YRD A;  1HN1 A;  1RUD 2;  4MVT A;  3FFQ A;  1RUG 2;  3MZH A;  2PLV 2;  2VNR A;  2BWA A;  4XJW A;  1JZ4 A;  5A70 A;  3I7D A;  1J84 A;  1PO2 3;  4IEW A;  5A80 A;  4ONU A;  1OUS A;  1A3K A;  1HQL A;  1AR6 3;  2R49 A;  2W08 A;  4XCB A;  1PZ9 A;  4XBN A;  2P1B A;  4Y20 B;  2VU9 A;  5EJZ B;  2D3S A;  3VZK A;  3E6B A;  5F1R A;  2VZS A;  1GNY A;  3RMX A;  3WW3 A;  4JCK A;  1V9U 3;  1U12 A;  1JOJ A;  2VZP A;  3FLR A;  4XPV A;  3PU3 A;  5LRS A;  3BIE A;  3EQE A;  3OGR A;  1U5X A;  1KJL A;  4V2V A;  1BMV 1;  1F2N A;  1KDM A;  4DXR A;  2VXJ A;  4UW5 A;  2Z79 A;  4A42 A;  1QJY 1;  3LB9 A;  1UY3 A;  1W6O A;  3K46 A;  5FFO C;  1XYN A;  4OHZ A;  1H1I A;  3NV4 A;  4H7L A;  5L9V A;  3PUA A;  4AED B;  1SLL A;  1ZBA 3;  2Q30 A;  3A0N A;  1SEF A;  2RJK A;  3GJA A;  5A7O A;  4CCC A;  5A1A A;  5F6K A;  1JXN A;  4F83 A;  4MHU A;  4IV3 C;  2YB7 A;  4FO9 A;  3RWN A;  3I2J A;  4NOT A;  1RUJ 3;  2GAL A;  4P9I A;  2EXK A;  4YLZ A;  4KL1 A;  1DQ4 A;  1U5Y A;  3ALQ A;  4C1W A;  1FMD 1;  4XC9 A;  3W20 A;  5A33 A;  3KLS A;  2A6X A;  5I8Y A;  2XHN A;  4UYB A;  4AVV A;  2ZX0 A;  1GQH A;  1JS9 A;  4N43 B;  1VBD 2;  4MZU A;  5CKQ A;  4E8D A;  2WAB A;  4QDS A;  3W59 A;  1W0O A;  2PFW A;  2QNK A;  2E32 A;  3T3Y A;  4CYD A;  3N4M A;  5FZ0 A;  1Q8Q A;  1S2E A;  1V6I A;  2OKX A;  3TEX A;  2VUJ A;  5IVE A;  1UX7 A;  2R16 A;  3FZ3 A;  1GKB A;  5FZ3 A;  4CP2 A;  2UWA A;  4COU A;  4RS5 B;  3D3A A;  4C1X A;  3VDD C;  2PN5 A;  4RGA A;  3OB8 A;  4M4P A;  2QVS B;  3ZM8 A;  1DQ5 A;  3RVH A;  4ASM B;  5KBF A;  3RZZ A;  1WW7 A;  3RI9 A;  2LRO A;  3OBZ A;  3WP5 A;  2NLR A;  1PK6 B;  2ADD A;  4XHB A;  5FY4 A;  4DY3 A;  3VUO A;  1MS1 A;  3ZN4 A;  1QQP 2;  1VMH A;  3M70 A;  3O1S A;  4Q4Y 1;  4QKN A;  5FY7 A;  2HWB 3;  2FDH A;  1H6X A;  4K21 A;  1TNF A;  2H0V A;  1XNA A;  4YVS C;  5K7P A;  5E1R A;  1AL2 1;  5ABJ A;  1DZR A;  5CKM A;  2RM2 2;  4JVA A;  2IXH A;  1HXS 3;  3PUQ A;  1MS4 A;  3POG A;  4UF0 B;  1NXM A;  1UZZ A;  1VAM A;  5FCC A;  3KV5 A;  1QJX 1;  2W68 A;  1KS5 A;  2GH2 A;  4N53 B;  5EP9 A;  4XF4 A;  1UX6 A;  1SLB A;  1AR8 1;  1CAW B;  3B9C A;  3OOX A;  4RFT 0;  5LK5 A;  4AXO A;  4ERO A;  4OI4 A;  5FUN A;  5TSW A;  3AM2 A;  5L7O B;  3UKN A;  2VAU A;  3WSO A;  4GA9 A;  3HMY A;  4Q8L A;  3AX4 A;  1OUR A;  1Z0H A;  4FXG B;  1WCD J;  2ZAA A;  1OF4 A;  4ZS3 A;  5FK7 A;  5FO9 B;  3EJK A;  4RHV 1;  4QB6 A;  3AK0 A;  4QXK A;  3WHT A;  1D2S A;  1S55 A;  5KR7 A;  2VCM A;  3CJI B;  3ASI A;  4YW4 A;  1YO8 A;  4YM0 A;  5SV5 A;  3VLB B;  4G3Y C;  1DYO A;  3N7L A;  4D94 A;  1VAL A;  3LIG A;  3QCW A;  3ITQ A;  1PHM A;  2P3J A;  5IFP A;  3BTZ A;  1QJZ A;  1DYP A;  5LY1 A;  2JB4 A;  2ORZ A;  1R09 2;  1ZZB A;  1GWM A;  2JEC A;  4AFA A;  3L9J T;  3ZXJ A;  3III A;  3C7E A;  3WNO A;  1LGN A;  2XL9 A;  3RS6 A;  1EYB A;  3WW2 A;  3IT8 A;  2XML A;  2VMH A;  2VNO A;  2BNN A;  2PHX A;  3KZ4 C;  1IOA A;  1VLN A;  1G9D A;  3AXD A;  4OUE A;  5F8P A;  1RUC 1;  2R06 1;  1H8T A;  4N90 A;  5FMC A;  1LHW A;  1ULC A;  2GP5 A;  2PHD A;  1OA3 A;  1OPO A;  3NJX A;  3MUY 1;  5FBJ A;  5FWE A;  5DZF A;  2Y6G A;  5GLT A;  4DIQ A;  1MQT A;  2GNB A;  2BVB A;  1S0E A;  3JBG 3;  3BGA A;  3PIG A;  4K20 A;  2WS9 2;  2XG3 A;  4COY A;  2OA2 A;  1H2N A;  5A3O A;  3UKV A;  2VTX J;  4RGG A;  1FMD 3;  3VBO C;  2D3P A;  3ZMN A;  1MS9 A;  3D82 A;  5LB6 A;  3ZSM A;  2ZKN A;  3FHA A;  4HN0 A;  4DQA A;  1HQN A;  1ND3 B;  1H1M A;  1SZB A;  5K9Y A;  4D0Q A;  4BIF A;  1J59 A;  4XMA A;  1QNW A;  1RMU 1;  2BGP A;  2A73 B;  1G7Y A;  1H8T B;  1WGP A;  1WW4 A;  2PQS A;  4XTM A;  3W5N A;  1LB2 A;  1UXX X;  4K7J A;  1S0D A;  2Q1Z B;  3ZXD A;  2WNU C;  1X33 A;  4PIZ A;  2TNF A;  2ZMN A;  5LRR A;  4JGZ B;  1HB3 A;  4XF3 A;  4LPL A;  1AYM 1;  3AFG A;  1QDO A;  4CA9 A;  2AGS A;  1MZE A;  1RUI 1;  2Q8D A;  4UBG A;  3S6P A;  4AGR A;  4PI2 A;  3S7E A;  3VDD B;  2B4K A;  3INA A;  2PHT A;  4Q0V A;  5LEK A;  1PIV 2;  3VBS C;  3HNB M;  3ZYI B;  1VBD 1;  2JDN A;  2W47 A;  1BKZ A;  2QKD A;  3NV2 A;  1W0P A;  2V73 A;  3T1M A;  3ZXL A;  5H9P A;  1G9A A;  1VJ2 A;  2JDP A;  4X6Q B;  4WVM A;  1T2X A;  1W2U A;  5FJH A;  3NST A;  3ZSE A;  1NCR A;  4JDN A;  4IGP A;  3RMY A;  1KGY A;  2VD7 A;  5A3L A;  4P14 A;  2BP6 A;  4PIX A;  5FO7 B;  4CCK A;  1YYN A;  2VOT A;  1DGR N;  2C5D A;  3B94 A;  5EWS A;  3VL9 A;  1IS5 A;  5A3M A;  4GMP 1;  2C1F A;  3T0D A;  2WC2 A;  5KXB A;  1Y7B A;  3AL6 A;  4I01 A;  4FPF A;  2O14 A;  2CU5 A;  4A41 A;  4CU8 A;  3WNN A;  4BPZ A;  5JI9 A;  3VHR A;  5FLI A;  2SBA A;  2YGL A;  4XQD A;  5HCB A;  4Y22 B;  5JUV A;  3BCW A;  4Q4Y 2;  1W3X A;  2ES3 A;  2CTV A;  1I1E A;  2J22 A;  1SG3 A;  2JXA A;  4XEZ A;  4CP9 B;  2YBP A;  1RVF 2;  2IXJ A;  3DYM A;  4LHS A;  3DGT A;  3WDX A;  3WP3 A;  1W8O A;  1VMJ A;  5BNP A;  1GSL A;  1RTV A;  2VM9 A;  3TEW A;  1FV3 A;  4FPG A;  3QH6 A;  1LEN A;  1UKR A;  1RUD 3;  2FQP A;  1C8M 1;  1UU5 A;  3OGJ A;  5FRA A;  1IQD C;  2WLP A;  3SC7 X;  3VZN A;  2DUP A;  5KHK A;  1W8H A;  5I93 A;  2IXI A;  4LT5 A;  3KV6 A;  3NQH A;  3FHQ A;  3POE A;  1IPK A;  3PJQ A;  5IVY A;  5HPO A;  2DUR A;  2BZD A;  2XHK A;  2XLA A;  3VBH C;  4AHX A;  1PK6 C;  1M06 G;  2XJU A;  1CAU A;  1J3Q A;  3ACI A;  5FV3 A;  1FPN 2;  2CNA A;  4C91 A;  5FMD A;  2XB6 C;  1Q8V A;  3H3Z A;  4LHN A;  5DZE A;  2Q0A A;  4M3C A;  3OG2 A;  4LKE A;  1K5J A;  3C8X A;  3ZYG A;  4JV4 A;  2RJ2 A;  4PLO A;  1YEW A;  2YZ4 A;  1JYX A;  1IQA A;  2BWC A;  1O7F A;  1UMZ A;  4XAC A;  1VAV A;  3ES4 A;  4KQ7 A;  4CVU A;  4FPK A;  1AVB A;  3M3C A;  4MGQ A;  4W6Y A;  3KT7 A;  1IS4 A;  3AYD A;  2R07 1;  5JR2 A;  5KC6 A;  1LOF A;  2VZT A;  3ES1 A;  4FP3 A;  5CKN A;  3LWC A;  4OI2 A;  1Z7S 2;  3TN9 1;  3NKT A;  2RV9 A;  4YZ3 A;  3WNP A;  1Y9G A;  2WYS A;  2FDG A;  3J7N A;  5IVB A;  5D21 A;  1V00 A;  3AKR A;  4EV0 A;  3TNQ A;  3U37 A;  4P9W A;  4E2Q A;  3W9A A;  1W6O B;  1CR7 A;  1K42 A;  4JKM A;  2YY1 A;  2HBU A;  3AZX A;  3I2G A;  5FZD A;  4JTO A;  2XJS A;  3PTY A;  1GFF 2;  2R04 1;  4A2U A;  2FMY A;  1CX1 A;  4M3C E;  2YFU A;  1AL0 G;  4ZY9 A;  3M3Q A;  1ZRE A;  2K9Z A;  1LOF C;  1GP6 A;  1G6N A;  1LGC A;  1JOD A;  5FY9 A;  3J7H A;  3Q8F A;  1RMU 3;  3T1L A;  5D8A C;  3I2F A;  3HQU A;  3LF7 A;  5JZG B;  2DFB A;  1DHK B;  4TTG A;  4FAH A;  1AR6 1;  2C24 A;  5DAP A;  2ZKL A;  2P2K A;  3WF4 A;  4JGZ C;  4NO4 A;  2V09 A;  1GZW B;  3L2H A;  5T50 A;  3NNF A;  1OOP C;  1JYW A;  1RUC 2;  3ILF A;  2AZ5 A;  1EPZ A;  2K46 A;  2QQO A;  3B02 A;  3UL2 A;  5C9A A;  5GKA C;  1BHG A;  1PX3 A;  5IAX A;  3N3H A;  1VBE 3;  4M4R A;  3B7M A;  1LU2 A;  2E9Q A;  3Q9O A;  5FPV A;  2XJQ A;  1FOD 2;  5IWF A;  5C8C C;  1MR5 A;  2P6C A;  5IVV A;  4AFM A;  1QQP 3;  3USS A;  5I0D A;  3A22 A;  4Q8K A;  4MGI E;  5K4L A;  4BQ2 A;  4OQ9 A;  3RQ0 A;  2DV9 A;  2KD7 A;  4XET A;  1E5R A;  1GR3 A;  1GZW A;  1CPN A;  2VBD A;  5A7S A;  4FBF A;  5B4N A;  2YGM A;  4CDX C;  4B8E A;  3O12 A;  3ELN A;  4JQT A;  4YFW A;  2ZGP A;  1CES A;  2FZ1 A;  2TBV A;  2NMN A;  4CDQ B;  2X5I C;  1RHI 2;  1VBA 3;  1PZ8 A;  1UL9 A;  1W6N B;  4Y5Z 0;  4WM8 A;  3WG2 A;  4X8N A;  5IAT A;  2VZV A;  2VOK A;  2BNM A;  2ZGM A;  1V6J A;  1SLI A;  2VBB A;  1ZZ6 A;  3ZXG A;  3VHN A;  4E2S A;  2VE1 A;  5JPM B;  4JZR A;  4BQW A;  3HBZ A;  5FYY A;  3SCF A;  2XVG A;  1CJP A;  1X8M A;  2WO1 A;  2XKP A;  3CF6 E;  4JDM A;  5EQU A;  2WL1 A;  3V56 A;  3T2Q A;  2Q1M A;  1JOP A;  4XFC A;  4BLI A;  1OLM E;  2VMF A;  2XJR A;  1VBB 3;  1HRV 3;  3MIF A;  3NMB A;  2QUO A;  3RSJ A;  3SQO A;  3WDW A;  2R6Q A;  1WMX A;  4IGO A;  1W90 A;  3WQ0 A;  4E8C A;  2E7A A;  1DF0 A;  4TSV A;  5C8W A;  2XKO A;  4QU1 A;  1QEX A;  1ZBA 1;  2HEV F;  5CIR A;  3WDU A;  1VRB A;  1VBD 3;  3VV1 A;  1FPN 1;  1WLT A;  4LK7 A;  3HN3 A;  1NG0 A;  4GXL A;  3O0V A;  4EYU A;  2D3R A;  3H42 B;  1DQ1 A;  3NRU A;  2XON A;  4MV2 A;  4MET A;  4NWV A;  1AR9 2;  4MH0 E;  2VZ3 A;  1U5Z A;  2JG8 A;  1O4Z A;  1DIW A;  1US3 A;  1WCS A;  3BYW A;  4CCO A;  4GB3 2;  1HKD A;  2CY6 A;  3S5A A;  1Q8P A;  3TB0 A;  5JOZ A;  4HPK A;  2DU1 A;  1ND3 A;  1NA1 C;  2ZOE B;  3SCG A;  3T2P A;  1FMD 2;  1IG0 A;  4YM2 A;  1W9T A;  4UBH A;  2W2I A;  1Q8O A;  1UPI A;  4R9A A;  2EIC A;  2WZ8 A;  1AYN 3;  4DEQ A;  1IHM A;  1XJA A;  2WR9 A;  1MEC 1;  4QWN A;  4QT6 A;  2W46 A;  4N8M A;  5ANN A;  1MQT B;  1W2N A;  5EHD A;  1A34 A;  3Q8A A;  2D6M A;  3H8O A;  5ACA 2;  3CNA A;  2CDP A;  3VD4 A;  5FZ8 A;  1LR5 A;  2BV4 A;  3NJZ A;  1NY7 2;  1WW5 A;  3WP6 A;  4EN8 B;  2W3J A;  1J3R A;  1S1A A;  2OVU A;  3QAC A;  3VBR B;  1FPN 3;  3R4S A;  4QGM A;  4XFH A;  4LBK A;  2UY9 A;  3PUR A;  4IGQ A;  4JTN A;  3WVJ A;  5HCA A;  4UOJ A;  3PVB B;  4N9H A;  1JZ3 A;  1RUE 1;  2HWC 1;  4Q4V 2;  3ZPO A;  3RZH A;  2YMZ A;  5FZG A;  1R09 3;  1CIW A;  4MAD A;  3WOG A;  4NWW A;  5BNQ A;  1TME 3;  5BUV A;  3LEI A;  1OFS A;  1ENQ A;  1RIT A;  2C9K A;  4IV1 C;  5FZE A;  2GN3 A;  1CGP A;  4BJ0 A;  5DG1 A;  1GWL A;  3J8F 2;  3FN9 A;  4I09 A;  3K4Z A;  2XUE A;  4HN1 A;  1AR9 1;  2AR6 A;  3K75 B;  1GAN A;  3R6S A;  2WNV C;  4DO0 A;  4M3C F;  5C3Q A;  1LOG A;  3C7G A;  3KT1 A;  5HV0 A;  1OPM A;  2WLQ A;  3UK9 A;  5K0U C;  3C7H A;  3D0S A;  1R08 2;  4IDZ A;  1REE A;  1U5I A;  1WCK A;  1UO9 A;  1YNA A;  1W05 A;  1YQ5 A;  2QJV A;  2IXL A;  3FFZ A;  2V4V A;  4IEO A;  4R52 A;  4XAB A;  1QJX 2;  2P17 A;  4C0H A;  4IE7 A;  4LBQ A;  4LA2 A;  2O0O A;  1S0G A;  2JEN A;  4UI9 L;  2BPA 2;  1NAE A;  1W6M B;  2AEZ A;  1X50 A;  1BEV 2;  3FUQ A;  3MW4 A;  2VUC A;  1SFY A;  3MLK A;  4FOY A;  3I49 A;  4TWT A;  1WLD A;  1B09 A;  2W39 A;  4BM8 A;  3C7O A;  5BV6 A;  2J7M A;  1G9F A;  2VMD A;  3UKT A;  3WG1 A;  2CWM A;  3NNM A;  1UY1 A;  4HSL A;  2JKB A;  3TEZ A;  2C26 A;  2XLF A;  2KXL A;  4HAN A;  5JZG A;  4CSW A;  1DYK A;  3DV8 A;  1LHN A;  2D93 A;  1RHI 1;  5CEH A;  2HJI A;  4J1W A;  2HYX A;  1R09 1;  1WUV A;  3LOI A;  3MYX A;  4D7S A;  4BOW A;  2QQV A;  2IC1 A;  5FYZ A;  5JOY A;  5FY8 A;  4QHZ A;  4XIK A;  4URA A;  4TLF A;  3H50 A;  4YNI A;  1SDW A;  1C5H A;  3ZX7 A;  3U11 A;  5K0U B;  4FTB A;  2X53 S;  5EPA A;  1HV1 A;  4IE0 A;  3SH4 A;  5G04 L;  4NHM A;  5F9T A;  5FO8 B;  3O5S A;  1KXG A;  2D6P A;  2IUW A;  1NCR C;  2EXJ A;  2EF6 A;  3A23 A;  3RGB A;  1H9W A;  5JR7 B;  3JQX A;  4A7Z A;  4Z8B A;  1GUI A;  3RZK A;  1SBD A;  3ZKU A;  1MS3 A;  3S30 A;  1UW8 A;  2WS9 1;  1NA1 B;  5LBB A;  3V0A A;  1CAW A;  2VGD A;  2ZX3 A;  3HAG A;  4WVV A;  3RYR A;  4QXC A;  4CE8 A;  4KWU A;  2E51 A;  3D6E A;  2JG9 B;  1VRH 1;  1L7L A;  3BPS A;  1BEV 1;  1D4M 2;  3HVD A;  1L3J A;  1ZM1 A;  4D6Q A;  3H7J A;  4K6B A;  3UJO A;  3WG4 A;  1E57 A;  3VZM A;  3TAY A;  3AKT A;  3VZL A;  3OGG A;  2RS1 1;  2WT1 A;  3VBU C;  4AFB A;  1GP4 A;  1SHW B;  3WCR A;  1RUJ 1;  2YU2 A;  4IL7 A;  1CPM A;  5E8A A;  3VD7 A;  1XRU A;  1LOB A;  4FOQ A;  5BY5 A;  4IV3 A;  4RN5 A;  4IEU A;  1BCX A;  3UGG A;  3FLP A;  1KJR A;  2ZXQ A;  4U36 A;  2JE7 A;  1WZX A;  5IK7 A;  4QX0 A;  3GHM A;  4WVZ A;  1DGW X;  2RS5 3;  4FFH A;  1QJY 3;  2W1Q A;  1K5M B;  1OBN A;  3E5U A;  3LEG A;  4UT5 A;  4ZON A;  4ZXE A;  2O8Q A;  1HB1 A;  4CDU C;  1W28 A;  3LSD A;  4XVH A;  4AL9 A;  1EAH 3;  2Z4F A;  1PK6 A;  1SLA A;  3A7Q A;  4KU7 A;  5L19 A;  4WBB A;  4XDO A;  3SCH A;  3UGF A;  2HWE 2;  1S0I A;  1YXW A;  2XXZ A;  3E6C C;  3AKQ A;  1IPJ A;  4LBQ B;  4QKF A;  3K2O A;  1N47 A;  1JZ7 A;  2R1D A;  1L7Q A;  3C7F A;  1E5H A;  5EFU A;  1FNZ A;  3ZYJ B;  2X10 A;  2F4L A;  3IB3 A;  2HBT A;  1BJQ A;  5ABJ B;  4PQ9 A;  1PZ7 A;  1W6M A;  2RMU 1;  3OUH A;  4Y3O A;  1ZRI A;  1QMJ A;  2QQJ A;  4AWD A;  2BNO A;  2PYT A;  1LOC A;  1VRH 2;  2YPJ A;  3GZU C;  1PGL 2;  2J1U A;  3J8F 1;  3MIC A;  5FMO L;  1REF A;  2W52 A;  4OVE A;  1AXK A;  1BBT 2;  1VBC 3;  2ARX A;  4QQO A;  1AR8 3;  2C6S A;  2D6K A;  3NNL A;  3ABZ A;  2MPF A;  2RS1 2;  2BDR A;  1LTE A;  4IEX A;  1RUC 3;  2HWB 2;  4OCT A;  2CDO A;  2A70 A;  1Z78 A;  4AHY A;  2NP0 A;  2BBA A;  2GAU A;  2PHR A;  2OQ7 A;  1CD3 G;  2QDR A;  2VEC A;  2WQ4 A;  3N7M A;  3PNA A;  2ETE A;  4Y5T A;  4E4D X;  3GM8 A;  4R4X A;  3RDI A;  4WVM B;  5FDB A;  1O3R A;  2FMD A;  1PO2 2;  1V70 A;  5C3R A;  3B3Q E;  4QGL A;  1OT5 A;  1MZ5 A;  4LOT A;  2QCS B;  4J1X A;  1R1A 2;  4IE6 A;  1HDK A;  4Q4W 1;  1UY2 A;  3ZIW A;  3KF5 A;  4A3Z A;  2HWC 2;  4Q4V 1;  4AQ2 A;  2ARB A;  2ZHN A;  4DFS A;  2CHH A;  1LOD A;  1OOP A;  4D7Y A;  4IE5 A;  3TEY A;  1GQP A;  4CDW B;  3AZW A;  3BAL A;  4GMP 0;  4Q5O A;  4OHX A;  4Q1R A;  3ZMO A;  1PX4 A;  4FPJ A;  3ZFE A;  1Q56 A;  1BVV A;  1OF3 A;  2J1A A;  3KCY A;  4XFF A;  2XPJ A;  5IFT A;  4KBB A;  1C5I A;  1JUH A;  3EMR A;  4ZZ8 A;  4G4F A;  1YLL A;  1ULF A;  1Y4W A;  3NV3 A;  1WME A;  4B4P A;  3IMN A;  4X8P A;  2VOW A;  5E88 A;  2E63 A;  4B7K A;  2XGX A;  1H9P A;  1PM7 A;  1PMI A;  3TOJ A;  1ALY A;  1WCU A;  3IZO A;  5FYI A;  3WUC A;  4IES A;  3ZN6 B;  4HKW A;  1CZT A;  4Z82 A;  1H30 A;  1COV 2;  1QJX 3;  2YC0 A;  3LD8 A;  3OUJ A;  5A6X A;  4P08 A;  4O65 A;  1ND2 C;  2HH9 A;  4LBQ D;  3OSD A;  4DUW A;  4QXH A;  1AR9 3;  1LUL A;  3HD8 B;  1QNY A;  2W1W A;  4NRO A;  3WQB A;  5CFD A;  3ZLI A;  3U0Z A;  4DB5 A;  1W2T A;  2DBN A;  3T2O A;  3KWV A;  3DXT A;  2H6B A;  3V64 A;  4B4Q A;  2BTV C;  4QPG A;  4LBO A;  1AYN 2;  3PUH A;  1MVQ A;  4QGN A;  5JLV A;  2QQW A;  1DU3 D;  1XNB A;  4AFC A;  1D4M 1;  1JMU B;  3USU B;  2D40 A;  3OD4 A;  3K48 A;  1UY0 A;  4FPO B;  5JSR A;  3ILR A;  4N7I A;  4XUR A;  4ET7 A;  4ZPI A;  3VBH B;  1S2B A;  3VBS A;  3ZYP A;  3VBU A;  1OD3 A;  3CJI A;  2ZGQ A;  1RUO A;  4CDQ A;  3JZV A;  4KH9 A;  3TBD A;  2D7F A;  5C4W B;  5IT6 A;  4CXY A;  1NE6 A;  4GIQ A;  1VBB 2;  2YPD A;  4P9G A;  1W8F A;  3AP5 A;  3ON7 A;  3WCS A;  1A8M A;  1ST8 A;  3NNG A;  3H7Y A;  4B1L A;  1SLC A;  2VUD A;  3CBN A;  3H0O A;  2AEN A;  2VQA A;  1ULD A;  3NWK A;  1HQW A;  1ZRD A;  3LCP A;  4KWK A;  1QXR A;  5L9B A;  3O7O A;  1GZC A;  4YYO A;  2R32 A;  4P5H A;  3WF2 A;  3WX5 A;  1UWW A;  3VHP A;  3FL7 A;  3N36 A;  4QM8 A;  5EXO A;  2UUR A;  2VR4 A;  4GB3 3;  4XYX A;  3KCX A;  3X29 B;  2GME A;  4JGY C;  2VCA A;  3KS7 A;  3AMP A;  4YM3 A;  4AGV A;  4LKF A;  2YBK A;  1W39 A;  2W5F A;  3K51 A;  4UXA A;  4NRP A;  2D6L X;  2RHP A;  3ZDV A;  1RGS A;  1CON A;  1POV 0;  3DKW A;  4ITC A;  4Y20 A;  5F2S A;  5LK7 B;  4AI0 A;  3KV9 A;  2XDV A;  3AJZ A;  3HOB A;  4GJZ A;  4AEK A;  3WNK A;  3I59 B;  1GV9 A;  1QJU 1;  2Y34 A;  3U14 A;  3QOP A;  1OHF A;  2IZW A;  3EYP A;  2GH8 A;  4MLO A;  2DUQ A;  3KHB A;  4LE3 A;  4QU2 A;  1N3P A;  4AR2 A;  4FOW A;  4H2A A;  5FYC A;  1W8Z A;  3V0B A;  4P9Y A;  2DCT A;  2B45 X;  2ZGT A;  4WZC A;  4PT6 A;  2QQK A;  2HWE 3;  2QZ2 A;  4PQQ A;  5FPB A;  4HT1 T;  3ACG A;  4H55 A;  4FTS A;  5BNN A;  4L9B A;  3AP6 A;  4X6R B;  1VB2 A;  3JXS A;  4Q4V 3;  4EN0 A;  2E7Q A;  2IVI B;  5JIU A;  3BTY A;  1AJK A;  2VOX A;  5JPN B;  3MGU A;  4CEY C;  4CUB A;  1PNG A;  4FPE A;  4XZU G;  2B9U A;  2EIE A;  2XWB B;  4YVW C;  1NQD A;  5B4X A;  4PJY A;  1TMF 2;  1X9T A;  2VQT A;  3U75 A;  2QQI A;  2YDE A;  3IIA A;  5F3I A;  4GB3 1;  4HKO A;  4HKL A;  4AZZ A;  2W87 A;  2JWP A;  2ID4 A;  1T6G C;  3AP7 A;  2HWB 1;  1YQ2 A;  3J7M A;  4SLI A;  4AQT A;  5G05 L;  1RUH 1;  4FP2 A;  2A6W A;  3Q8B A;  2WJS A;  3M2M A;  4JHZ A;  3SH5 A;  4HSJ A;  3WR0 A;  4ZZ5 A;  1NCQ C;  3NL1 A;  1MEC 2;  1FOD 3;  4H7M A;  1QOO A;  4LOS A;  1HB2 A;  3VBO A;  1GOG A;  1QJU 2;  4BH9 A;  4OQ8 A;  5GLV A;  2J1R A;  5FMO S;  1BEV 3;  1H0B A;  2OT7 A;  3LE0 A;  4MX3 A;  3E5X A;  3HEI A;  1HJF A;  1X36 A;  2Y60 A;  5GZE A;  2HWD 1;  1H6Y A;  2HWF 2;  3ETQ A;  3LOB A;  2J1V A;  4DXZ A;  3IDC B;  2ZGR A;  4JGY B;  1IS6 A;  3BU0 A;  1MS0 A;  2GDF A;  3S0M A;  4DRV A;  1LKN A;  3LPF A;  2R04 3;  5F7U A;  1RUE 2;  1AYM 3;  2CL2 A;  2BYV E;  2WZE A;  1AR7 3;  4GUL A;  4NRM A;  2D5F A;  2GN7 A;  4RR3 B;  4DS0 A;  4LO4 B;  3A4U A;  4QB2 A;  4AEM A;  4C90 A;  1V9U 1;  2OZ6 A;  2P3I A;  3M7A A;  4B29 A;  4HET A;  1DQ2 A;  2G9Z A;  3I4I A;  5FXZ A;  2JDZ A;  5A7W B;  3VHO A;  3ZYR A;  3ZXF A;  4AVA A;  4CDU A;  1RMU 2;  4MUV A;  1OA2 A;  4CPB D;  2QQL A;  1SDD B;  2VW1 A;  3WNM A;  5T52 A;  4LUL A;  3MIE A;  4Q0P A;  4H3W A;  1VBB 1;  2A71 A;  4FPH A;  1RUG 1;  5DUX A;  4LA3 A;  2PLV 1;  4XMI A;  1YFX A;  2MEV 1;  5GZC A;  3V65 A;  1N3O A;  1N1V A;  5E6H A;  3EXU A;  5FP4 A;  1JW6 A;  2O8O A;  4YVS B;  4FXK B;  1N1Y A;  5FZK A;  3KMH A;  1S0C A;  4ATF A;  4BU2 A;  5KXE A;  1I5Z A;  1XSQ A;  4Q27 A;  5L9R A;  2DCY A;  2PA7 A;  4YW1 A;  4QQH A;  5FKC A;  3N9O A;  5GM0 A;  4CZS A;  3H1Y A;  2WUH A;  5FBZ A;  2XBO 2;  5CA6 A;  2BFU L;  4BQ3 A;  3BUC A;  5HV4 A;  2ZHM A;  4HBN A;  4LLF A;  4CCE A;  4XCA A;  5ISL A;  1GOH A;  1FAY A;  4R8H A;  3RJR A;  5BNP C;  4LR4 A;  1BXH A;  3AZV A;  1B35 C;  3THD A;  4IEZ A;  3S5Q A;  2ZX4 A;  2B7Y A;  1CAU B;  2XVK A;  1SBE A;  1UOB A;  4OUL A;  5I91 A;  2CYF A;  4XBQ A;  5KXC A;  4NII A;  5HXM A;  2J1T A;  4PF5 A;  4COZ A;  3KD4 A;  4Y1Z A;  4AW7 A;  2A3X A;  1W2O A;  5DDJ 1;  2Z5W A;  1C4R A;  1A78 A;  1EV1 3;  1H8V A;  1UN1 A;  2ARA A;  3OGS A;  4E4S A;  4EZ4 A;  4COV A;  1YRZ A;  2XH6 A;  4WV8 A;  2E6V A;  3THP A;  5CG9 A;  2X29 A;  2YC4 A;  1AXY A;  3U4S A;  1ODM A;  3POS A;  1DLL A;  1APN A;  2ZMK A;  4DXS A;  5K8S A;  4FSJ A;  3FX3 A;  4WM7 C;  4XFA A;  3APB A;  3GBF A;  1CX4 A;  4OMC A;  4QPI B;  3ZN5 A;  4MGS A;  2Z69 A;  3USU A;  3WDV A;  1BYH A;  1V6N A;  3JD7 3;  4OYU A;  1ACC A;  2RS3 2;  3K4D A;  3SKV A;  1DGR A;  3I97 A;  4XJU A;  2DDU A;  4A6S A;  2VZQ A;  4L8Q A;  4CP1 A;  3O1T A;  4D6S A;  2XL7 A;  3MPB A;  3VGI A;  5KXD A;  4QAW A;  5A1F A;  3I3B A;  1UCX A;  1FXZ A;  4LIV A;  5D8A A;  4XZP A;  3OBR A;  3AYA A;  2VVE A;  4ORF A;  3RI8 A;  2EXH A;  2YV8 A;  4NN0 A;  5EJ1 B;  3UV9 A;  2SLI A;  1W8U A;  1A6C A;  2VUL A;  5DAX A;  4CDW C;  4QPI A;  2GU9 A;  2QZ3 A;  4R9C A;  4AF9 A;  2X09 A;  2WNU A;  1RUF 2;  4QKD A;  4YW2 A;  5C9A C;  4HVO A;  4ATE A;  4QPG B;  3WQ7 A;  2ZX1 A;  2Y38 A;  4PLM A;  3THC A;  2HWD 3;  2PAK A;  4Q4X 3;  2YXS A;  4NHK A;  1AL2 2;  4ZXK A;  1XND A;  4XBL A;  4YGD A;  2RM2 1;  4Y4R A;  5KHH A;  2W94 A;  4EWA A;  5J96 B;  1VBE 2;  4FFG A;  3P3N A;  2NYY A;  2W95 A;  1HRI 3;  2JDM A;  3J26 N;  3PVN A;  2FDJ A;  5GZF A;  3IKW A;  1W2A X;  3PL0 A;  4MGT A;  2GND A;  1QKQ A;  5C71 A;  2PHU A;  2ZGS A;  4NIH A;  2VNG A;  2DCJ A;  1GIC A;  5LA0 A;  1JTZ X;  4EWE A;  4MXW B;  2DCZ A;  4YG0 A;  5FZB A;  4CXX A;  5FZH A;  3POF A;  1LOE A;  1QOS A;  1RXG A;  2ZS6 B;  2Q8O A;  4N53 A;  4QX5 A;  1EV1 1;  5CB7 A;  2RS3 1;  3LEM A;  3ZKY A;  5I0R A;  1UOG A;  2RM2 3;  4CUC A;  2LTN A;  4IEY A;  2WO3 A;  3VB9 A;  2WNE A;  1Y9Q A;  3B00 A;  4LK6 A;  5FZF A;  3PUI A;  5LA9 A;  2W91 A;  5A32 A;  1C57 A;  2XQR A;  1UY4 A;  2UYB A;  3POW A;  4FI9 A;  3ZFE B;  1SBF A;  3CL1 A;  4RFR B;  4BWO A;  2J1S A;  2X5I A;  3CMG A;  4HMZ A;  3TYJ A;  4MXW A;  3QD6 A;  5T54 A;  2ERF A;  2XR4 A;  3J4U H;  4M00 A;  3N7K A;  3SKJ E;  4FPY A;  4UFH A;  2JIC A;  1F4H A;  4AI2 A;  3ZFE C;  3ZOI A;  1DDL A;  1PNF A;  3ZSK A;  3POJ A;  5FZL A;  1S2K A;  1ENR A;  4EJR A;  5F6L B;  5A7W A;  4CDU B;  4JRA A;  4XFI A;  4URT A;  2XBO 1;  3VKO A;  1LGB A;  2VVF A;  4AVB A;  2R06 2;  5JXJ A;  3E5Q A;  1YFW A;  5I8S A;  3HIF A;  1H1A A;  3LKJ A;  1VBE 1;  5JOW A;  4V2W A;  2J1E A;  4QPY A;  3ST7 A;  1X7N A;  2I07 B;  2KA3 A;  1S0B A;  3H3L A;  3IAP A;  3O1V A;  2AEY A;  4CPB A;  4QX8 A;  4BMB A;  1BBT 3;  1UQX A;  5DZG A;  3AMN A;  4FCA A;  3QBQ A;  1YFU A;  1CZV A;  4LIU A;  4NPM A;  1YQC A;  2IXC A;  5JXI A;  3HPN A;  4Q4X 2;  3GBG A;  4WM8 B;  2EID A;  1FT9 A;  4XAA A;  5J98 B;  3R05 A;  4E9K A;  3LDR A;  3TRS B;  2VMI A;  2ADE A;  2OQ6 A;  4PLN A;  1IKQ A;  1YJK A;  2Y6F A;  4CU7 A;  2XUM A;  1QIQ A;  5DUV A;  4AED A;  4RD7 A;  1K45 A;  4W50 A;  1GZ9 A;  3ME2 A;  1UZY A;  2PHF A;  3LEK A;  2YUE A;  4K40 A;  2R1B A;  3CDZ B;  4YSF A;  1JHN A;  4JAA A;  3GAL A;  1XBF A;  4AAX A;  3HN1 A;  1KRI A;  1I5P A;  3OPW A;  2XQX A;  2PMW B;  4DOU A;  5H9S A;  1DQ0 A;  1ZBE 1;  1LAJ A;  1KS4 A;  3ZR5 A;  4I2O A;  2JE9 A;  1MS8 A;  5JXH A;  4OZO A;  1VBC 2;  3I2I A;  4XUQ A;  4JGY A;  5FXX A;  3ROU A;  1W6P B;  1N1S A;  1BVP 1;  4HL0 A;  4BA6 A;  4FFF A;  5CIS A;  4MG2 A;  3OY8 B;  5LBE A;  1EAH 1;  5APA A;  4KU8 A;  4ZU4 A;  2JG9 C;  3M8L A;  4PCR A;  5FPA A;  1JI6 A;  1PVC 1;  3D8C A;  3LDK A;  2TEP A;  2GP3 A;  1F5J A;  5A7Q A;  2WZR 2;  3WEZ A;  3ZYH A;  2DU0 A;  4HON A;  4PI0 A;  2ZGN A;  5C4W A;  1S0J A;  1OQD A;  2NMO A;  3ACL A;  3U07 A;  3JU9 A;  5BNO A;  5T5J A;  3O1U A;  2JG9 A;  1CZS A;  1DCS A;  1H2L A;  3GCX A;  4NVP A;  3GNE A;  1KFX L;  1FAT A;  4AI9 A;  2UY8 A;  4E27 A;  1UYX A;  5FLH A;  1RVF 1;  4XTP A;  4IEV A;  4BLJ A;  3VKM A;  1XQN A;  3T2T A;  3J7L A;  1MVE A;  1IZ3 A;  1NT0 A;  3I59 A;  2VOV A;  5FKB A;  5DMY A;  1YIP A;  3LAG A;  1POV 1;  4DY5 A;  4R9B A;  3KV4 A;  4AQ6 A;  1YQ6 A;  3QH7 A;  3P3P A;  5B2G B;  1H2K A;  5FYV A;  2H0B A;  4RHV 2;  3OBA A;  3KCC A;  4AOC A;  1JYN A;  1OQE A;  2JB8 A;  3LQC A;  4YG3 A;  4F8A A;  4ISQ A;  4DZG A;  5A3W A;  1RVF 3;  2DBI A;  3DKQ A;  2D44 A;  2WIN B;  4LIT A;  1DG6 A;  2WS9 3;  1LU1 A;  1ZA4 A;  1ZVF A;  1H4G A;  3JD7 1;  4QD2 A;  3AFK A;  3RYK A;  3AB0 A;  3N9L A;  3T4V A;  3DXU A;  1MQT C;  4RA0 A;  5JSP A;  5J36 A;  2HLE A;  1RUF 1;  4W4Z A;  5FAX A;  1WLC A;  5FXV A;  5CFC A;  2K0G A;  1OI6 A;  1ULO A;  4KG8 A;  2OZJ A;  1FX5 A;  5A7N A;  4A44 A;  2HWF 3;  4GWN A;  1WA6 X;  2VUA A;  1KIT A;  1XE7 A;  3FE5 A;  2AAC A;  4QQ2 A;  3ECQ A;  3OEB A;  4OZX A;  3NAP C;  2WFF 3;  2VZR A;  3A21 A;  5KC5 A;  4OUM A;  2CV6 A;  1AF9 A;  4LKS A;  4S2D A;  4ARY A;  2ZEW A;  5D1I A;  4AFD A;  4BK4 A;  3I2H A;  4O7X A;  4F3J A;  3MV1 1;  3AVS A;  3MUZ 1;  2B8M A;  3KM5 A;  4KG0 A;  4LE4 A;  4QDQ A;  5GLW A;  5GLZ A;  1UIJ A;  2ATF A;  3HT1 A;  4AHW A;  2CGP A;  5A6Z A;  1Z7S 1;  4LO7 A;  1QJE A;  3OPZ A;  1R64 A;  5DAQ A;  3VDB A;  1TMF 1;  4L99 A;  5F5C A;  1N3Q A;  2VG9 A;  1I3H A;  1HN0 A;  1UYZ A;  3DF0 A;  2R04 2;  2QTW B;  2CAV A;  3ACH A;  1SFN A;  3MPP G;  5SV8 A;  2GC1 A;  4BQ1 A;  1AYM 2;  4P02 B;  4BXS V;  1HV0 A;  5DAV A;  1BK0 A;  2ZAC A;  2ZEX A;  3RZJ A;  2JJ6 A;  4D69 A;  2DUO A;  1K5M C;  2Y64 A;  1AXZ A;  1H2M A;  1ONA A;  1W99 A;  3D0J A;  3DCQ A;  5DG2 A;  1S0F A;  4IEQ A;  4UFM A;  2WFF 1;  2VMC A;  4CCD A;  5FYU A;  2Y6J A;  2R07 2;  5IVJ A;  1HLC A;  5HBA A;  1HB4 A;  1UAI A;  3VBS B;  3TN9 3;  4UAP A;  4NIG A;  1SPP B;  4Q0Q A;  5DXD A;  1MZF A;  5F5Q A;  4OLL A;  4PDW B;  3MF6 A;  2Q8E A;  4YW3 A;  4IET A;  4ZU7 A;  3FBY A;  4E4H A;  4GKX A;  5FP3 A;  4QHO A;  3ZN6 A;  1AR8 2;  3HR9 A;  2GC0 A;  1JN2 P;  4AVT A;  3MIB A;  4FVV A;  1W6Q A;  4GH4 C;  5FQ0 B;  3LSE A;  3BB6 A;  4N9I A;  5FUI A;  3VBF A;  1V9U 2;  3C3V A;  1TE1 B;  4BZ4 A;  4CEY B;  2W1S A;  4LNV A;  5IW0 A;  3W5M A;  4P9L A;  2ENR A;  1W3V A;  3LDB A;  1SPP A;  1UKG A;  1ZNP A;  1O91 A;  2JG8 B;  1POQ A;  2VW2 A;  1CVN A;  1C28 A;  4FFI A;  4XDP A;  4LO8 A;  2WN2 A;  4YGE A;  2VQ0 A;  3BIW E;  1D7P M;  2LW8 A;  1VRH 3;  3SNM A;  2GC3 A;  3WT3 A;  2WWU A;  5FJK A;  3WF0 A;  4YVW A;  3VDA A;  2VQU A;  2X8K A;  1QGL A;  2WA3 A;  3OYW B;  4U2A A;  5FK8 A;  4BDV B;  2EIG A;  4YW6 A;  2WNU B;  5AFE A;  3SHR A;  3HWJ A;  1V6K A;  3EB7 A;  3P6B A;  3WW1 A;  5BNO C;  4UW4 A;  1WW6 A;  5FOB B;  3H8U A;  2JD9 A;  1O8P A;  2WSV A;  5BPX A;  1GQG A;  1Y43 B;  2WWS A;  1V6M A;  3MW2 A;  5CNA A;  5GAL A;  3TWI A;  5J1X A;  1QXJ A;  3EO6 A;  5L73 A;  4BQY A;  3UGH A;  1F5F A;  2RS5 1;  1QJY 2;  2ZGU A;  4WM7 A;  4PHZ A;  2D5H A;  3WXP A;  1QF3 A;  1LHU A;  1EPW A;  2VNV A;  2ZJC A;  4XHX A;  3SEE A;  2GMP A;  1JU3 A;  1PVC 2;  1ZBA 2;  3I2D A;  5F5I A;  3AP4 A;  4JKK A;  3VD5 A;  2D43 A;  4UFJ A;  3PLQ A;  4LUK A;  3ZFG C;  1MEC 3;  2VZU A;  3KVB A;  4D8M A;  3Q8C A;  5BYN A;  5F39 A;  1UXZ A;  2CGO A;  5T3N A;  5A3P A;  1NLQ A;  4M01 A;  3DEM A;  1NZI A;  5FRE A;  3WNL A;  4QKB A;  3MBW A;  5JCT A;  2JIJ A;  3H1W A;  2VCB A;  5LAS A;  5L36 A;  4Y4Y A;  5T5L A;  3WW4 A;  2Y6L A;  4L2N A;  3POB A;  1AX1 A;  2QQP A;  4AVS A;  1K5M A;  4OI1 A;  4B1M A;  1XC6 A;  4K9S A;  4AG4 A;  5FLJ A;  4BME A;  1OA4 A;  5DUU A;  5FZ4 A;  1NLS A;  3NW4 A;  1XSR A;  2FCU A;  3NAP B;  1JYV A;  4ES9 A;  2JD4 A;  2I74 A;  1RUI 2;  1ZZ9 A;  1LES A;  3JQW A;  1NXD 1;  3GF6 A;  2ZPX A;  3G6J B;  4GWI A;  4HFS A;  4K8R B;  4BQ5 A;  2X5I B;  1R1A 1;  4V1P A;  4A3X A;  1PIV 1;  4QQP A;  1LED A;  3GBW A;  5J7M A;  3GGL A;  2LM3 A;  2B5H A;  4CP9 A;  1W9F A;  5F5A A; 
#chains in the Genus database with same CATH homology
 5A80 A;  4AI9 A;  2Q8C A;  5FV3 A;  4IGO A;  5LY1 A;  5A3N A;  5FZO A;  4GD4 A;  5FYI A;  4QU1 A;  5F3I A;  4CCM A;  1VRB A;  3LD8 A;  4GJY A;  4EYU A;  2XML A;  4QXH A;  4D6S A;  3PDQ A;  3K3O A;  3NJY A;  5FYU A;  5A1F A;  5IVJ A;  3PU3 A;  3OPW A;  3N9P A;  4QXC A;  3ZLI A;  4LIV A;  4V2V A;  4CCO A;  3DXT A;  5LW9 A;  5FBJ A;  2GP5 A;  4Y33 A;  4C8D A;  5FWE A;  5FXW A;  2PXJ A;  5FUP A;  4DIQ A;  3N9Q A;  5FXX A;  2Q8E A;  4D6Q A;  2OT7 A;  5LWB A;  2W2I A;  4E4H A;  4BXF A;  5FP3 A;  3PUA A;  5FY5 A;  5IVB A;  5A7O A;  4QWN A;  5FZI A;  5FPA A;  2YU2 A;  5F3E A;  2GP3 A;  5A7Q A;  3K3N A;  5ANQ A;  5FY0 A;  4HON A;  4GAZ A;  3AVR A;  5FZD A;  3PTR B;  2YBS A;  5IW0 A;  3PUS A;  5FZ7 A;  3UYJ A;  5FP8 A;  3LDB A;  4CCJ A;  5FZ8 A;  4ASK A;  5F2W A;  4Y4R A;  5A7P A;  4XDP A;  5FZ1 A;  5F37 A;  5FP9 A;  5FY9 A;  2WWU A;  5FJK A;  3U78 A;  3PUR A;  4IGQ A;  5FYT A;  5FXZ A;  5A7W B;  2Q8D A;  2YPD A;  4XDO A;  5F3C A;  5FZB A;  2P5B A;  5FZC A;  5FZH A;  3ZPO A;  3KV4 A;  5A3T A;  2XXZ A;  5FZG A;  4UF0 A;  5FYV A;  5FZ0 A;  3K2O A;  5FYS A;  5IVE A;  5FYH A;  5FZ3 A;  5FZE A;  4EZH A;  4CCL A;  4BIS A;  4D6R A;  5F32 A;  5FZF A;  4AAP A;  5A3W A;  5FWJ A;  2XUE A;  3OPT A;  5FJH A;  4DO0 A;  4LIT A;  3AL5 A;  4Y3O A;  5FPV A;  4IGP A;  5E6H A;  5IWF A;  5LY2 A;  3RVH A;  2VD7 A;  5FP4 A;  4LXL A;  3N9L A;  5IVV A;  5FZK A;  3DXU A;  4HOO A;  4CCK A;  5FY4 A;  4BU2 A;  5FZM A;  5IVC A;  5FYM A;  2YBK A;  2OS2 A;  5FPU A;  5FZ6 A;  5F5I A;  5FXV A;  5FY7 A;  3N9O A;  5K4L A;  3AL6 A;  5A7N A;  3KVB A;  5F2S A;  4NUB A;  5FZO B;  4TN7 A;  3KV9 A;  5FZL A;  4CUG A;  5F39 A;  2XDV A;  4CCN A;  3N9M A;  5A7S A;  5A3P A;  2OQ7 A;  4GJZ A;  5ISL A;  3KVA A;  5A7W A;  5IVF A;  2YU1 A;  3PUQ A;  4UF0 B;  2YBP A;  3KV5 A;  5FZ9 A;  4QXB A;  5F3G A;  5FYC A;  4V2W A;  3AVS A;  5FY1 A;  5FPL A;  5FZ4 A;  4QX8 A;  5FUN A;  5FPB A;  4CSW A;  4QX7 A;  5FP7 A;  5CEH A;  5A1L A;  4LIU A;  3PU8 A;  5FZA A;  5F5C A;  2OX0 A;  5FYB A;  5FYY A;  2WWJ A;  4EZ4 A;  3KV6 A;  5IVY A;  3N9N A;  5FYZ A;  5KR7 A;  5FY8 A;  2OQ6 A;  4URA A;  3U4S A;  5F5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...