2OQKA

Crystal structure of putative cryptosporidium parvum translation initiation factor eif-1a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
94
structure length
94
Chain Sequence
b'DKRELVFKEEGQEYGQVQRMLGNGRLDAYCFDGQKRLCHIRGKMRKKVWVNPGDIVLVSLRDFQDSKGDIILKYTPDEARALKSKGEIPETTKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative translation initiation factor eIF-1A
publication title Crystal structure of putative Cryptosporidium parvum translation initiation factor eIF-1A
rcsb
source organism Cryptosporidium parvum iowa ii
molecule tags Translation
total genus 23
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2oqkA00
1MIUA 4X6AH 4X66Q 1Z47A 1YI2A 3CC2A 1SMXA 4DV6L 2Q2IA 1X65A 2NZHA 3CCJA 3ER0A 4NXMQ 1EOVA 2OQ0A 4HIOA 1R9TH 3K0XA 3K81C 4A3IH 3GTLH 1PH9A 2JQOA 3J81c 1VQEA 3I4NG 4A3BG 4JI6Q 1T9HA 1HNZL 4DR3L 4LFCL 2VL6A 1TXYA 4YHHQ 5IYCH 3HOUH 4LNQA 5ELNA 1JJGA 1YJ9A 5FJ8H 2R7FA 3H0GH 3H15A 3HOUG 4QIWE 1K8GA 4JOIC 2K4KA 2E8GA 2CWAA 5C3EH 1PH5A 2HHHL 4GLVB 1NE3A 3TQYA 3S1NH 4K0KL 1Q1EA 2BA0A 1SLJA 2KCTA 3GTKH 1GD7A 3I55A 1Q12A 1KQSA 4LFBL 3L0OA 3L7ZC 2MNAA 1UWVA 3FKIH 4R4QA 4LUOA 3SGIA 4GOPC 2R6GA 5IYDG 5IT9c 1HNXQ 2YYZA 2AWOA 3KFUA 1HJPA 1WOCA 5LMUQ 2ES2A 2N78A 1O7IA 1SFOH 2JE6I 1Q81C 3PIPA 1PVOA 2K5VA 4P74A 3JC66 3TEHB 1Q46A 5C0XJ 1EYGA 3HOYH 1YEZA 3HOVH 1QVCA 1WCMH 2QEXA 2RF4A 4LF5L 1VQHA 3K7UC 1L1OA 2E5LQ 3ICEA 4JI2Q 1XNQQ 4LF6Q 4JI7L 4LF7Q 4PMWA 3H3VI 3UDIA 1CSQA 1KHIA 4GNXA 1VQCA 4AYBE 4GN5A 4LUVA 2UU9L 1YJWA 1FJGQ 3TS2A 2Z6KC 5GQOA 1QUQA 1U0LA 3RN2A 1HH2P 1K9MC 4YWMA 2VQEL 4B3MQ 4NXML 4UPAA 4OONA 4IPCA 1V1QA 5M3MH 1GKHA 2K5NA 2Z0SA 3T1HL 3H3VH 1E1TA 1TWAH 1Y14B 2VUMG 5C0XG 4QY7A 3M4PA 1A63A 2EXDA 1L0WA 4AYBG 4JBMA 3KYHC 3OTOL 3CQZH 2VNUD 4JV5Q 1JMCA 4YCWA 1PH6A 2B63G 5C4XH 2A8VA 5M5YH 1A0IA 2Y0SE 4KLKA 4DR5Q 4A3GG 2K50A 3UDXA 3STBD 1V43A 4YY3L 4X65Q 3RN5A 1CSPA 2ZTEA 1D8LA 3EIVA 1HR0W 1N32L 1Q82C 1U5KA 5LMNW 1HR0Q 1KAWA 4DR7L 4NXNQ 2UXCQ 2I5HA 2GN5A 3J80c 3CCRA 2UUAQ 2OCEA 3IRBA 3BZKA 1CKNB 3CC7A 1E24A 2MQHA 3CMAA 5GROA 5LMUL 1K8AC 1VQOA 2NN6I 1JJ2A 1VQNA 3ULJA 3CCMA 1IBKQ 1YVCA 4A4IA 3HOWG 2JEBI 4DV4Q 3GDEA 4O0AA 1E1OA 4DR2Q 1QZGA 4JI2L 3CCLA 3F8TA 1E22A 3ERSX 1S40A 4DUYQ 1B70B 3CPFA 5H1SE 4LF7L 3PF4A 1HZAA 3RZOH 2I5MX 1EFWA 3UDFA 2Q2UA 3PF5A 1EIYB 1VS0A 1JJCB 2NN6G 4JBKA 1XPUA 4BA1I 3CAMA 1P16A 2JK8A 2CFMA 3ULPA 4ME3A 4BY7H 5FLMH 1LTLA 3DM3A 4LFAQ 4DPGA 2R93G 4OXPA 1I5FA 2WAQG 2YU9H 4K0KQ 4A76A 4LF4Q 5BR8Q 1A8VA 3NELA 5FLXc 4L5TA 2OTJA 4A3FG 3S2DH 1UEBA 2FXQA 3STBC 1VQ8A 1GO3E 1K83H 1N34L 4JI0Q 5IYBH 5GAEC 2ZTDA 4JV5L 1OXUA 3I7FA 3NBHB 1CKOA 3S2HH 3RLOA 1G6PA 1UE1A 4DR1L 3M4OH 1SN8A 3Q8DA 4OWWB 1EIFA 4DR4Q 4LF9Q 5IWAL 3HOXH 1Z9FA 4BBSH 5GAGC 2RHSB 2JA6H 1VQFA 2B3GA 2IT1A 4FDBA 1YJNA 1HR0L 2R92H 4NXNL 5LMNL 5IY0A 1Q7YC 1A62A 1VQIA 1X55A 2JA6G 1TWHH 1UE5A 3KF6B 1XMQL 4DV3Q 4OO1G 4DV1Q 1YIJA 3B6YA 4R4CA 2UUCQ 3GTQH 1EWIA 4DV5Q 2LXJA 2IX1A 3M9BA 1K0RA 4LW1A 4IOAA 2KHJA 4DV4L 4GKKQ 1TWGH 1YZ6A 1KD1C 1J6QA 2A1AA 4GKJQ 1GVPA 4A3IG 4DUYL 3K8AA 3AEVA 2UUBQ 2DUDA 4PG3A 4B3TL 1JE5A 5IYCG 2NVQH 1SROA 4JBJA 4BBRH 1MKHA 4LWCA 4L5RC 1HNWL 5FJ8G 3H0GG 4QQBX 2KBNA 2ATWA 5GAHC 1X3GA 1KIXA 3S1MH 1EUJA 4A3KH 3BZCA 5C3EG 2PQAA 1DGSA 3PGZA 4AQYL 4GLAC 3RLNA 4LF8L 1IBMQ 4OX9Q 4DAYB 1HZBA 4QL5A 1OXVA 3D31A 4APVA 4X64L 4DV7L 1PV4A 1JB7A 1HZCA 2NVYH 2WB1E 3CCVA 2ASBA 1J5EQ 3FKIG 1I94L 4IJLA 4IPGA 1BBUA 2UXCL 3M85A 1IL2A 3F2CA 2VQFQ 4PZ6A 4JBWA 1PYBA 4XTCS 3GD7A 3KLWA 1PHJA 2F4VL 4YWKA 2BH2A 1LUZA 1VQJA 3A5UA 4B3SL 1X54A 3E9IA 4X62L 3HOYG 2WB1G 2HIXA 2K52A 3HOVG 1QUQB 1WCMG 3I4MH 3F1ZA 1FVIA 3S17H 3CF5A 4C2MH 2EIFA 3F2DA 4DV3L 4Y7NH 4DAMA 2IX0A 3AFQA 3W1GA 2JEAI 4GKKL 4P73A 1IBLQ 4X66L 4A3DH 1B8AA 2K5HA 2PI2E 3KDFA 4HJ7A 1PH7A 2HT1A 1IYJB 3J81i 1ASYA 2R7ZH 5ELOA 1G51A 3WWVA 4POFA 1VQBA 4C3IH 4GLXA 4JI6L 5M3MG 1W3SA 2ZJPA 4YHHL 3UE0A 1C7YA 4JI8Q 1D7QA 3AFPA 2UUBL 1CKMA 1MJCA 5E7NA 4DV2Q 3HOZH 1XNRQ 3RZDH 1Q86C 3CMEA 4IJHA 3M4QA 1QVGA 3VDYA 4IPHA 4EQ5A 4A93H 5C4XG 1VQKA 2UXBQ 1H95A 3S14H 5JJIA 1V9PA 1N36Q 1VQPA 5AJ3Q 1YHBA 1PFSA 3A5ZB 1YNXA 4DUZQ 5JJKA 2I0QA 4JYAQ 3CP0A 3W1BA 4H02A 1HNXL 3KOJA 3DLLA 4DR6Q 2UXDQ 4A3LH 4DK3C 3GTOH 4BXXH 4QJFA 3G4SA 1XMOQ 4HIMA 3RR5A 1IXRA 4JI1Q 1Y1VH 2D0PA 2ZM6Q 2QGQA 3OW2A 3NENA 1Y1VG 2MO0A 2E5LL 2ZJQA 2JA5H 1XNQL 1X3FA 2WAQE 4JG2A 4LF6L 3AQQA 1LM0A 2ID0A 2AMCB 3LGJA 4JCVE 4HJ8A 4GOPA 3PIOA 3FHWA 1IBLL 4HJ9A 1FJGL 2HIVA 5JEAJ 1Y1WH 4P72A 1WJJA 4A3EH 4BA2I 4A3JH 2K75A 2IY5B 4B3ML 1X3EA 3EBEA 1IZ6A 1X6OA 1CUKA 2Q2TA 4OWTB 4DV6Q 4BY7G 5FLMG 1SR3A 4YCUA 1K73C 4EX5A 2VS1A 5M5WH 1VQDA 1Q8KA 4DV0Q 2XGTA 1NJIC 1NBWA 4A3MH 1GM5A 1HNZQ 4DR3Q 4LFCQ 4XIGS 3OYYA 1OXSC 1RL2A 4LUZA 1MJEA 1WFQA 1I6HH 1NMGA 2B29A 4YCVA 5IYBG 3G71A 3UE1A 4DR5L 3PO2H 4X65L 4QGUA 5IP7H 3J80i 5M3FH 2D0OA 3M3YH 1BKBA 1PYSB 1L1OC 4YWLA 3HOXG 4BBSG 2I5LX 2PI2A 4DUZL 3CCQA 2UUAL 4JYAL 3J7ZC 2R92G 4LFBQ 1SE8A 3PSIA 4P71A 1EQRA 4DR6L 2UXDL 3BJUA 1L2FA 3PUYA 4GNXC 2BA1A 4GN3B 1IBKL 2E2HH 1NY4A 4JI1L 1AE2A 3FP9A 1XJVA 2C35B 4A3CH 4PZ7A 2PNHA 4AIMA 2IHFA 5C44H 2ZM6L 2JA8H 3MXNB 3TRZA 4A3CG 3CCEA 4DR2L 3HFZB 4KHZA 2OWOA 1HZ9A 1PA6A 2IHEA 2JA7H 2VY3A 2PQAB 1FGUA 2NVTH 1ASZA 2N49A 2NVXH 3S24A 2MFIA 1KL9A 1C0AA 4UP8A 4BBRG 3HKZG 4C3JH 1S3OA 1WYDA 2UU9Q 4LFAL 2OTLA 2KENA 2OQKA 3S1RH 4A3KG 2ZJRA 3HKSA 1KC8C 3I4NH 2RCNA 5BR8L 2VQEQ 4DV0L 3KF6A 4LF4L 3L2PA 2K14A 1QZHA 4L5SA 4A3BH 4MTNA 1VQ9A 4B3RL 4JI0L 3T1HQ 2JA9A 2Q2HA 1VQ4A 1M1KC 1L1OB 1TWFH 4MNOA 1N33Q 4IO9A 1S72A 3E9HA 3OTOQ 4KI0A 3A0JA 4B3RQ 4DR4L 4LF9L 2JJQA 3G48A 4GNXB 1VQLA 2V1CC 2CWPA 3KDFB 3J7A5 4YY3Q 3PUWA 4UP9A 1N32Q 3I4MG 4JI4Q 5IYDH 4TVAB 3U4VA 1PH8A 4DNIA 4DV1L 4DR7Q 4J15A 2F3IA 1G291 2UUCL 2YTYA 5JJLA 4DV5L 1PH3A 2GVBA 2YTVA 4WJ3M 4A3DG 4WJ4A 1KXLA 1X56A 1K3RA 1KRTA 2E2JH 4BY1H 3J81j 3PV0A 1YBYA 3AYHB 4PZ8A 4JI3Q 2R7ZG 4GKJL 3CXCA 4KHPQ 1M90C 1I50H 5EAYA 4BY1G 1LYLA 4A75A 4GN4B 2MO1A 2VZAA 4P75A 1AH9A 4RG1A 1PH2A 4IPDA 3T1YQ 4JI5Q 5C0XI 1NTGA 4HJAA 1E3PA 3KF8B 4TQUS 3HOZG 3U4ZA 1N8RC 3S16H 4IFDJ 1VQAA 4NB3A 3TS0A 3D0FA 1XTDA 2ALYB 1IBML 4OX9L 1JT8A 4A93G 1C9OA 3ULLA 1VQGA 2KHIA 4R4OA 1J5EL 2VUMH 3GTPH 4IFDI 1YITA 3E0EA 3GTMH 1FL0A 4IOCA 1N33L 2VQFL 1WI5A 3CW2C 1Q1BA 1VQMA 1N34Q 2B63H 3CD6A 4HJ5A 4JOIA 2CCZA 1TWCH 2A19A 4R4TA 3UDGA 1W2BA 4A3LG 2PMZE 1UE7A 4BXXG 4A3GH 4GOPB 3I56A 3PUZA 1YHQA 2ZTCA 4DR1Q 3S15H 4AH6A 1VQ5A 4RMFA 1PH1A 5IWAQ 3KJOA 4IFDG 4MZ9A 5IE8A 3JAMc 3CCSA 2E2IH 2JA5G 4JI4L 4C3HH 5LMNQ 3GTJH 2QA4A 1XPRA 3A74A 2KCMA 2CQOA 4OWXB 1XMQQ 1EQQA 1Y1WG 4NPSA 2Y0SG 5IP9H 4A3EG 1OXTA 1N9WA 3HOWH 3I2ZA 4A3JG 2HQLA 3K80C 3F2BA 4KHPL 3U58A 2H5XA 2AWNA 4JI3L 5IP9G 3W5OA 2BH8A 1CKNA 2N8NA 2RHQB 4JI8L 4ALPA 4DK6C 1QVFA 2LXKA 2YV5A 2N3SA 3RLFA 1UE6A 2WFWA 1P8LA 3CCUA 4JI5L 4DV2L 3T1YL 1B7YB 1XNRL 1NMFA 2AHOB 3U50C 4A3MG 2R7DA 5J3BA 1PH4A 4B3TQ 4UY8C 1BBWA 2Z6KA 4HIKA 2UXBL 3PO3H 2VW9A 1HNWQ 5JEAG 2DGYA 2HHHQ 3PO2G 4UP7A 1N36L 1YHAA 5AJ3L 5IP7G 2R93H 1VCIA 3K7AH 3PO3G 4GS3A 2XTIA 3I4OA 3NEMA 5M3FG 4AQYQ 5HY6A 3BU2A 4DKAC 5HGQA 3ZJYC 4DV7Q 4X64Q 4A3FH 4LF8Q 1RIPA 1VQ6A 2EQSA 1SRUA 3PUXA 1AE3A 1OXXK 4R4IA 5C4JH 2NZOA 1KRSA 2F52A 1XMOL 2GVAA 5GADC 2WP8J 4R1JA 3KJPA 1I94Q 4OO1I 5M5XH 4O2DA 2L15A 3G6EA 3HKZE 5K36G 4Y52H 3GO5A 2LSSA 2F4VQ 3EN2A 3JAMi 4L5QA 1BVSA 5C44G 1OTCA 3CC4A 3MEFA 4B3SQ 4POGA 2JA8G 3M7NA 3PCOB 4X62Q 4JC0A 1X9NA 4LF5Q 1VQ7A 3S1QH 2YTXA 2D62A 4HIDA 5DLQE 3CPWA 2JA7G 3GTGH 1I3QH 2AKWB 1E7ZA 2CKZB 3PUVA 3RNUA 4JI7Q 3TREA 1XPOA
chains in the Genus database with same CATH superfamily
5IGBA 4X66Q 1Z47A 3VYRA 4DV6L 2Z9HA 4JK1C 4EQOA 3CCJA 2EYPA 4NXMQ 1EOVA 2OQ0A 1GUNA 3MHBA 3NQTA 2A6EC 2JQOA 3J81c 1T9HA 3D6WA 2KJXA 1TXYA 1JJGA 1LLRD 2R7FA 3H15A 3J80E 4HSVA 1FNWA 5M5XB 2HHHL 4X3UA 5C5LA 5IIFA 3A7LA 2BA0A 1SLJA 5EBDA 1KQSA 4PMBA 4LFBL 2MNAA 2PZTA 3A56A 3NTHA 1HA5A 3OPOA 1QNUA 1AN8A 5IT9c 2YYZA 3GTGB 1WTHA 1HJPA 5LMUQ 2PNRC 3KUPA 4FXGC 3A8IE 4DXFA 2K5VA 1F9PA 3RMHA 1L1OA 3JAML 5I4DA 2CH4A 2PZWA 4JI7L 4LF7Q 1HRJA 3UDIA 2ZT9C 1KHIA 4GNXA 4AYBE 2K01A 4GN5A 2Z6KC 2F0OA 1CM9A 1ML0D 3RN2A 1HH2P 3FRPB 4UPAA 3NUCA 4RKLA 5M3MH 2NWGA 3H3VH 3VYSA 2D5DA 3GTKB 4N8X1 4KK7A 3M4PA 3FKIB 4R9WA 1L0WA 3A8KE 5EBCA 3OMCA 3KYHC 4AYBG 4JBMA 2HCCA 3SEBA 5M5YH 5EKLA 3Q6SA 2EJGC 1SFOB 3UDXA 5CBAE 1V43A 3RN5A 3D4RA 3ITPA 5LL6X 1CSPA 3QOLA 1D8LA 1Q82C 3HOVB 2WV6D 1HR0Q 1BXTA 3K0YA 2I5HA 2GN5A 3J80c 2UUAQ 1XX8A 3FPUB 1FYCA 1VQOA 4G57A 2QCPX 3HOWG 1B9NA 4DV4Q 1HUNA 4JI2L 3ERSX 1S40A 4DUYQ 4IUPA 1TWAB 2F4IA 2XRQD 1PFNA 2JK8A 3ULPA 1PTOD 5FO9B 4BY7H 5FLMH 5C4XB 1LTLA 1KDBA 3DM3A 4HSPA 2F3WA 5D3DA 5I6YA 2YU9H 4LF4Q 3NELA 2OTJA 1WD0A 1UEBA 1H9KA 1GHKA 1CKOA 1UE1A 4DR1L 1EFID 4F88A 2KA7A 4BBSH 2RHSB 2AUJD 2IT1A 1YJNA 5EJWA 3RUZA 2F0LA 1A62A 3HG9A 3I3CA 3FPPA 3KF6B 3ZYYX 4OO1G 2G9DA 3DHQA 3B6YA 2OT2A 1EWIA 2PMZB 1LT3D 1JOQA 3I90A 1YNJC 4N9TA 3M9BA 2FFKB 1K0RA 5EGTA 1BNZA 4IOAA 1YZ6A 1KD1C 1I4RA 4WORA 3VR3A 3CU7A 3HZXA 5E3FA 4ZCKA 2UUBQ 2DUDA 4PG3A 3S2DB 2I46A 3BVGA 3MXPA 1CFMA 1SROA 4IUVA 4JBJA 2F03A 4L5RC 5DAUA 3I91A 2ATWA 3S1MH 1EUJA 1D5XC 3QB3A 4A3KH 3BZCA 3PGZA 3ERQA 3OIQA 3RLNA 1MD2D 3HOXB 1E2VA 1EYCA 2A68C 3CCVA 1D1KA 2RKSA 1IKLA 3FKIG 4ZK9B 1QNKA 1IL2A 1ICFB 4PZ6A 4XT3B 1PHJA 4YWKA 2DJGC 4B3SL 2G5DA 3A5UA 1TS4A 1PDQA 3AB9A 1A3TA 1A3UA 1TWGB 3E3XA 3NWSA 3HOVG 5HGTA 2ZXPA 4C2MH 4X3TA 1Q3LA 1CQFA 2IX0A 3AFQA 3W1GA 2JEAI 2BOSA 4P73A 1IBLQ 1B8AA 2NVQB 4BBRB 1EOTA 3H3VC 2L4NA 2F0GA 3WWVA 4C3IH 1BBXC 3K6OA 1W3SA 4YHHL 1D7QA 4F87A 1S4ZA 5KNCA 3T53B 1TY0A 2H1EA 4DNRB 4CKEA 5IGFA 4IJHA 3TP5A 3M4QA 4EQ5A 5C4XG 3DWAA 1EZ8A 1PFSA 2XN9C 5JJKA 2I0QA 3IFDA 3KOJA 3G4SA 2F0PA 1XMOQ 1AZPA 1VF7A 4JI1Q 2B2YC 1TVXA 5E1FA 1LT6D 2NTSA 4IFDH 1STHA 2EJFC 2WAQE 3TP8A 2PPBC 2FHTA 2IJ0A 4DFAA 4JCVE 3LGJA 4HTHA 3WOEA 5FO7B 2HIVA 5JEAJ 1LTAD 4BA2I 3HOZB 1B9MA 2IY5B 5CV8A 1X3EA 1F2ZA 1IZ6A 5CBEE 1X6OA 1RJTA 1CUKA 4DV6Q 2ENBA 1SYEA 3OHXC 1K73C 4EX5A 2EXZA 5BN5A 1SMYD 1NJIC 4A3MH 2E2DC 4XIGS 2BDOA 3G71A 3GTOB 4DR5L 2KQ3A 2K7VA 4L63B 1PYSB 4F7XA 3HOXG 2PI2A 5CYUA 4LFBQ 5CV4A 1L2FA 4EQNA 3PUYA 1NY4A 3FP9A 1XJVA 5K36H 3H09A 1R4PB 3V96A 4A3JB 1BCPF 1PRTD 3MVVA 4P2CB 3HFZB 3KLRA 2XIWA 4NKLA 4LK1C 2NVTH 4IUNA 4IN3A 3T13A 4RGMA 2G9HD 4BBRG 5EPKA 3HKZG 5JAVA 2WKCA 1VMCA 2SEBD 4LFAL 2EY1A 2ZJRA 2QKIC 3LWUA 4DXGA 4A3BH 2K14A 4H7BA 2B2VC 5C3XA 1ZYRC 2J4XA 4K14A 4MTNA 1VQ9A 2JA9A 4MNOA 1N33Q 3JAME 4IO9A 3MWYW 1YNND 1EWHA 4KI0A 1I4PA 4DR4L 5A2QL 4Q0FA 2E2HB 2DJFC 3T51B 1ET9A 3J7A5 1DOKA 3PUWA 4TRDA 4CDEC 5IYDH 4JI4Q 4TVAB 4FXDA 1BQQT 1DCZA 2UUCL 2YTYA 2B2TA 1QILA 2NTTA 4WJ3M 1LTBD 3DWQA 2L9HA 1X56A 4ODGA 1K3RA 1R4QB 4C3JB 3PV0A 4PZ8A 3GV3A 1SYFA 3CXCA 3M7GA 3S1RB 4A75A 4GN4B 1FGBD 5I9PA 1QE6A 3T1YQ 4IALA 2JYOA 3QOJA 2EOTA 4IUQA 1TWFB 4MIUA 4TQUS 3HOZG 4IFDJ 2V4DA 4NB3A 3IFTA 3D4DA 2KHIA 1C4QA 1G8ZD 1J5EL 2MUYA 2EDGA 5C0XH 3GTPH 4ZKCB 1YITA 3E0EA 2LMCB 1RD9D 4IZ8A 3I4LA 2PW7A 3VR6A 4HJ5A 2CCZA 2A19A 4BXXG 1W2BA 1K0SA 3FVQA 4A3GH 1CK1A 1TS3A 5T1IA 3WDNA 4DR1Q 2WINB 4AH6A 1PH1A 2MPMA 4JPBW 3JAMc 3CCSA 3CKIB 3VR5A 1B44D 3GTJH 1XPRA 1CHQD 1G2TA 1JWUD 5IP9H 4C1NK 4A3JG 4KHPL 4A93B 2H5XA 2AWNA 4FP5D 4NDXA 5IP9G 1WTQA 1Y8PB 4DK6C 2VUMB 2WFWA 4DV2L 1TIID 4O42A 3MFYA 2NN6H 4ZUJA 4UY8C 1O7YA 4BS9A 4HIKA 2B63B 2UXBL 3EQLC 2VW9A 4K2LA 5KIXA 1N36L 3KK7A 5IP7G 2R93H 4G7OC 5ELBA 3NEMA 5I2YA 1QCBD 4NMZA 1JB3A 2R61A 1EY9A 3AMUA 3BDOA 2EQSA 1AE3A 1OXXK 2E2IB 3TMEA 3WOFA 1L0YB 4C3HB 2WP8J 3M4YA 4XQJA 2IW3A 5D14A 3G6EA 2ICIA 2LSSA 3MC0B 4L5QA 3CC4A 4B3SQ 4HN7A 3BG3A 3PCOB 5I2XA 1X9NA 3S1QH 2NB0A 2YTXA 5CV9A 2D62A 3OIPA 4WRDA 1I3QH 3EROA 3P75A 4XDXA 1DJRD 3C1FA 4G7ZC 4X6AH 1YI2A 1SMXA 4QUFA 3HP3A 1EYDA 4C3JG 1ET6A 3ER0A 1SNCA 3GP7A 1SJHD 4DAPA 1VQEA 2K33A 3MXUA 4DR3L 4LFCL 2VL6A 4A3FB 2OXPA 5C4ZA 4YHHQ 3HOUH 3P20A 5C4JB 3HOUG 1HA6A 5DM73 1PH5A 5C3EH 3TQYA 4CJ1B 5IOCA 2KCTA 3K5NA 3I55A 1Q12A 3L7ZC 1HXYD 4LUOA 3SGIA 1HCZA 2R6GA 2O4XA 4ZUIA 1CQVA 1F9SA 3C2PA 2F0HA 3KFUA 1VDZA 2CW0D 1RTNA 2HD3A 3QR8A 1O7IA 4E6IA 1TQOA 1Q81C 1S5FD 1TS2A 1EYGA 5C0XJ 3F2UA 2QEXA 4LF5L 3K7UC 1SJED 3ICEA 1SE2A 1ZXTA 1LO5D 3H3VI 1MHWC 1ESFA 2UU9L 5GQOA 3MZ5A 2VQEL 4QB4A 4IPCA 1KNEA 1NUCA 1C8CA 3AU7A 1A2UA 1Y14B 2VUMG 2WIIB 1A63A 2EXDA 2EE1A 3SXHA 4BWGB 3CQZH 3NHHA 5ELDA 1JMCA 2B63G 2A8VA 2Y0SE 4KLKA 4DR5Q 2L1BA 2K50A 4YY3L 3P1HA 2ZTEA 3EIVA 2WB1B 1CZWA 5LMNW 2B2VA 1KAWA 3NBIA 4NXNQ 2EVBA 4XYQA 4C3HG 3CMAA 3V2TA 1ENAA 1D5MC 3CCMA 2XRSD 1F2LA 3DXJC 4A4IA 2JEBI 4DNTB 5M3MB 3IKJA 1E22A 1HZAA 2Z4IA 3PIO3 2Q8RE 1EIYB 1XPUA 4JBKA 2LKVA 1FNVA 5CORA 1LABA 4ME3A 3TDQA 5M5YB 4LFAQ 1IW7D 1D6EC 2QDBA 3OWEB 4L5TA 4A3FG 1EIGA 1K83H 1N34L 5IGCA 4RFBA 4JV5L 1JWSD 3I7FA 4HR7B 3VR4A 3VA7A 4ILWA 1SN8A 1EIFA 4DR4Q 5IWAL 4ZLTF 2R92H 5LMNL 3VR2A 5IY0A 4KKUA 1XMQL 1EY8A 2EY2A 1SNQA 1YIJA 4YIJA 4R4CA 2RQXA 2UUCQ 1LV9A 3W2DA 2IX1A 2CVRA 4BY7B 5A2QE 1GUWA 2A1AA 2Q8IB 2B2WC 1G2SA 1U4LA 4KN4C 3J7YW 2YU9B 3K8AA 5CC4A 3AEVA 1JE5A 1NSNS 3MXNA 1SDFA 1JE4A 1EU4A 5GAHC 1V1PA 4CKCA 3R93A 1DGSA 1HZBA 4BBSB 5M9OA 2NVYH 2WB1E 1J5EQ 1I94L 1BBUA 1SYDA 3F2CA 2RSNA 4JBWA 1PYBA 5BN3A 3E6ZX 2BH2A 1SNOA 1LUZA 2ZXRA 3E9IA 4X62L 2WB1G 2HIXA 2K52A 4CDDC 5KYLA 2KVMA 3I4MH 1EQVA 1W6JA 2EIFA 4DV3L 4A3DH 5CV6A 1PH7A 4QF4A 2HT1A 3J7AV 2NBFA 1ESRA 2SNSA 5ELOA 3S1MB 4A3KB 1K28A 4JI6L 5J39A 5M3MG 4GZYC 5DM63 2CQAA 2RDHA 3AFPA 1CKMA 1WD1A 1O78A 4DV2Q 2JP1A 2KOLA 5JPMC 3RZDH 4RA8A 3CMEA 5FKAC 1EYAA 3VDYA 4IPHA 2F0UA 1VQKA 4X3KA 2UXBQ 3S14H 1LACA 4KMUC 1N36Q 3TN2A 1YNXA 1PXUA 4KJOA 4JYAQ 5FLXL 5KNBA 5C6AA 1HNXL 4C2MB 3DLLA 4DR6Q 2UXDQ 2KEEA 4A3LH 4QIWB 4QJFA 4HMIA 1GUTA 2A5HA 1JICA 2ZM6Q 1WTRA 2E5LL 1WTOA 1XNQL 1X3FA 4LF6L 4C3IB 1CI3M 2ID0A 2AMCB 3PIOA 4K8IA 1ZEQX 4B9XA 1J8IA 3MA2B 1H9MA 4CBVA 4B3ML 4QMGA 1W6KA 3NTIA 3Q24A 4H13C 4BY7G 5FLMG 4MHEA 4DV0Q 2VS1A 2L0CA 1VQDA 5NUCA 1ILPA 1B1ZA 4LAAA 1GM5A 4DR3Q 4LFCQ 3OYYA 3OSOA 1NMGA 3UE1A 1LTRD 5JEAH 5M3FH 2D0OA 2Z8LA 2WKDA 4OHJA 4WFN3 4BBSG 4DUZL 2UXCL 3CCQA 1Z7TA 3J7ZC 3PSIA 1EQRA 2F0JA 3BJUA 1C48A 2EYFA 3R2IA 1IBKL 4PMCA 3SK6A 5C44H 2A69D 3MXNB 1EY5A 4DR2L 4IURA 1PMRA 1V1PB 2VY3A 1LTTD 3GQBA 4A3MB 1B4OA 2TSSA 1KL9A 3UI2A 1C0AA 1F77A 4DK1A 1WYDA 3GV6A 2UU9Q 2OTLA 2KENA 4A3KG 1KC8C 3HKSA 3NK9A 3I4NH 2RCNA 2VQEQ 1QZHA 1E0BA 1U4PA 1L1OB 1S72A 3A0JA 4B3RQ 4LF9L 2JJQA 1ILQA 4K5XA 4GNXB 4KN7C 1TY2A 4C1NI 4YY3Q 2J0TD 3A55A 5D65A 3TP7A 2R3ZA 2F0WA 1BUVT 4DAVA 4UDUC 3U4VA 4DV1L 3NXWA 4J15A 5JJLA 2NVTB 1B50A 3VYUA 3HKZB 3TZDA 3SDZA 2E2JH 4BY1H 4GKJL 3AYHB 3FEWX 1I50H 4BY1G 5IODA 4C3IG 2MO1A 2VZAA 4A3BB 3Q22A 1M4VA 4KY7A 4RG1A 4JI5Q 4OIKA 1NTGA 5C0XI 2K5DA 1N8RC 3TS0A 3SK4A 1XTDA 4HAEA 4OX9L 1EL0A 1JT8A 2B2UC 1YNNC 3W3AA 3ULLA 1VQGA 4RAUC 1KDCA 2RVLA 4IUTA 2VQFL 1WI5A 3NTKA 3CW2C 1Q1BA 1N34Q 3CD6A 2L11A 1STYA 1I6VC 2PMZE 3FDTA 4N8FA 3S15H 5ELFA 4B08A 3NPPA 1VQ5A 5IWAQ 1ENFA 4IFDG 4MZ9A 4L8JA 5IE8A 2BCOA 3BVZA 1V1OA 5LMNQ 2EJMA 4PV1C 3C3LA 3A74A 4OWXB 1XMQQ 1EQQA 5DEHA 5EKIA 4JI3L 2BH8A 3NE5B 1AP0A 2N8NA 2C5CA 2YV5A 3TZUA 3RLFA 3CCUA 3GTPB 1B7YB 1XNRL 2AHOB 2DNCA 4A3MG 2VB2X 1A2TA 5J3BA 1BBWA 2Z6KA 1GUOA 2EYOA 3PO3H 5JVH3 2DGYA 2HHHQ 4A3GB 1YHAA 3EFXD 5AJ3L 3K7AH 3PO3G 4GS3A 2BE5C 4DKAC 1VQ6A 1RIPA 2NZOA 3D4WA 4CJ0B 2GVAA 1I94Q 3KJPA 3GTJB 1D1IA 4O2DA 3HKZE 4XYOA 5K36G 3JAMi 1SNDA 4RGOS 1A15A 3CRLC 3M7NA 4X62Q 4JC0A 2KEDA 1VQ7A 1XTCD 3NBHA 3Q23A 1EEFD 1ZKOA 2E75C 5DLQE 5FOBB 4JI7Q 4KV6A 4FF1A 1MIUA 1GOZA 3CC2A 2Q2IA 4IUUA 1X65A 1LT4D 3MTSA 3GTLH 1R9TH 4A3IH 1PH9A 3P7JA 2DY7A 2R93B 2F0NA 4A3BG 5ELEA 4JI6Q 1QJOA 1SNPA 2KUMA 2RA4A 5IYCH 4LNQA 5ELNA 4HEDA 1YJ9A 5FJ8H 3H0GH 4IQZA 2IX3A 4Q5VA 1K8GA 4JOIC 2E8GA 1WVLA 4I7AA 2Z6BA 4GLVB 1NE3A 3CRKC 3S1NH 1B3QA 3O13A 1BCPB 2K03A 3I73A 1HHVA 1TT2A 1UWVA 5L37A 1H9SA 4DN4M 3S1QB 2K5WA 5IYDG 2PYKA 1HNXQ 1I3QB 1K8MA 4EGVA 2ES2A 1PVOA 4P74A 3JC66 3TEHB 1Q46A 5I6WA 3HOYH 1YEZA 2PQEA 1WCMH 2RF4A 2E5LQ 4RCOA 4JI2Q 4RWSC 1XNQQ 2QEJC 5FK9C 4LF6Q 5FLXE 3HOUB 4OL7A 3TS2A 1YJWA 5D3IB 1PFMA 3T56B 2EZVA 1U0LA 4B3MQ 4NXML 2ICEC 5C3EB 4KTAA 1GKHA 2K5NA 3L9AX 2Z0SA 3T1HL 1CA6A 1HFGA 5C4HA 5C0XG 4V0BA 1RCVD 1SYGA 4A3GG 3STBD 1DOLA 2CW0C 1HR0W 1N32L 1ENCA 2QDLA 5CV5A 3PMFA 2UXCQ 1UEAB 3CCRA 4HMJA 1T5EA 3IRBA 2LS01 2F0FA 1SBBB 2MQHA 2A6HC 1BOSA 5GROA 5LMUL 1K8AC 1VQNA 3ULJA 1IBKQ 1YVCA 2FINB 2HDMA 4DR2Q 3F8TA 4XXEA 4TSSA 4KY5A 1HTLD 5H1SE 1BF4A 4LF7L 3RZOH 3D3RA 1EFWA 3UDFA 2Q2UA 1KLGD 2EYJA 1VS0A 1JJCB 2NN6G 1AW7A 3CQZB 4BA1I 2GA4B 3CAMA 2CFMA 1PYWD 1IL8A 1M8AA 2AQ1B 2A73B 2O5JC 2R93G 4RHSA 2IL8A 1A8VA 5FLXc 3K5LA 2FXQA 1VQ8A 5IYBH 5GAEC 2ZTDA 1OXUA 5JJZA 3NBHB 2KCNA 1MGSA 4DGZA 3S2HH 3RLOA 3QJYA 3M4OH 1HTPA 1F9RA 1ZYRD 4LF9Q 1Z9FA 3SR1A 5GAGC 2B2UA 2JA6H 4CDFC 1O7ZA 1HR0L 1VQIA 2N88A 2JA6G 4UHVA 1TWHH 1UE5A 2QF7A 5G3LF 4DV1Q 2SDFA 3BYTB 3GTQH 4RGNA 2B2YA 1OO9B 1Q90A 2LXJA 4DV4L 5LL6S 1J6QA 1I4XA 2VXWA 4GKJQ 1EY0A 4DUYL 1IKMA 2EPBA 3ND9A 1PTOH 4B3TL 1K83B 4LWCA 3R8BA 1HNWL 1H9SB 3QO2A 4QQBX 2B39A 4EVOA 1X3GA 1KIXA 1DZ1A 5ISRA 5C3EG 4K8JA 4GLAC 4NP5A 4LF8L 4OX9Q 4DV7L 1CHPD 4QL5A 1OXVA 3D31A 4APVA 1JB7A 4RCNA 1HZCA 2ASBA 2R92B 3R2TA 1E2ZA 2XNAC 3K57A 2RDFA 3M85A 4X3SA 2VQFQ 5JOBA 1GJXA 3Q0AA 3GD7A 3KLWA 5KGUA 1X54A 1HQRD 3F1ZA 1FVIA 3S17H 3H94A 1IHZA 5IGEA 2KCCA 3F2DA 4Y7NH 4XT1B 4OELB 1LTGD 4GKKL 2PI2E 3KDFA 4HJ7A 4XQQA 4ZYSA 1IYJB 1T5XD 3J81i 2R7ZH 1G51A 2E76C 1RF2D 4POFA 2K05A 4KJNA 1VQBA 3E5SA 5TSSA 1A3VA 1DYQA 2SOBA 3OOCA 2UUBL 1SSOA 2NVYB 1MJCA 1WTXA 4L6TB 1XNRQ 2K6AA 4A93H 1EY7A 3T16A 1VQPA 4G4KA 5AJ3Q 1YHBA 4N9PA 4K5VA 3CP0A 3W1BA 3I4MB 4H02A 4QUCA 1RODA 1DD2A 1S5BD 4A3DB 1IXRA 1Y1VH 3BDLA 2F1MA 3C1EA 2D0PA 3DUZA 3OW2A 1Y1VG 2MO0A 3DM1A 2JA5H 4DK0A 3N52A 1LM0A 1STBA 1QG7A 4H0LC 3FHWA 4S3SA 1IBLL 3BYYB 4M8AA 4FNFA 1Y1WH 4FF2A 1FJGL 5E4XA 1WJJA 4A3EH 4FVMA 3RZDB 2RBMA 2Q2TA 4OWTB 1SR3A 5M5WH 3S14B 1I4HA 2X69A 4K5WA 3D8GA 1B3AA 1DOMA 2JSOA 1OXSC 1I6HH 1DONA 5KRUA 1MSHA 3PO2H 4X65L 3J80i 4C56C 3M3YH 1BKBA 4YWLA 3NSWA 2R92G 4ME5A 1SE8A 4P71A 1EEID 4Z9CB 5KEEA 1FD7D 3D6CA 2BA1A 4GN3B 1V8QA 4JI1L 2C35B 4A3CH 4OEMB 2C9OA 2PNHA 1QOHA 4AIMA 2JA8H 3TRZA 3DWPA 4A3CG 3NQIA 2OWOA 1HZ9A 1PTOC 1E2WA 2JA7H 5DNFA 1FGUA 2WACA 2KECA 3LNNA 1ASZA 2NVXH 3S24A 2H4OA 4CDCC 2CHBD 4UP8A 3BVMA 4ULLA 2OQKA 4KD3A 4K0KL 4CKBA 5BR8L 3KF6A 3L2PA 5M3FB 4KKTA 1FNUA 1AFPA 4JI0L 3T1HQ 3ONAB 5J22A 2Q2HA 1VQ4A 1M1KC 2B8GA 1STNA 3G48A 3K5MA 1VQLA 3BS1A 1DM0B 2CWPA 3KDFB 5C44B 1TS5A 1Q8IA 3J7AF 2PO4A 1X3QA 3G7LA 1N32Q 3I4MG 2A69C 1PH8A 1EU3A 2K32A 2F3IA 1G291 4DV5L 3R3OA 1STEA 2GVBA 4WJ4A 2HUGA 4A3DG 1WTWA 1O7LA 1F2YA 1KXLA 3KLSX 4R8NA 1D5ZC 3J81j 4ZRZA 1YBYA 4DU9A 3PIP3 1JC7A 3DMUA 4U673 4KHPQ 3I4NB 1PH2A 5C3WA 3SVMA 4HJAA 2VB3X 1E3PA 3MXGA 1SAPA 3U4ZA 3S16H 3D0FA 2ALYB 2K1BA 5KYIA 2DN8A 1STGA 2EY5A 1IBML 1PFBA 5IGGA 4IFDI 3IAYA 2RDGA 3GTMH 3ND8A 2MGSA 1I4GA 3A7AB 1FL0A 1HQMC 1JCKB 2F0IA 1N33L 1VQMA 1UAPA 2EYMA 4A3LG 5T1GA 1TWCH 4R4TA 1UE7A 2ZTCA 3QIAA 4B9WA 2PW5A 2E2JB 4CHTB 4BY1B 1KTKA 3KJOA 5CMDA 1I50B 4JI4L 1BCPD 3QWNA 2KCMA 2AUKA 2CQOA 4KHVA 4NPSA 1GXDC 3HOWH 1OXTA 1CT1D 2HQLA 3K80C 3F2BA 3U58A 4EQPA 1CKNA 1VF5C 1QB5D 4JI8L 2RHQB 1QVFA 2LXKA 4HCSA 2A74C 1UE6A 4UAIA 1P8LA 3T1YL 2OEOA 3H6MA 5EKKA 4F8MA 2I07B 4U68A 2P5ZX 3N6RA 3V05A 1PH4A 4B3TQ 2A6ED 1HNWQ 4TKOB 5JEAG 1KDAA 5BN4A 4ZAIA 1VCIA 5F2DA 3S15B 5M3FG 1EY4A 5HY6A 3BU2A 4LF8Q 3ZJYC 4DV7Q 1UUPA 2JXMB 1BO0A 3TP6A 4R1JA 2F3VA 2B2TC 1TKWB 5M5XH 5CV7A 2L15A 4ZKBB 2BDNA 5A35A 2XWJB 3EN2A 1ONLA 5C44G 2IPKD 2X6LA 1OTCA 2JN4A 3MEFA 1IYVA 4LF5Q 2Z4HA 4OO1H 4HIDA 3CPWA 3GTGH 1SE3A 2F0MA 2AKWB 1E7ZA 1SMYC 3EJIA 2M2LA 3TREA 4GKKQ 1KLUD 1JORA 2NZHA 3EA6A 3PO3B 4HIOA 2RCFA 1VMPA 3K0XA 3K81C 3I4NG 2WAQB 3EVQA 3K7AB 4KY6A 1HNZL 1U4RA 4RHRA 1A6XA 5JPNC 1II3A 4QIWE 2K4KA 2CWAA 1Q1EA 1HFNA 4RGTA 3GTKH 1GD7A 1I4QA 3TBIB 3L0OA 1PRTC 1EQTA 3FKIH 4R4QA 4GOPC 2X6GA 4PQXA 1UNSA 2AWOA 1X3PA 4DAYA 1WOCA 2N78A 1SFOH 3KLSA 2JE6I 4MN3A 5K5PA 3PIPA 1MSGA 2K28A 1WTPA 4PNYA 4WJWA 3HOVH 1QVCA 4FF4A 1VQHA 3GTLB 1R9TB 4A3IB 5CGKA 1KNAA 4HCEA 4PMWA 1CSQA 1VQCA 1RDPD 4LUVA 1FJGQ 3H0GB 2MP1A 1QUQA 1K9MC 3K5OA 4YWMA 2EY6A 4OONA 1V1QA 2B2WA 3S1NB 1E1TA 4J6HA 1TWAH 1AZQA 4QY7A 4J1MA 1KABA 3OTOL 2VNUD 4R8IA 4JV5Q 5HURA 4YCWA 1PH6A 5C4XH 4I65A 1A0IA 1BDOA 4X65Q 3HOYB 1U5KA 4J8QA 1WCMB 4DR7L 4CJ2C 2OCEA 1EIHA 3BZKA 1CKNB 3CC7A 1E24A 2OF1A 3NWTA 2NN6I 1JJ2A 3VA5A 1PZID 1SEBD 1XXGA 5EPLA 3GDEA 5G3LD 1TR5A 4O0AA 1E1OA 1IYUA 3X3MA 1QZGA 1XWEA 3CCLA 1D2BA 1B70B 3CPFA 1PZKD 1YNJD 3S9WA 4QCLA 3PF4A 2I5MX 2N55A 2K5QA 5EPJA 3PF5A 1Y8NB 1P16A 2KHSA 3IL8A 4RH6A 3T4AC 1BR9A 1CZGA 4DPGA 3L3OC 3DEPA 4OXPA 1I5FA 2WAQG 4K0KQ 4A76A 5BR8Q 1NCVA 3NP8A 1B53A 5AFWA 3J81L 3S2DH 1JWMD 3STBC 4JI0Q 1GO3E 2F0DA 2F0SA 1G6PA 2A68D 2PCFB 3Q8DA 4NW2A 5ELCA 4OIJA 1XYIA 4OWWB 1J9OA 2F0KA 2J7ZA 3MFGA 3VYTA 3HOXH 3A54A 1VQFA 2B3GA 3A8JE 1FR3A 4FDBA 4NXNL 1GUSA 1G91A 1Q7YC 1X55A 1NNXA 1Z6HA 3KBXA 4DV3Q 5IT9L 3RZOB 1AEXA 4DV5Q 1U4MA 4ABNA 5EQ0A 4LW1A 1L0XB 2KHJA 1TWGH 4FO2A 1GVPA 4A3IG 1PTOF 5IYCG 2NVQH 2L55A 4BBRH 1MKHA 5FJ8G 3H0GG 2KBNA 1RKNA 2RSOA 3S2HB 1JOOA 4KKSA 2XWBB 3K58A 2PQAA 4AQYL 3M4OB 5CR3A 2ZXOA 1IBMQ 4DAYB 4X64L 1PV4A 3H91A 2JA6B 1EZ6A 4IJLA 2D2CC 2Z1CA 3CHBD 4IPGA 4DA2A 1TWHB 3HRZC 1SXTA 4XQNA 3HEJA 4XTCS 2F4VL 3GTQB 1G6ZA 1VQJA 1MBYA 3I70A 2MJ8A 2L12A 3HOYG 2HCIA 4ID6A 1NR4A 1QUQB 1WCMG 2FJ2A 3CF5A 2SNMA 3J80L 4DAMA 1CA5A 3OW7A 4X66L 1PTOB 2K5HA 2NUCA 1ASYA 1K3BC 4GLXA 2ZJPA 4V190 2MHVA 3UE0A 1C7YA 4JI8Q 5E7NA 3HOZH 1Q86C 3FMCA 1QVGA 1H95A 1NR2A 5JJIA 1V9PA 3A5ZB 3SHLA 4DUZQ 3KF8A 3TSSA 3S17B 3SK8A 4DK3C 4Y7NB 3GTOH 4BXXH 4HIMA 3RR5A 2BE5D 3OWFA 2FMCA 2DY8A 1S5ED 1WTVA 2QGQA 3NENA 3KBGA 2R7ZB 2ZJQA 1LT5D 1JOKA 4G7HC 4JG2A 5FO8B 3AQQA 4HJ8A 4LJZC 4GOPA 1ICWA 1RHPA 4HJ9A 2B8FA 4P72A 4A3JH 2K75A 5E4WC 3EBEA 1F9QA 4YCUA 3PQIA 1Q8KA 3MEHA 2XGTA 2XVSA 2AQ2B 1NBWA 3I72A 1HNZQ 5C5MA 1PZJD 1RL2A 4LUZA 1MJEA 1WFQA 1LTSD 2B29A 4YCVA 5IYBG 1H9RA 4QGUA 5IP7H 1Y1VB 1L1OC 2I5LX 2UUAL 4JYAL 1B2TA 2JA5B 5IGDA 4CGYB 4DR6L 4O1NA 2UXDL 4GNXC 1LTID 2E2HH 1Y1WB 1AE2A 3URYA 2PZUA 2FMMA 2Y0SB 4PZ7A 4A3EB 2ZM6L 2IHFA 2M00A 3CCEA 5JVG3 4KHZA 4M1UB 1PA6A 5M5WB 2IHEA 2PQAB 1SE4A 1IW7C 1S5DD 2N49A 2MFIA 4OGQC 1I6HB 1DXMA 1KAAA 1HPCA 1S3OA 4C3JH 4I7ZC 1PLFA 1EY6A 1EWCA 3PO2B 5COYA 3S1RH 4K6LA 4DV0L 4LF4L 1U9RA 2LFNA 4L5SA 1S5CD 3M3YB 1NAPA 1TWFH 4RKBA 1H9JA 2EYHA 3E9HA 3OTOQ 4FYDA 2D9UA 2V1CC 3DEOA 3BDCA 2JA8B 1Y8OB 2QW7A 2DNEA 2XSCA 4UP9A 1JQYD 2M9VA 1PRTF 3G6JB 4DNIA 4DR7Q 2Q8TA 2JA7B 4LMQD 1PH3A 3X3NA 2YTVA 2NVXB 1GHJA 2F0EA 4MTKA 3RD4A 1GUGA 1KRTA 3OMGA 4JI3Q 2R7ZG 1TU2B 1M90C 5EAYA 1LYLA 2TMPA 5J1ZA 4P75A 1SNMA 2A6HD 2HQEA 1AH9A 3U9OA 4IPDA 4H44C 3QG1A 2QILA 3HGBA 3KF8B 2O2LD 2F0VA 1VQAA 1Y69U 4A93G 1C9OA 4R4OA 2VUMH 3LX0A 3C46A 1HUMA 4IOCA 1X32A 3MAQA 2B63H 4JOIA 3SE0A 1PRTB 4FXKC 3UDGA 4B3RL 3SK5A 2AQ3B 4GOPB 3I56A 3PUZA 1YHQA 3LWEA 1MI2A 4DF7A 2EYLA 4JW0A 4RMFA 1JR0D 1F2MA 2IWHA 2L5TA 2E2IH 2JA5G 2O5IC 4C3HH 1K8OA 3J81E 2QA4A 2CH4W 1Y1WG 2Y0SG 2F0QA 1SYBA 4A3EG 1N9WA 3I2ZA 3S16B 2E74C 2HDLA 4JVZA 3W5OA 3BZDB 1SYCA 4KD4A 4ALPA 1STAA 2N3SA 2NYZD 5I9OA 4JI5L 2F0TA 1NMFA 3U50C 3GTMB 4AYBB 2R7DA 5KNDA 3HS0C 1TWCB 4ZQ3A 5IT9E 3PO2G 4UP7A 4FF3A 1QWYA 1O80A 2XTIA 3I4OA 4AQYQ 4A3FH 5HGQA 5LHY1 4X64Q 1SRUA 3PUXA 4R4IA 1RTOA 2NZ1D 1CTMA 3E0JA 5C4JH 1KRSA 2F52A 1XMOL 5GADC 4OO1I 3U9SA 2K04A 1BCPC 4Y52H 3GO5A 2F4VQ 3HOWB 1BVSA 2JA8G 4POGA 3I8ZA 3K59A 4K6DA 2JA7G 2CKZB 2LY7A 3PUVA 3RNUA 1XPOA 4K2KA
chains in the Genus database with same CATH topology
1MIUA 4X6AH 4X66Q 1Z47A 1YI2A 3CC2A 1SMXA 4DV6L 2Q2IA 1X65A 2NZHA 3CCJA 3ER0A 4NXMQ 1EOVA 2OQ0A 4HIOA 1R9TH 3K0XA 3K81C 4A3IH 3GTLH 1PH9A 2JQOA 3J81c 1VQEA 3I4NG 4A3BG 4JI6Q 1T9HA 1HNZL 4DR3L 4LFCL 2VL6A 1TXYA 4YHHQ 5IYCH 3HOUH 4LNQA 5ELNA 1JJGA 1YJ9A 5FJ8H 2R7FA 3H0GH 3H15A 3HOUG 4QIWE 1K8GA 4JOIC 2K4KA 2E8GA 2CWAA 5C3EH 1PH5A 2HHHL 4GLVB 1NE3A 3TQYA 3S1NH 4K0KL 1Q1EA 2BA0A 1SLJA 2KCTA 3GTKH 1GD7A 3I55A 1Q12A 1KQSA 4LFBL 3L0OA 3L7ZC 2MNAA 1UWVA 3FKIH 4R4QA 4LUOA 3SGIA 4GOPC 2R6GA 5IYDG 5IT9c 1HNXQ 2YYZA 2AWOA 3KFUA 1HJPA 1WOCA 5LMUQ 2ES2A 2N78A 1O7IA 1SFOH 2JE6I 1Q81C 3PIPA 1PVOA 2K5VA 4P74A 3JC66 3TEHB 1Q46A 5C0XJ 1EYGA 3HOYH 1YEZA 3HOVH 1QVCA 1WCMH 2QEXA 2RF4A 4LF5L 1VQHA 3K7UC 1L1OA 2E5LQ 3ICEA 4JI2Q 1XNQQ 4LF6Q 4JI7L 4LF7Q 4PMWA 3H3VI 3UDIA 1CSQA 1KHIA 4GNXA 1VQCA 4AYBE 4GN5A 4LUVA 2UU9L 1YJWA 1FJGQ 3TS2A 2Z6KC 5GQOA 1QUQA 1U0LA 3RN2A 1HH2P 1K9MC 4YWMA 2VQEL 4B3MQ 4NXML 4UPAA 4OONA 4IPCA 1V1QA 5M3MH 1GKHA 2K5NA 2Z0SA 3T1HL 3H3VH 1E1TA 1TWAH 1Y14B 2VUMG 5C0XG 4QY7A 3M4PA 1A63A 2EXDA 1L0WA 4AYBG 4JBMA 3KYHC 3OTOL 3CQZH 2VNUD 4JV5Q 1JMCA 4YCWA 1PH6A 2B63G 5C4XH 2A8VA 5M5YH 1A0IA 2Y0SE 4KLKA 4DR5Q 4A3GG 2K50A 3UDXA 3STBD 1V43A 4YY3L 4X65Q 3RN5A 1CSPA 2ZTEA 1D8LA 3EIVA 1HR0W 1N32L 1Q82C 1U5KA 5LMNW 1HR0Q 1KAWA 4DR7L 4NXNQ 2UXCQ 2I5HA 2GN5A 3J80c 3CCRA 2UUAQ 2OCEA 3IRBA 3BZKA 1CKNB 3CC7A 1E24A 2MQHA 3CMAA 5GROA 5LMUL 1K8AC 1VQOA 2NN6I 1JJ2A 1VQNA 3ULJA 3CCMA 1IBKQ 1YVCA 4A4IA 3HOWG 2JEBI 4DV4Q 3GDEA 4O0AA 1E1OA 4DR2Q 1QZGA 4JI2L 3CCLA 3F8TA 1E22A 3ERSX 1S40A 4DUYQ 1B70B 3CPFA 5H1SE 4LF7L 3PF4A 1HZAA 3RZOH 2I5MX 1EFWA 3UDFA 2Q2UA 3PF5A 1EIYB 1VS0A 1JJCB 2NN6G 4JBKA 1XPUA 4BA1I 3CAMA 1P16A 2JK8A 2CFMA 3ULPA 4ME3A 4BY7H 5FLMH 1LTLA 3DM3A 4LFAQ 4DPGA 2R93G 4OXPA 1I5FA 2WAQG 2YU9H 4K0KQ 4A76A 4LF4Q 5BR8Q 1A8VA 3NELA 5FLXc 4L5TA 2OTJA 4A3FG 3S2DH 1UEBA 2FXQA 3STBC 1VQ8A 1GO3E 1K83H 1N34L 4JI0Q 5IYBH 5GAEC 2ZTDA 4JV5L 1OXUA 3I7FA 3NBHB 1CKOA 3S2HH 3RLOA 1G6PA 1UE1A 4DR1L 3M4OH 1SN8A 3Q8DA 4OWWB 1EIFA 4DR4Q 4LF9Q 5IWAL 3HOXH 1Z9FA 4BBSH 5GAGC 2RHSB 2JA6H 1VQFA 2B3GA 2IT1A 4FDBA 1YJNA 1HR0L 2R92H 4NXNL 5LMNL 5IY0A 1Q7YC 1A62A 1VQIA 1X55A 2JA6G 1TWHH 1UE5A 3KF6B 1XMQL 4DV3Q 4OO1G 4DV1Q 1YIJA 3B6YA 4R4CA 2UUCQ 3GTQH 1EWIA 4DV5Q 2LXJA 2IX1A 3M9BA 1K0RA 4LW1A 4IOAA 2KHJA 4DV4L 4GKKQ 1TWGH 1YZ6A 1KD1C 1J6QA 2A1AA 4GKJQ 1GVPA 4A3IG 4DUYL 3K8AA 3AEVA 2UUBQ 2DUDA 4PG3A 4B3TL 1JE5A 5IYCG 2NVQH 1SROA 4JBJA 4BBRH 1MKHA 4LWCA 4L5RC 1HNWL 5FJ8G 3H0GG 4QQBX 2KBNA 2ATWA 5GAHC 1X3GA 1KIXA 3S1MH 1EUJA 4A3KH 3BZCA 5C3EG 2PQAA 1DGSA 3PGZA 4AQYL 4GLAC 3RLNA 4LF8L 1IBMQ 4OX9Q 4DAYB 1HZBA 4QL5A 1OXVA 3D31A 4APVA 4X64L 4DV7L 1PV4A 1JB7A 1HZCA 2NVYH 2WB1E 3CCVA 2ASBA 1J5EQ 3FKIG 1I94L 4IJLA 4IPGA 1BBUA 2UXCL 3M85A 1IL2A 3F2CA 2VQFQ 4PZ6A 4JBWA 1PYBA 4XTCS 3GD7A 3KLWA 1PHJA 2F4VL 4YWKA 2BH2A 1LUZA 1VQJA 3A5UA 4B3SL 1X54A 3E9IA 4X62L 3HOYG 2WB1G 2HIXA 2K52A 3HOVG 1QUQB 1WCMG 3I4MH 3F1ZA 1FVIA 3S17H 3CF5A 4C2MH 2EIFA 3F2DA 4DV3L 4Y7NH 4DAMA 2IX0A 3AFQA 3W1GA 2JEAI 4GKKL 4P73A 1IBLQ 4X66L 4A3DH 1B8AA 2K5HA 2PI2E 3KDFA 4HJ7A 1PH7A 2HT1A 1IYJB 3J81i 1ASYA 2R7ZH 5ELOA 1G51A 3WWVA 4POFA 1VQBA 4C3IH 4GLXA 4JI6L 5M3MG 1W3SA 2ZJPA 4YHHL 3UE0A 1C7YA 4JI8Q 1D7QA 3AFPA 2UUBL 1CKMA 1MJCA 5E7NA 4DV2Q 3HOZH 1XNRQ 3RZDH 1Q86C 3CMEA 4IJHA 3M4QA 1QVGA 3VDYA 4IPHA 4EQ5A 4A93H 5C4XG 1VQKA 2UXBQ 1H95A 3S14H 5JJIA 1V9PA 1N36Q 1VQPA 5AJ3Q 1YHBA 1PFSA 3A5ZB 1YNXA 4DUZQ 5JJKA 2I0QA 4JYAQ 3CP0A 3W1BA 4H02A 1HNXL 3KOJA 3DLLA 4DR6Q 2UXDQ 4A3LH 4DK3C 3GTOH 4BXXH 4QJFA 3G4SA 1XMOQ 4HIMA 3RR5A 1IXRA 4JI1Q 1Y1VH 2D0PA 2ZM6Q 2QGQA 3OW2A 3NENA 1Y1VG 2MO0A 2E5LL 2ZJQA 2JA5H 1XNQL 1X3FA 2WAQE 4JG2A 4LF6L 3AQQA 1LM0A 2ID0A 2AMCB 3LGJA 4JCVE 4HJ8A 4GOPA 3PIOA 3FHWA 1IBLL 4HJ9A 1FJGL 2HIVA 5JEAJ 1Y1WH 4P72A 1WJJA 4A3EH 4BA2I 4A3JH 2K75A 2IY5B 4B3ML 1X3EA 3EBEA 1IZ6A 1X6OA 1CUKA 2Q2TA 4OWTB 4DV6Q 4BY7G 5FLMG 1SR3A 4YCUA 1K73C 4EX5A 2VS1A 5M5WH 1VQDA 1Q8KA 4DV0Q 2XGTA 1NJIC 1NBWA 4A3MH 1GM5A 1HNZQ 4DR3Q 4LFCQ 4XIGS 3OYYA 1OXSC 1RL2A 4LUZA 1MJEA 1WFQA 1I6HH 1NMGA 2B29A 4YCVA 5IYBG 3G71A 3UE1A 4DR5L 3PO2H 4X65L 4QGUA 5IP7H 3J80i 5M3FH 2D0OA 3M3YH 1BKBA 1PYSB 1L1OC 4YWLA 3HOXG 4BBSG 2I5LX 2PI2A 4DUZL 3CCQA 2UUAL 4JYAL 3J7ZC 2R92G 4LFBQ 1SE8A 3PSIA 4P71A 1EQRA 4DR6L 2UXDL 3BJUA 1L2FA 3PUYA 4GNXC 2BA1A 4GN3B 1IBKL 2E2HH 1NY4A 4JI1L 1AE2A 3FP9A 1XJVA 2C35B 4A3CH 4PZ7A 2PNHA 4AIMA 2IHFA 5C44H 2ZM6L 2JA8H 3MXNB 3TRZA 4A3CG 3CCEA 4DR2L 3HFZB 4KHZA 2OWOA 1HZ9A 1PA6A 2IHEA 2JA7H 2VY3A 2PQAB 1FGUA 2NVTH 1ASZA 2N49A 2NVXH 3S24A 2MFIA 1KL9A 1C0AA 4UP8A 4BBRG 3HKZG 4C3JH 1S3OA 1WYDA 2UU9Q 4LFAL 2OTLA 2KENA 2OQKA 3S1RH 4A3KG 2ZJRA 3HKSA 1KC8C 3I4NH 2RCNA 5BR8L 2VQEQ 4DV0L 3KF6A 4LF4L 3L2PA 2K14A 1QZHA 4L5SA 4A3BH 4MTNA 1VQ9A 4B3RL 4JI0L 3T1HQ 2JA9A 2Q2HA 1VQ4A 1M1KC 1L1OB 1TWFH 4MNOA 1N33Q 4IO9A 1S72A 3E9HA 3OTOQ 4KI0A 3A0JA 4B3RQ 4DR4L 4LF9L 2JJQA 3G48A 4GNXB 1VQLA 2V1CC 2CWPA 3KDFB 3J7A5 4YY3Q 3PUWA 4UP9A 1N32Q 3I4MG 4JI4Q 5IYDH 4TVAB 3U4VA 1PH8A 4DNIA 4DV1L 4DR7Q 4J15A 2F3IA 1G291 2UUCL 2YTYA 5JJLA 4DV5L 1PH3A 2GVBA 2YTVA 4WJ3M 4A3DG 4WJ4A 1KXLA 1X56A 1K3RA 1KRTA 2E2JH 4BY1H 3J81j 3PV0A 1YBYA 3AYHB 4PZ8A 4JI3Q 2R7ZG 4GKJL 3CXCA 4KHPQ 1M90C 1I50H 5EAYA 4BY1G 1LYLA 4A75A 4GN4B 2MO1A 2VZAA 4P75A 1AH9A 4RG1A 1PH2A 4IPDA 3T1YQ 4JI5Q 5C0XI 1NTGA 4HJAA 1E3PA 3KF8B 4TQUS 3HOZG 3U4ZA 1N8RC 3S16H 4IFDJ 1VQAA 4NB3A 3TS0A 3D0FA 1XTDA 2ALYB 1IBML 4OX9L 1JT8A 4A93G 1C9OA 3ULLA 1VQGA 2KHIA 4R4OA 1J5EL 2VUMH 3GTPH 4IFDI 1YITA 3E0EA 3GTMH 1FL0A 4IOCA 1N33L 2VQFL 1WI5A 3CW2C 1Q1BA 1VQMA 1N34Q 2B63H 3CD6A 4HJ5A 4JOIA 2CCZA 1TWCH 2A19A 4R4TA 3UDGA 1W2BA 4A3LG 2PMZE 1UE7A 4BXXG 4A3GH 4GOPB 3I56A 3PUZA 1YHQA 2ZTCA 4DR1Q 3S15H 4AH6A 1VQ5A 4RMFA 1PH1A 5IWAQ 3KJOA 4IFDG 4MZ9A 5IE8A 3JAMc 3CCSA 2E2IH 2JA5G 4JI4L 4C3HH 5LMNQ 3GTJH 2QA4A 1XPRA 3A74A 2KCMA 2CQOA 4OWXB 1XMQQ 1EQQA 1Y1WG 4NPSA 2Y0SG 5IP9H 4A3EG 1OXTA 1N9WA 3HOWH 3I2ZA 4A3JG 2HQLA 3K80C 3F2BA 4KHPL 3U58A 2H5XA 2AWNA 4JI3L 5IP9G 3W5OA 2BH8A 1CKNA 2N8NA 2RHQB 4JI8L 4ALPA 4DK6C 1QVFA 2LXKA 2YV5A 2N3SA 3RLFA 1UE6A 2WFWA 1P8LA 3CCUA 4JI5L 4DV2L 3T1YL 1B7YB 1XNRL 1NMFA 2AHOB 3U50C 4A3MG 2R7DA 5J3BA 1PH4A 4B3TQ 4UY8C 1BBWA 2Z6KA 4HIKA 2UXBL 3PO3H 2VW9A 1HNWQ 5JEAG 2DGYA 2HHHQ 3PO2G 4UP7A 1N36L 1YHAA 5AJ3L 5IP7G 2R93H 1VCIA 3K7AH 3PO3G 4GS3A 2XTIA 3I4OA 3NEMA 5M3FG 4AQYQ 5HY6A 3BU2A 4DKAC 5HGQA 3ZJYC 4DV7Q 4X64Q 4A3FH 4LF8Q 1RIPA 1VQ6A 2EQSA 1SRUA 3PUXA 1AE3A 1OXXK 4R4IA 5C4JH 2NZOA 1KRSA 2F52A 1XMOL 2GVAA 5GADC 2WP8J 4R1JA 3KJPA 1I94Q 4OO1I 5M5XH 4O2DA 2L15A 3G6EA 3HKZE 5K36G 4Y52H 3GO5A 2LSSA 2F4VQ 3EN2A 3JAMi 4L5QA 1BVSA 5C44G 1OTCA 3CC4A 3MEFA 4B3SQ 4POGA 2JA8G 3M7NA 3PCOB 4X62Q 4JC0A 1X9NA 4LF5Q 1VQ7A 3S1QH 2YTXA 2D62A 4HIDA 5DLQE 3CPWA 2JA7G 3GTGH 1I3QH 2AKWB 1E7ZA 2CKZB 3PUVA 3RNUA 4JI7Q 3TREA 1XPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MIU A;  4X6A H;  4X66 Q;  1Z47 A;  1YI2 A;  3CC2 A;  1SMX A;  4DV6 L;  2Q2I A;  1X65 A;  2NZH A;  3CCJ A;  3ER0 A;  4NXM Q;  1EOV A;  2OQ0 A;  4HIO A;  1R9T H;  3K0X A;  3K81 C;  4A3I H;  3GTL H;  1PH9 A;  2JQO A;  3J81 c;  1VQE A;  3I4N G;  4A3B G;  4JI6 Q;  1T9H A;  1HNZ L;  4DR3 L;  4LFC L;  2VL6 A;  1TXY A;  4YHH Q;  5IYC H;  3HOU H;  4LNQ A;  5ELN A;  1JJG A;  1YJ9 A;  5FJ8 H;  2R7F A;  3H0G H;  3H15 A;  3HOU G;  4QIW E;  1K8G A;  4JOI C;  2K4K A;  2E8G A;  2CWA A;  5C3E H;  1PH5 A;  2HHH L;  4GLV B;  1NE3 A;  3TQY A;  3S1N H;  4K0K L;  1Q1E A;  2BA0 A;  1SLJ A;  2KCT A;  3GTK H;  1GD7 A;  3I55 A;  1Q12 A;  1KQS A;  4LFB L;  3L0O A;  3L7Z C;  2MNA A;  1UWV A;  3FKI H;  4R4Q A;  4LUO A;  3SGI A;  4GOP C;  2R6G A;  5IYD G;  5IT9 c;  1HNX Q;  2YYZ A;  2AWO A;  3KFU A;  1HJP A;  1WOC A;  5LMU Q;  2ES2 A;  2N78 A;  1O7I A;  1SFO H;  2JE6 I;  1Q81 C;  3PIP A;  1PVO A;  2K5V A;  4P74 A;  3JC6 6;  3TEH B;  1Q46 A;  5C0X J;  1EYG A;  3HOY H;  1YEZ A;  3HOV H;  1QVC A;  1WCM H;  2QEX A;  2RF4 A;  4LF5 L;  1VQH A;  3K7U C;  1L1O A;  2E5L Q;  3ICE A;  4JI2 Q;  1XNQ Q;  4LF6 Q;  4JI7 L;  4LF7 Q;  4PMW A;  3H3V I;  3UDI A;  1CSQ A;  1KHI A;  4GNX A;  1VQC A;  4AYB E;  4GN5 A;  4LUV A;  2UU9 L;  1YJW A;  1FJG Q;  3TS2 A;  2Z6K C;  5GQO A;  1QUQ A;  1U0L A;  3RN2 A;  1HH2 P;  1K9M C;  4YWM A;  2VQE L;  4B3M Q;  4NXM L;  4UPA A;  4OON A;  4IPC A;  1V1Q A;  5M3M H;  1GKH A;  2K5N A;  2Z0S A;  3T1H L;  3H3V H;  1E1T A;  1TWA H;  1Y14 B;  2VUM G;  5C0X G;  4QY7 A;  3M4P A;  1A63 A;  2EXD A;  1L0W A;  4AYB G;  4JBM A;  3KYH C;  3OTO L;  3CQZ H;  2VNU D;  4JV5 Q;  1JMC A;  4YCW A;  1PH6 A;  2B63 G;  5C4X H;  2A8V A;  5M5Y H;  1A0I A;  2Y0S E;  4KLK A;  4DR5 Q;  4A3G G;  2K50 A;  3UDX A;  3STB D;  1V43 A;  4YY3 L;  4X65 Q;  3RN5 A;  1CSP A;  2ZTE A;  1D8L A;  3EIV A;  1HR0 W;  1N32 L;  1Q82 C;  1U5K A;  5LMN W;  1HR0 Q;  1KAW A;  4DR7 L;  4NXN Q;  2UXC Q;  2I5H A;  2GN5 A;  3J80 c;  3CCR A;  2UUA Q;  2OCE A;  3IRB A;  3BZK A;  1CKN B;  3CC7 A;  1E24 A;  2MQH A;  3CMA A;  5GRO A;  5LMU L;  1K8A C;  1VQO A;  2NN6 I;  1JJ2 A;  1VQN A;  3ULJ A;  3CCM A;  1IBK Q;  1YVC A;  4A4I A;  3HOW G;  2JEB I;  4DV4 Q;  3GDE A;  4O0A A;  1E1O A;  4DR2 Q;  1QZG A;  4JI2 L;  3CCL A;  3F8T A;  1E22 A;  3ERS X;  1S40 A;  4DUY Q;  1B70 B;  3CPF A;  5H1S E;  4LF7 L;  3PF4 A;  1HZA A;  3RZO H;  2I5M X;  1EFW A;  3UDF A;  2Q2U A;  3PF5 A;  1EIY B;  1VS0 A;  1JJC B;  2NN6 G;  4JBK A;  1XPU A;  4BA1 I;  3CAM A;  1P16 A;  2JK8 A;  2CFM A;  3ULP A;  4ME3 A;  4BY7 H;  5FLM H;  1LTL A;  3DM3 A;  4LFA Q;  4DPG A;  2R93 G;  4OXP A;  1I5F A;  2WAQ G;  2YU9 H;  4K0K Q;  4A76 A;  4LF4 Q;  5BR8 Q;  1A8V A;  3NEL A;  5FLX c;  4L5T A;  2OTJ A;  4A3F G;  3S2D H;  1UEB A;  2FXQ A;  3STB C;  1VQ8 A;  1GO3 E;  1K83 H;  1N34 L;  4JI0 Q;  5IYB H;  5GAE C;  2ZTD A;  4JV5 L;  1OXU A;  3I7F A;  3NBH B;  1CKO A;  3S2H H;  3RLO A;  1G6P A;  1UE1 A;  4DR1 L;  3M4O H;  1SN8 A;  3Q8D A;  4OWW B;  1EIF A;  4DR4 Q;  4LF9 Q;  5IWA L;  3HOX H;  1Z9F A;  4BBS H;  5GAG C;  2RHS B;  2JA6 H;  1VQF A;  2B3G A;  2IT1 A;  4FDB A;  1YJN A;  1HR0 L;  2R92 H;  4NXN L;  5LMN L;  5IY0 A;  1Q7Y C;  1A62 A;  1VQI A;  1X55 A;  2JA6 G;  1TWH H;  1UE5 A;  3KF6 B;  1XMQ L;  4DV3 Q;  4OO1 G;  4DV1 Q;  1YIJ A;  3B6Y A;  4R4C A;  2UUC Q;  3GTQ H;  1EWI A;  4DV5 Q;  2LXJ A;  2IX1 A;  3M9B A;  1K0R A;  4LW1 A;  4IOA A;  2KHJ A;  4DV4 L;  4GKK Q;  1TWG H;  1YZ6 A;  1KD1 C;  1J6Q A;  2A1A A;  4GKJ Q;  1GVP A;  4A3I G;  4DUY L;  3K8A A;  3AEV A;  2UUB Q;  2DUD A;  4PG3 A;  4B3T L;  1JE5 A;  5IYC G;  2NVQ H;  1SRO A;  4JBJ A;  4BBR H;  1MKH A;  4LWC A;  4L5R C;  1HNW L;  5FJ8 G;  3H0G G;  4QQB X;  2KBN A;  2ATW A;  5GAH C;  1X3G A;  1KIX A;  3S1M H;  1EUJ A;  4A3K H;  3BZC A;  5C3E G;  2PQA A;  1DGS A;  3PGZ A;  4AQY L;  4GLA C;  3RLN A;  4LF8 L;  1IBM Q;  4OX9 Q;  4DAY B;  1HZB A;  4QL5 A;  1OXV A;  3D31 A;  4APV A;  4X64 L;  4DV7 L;  1PV4 A;  1JB7 A;  1HZC A;  2NVY H;  2WB1 E;  3CCV A;  2ASB A;  1J5E Q;  3FKI G;  1I94 L;  4IJL A;  4IPG A;  1BBU A;  2UXC L;  3M85 A;  1IL2 A;  3F2C A;  2VQF Q;  4PZ6 A;  4JBW A;  1PYB A;  4XTC S;  3GD7 A;  3KLW A;  1PHJ A;  2F4V L;  4YWK A;  2BH2 A;  1LUZ A;  1VQJ A;  3A5U A;  4B3S L;  1X54 A;  3E9I A;  4X62 L;  3HOY G;  2WB1 G;  2HIX A;  2K52 A;  3HOV G;  1QUQ B;  1WCM G;  3I4M H;  3F1Z A;  1FVI A;  3S17 H;  3CF5 A;  4C2M H;  2EIF A;  3F2D A;  4DV3 L;  4Y7N H;  4DAM A;  2IX0 A;  3AFQ A;  3W1G A;  2JEA I;  4GKK L;  4P73 A;  1IBL Q;  4X66 L;  4A3D H;  1B8A A;  2K5H A;  2PI2 E;  3KDF A;  4HJ7 A;  1PH7 A;  2HT1 A;  1IYJ B;  3J81 i;  1ASY A;  2R7Z H;  5ELO A;  1G51 A;  3WWV A;  4POF A;  1VQB A;  4C3I H;  4GLX A;  4JI6 L;  5M3M G;  1W3S A;  2ZJP A;  4YHH L;  3UE0 A;  1C7Y A;  4JI8 Q;  1D7Q A;  3AFP A;  2UUB L;  1CKM A;  1MJC A;  5E7N A;  4DV2 Q;  3HOZ H;  1XNR Q;  3RZD H;  1Q86 C;  3CME A;  4IJH A;  3M4Q A;  1QVG A;  3VDY A;  4IPH A;  4EQ5 A;  4A93 H;  5C4X G;  1VQK A;  2UXB Q;  1H95 A;  3S14 H;  5JJI A;  1V9P A;  1N36 Q;  1VQP A;  5AJ3 Q;  1YHB A;  1PFS A;  3A5Z B;  1YNX A;  4DUZ Q;  5JJK A;  2I0Q A;  4JYA Q;  3CP0 A;  3W1B A;  4H02 A;  1HNX L;  3KOJ A;  3DLL A;  4DR6 Q;  2UXD Q;  4A3L H;  4DK3 C;  3GTO H;  4BXX H;  4QJF A;  3G4S A;  1XMO Q;  4HIM A;  3RR5 A;  1IXR A;  4JI1 Q;  1Y1V H;  2D0P A;  2ZM6 Q;  2QGQ A;  3OW2 A;  3NEN A;  1Y1V G;  2MO0 A;  2E5L L;  2ZJQ A;  2JA5 H;  1XNQ L;  1X3F A;  2WAQ E;  4JG2 A;  4LF6 L;  3AQQ A;  1LM0 A;  2ID0 A;  2AMC B;  3LGJ A;  4JCV E;  4HJ8 A;  4GOP A;  3PIO A;  3FHW A;  1IBL L;  4HJ9 A;  1FJG L;  2HIV A;  5JEA J;  1Y1W H;  4P72 A;  1WJJ A;  4A3E H;  4BA2 I;  4A3J H;  2K75 A;  2IY5 B;  4B3M L;  1X3E A;  3EBE A;  1IZ6 A;  1X6O A;  1CUK A;  2Q2T A;  4OWT B;  4DV6 Q;  4BY7 G;  5FLM G;  1SR3 A;  4YCU A;  1K73 C;  4EX5 A;  2VS1 A;  5M5W H;  1VQD A;  1Q8K A;  4DV0 Q;  2XGT A;  1NJI C;  1NBW A;  4A3M H;  1GM5 A;  1HNZ Q;  4DR3 Q;  4LFC Q;  4XIG S;  3OYY A;  1OXS C;  1RL2 A;  4LUZ A;  1MJE A;  1WFQ A;  1I6H H;  1NMG A;  2B29 A;  4YCV A;  5IYB G;  3G71 A;  3UE1 A;  4DR5 L;  3PO2 H;  4X65 L;  4QGU A;  5IP7 H;  3J80 i;  5M3F H;  2D0O A;  3M3Y H;  1BKB A;  1PYS B;  1L1O C;  4YWL A;  3HOX G;  4BBS G;  2I5L X;  2PI2 A;  4DUZ L;  3CCQ A;  2UUA L;  4JYA L;  3J7Z C;  2R92 G;  4LFB Q;  1SE8 A;  3PSI A;  4P71 A;  1EQR A;  4DR6 L;  2UXD L;  3BJU A;  1L2F A;  3PUY A;  4GNX C;  2BA1 A;  4GN3 B;  1IBK L;  2E2H H;  1NY4 A;  4JI1 L;  1AE2 A;  3FP9 A;  1XJV A;  2C35 B;  4A3C H;  4PZ7 A;  2PNH A;  4AIM A;  2IHF A;  5C44 H;  2ZM6 L;  2JA8 H;  3MXN B;  3TRZ A;  4A3C G;  3CCE A;  4DR2 L;  3HFZ B;  4KHZ A;  2OWO A;  1HZ9 A;  1PA6 A;  2IHE A;  2JA7 H;  2VY3 A;  2PQA B;  1FGU A;  2NVT H;  1ASZ A;  2N49 A;  2NVX H;  3S24 A;  2MFI A;  1KL9 A;  1C0A A;  4UP8 A;  4BBR G;  3HKZ G;  4C3J H;  1S3O A;  1WYD A;  2UU9 Q;  4LFA L;  2OTL A;  2KEN A;  2OQK A;  3S1R H;  4A3K G;  2ZJR A;  3HKS A;  1KC8 C;  3I4N H;  2RCN A;  5BR8 L;  2VQE Q;  4DV0 L;  3KF6 A;  4LF4 L;  3L2P A;  2K14 A;  1QZH A;  4L5S A;  4A3B H;  4MTN A;  1VQ9 A;  4B3R L;  4JI0 L;  3T1H Q;  2JA9 A;  2Q2H A;  1VQ4 A;  1M1K C;  1L1O B;  1TWF H;  4MNO A;  1N33 Q;  4IO9 A;  1S72 A;  3E9H A;  3OTO Q;  4KI0 A;  3A0J A;  4B3R Q;  4DR4 L;  4LF9 L;  2JJQ A;  3G48 A;  4GNX B;  1VQL A;  2V1C C;  2CWP A;  3KDF B;  3J7A 5;  4YY3 Q;  3PUW A;  4UP9 A;  1N32 Q;  3I4M G;  4JI4 Q;  5IYD H;  4TVA B;  3U4V A;  1PH8 A;  4DNI A;  4DV1 L;  4DR7 Q;  4J15 A;  2F3I A;  1G29 1;  2UUC L;  2YTY A;  5JJL A;  4DV5 L;  1PH3 A;  2GVB A;  2YTV A;  4WJ3 M;  4A3D G;  4WJ4 A;  1KXL A;  1X56 A;  1K3R A;  1KRT A;  2E2J H;  4BY1 H;  3J81 j;  3PV0 A;  1YBY A;  3AYH B;  4PZ8 A;  4JI3 Q;  2R7Z G;  4GKJ L;  3CXC A;  4KHP Q;  1M90 C;  1I50 H;  5EAY A;  4BY1 G;  1LYL A;  4A75 A;  4GN4 B;  2MO1 A;  2VZA A;  4P75 A;  1AH9 A;  4RG1 A;  1PH2 A;  4IPD A;  3T1Y Q;  4JI5 Q;  5C0X I;  1NTG A;  4HJA A;  1E3P A;  3KF8 B;  4TQU S;  3HOZ G;  3U4Z A;  1N8R C;  3S16 H;  4IFD J;  1VQA A;  4NB3 A;  3TS0 A;  3D0F A;  1XTD A;  2ALY B;  1IBM L;  4OX9 L;  1JT8 A;  4A93 G;  1C9O A;  3ULL A;  1VQG A;  2KHI A;  4R4O A;  1J5E L;  2VUM H;  3GTP H;  4IFD I;  1YIT A;  3E0E A;  3GTM H;  1FL0 A;  4IOC A;  1N33 L;  2VQF L;  1WI5 A;  3CW2 C;  1Q1B A;  1VQM A;  1N34 Q;  2B63 H;  3CD6 A;  4HJ5 A;  4JOI A;  2CCZ A;  1TWC H;  2A19 A;  4R4T A;  3UDG A;  1W2B A;  4A3L G;  2PMZ E;  1UE7 A;  4BXX G;  4A3G H;  4GOP B;  3I56 A;  3PUZ A;  1YHQ A;  2ZTC A;  4DR1 Q;  3S15 H;  4AH6 A;  1VQ5 A;  4RMF A;  1PH1 A;  5IWA Q;  3KJO A;  4IFD G;  4MZ9 A;  5IE8 A;  3JAM c;  3CCS A;  2E2I H;  2JA5 G;  4JI4 L;  4C3H H;  5LMN Q;  3GTJ H;  2QA4 A;  1XPR A;  3A74 A;  2KCM A;  2CQO A;  4OWX B;  1XMQ Q;  1EQQ A;  1Y1W G;  4NPS A;  2Y0S G;  5IP9 H;  4A3E G;  1OXT A;  1N9W A;  3HOW H;  3I2Z A;  4A3J G;  2HQL A;  3K80 C;  3F2B A;  4KHP L;  3U58 A;  2H5X A;  2AWN A;  4JI3 L;  5IP9 G;  3W5O A;  2BH8 A;  1CKN A;  2N8N A;  2RHQ B;  4JI8 L;  4ALP A;  4DK6 C;  1QVF A;  2LXK A;  2YV5 A;  2N3S A;  3RLF A;  1UE6 A;  2WFW A;  1P8L A;  3CCU A;  4JI5 L;  4DV2 L;  3T1Y L;  1B7Y B;  1XNR L;  1NMF A;  2AHO B;  3U50 C;  4A3M G;  2R7D A;  5J3B A;  1PH4 A;  4B3T Q;  4UY8 C;  1BBW A;  2Z6K A;  4HIK A;  2UXB L;  3PO3 H;  2VW9 A;  1HNW Q;  5JEA G;  2DGY A;  2HHH Q;  3PO2 G;  4UP7 A;  1N36 L;  1YHA A;  5AJ3 L;  5IP7 G;  2R93 H;  1VCI A;  3K7A H;  3PO3 G;  4GS3 A;  2XTI A;  3I4O A;  3NEM A;  5M3F G;  4AQY Q;  5HY6 A;  3BU2 A;  4DKA C;  5HGQ A;  3ZJY C;  4DV7 Q;  4X64 Q;  4A3F H;  4LF8 Q;  1RIP A;  1VQ6 A;  2EQS A;  1SRU A;  3PUX A;  1AE3 A;  1OXX K;  4R4I A;  5C4J H;  2NZO A;  1KRS A;  2F52 A;  1XMO L;  2GVA A;  5GAD C;  2WP8 J;  4R1J A;  3KJP A;  1I94 Q;  4OO1 I;  5M5X H;  4O2D A;  2L15 A;  3G6E A;  3HKZ E;  5K36 G;  4Y52 H;  3GO5 A;  2LSS A;  2F4V Q;  3EN2 A;  3JAM i;  4L5Q A;  1BVS A;  5C44 G;  1OTC A;  3CC4 A;  3MEF A;  4B3S Q;  4POG A;  2JA8 G;  3M7N A;  3PCO B;  4X62 Q;  4JC0 A;  1X9N A;  4LF5 Q;  1VQ7 A;  3S1Q H;  2YTX A;  2D62 A;  4HID A;  5DLQ E;  3CPW A;  2JA7 G;  3GTG H;  1I3Q H;  2AKW B;  1E7Z A;  2CKZ B;  3PUV A;  3RNU A;  4JI7 Q;  3TRE A;  1XPO A; 
#chains in the Genus database with same CATH topology
 5IGB A;  4X66 Q;  1Z47 A;  3VYR A;  4DV6 L;  2Z9H A;  4JK1 C;  4EQO A;  3CCJ A;  2EYP A;  4NXM Q;  1EOV A;  2OQ0 A;  1GUN A;  3MHB A;  3NQT A;  2A6E C;  2JQO A;  3J81 c;  1T9H A;  3D6W A;  2KJX A;  1TXY A;  1JJG A;  1LLR D;  2R7F A;  3H15 A;  3J80 E;  4HSV A;  1FNW A;  5M5X B;  2HHH L;  4X3U A;  5C5L A;  5IIF A;  3A7L A;  2BA0 A;  1SLJ A;  5EBD A;  1KQS A;  4PMB A;  4LFB L;  2MNA A;  2PZT A;  3A56 A;  3NTH A;  1HA5 A;  3OPO A;  1QNU A;  1AN8 A;  5IT9 c;  2YYZ A;  3GTG B;  1WTH A;  1HJP A;  5LMU Q;  2PNR C;  3KUP A;  4FXG C;  3A8I E;  4DXF A;  2K5V A;  1F9P A;  3RMH A;  1L1O A;  3JAM L;  5I4D A;  2CH4 A;  2PZW A;  4JI7 L;  4LF7 Q;  1HRJ A;  3UDI A;  2ZT9 C;  1KHI A;  4GNX A;  4AYB E;  2K01 A;  4GN5 A;  2Z6K C;  2F0O A;  1CM9 A;  1ML0 D;  3RN2 A;  1HH2 P;  3FRP B;  4UPA A;  3NUC A;  4RKL A;  5M3M H;  2NWG A;  3H3V H;  3VYS A;  2D5D A;  3GTK B;  4N8X 1;  4KK7 A;  3M4P A;  3FKI B;  4R9W A;  1L0W A;  3A8K E;  5EBC A;  3OMC A;  3KYH C;  4AYB G;  4JBM A;  2HCC A;  3SEB A;  5M5Y H;  5EKL A;  3Q6S A;  2EJG C;  1SFO B;  3UDX A;  5CBA E;  1V43 A;  3RN5 A;  3D4R A;  3ITP A;  5LL6 X;  1CSP A;  3QOL A;  1D8L A;  1Q82 C;  3HOV B;  2WV6 D;  1HR0 Q;  1BXT A;  3K0Y A;  2I5H A;  2GN5 A;  3J80 c;  2UUA Q;  1XX8 A;  3FPU B;  1FYC A;  1VQO A;  4G57 A;  2QCP X;  3HOW G;  1B9N A;  4DV4 Q;  1HUN A;  4JI2 L;  3ERS X;  1S40 A;  4DUY Q;  4IUP A;  1TWA B;  2F4I A;  2XRQ D;  1PFN A;  2JK8 A;  3ULP A;  1PTO D;  5FO9 B;  4BY7 H;  5FLM H;  5C4X B;  1LTL A;  1KDB A;  3DM3 A;  4HSP A;  2F3W A;  5D3D A;  5I6Y A;  2YU9 H;  4LF4 Q;  3NEL A;  2OTJ A;  1WD0 A;  1UEB A;  1H9K A;  1GHK A;  1CKO A;  1UE1 A;  4DR1 L;  1EFI D;  4F88 A;  2KA7 A;  4BBS H;  2RHS B;  2AUJ D;  2IT1 A;  1YJN A;  5EJW A;  3RUZ A;  2F0L A;  1A62 A;  3HG9 A;  3I3C A;  3FPP A;  3KF6 B;  3ZYY X;  4OO1 G;  2G9D A;  3DHQ A;  3B6Y A;  2OT2 A;  1EWI A;  2PMZ B;  1LT3 D;  1JOQ A;  3I90 A;  1YNJ C;  4N9T A;  3M9B A;  2FFK B;  1K0R A;  5EGT A;  1BNZ A;  4IOA A;  1YZ6 A;  1KD1 C;  1I4R A;  4WOR A;  3VR3 A;  3CU7 A;  3HZX A;  5E3F A;  4ZCK A;  2UUB Q;  2DUD A;  4PG3 A;  3S2D B;  2I46 A;  3BVG A;  3MXP A;  1CFM A;  1SRO A;  4IUV A;  4JBJ A;  2F03 A;  4L5R C;  5DAU A;  3I91 A;  2ATW A;  3S1M H;  1EUJ A;  1D5X C;  3QB3 A;  4A3K H;  3BZC A;  3PGZ A;  3ERQ A;  3OIQ A;  3RLN A;  1MD2 D;  3HOX B;  1E2V A;  1EYC A;  2A68 C;  3CCV A;  1D1K A;  2RKS A;  1IKL A;  3FKI G;  4ZK9 B;  1QNK A;  1IL2 A;  1ICF B;  4PZ6 A;  4XT3 B;  1PHJ A;  4YWK A;  2DJG C;  4B3S L;  2G5D A;  3A5U A;  1TS4 A;  1PDQ A;  3AB9 A;  1A3T A;  1A3U A;  1TWG B;  3E3X A;  3NWS A;  3HOV G;  5HGT A;  2ZXP A;  4C2M H;  4X3T A;  1Q3L A;  1CQF A;  2IX0 A;  3AFQ A;  3W1G A;  2JEA I;  2BOS A;  4P73 A;  1IBL Q;  1B8A A;  2NVQ B;  4BBR B;  1EOT A;  3H3V C;  2L4N A;  2F0G A;  3WWV A;  4C3I H;  1BBX C;  3K6O A;  1W3S A;  4YHH L;  1D7Q A;  4F87 A;  1S4Z A;  5KNC A;  3T53 B;  1TY0 A;  2H1E A;  4DNR B;  4CKE A;  5IGF A;  4IJH A;  3TP5 A;  3M4Q A;  4EQ5 A;  5C4X G;  3DWA A;  1EZ8 A;  1PFS A;  2XN9 C;  5JJK A;  2I0Q A;  3IFD A;  3KOJ A;  3G4S A;  2F0P A;  1XMO Q;  1AZP A;  1VF7 A;  4JI1 Q;  2B2Y C;  1TVX A;  5E1F A;  1LT6 D;  2NTS A;  4IFD H;  1STH A;  2EJF C;  2WAQ E;  3TP8 A;  2PPB C;  2FHT A;  2IJ0 A;  4DFA A;  4JCV E;  3LGJ A;  4HTH A;  3WOE A;  5FO7 B;  2HIV A;  5JEA J;  1LTA D;  4BA2 I;  3HOZ B;  1B9M A;  2IY5 B;  5CV8 A;  1X3E A;  1F2Z A;  1IZ6 A;  5CBE E;  1X6O A;  1RJT A;  1CUK A;  4DV6 Q;  2ENB A;  1SYE A;  3OHX C;  1K73 C;  4EX5 A;  2EXZ A;  5BN5 A;  1SMY D;  1NJI C;  4A3M H;  2E2D C;  4XIG S;  2BDO A;  3G71 A;  3GTO B;  4DR5 L;  2KQ3 A;  2K7V A;  4L63 B;  1PYS B;  4F7X A;  3HOX G;  2PI2 A;  5CYU A;  4LFB Q;  5CV4 A;  1L2F A;  4EQN A;  3PUY A;  1NY4 A;  3FP9 A;  1XJV A;  5K36 H;  3H09 A;  1R4P B;  3V96 A;  4A3J B;  1BCP F;  1PRT D;  3MVV A;  4P2C B;  3HFZ B;  3KLR A;  2XIW A;  4NKL A;  4LK1 C;  2NVT H;  4IUN A;  4IN3 A;  3T13 A;  4RGM A;  2G9H D;  4BBR G;  5EPK A;  3HKZ G;  5JAV A;  2WKC A;  1VMC A;  2SEB D;  4LFA L;  2EY1 A;  2ZJR A;  2QKI C;  3LWU A;  4DXG A;  4A3B H;  2K14 A;  4H7B A;  2B2V C;  5C3X A;  1ZYR C;  2J4X A;  4K14 A;  4MTN A;  1VQ9 A;  2JA9 A;  4MNO A;  1N33 Q;  3JAM E;  4IO9 A;  3MWY W;  1YNN D;  1EWH A;  4KI0 A;  1I4P A;  4DR4 L;  5A2Q L;  4Q0F A;  2E2H B;  2DJF C;  3T51 B;  1ET9 A;  3J7A 5;  1DOK A;  3PUW A;  4TRD A;  4CDE C;  5IYD H;  4JI4 Q;  4TVA B;  4FXD A;  1BQQ T;  1DCZ A;  2UUC L;  2YTY A;  2B2T A;  1QIL A;  2NTT A;  4WJ3 M;  1LTB D;  3DWQ A;  2L9H A;  1X56 A;  4ODG A;  1K3R A;  1R4Q B;  4C3J B;  3PV0 A;  4PZ8 A;  3GV3 A;  1SYF A;  3CXC A;  3M7G A;  3S1R B;  4A75 A;  4GN4 B;  1FGB D;  5I9P A;  1QE6 A;  3T1Y Q;  4IAL A;  2JYO A;  3QOJ A;  2EOT A;  4IUQ A;  1TWF B;  4MIU A;  4TQU S;  3HOZ G;  4IFD J;  2V4D A;  4NB3 A;  3IFT A;  3D4D A;  2KHI A;  1C4Q A;  1G8Z D;  1J5E L;  2MUY A;  2EDG A;  5C0X H;  3GTP H;  4ZKC B;  1YIT A;  3E0E A;  2LMC B;  1RD9 D;  4IZ8 A;  3I4L A;  2PW7 A;  3VR6 A;  4HJ5 A;  2CCZ A;  2A19 A;  4BXX G;  1W2B A;  1K0S A;  3FVQ A;  4A3G H;  1CK1 A;  1TS3 A;  5T1I A;  3WDN A;  4DR1 Q;  2WIN B;  4AH6 A;  1PH1 A;  2MPM A;  4JPB W;  3JAM c;  3CCS A;  3CKI B;  3VR5 A;  1B44 D;  3GTJ H;  1XPR A;  1CHQ D;  1G2T A;  1JWU D;  5IP9 H;  4C1N K;  4A3J G;  4KHP L;  4A93 B;  2H5X A;  2AWN A;  4FP5 D;  4NDX A;  5IP9 G;  1WTQ A;  1Y8P B;  4DK6 C;  2VUM B;  2WFW A;  4DV2 L;  1TII D;  4O42 A;  3MFY A;  2NN6 H;  4ZUJ A;  4UY8 C;  1O7Y A;  4BS9 A;  4HIK A;  2B63 B;  2UXB L;  3EQL C;  2VW9 A;  4K2L A;  5KIX A;  1N36 L;  3KK7 A;  5IP7 G;  2R93 H;  4G7O C;  5ELB A;  3NEM A;  5I2Y A;  1QCB D;  4NMZ A;  1JB3 A;  2R61 A;  1EY9 A;  3AMU A;  3BDO A;  2EQS A;  1AE3 A;  1OXX K;  2E2I B;  3TME A;  3WOF A;  1L0Y B;  4C3H B;  2WP8 J;  3M4Y A;  4XQJ A;  2IW3 A;  5D14 A;  3G6E A;  2ICI A;  2LSS A;  3MC0 B;  4L5Q A;  3CC4 A;  4B3S Q;  4HN7 A;  3BG3 A;  3PCO B;  5I2X A;  1X9N A;  3S1Q H;  2NB0 A;  2YTX A;  5CV9 A;  2D62 A;  3OIP A;  4WRD A;  1I3Q H;  3ERO A;  3P75 A;  4XDX A;  1DJR D;  3C1F A;  4G7Z C;  4X6A H;  1YI2 A;  1SMX A;  4QUF A;  3HP3 A;  1EYD A;  4C3J G;  1ET6 A;  3ER0 A;  1SNC A;  3GP7 A;  1SJH D;  4DAP A;  1VQE A;  2K33 A;  3MXU A;  4DR3 L;  4LFC L;  2VL6 A;  4A3F B;  2OXP A;  5C4Z A;  4YHH Q;  3HOU H;  3P20 A;  5C4J B;  3HOU G;  1HA6 A;  5DM7 3;  1PH5 A;  5C3E H;  3TQY A;  4CJ1 B;  5IOC A;  2KCT A;  3K5N A;  3I55 A;  1Q12 A;  3L7Z C;  1HXY D;  4LUO A;  3SGI A;  1HCZ A;  2R6G A;  2O4X A;  4ZUI A;  1CQV A;  1F9S A;  3C2P A;  2F0H A;  3KFU A;  1VDZ A;  2CW0 D;  1RTN A;  2HD3 A;  3QR8 A;  1O7I A;  4E6I A;  1TQO A;  1Q81 C;  1S5F D;  1TS2 A;  1EYG A;  5C0X J;  3F2U A;  2QEX A;  4LF5 L;  3K7U C;  1SJE D;  3ICE A;  1SE2 A;  1ZXT A;  1LO5 D;  3H3V I;  1MHW C;  1ESF A;  2UU9 L;  5GQO A;  3MZ5 A;  2VQE L;  4QB4 A;  4IPC A;  1KNE A;  1NUC A;  1C8C A;  3AU7 A;  1A2U A;  1Y14 B;  2VUM G;  2WII B;  1A63 A;  2EXD A;  2EE1 A;  3SXH A;  4BWG B;  3CQZ H;  3NHH A;  5ELD A;  1JMC A;  2B63 G;  2A8V A;  2Y0S E;  4KLK A;  4DR5 Q;  2L1B A;  2K50 A;  4YY3 L;  3P1H A;  2ZTE A;  3EIV A;  2WB1 B;  1CZW A;  5LMN W;  2B2V A;  1KAW A;  3NBI A;  4NXN Q;  2EVB A;  4XYQ A;  4C3H G;  3CMA A;  3V2T A;  1ENA A;  1D5M C;  3CCM A;  2XRS D;  1F2L A;  3DXJ C;  4A4I A;  2JEB I;  4DNT B;  5M3M B;  3IKJ A;  1E22 A;  1HZA A;  2Z4I A;  3PIO 3;  2Q8R E;  1EIY B;  1XPU A;  4JBK A;  2LKV A;  1FNV A;  5COR A;  1LAB A;  4ME3 A;  3TDQ A;  5M5Y B;  4LFA Q;  1IW7 D;  1D6E C;  2QDB A;  3OWE B;  4L5T A;  4A3F G;  1EIG A;  1K83 H;  1N34 L;  5IGC A;  4RFB A;  4JV5 L;  1JWS D;  3I7F A;  4HR7 B;  3VR4 A;  3VA7 A;  4ILW A;  1SN8 A;  1EIF A;  4DR4 Q;  5IWA L;  4ZLT F;  2R92 H;  5LMN L;  3VR2 A;  5IY0 A;  4KKU A;  1XMQ L;  1EY8 A;  2EY2 A;  1SNQ A;  1YIJ A;  4YIJ A;  4R4C A;  2RQX A;  2UUC Q;  1LV9 A;  3W2D A;  2IX1 A;  2CVR A;  4BY7 B;  5A2Q E;  1GUW A;  2A1A A;  2Q8I B;  2B2W C;  1G2S A;  1U4L A;  4KN4 C;  3J7Y W;  2YU9 B;  3K8A A;  5CC4 A;  3AEV A;  1JE5 A;  1NSN S;  3MXN A;  1SDF A;  1JE4 A;  1EU4 A;  5GAH C;  1V1P A;  4CKC A;  3R93 A;  1DGS A;  1HZB A;  4BBS B;  5M9O A;  2NVY H;  2WB1 E;  1J5E Q;  1I94 L;  1BBU A;  1SYD A;  3F2C A;  2RSN A;  4JBW A;  1PYB A;  5BN3 A;  3E6Z X;  2BH2 A;  1SNO A;  1LUZ A;  2ZXR A;  3E9I A;  4X62 L;  2WB1 G;  2HIX A;  2K52 A;  4CDD C;  5KYL A;  2KVM A;  3I4M H;  1EQV A;  1W6J A;  2EIF A;  4DV3 L;  4A3D H;  5CV6 A;  1PH7 A;  4QF4 A;  2HT1 A;  3J7A V;  2NBF A;  1ESR A;  2SNS A;  5ELO A;  3S1M B;  4A3K B;  1K28 A;  4JI6 L;  5J39 A;  5M3M G;  4GZY C;  5DM6 3;  2CQA A;  2RDH A;  3AFP A;  1CKM A;  1WD1 A;  1O78 A;  4DV2 Q;  2JP1 A;  2KOL A;  5JPM C;  3RZD H;  4RA8 A;  3CME A;  5FKA C;  1EYA A;  3VDY A;  4IPH A;  2F0U A;  1VQK A;  4X3K A;  2UXB Q;  3S14 H;  1LAC A;  4KMU C;  1N36 Q;  3TN2 A;  1YNX A;  1PXU A;  4KJO A;  4JYA Q;  5FLX L;  5KNB A;  5C6A A;  1HNX L;  4C2M B;  3DLL A;  4DR6 Q;  2UXD Q;  2KEE A;  4A3L H;  4QIW B;  4QJF A;  4HMI A;  1GUT A;  2A5H A;  1JIC A;  2ZM6 Q;  1WTR A;  2E5L L;  1WTO A;  1XNQ L;  1X3F A;  4LF6 L;  4C3I B;  1CI3 M;  2ID0 A;  2AMC B;  3PIO A;  4K8I A;  1ZEQ X;  4B9X A;  1J8I A;  3MA2 B;  1H9M A;  4CBV A;  4B3M L;  4QMG A;  1W6K A;  3NTI A;  3Q24 A;  4H13 C;  4BY7 G;  5FLM G;  4MHE A;  4DV0 Q;  2VS1 A;  2L0C A;  1VQD A;  5NUC A;  1ILP A;  1B1Z A;  4LAA A;  1GM5 A;  4DR3 Q;  4LFC Q;  3OYY A;  3OSO A;  1NMG A;  3UE1 A;  1LTR D;  5JEA H;  5M3F H;  2D0O A;  2Z8L A;  2WKD A;  4OHJ A;  4WFN 3;  4BBS G;  4DUZ L;  2UXC L;  3CCQ A;  1Z7T A;  3J7Z C;  3PSI A;  1EQR A;  2F0J A;  3BJU A;  1C48 A;  2EYF A;  3R2I A;  1IBK L;  4PMC A;  3SK6 A;  5C44 H;  2A69 D;  3MXN B;  1EY5 A;  4DR2 L;  4IUR A;  1PMR A;  1V1P B;  2VY3 A;  1LTT D;  3GQB A;  4A3M B;  1B4O A;  2TSS A;  1KL9 A;  3UI2 A;  1C0A A;  1F77 A;  4DK1 A;  1WYD A;  3GV6 A;  2UU9 Q;  2OTL A;  2KEN A;  4A3K G;  1KC8 C;  3HKS A;  3NK9 A;  3I4N H;  2RCN A;  2VQE Q;  1QZH A;  1E0B A;  1U4P A;  1L1O B;  1S72 A;  3A0J A;  4B3R Q;  4LF9 L;  2JJQ A;  1ILQ A;  4K5X A;  4GNX B;  4KN7 C;  1TY2 A;  4C1N I;  4YY3 Q;  2J0T D;  3A55 A;  5D65 A;  3TP7 A;  2R3Z A;  2F0W A;  1BUV T;  4DAV A;  4UDU C;  3U4V A;  4DV1 L;  3NXW A;  4J15 A;  5JJL A;  2NVT B;  1B50 A;  3VYU A;  3HKZ B;  3TZD A;  3SDZ A;  2E2J H;  4BY1 H;  4GKJ L;  3AYH B;  3FEW X;  1I50 H;  4BY1 G;  5IOD A;  4C3I G;  2MO1 A;  2VZA A;  4A3B B;  3Q22 A;  1M4V A;  4KY7 A;  4RG1 A;  4JI5 Q;  4OIK A;  1NTG A;  5C0X I;  2K5D A;  1N8R C;  3TS0 A;  3SK4 A;  1XTD A;  4HAE A;  4OX9 L;  1EL0 A;  1JT8 A;  2B2U C;  1YNN C;  3W3A A;  3ULL A;  1VQG A;  4RAU C;  1KDC A;  2RVL A;  4IUT A;  2VQF L;  1WI5 A;  3NTK A;  3CW2 C;  1Q1B A;  1N34 Q;  3CD6 A;  2L11 A;  1STY A;  1I6V C;  2PMZ E;  3FDT A;  4N8F A;  3S15 H;  5ELF A;  4B08 A;  3NPP A;  1VQ5 A;  5IWA Q;  1ENF A;  4IFD G;  4MZ9 A;  4L8J A;  5IE8 A;  2BCO A;  3BVZ A;  1V1O A;  5LMN Q;  2EJM A;  4PV1 C;  3C3L A;  3A74 A;  4OWX B;  1XMQ Q;  1EQQ A;  5DEH A;  5EKI A;  4JI3 L;  2BH8 A;  3NE5 B;  1AP0 A;  2N8N A;  2C5C A;  2YV5 A;  3TZU A;  3RLF A;  3CCU A;  3GTP B;  1B7Y B;  1XNR L;  2AHO B;  2DNC A;  4A3M G;  2VB2 X;  1A2T A;  5J3B A;  1BBW A;  2Z6K A;  1GUO A;  2EYO A;  3PO3 H;  5JVH 3;  2DGY A;  2HHH Q;  4A3G B;  1YHA A;  3EFX D;  5AJ3 L;  3K7A H;  3PO3 G;  4GS3 A;  2BE5 C;  4DKA C;  1VQ6 A;  1RIP A;  2NZO A;  3D4W A;  4CJ0 B;  2GVA A;  1I94 Q;  3KJP A;  3GTJ B;  1D1I A;  4O2D A;  3HKZ E;  4XYO A;  5K36 G;  3JAM i;  1SND A;  4RGO S;  1A15 A;  3CRL C;  3M7N A;  4X62 Q;  4JC0 A;  2KED A;  1VQ7 A;  1XTC D;  3NBH A;  3Q23 A;  1EEF D;  1ZKO A;  2E75 C;  5DLQ E;  5FOB B;  4JI7 Q;  4KV6 A;  4FF1 A;  1MIU A;  1GOZ A;  3CC2 A;  2Q2I A;  4IUU A;  1X65 A;  1LT4 D;  3MTS A;  3GTL H;  1R9T H;  4A3I H;  1PH9 A;  3P7J A;  2DY7 A;  2R93 B;  2F0N A;  4A3B G;  5ELE A;  4JI6 Q;  1QJO A;  1SNP A;  2KUM A;  2RA4 A;  5IYC H;  4LNQ A;  5ELN A;  4HED A;  1YJ9 A;  5FJ8 H;  3H0G H;  4IQZ A;  2IX3 A;  4Q5V A;  1K8G A;  4JOI C;  2E8G A;  1WVL A;  4I7A A;  2Z6B A;  4GLV B;  1NE3 A;  3CRK C;  3S1N H;  1B3Q A;  3O13 A;  1BCP B;  2K03 A;  3I73 A;  1HHV A;  1TT2 A;  1UWV A;  5L37 A;  1H9S A;  4DN4 M;  3S1Q B;  2K5W A;  5IYD G;  2PYK A;  1HNX Q;  1I3Q B;  1K8M A;  4EGV A;  2ES2 A;  1PVO A;  4P74 A;  3JC6 6;  3TEH B;  1Q46 A;  5I6W A;  3HOY H;  1YEZ A;  2PQE A;  1WCM H;  2RF4 A;  2E5L Q;  4RCO A;  4JI2 Q;  4RWS C;  1XNQ Q;  2QEJ C;  5FK9 C;  4LF6 Q;  5FLX E;  3HOU B;  4OL7 A;  3TS2 A;  1YJW A;  5D3I B;  1PFM A;  3T56 B;  2EZV A;  1U0L A;  4B3M Q;  4NXM L;  2ICE C;  5C3E B;  4KTA A;  1GKH A;  2K5N A;  3L9A X;  2Z0S A;  3T1H L;  1CA6 A;  1HFG A;  5C4H A;  5C0X G;  4V0B A;  1RCV D;  1SYG A;  4A3G G;  3STB D;  1DOL A;  2CW0 C;  1HR0 W;  1N32 L;  1ENC A;  2QDL A;  5CV5 A;  3PMF A;  2UXC Q;  1UEA B;  3CCR A;  4HMJ A;  1T5E A;  3IRB A;  2LS0 1;  2F0F A;  1SBB B;  2MQH A;  2A6H C;  1BOS A;  5GRO A;  5LMU L;  1K8A C;  1VQN A;  3ULJ A;  1IBK Q;  1YVC A;  2FIN B;  2HDM A;  4DR2 Q;  3F8T A;  4XXE A;  4TSS A;  4KY5 A;  1HTL D;  5H1S E;  1BF4 A;  4LF7 L;  3RZO H;  3D3R A;  1EFW A;  3UDF A;  2Q2U A;  1KLG D;  2EYJ A;  1VS0 A;  1JJC B;  2NN6 G;  1AW7 A;  3CQZ B;  4BA1 I;  2GA4 B;  3CAM A;  2CFM A;  1PYW D;  1IL8 A;  1M8A A;  2AQ1 B;  2A73 B;  2O5J C;  2R93 G;  4RHS A;  2IL8 A;  1A8V A;  5FLX c;  3K5L A;  2FXQ A;  1VQ8 A;  5IYB H;  5GAE C;  2ZTD A;  1OXU A;  5JJZ A;  3NBH B;  2KCN A;  1MGS A;  4DGZ A;  3S2H H;  3RLO A;  3QJY A;  3M4O H;  1HTP A;  1F9R A;  1ZYR D;  4LF9 Q;  1Z9F A;  3SR1 A;  5GAG C;  2B2U A;  2JA6 H;  4CDF C;  1O7Z A;  1HR0 L;  1VQI A;  2N88 A;  2JA6 G;  4UHV A;  1TWH H;  1UE5 A;  2QF7 A;  5G3L F;  4DV1 Q;  2SDF A;  3BYT B;  3GTQ H;  4RGN A;  2B2Y A;  1OO9 B;  1Q90 A;  2LXJ A;  4DV4 L;  5LL6 S;  1J6Q A;  1I4X A;  2VXW A;  4GKJ Q;  1EY0 A;  4DUY L;  1IKM A;  2EPB A;  3ND9 A;  1PTO H;  4B3T L;  1K83 B;  4LWC A;  3R8B A;  1HNW L;  1H9S B;  3QO2 A;  4QQB X;  2B39 A;  4EVO A;  1X3G A;  1KIX A;  1DZ1 A;  5ISR A;  5C3E G;  4K8J A;  4GLA C;  4NP5 A;  4LF8 L;  4OX9 Q;  4DV7 L;  1CHP D;  4QL5 A;  1OXV A;  3D31 A;  4APV A;  1JB7 A;  4RCN A;  1HZC A;  2ASB A;  2R92 B;  3R2T A;  1E2Z A;  2XNA C;  3K57 A;  2RDF A;  3M85 A;  4X3S A;  2VQF Q;  5JOB A;  1GJX A;  3Q0A A;  3GD7 A;  3KLW A;  5KGU A;  1X54 A;  1HQR D;  3F1Z A;  1FVI A;  3S17 H;  3H94 A;  1IHZ A;  5IGE A;  2KCC A;  3F2D A;  4Y7N H;  4XT1 B;  4OEL B;  1LTG D;  4GKK L;  2PI2 E;  3KDF A;  4HJ7 A;  4XQQ A;  4ZYS A;  1IYJ B;  1T5X D;  3J81 i;  2R7Z H;  1G51 A;  2E76 C;  1RF2 D;  4POF A;  2K05 A;  4KJN A;  1VQB A;  3E5S A;  5TSS A;  1A3V A;  1DYQ A;  2SOB A;  3OOC A;  2UUB L;  1SSO A;  2NVY B;  1MJC A;  1WTX A;  4L6T B;  1XNR Q;  2K6A A;  4A93 H;  1EY7 A;  3T16 A;  1VQP A;  4G4K A;  5AJ3 Q;  1YHB A;  4N9P A;  4K5V A;  3CP0 A;  3W1B A;  3I4M B;  4H02 A;  4QUC A;  1ROD A;  1DD2 A;  1S5B D;  4A3D B;  1IXR A;  1Y1V H;  3BDL A;  2F1M A;  3C1E A;  2D0P A;  3DUZ A;  3OW2 A;  1Y1V G;  2MO0 A;  3DM1 A;  2JA5 H;  4DK0 A;  3N52 A;  1LM0 A;  1STB A;  1QG7 A;  4H0L C;  3FHW A;  4S3S A;  1IBL L;  3BYY B;  4M8A A;  4FNF A;  1Y1W H;  4FF2 A;  1FJG L;  5E4X A;  1WJJ A;  4A3E H;  4FVM A;  3RZD B;  2RBM A;  2Q2T A;  4OWT B;  1SR3 A;  5M5W H;  3S14 B;  1I4H A;  2X69 A;  4K5W A;  3D8G A;  1B3A A;  1DOM A;  2JSO A;  1OXS C;  1I6H H;  1DON A;  5KRU A;  1MSH A;  3PO2 H;  4X65 L;  3J80 i;  4C56 C;  3M3Y H;  1BKB A;  4YWL A;  3NSW A;  2R92 G;  4ME5 A;  1SE8 A;  4P71 A;  1EEI D;  4Z9C B;  5KEE A;  1FD7 D;  3D6C A;  2BA1 A;  4GN3 B;  1V8Q A;  4JI1 L;  2C35 B;  4A3C H;  4OEM B;  2C9O A;  2PNH A;  1QOH A;  4AIM A;  2JA8 H;  3TRZ A;  3DWP A;  4A3C G;  3NQI A;  2OWO A;  1HZ9 A;  1PTO C;  1E2W A;  2JA7 H;  5DNF A;  1FGU A;  2WAC A;  2KEC A;  3LNN A;  1ASZ A;  2NVX H;  3S24 A;  2H4O A;  4CDC C;  2CHB D;  4UP8 A;  3BVM A;  4ULL A;  2OQK A;  4KD3 A;  4K0K L;  4CKB A;  5BR8 L;  3KF6 A;  3L2P A;  5M3F B;  4KKT A;  1FNU A;  1AFP A;  4JI0 L;  3T1H Q;  3ONA B;  5J22 A;  2Q2H A;  1VQ4 A;  1M1K C;  2B8G A;  1STN A;  3G48 A;  3K5M A;  1VQL A;  3BS1 A;  1DM0 B;  2CWP A;  3KDF B;  5C44 B;  1TS5 A;  1Q8I A;  3J7A F;  2PO4 A;  1X3Q A;  3G7L A;  1N32 Q;  3I4M G;  2A69 C;  1PH8 A;  1EU3 A;  2K32 A;  2F3I A;  1G29 1;  4DV5 L;  3R3O A;  1STE A;  2GVB A;  4WJ4 A;  2HUG A;  4A3D G;  1WTW A;  1O7L A;  1F2Y A;  1KXL A;  3KLS X;  4R8N A;  1D5Z C;  3J81 j;  4ZRZ A;  1YBY A;  4DU9 A;  3PIP 3;  1JC7 A;  3DMU A;  4U67 3;  4KHP Q;  3I4N B;  1PH2 A;  5C3W A;  3SVM A;  4HJA A;  2VB3 X;  1E3P A;  3MXG A;  1SAP A;  3U4Z A;  3S16 H;  3D0F A;  2ALY B;  2K1B A;  5KYI A;  2DN8 A;  1STG A;  2EY5 A;  1IBM L;  1PFB A;  5IGG A;  4IFD I;  3IAY A;  2RDG A;  3GTM H;  3ND8 A;  2MGS A;  1I4G A;  3A7A B;  1FL0 A;  1HQM C;  1JCK B;  2F0I A;  1N33 L;  1VQM A;  1UAP A;  2EYM A;  4A3L G;  5T1G A;  1TWC H;  4R4T A;  1UE7 A;  2ZTC A;  3QIA A;  4B9W A;  2PW5 A;  2E2J B;  4CHT B;  4BY1 B;  1KTK A;  3KJO A;  5CMD A;  1I50 B;  4JI4 L;  1BCP D;  3QWN A;  2KCM A;  2AUK A;  2CQO A;  4KHV A;  4NPS A;  1GXD C;  3HOW H;  1OXT A;  1CT1 D;  2HQL A;  3K80 C;  3F2B A;  3U58 A;  4EQP A;  1CKN A;  1VF5 C;  1QB5 D;  4JI8 L;  2RHQ B;  1QVF A;  2LXK A;  4HCS A;  2A74 C;  1UE6 A;  4UAI A;  1P8L A;  3T1Y L;  2OEO A;  3H6M A;  5EKK A;  4F8M A;  2I07 B;  4U68 A;  2P5Z X;  3N6R A;  3V05 A;  1PH4 A;  4B3T Q;  2A6E D;  1HNW Q;  4TKO B;  5JEA G;  1KDA A;  5BN4 A;  4ZAI A;  1VCI A;  5F2D A;  3S15 B;  5M3F G;  1EY4 A;  5HY6 A;  3BU2 A;  4LF8 Q;  3ZJY C;  4DV7 Q;  1UUP A;  2JXM B;  1BO0 A;  3TP6 A;  4R1J A;  2F3V A;  2B2T C;  1TKW B;  5M5X H;  5CV7 A;  2L15 A;  4ZKB B;  2BDN A;  5A35 A;  2XWJ B;  3EN2 A;  1ONL A;  5C44 G;  2IPK D;  2X6L A;  1OTC A;  2JN4 A;  3MEF A;  1IYV A;  4LF5 Q;  2Z4H A;  4OO1 H;  4HID A;  3CPW A;  3GTG H;  1SE3 A;  2F0M A;  2AKW B;  1E7Z A;  1SMY C;  3EJI A;  2M2L A;  3TRE A;  4GKK Q;  1KLU D;  1JOR A;  2NZH A;  3EA6 A;  3PO3 B;  4HIO A;  2RCF A;  1VMP A;  3K0X A;  3K81 C;  3I4N G;  2WAQ B;  3EVQ A;  3K7A B;  4KY6 A;  1HNZ L;  1U4R A;  4RHR A;  1A6X A;  5JPN C;  1II3 A;  4QIW E;  2K4K A;  2CWA A;  1Q1E A;  1HFN A;  4RGT A;  3GTK H;  1GD7 A;  1I4Q A;  3TBI B;  3L0O A;  1PRT C;  1EQT A;  3FKI H;  4R4Q A;  4GOP C;  2X6G A;  4PQX A;  1UNS A;  2AWO A;  1X3P A;  4DAY A;  1WOC A;  2N78 A;  1SFO H;  3KLS A;  2JE6 I;  4MN3 A;  5K5P A;  3PIP A;  1MSG A;  2K28 A;  1WTP A;  4PNY A;  4WJW A;  3HOV H;  1QVC A;  4FF4 A;  1VQH A;  3GTL B;  1R9T B;  4A3I B;  5CGK A;  1KNA A;  4HCE A;  4PMW A;  1CSQ A;  1VQC A;  1RDP D;  4LUV A;  1FJG Q;  3H0G B;  2MP1 A;  1QUQ A;  1K9M C;  3K5O A;  4YWM A;  2EY6 A;  4OON A;  1V1Q A;  2B2W A;  3S1N B;  1E1T A;  4J6H A;  1TWA H;  1AZQ A;  4QY7 A;  4J1M A;  1KAB A;  3OTO L;  2VNU D;  4R8I A;  4JV5 Q;  5HUR A;  4YCW A;  1PH6 A;  5C4X H;  4I65 A;  1A0I A;  1BDO A;  4X65 Q;  3HOY B;  1U5K A;  4J8Q A;  1WCM B;  4DR7 L;  4CJ2 C;  2OCE A;  1EIH A;  3BZK A;  1CKN B;  3CC7 A;  1E24 A;  2OF1 A;  3NWT A;  2NN6 I;  1JJ2 A;  3VA5 A;  1PZI D;  1SEB D;  1XXG A;  5EPL A;  3GDE A;  5G3L D;  1TR5 A;  4O0A A;  1E1O A;  1IYU A;  3X3M A;  1QZG A;  1XWE A;  3CCL A;  1D2B A;  1B70 B;  3CPF A;  1PZK D;  1YNJ D;  3S9W A;  4QCL A;  3PF4 A;  2I5M X;  2N55 A;  2K5Q A;  5EPJ A;  3PF5 A;  1Y8N B;  1P16 A;  2KHS A;  3IL8 A;  4RH6 A;  3T4A C;  1BR9 A;  1CZG A;  4DPG A;  3L3O C;  3DEP A;  4OXP A;  1I5F A;  2WAQ G;  4K0K Q;  4A76 A;  5BR8 Q;  1NCV A;  3NP8 A;  1B53 A;  5AFW A;  3J81 L;  3S2D H;  1JWM D;  3STB C;  4JI0 Q;  1GO3 E;  2F0D A;  2F0S A;  1G6P A;  2A68 D;  2PCF B;  3Q8D A;  4NW2 A;  5ELC A;  4OIJ A;  1XYI A;  4OWW B;  1J9O A;  2F0K A;  2J7Z A;  3MFG A;  3VYT A;  3HOX H;  3A54 A;  1VQF A;  2B3G A;  3A8J E;  1FR3 A;  4FDB A;  4NXN L;  1GUS A;  1G91 A;  1Q7Y C;  1X55 A;  1NNX A;  1Z6H A;  3KBX A;  4DV3 Q;  5IT9 L;  3RZO B;  1AEX A;  4DV5 Q;  1U4M A;  4ABN A;  5EQ0 A;  4LW1 A;  1L0X B;  2KHJ A;  1TWG H;  4FO2 A;  1GVP A;  4A3I G;  1PTO F;  5IYC G;  2NVQ H;  2L55 A;  4BBR H;  1MKH A;  5FJ8 G;  3H0G G;  2KBN A;  1RKN A;  2RSO A;  3S2H B;  1JOO A;  4KKS A;  2XWB B;  3K58 A;  2PQA A;  4AQY L;  3M4O B;  5CR3 A;  2ZXO A;  1IBM Q;  4DAY B;  4X64 L;  1PV4 A;  3H91 A;  2JA6 B;  1EZ6 A;  4IJL A;  2D2C C;  2Z1C A;  3CHB D;  4IPG A;  4DA2 A;  1TWH B;  3HRZ C;  1SXT A;  4XQN A;  3HEJ A;  4XTC S;  2F4V L;  3GTQ B;  1G6Z A;  1VQJ A;  1MBY A;  3I70 A;  2MJ8 A;  2L12 A;  3HOY G;  2HCI A;  4ID6 A;  1NR4 A;  1QUQ B;  1WCM G;  2FJ2 A;  3CF5 A;  2SNM A;  3J80 L;  4DAM A;  1CA5 A;  3OW7 A;  4X66 L;  1PTO B;  2K5H A;  2NUC A;  1ASY A;  1K3B C;  4GLX A;  2ZJP A;  4V19 0;  2MHV A;  3UE0 A;  1C7Y A;  4JI8 Q;  5E7N A;  3HOZ H;  1Q86 C;  3FMC A;  1QVG A;  1H95 A;  1NR2 A;  5JJI A;  1V9P A;  3A5Z B;  3SHL A;  4DUZ Q;  3KF8 A;  3TSS A;  3S17 B;  3SK8 A;  4DK3 C;  4Y7N B;  3GTO H;  4BXX H;  4HIM A;  3RR5 A;  2BE5 D;  3OWF A;  2FMC A;  2DY8 A;  1S5E D;  1WTV A;  2QGQ A;  3NEN A;  3KBG A;  2R7Z B;  2ZJQ A;  1LT5 D;  1JOK A;  4G7H C;  4JG2 A;  5FO8 B;  3AQQ A;  4HJ8 A;  4LJZ C;  4GOP A;  1ICW A;  1RHP A;  4HJ9 A;  2B8F A;  4P72 A;  4A3J H;  2K75 A;  5E4W C;  3EBE A;  1F9Q A;  4YCU A;  3PQI A;  1Q8K A;  3MEH A;  2XGT A;  2XVS A;  2AQ2 B;  1NBW A;  3I72 A;  1HNZ Q;  5C5M A;  1PZJ D;  1RL2 A;  4LUZ A;  1MJE A;  1WFQ A;  1LTS D;  2B29 A;  4YCV A;  5IYB G;  1H9R A;  4QGU A;  5IP7 H;  1Y1V B;  1L1O C;  2I5L X;  2UUA L;  4JYA L;  1B2T A;  2JA5 B;  5IGD A;  4CGY B;  4DR6 L;  4O1N A;  2UXD L;  4GNX C;  1LTI D;  2E2H H;  1Y1W B;  1AE2 A;  3URY A;  2PZU A;  2FMM A;  2Y0S B;  4PZ7 A;  4A3E B;  2ZM6 L;  2IHF A;  2M00 A;  3CCE A;  5JVG 3;  4KHZ A;  4M1U B;  1PA6 A;  5M5W B;  2IHE A;  2PQA B;  1SE4 A;  1IW7 C;  1S5D D;  2N49 A;  2MFI A;  4OGQ C;  1I6H B;  1DXM A;  1KAA A;  1HPC A;  1S3O A;  4C3J H;  4I7Z C;  1PLF A;  1EY6 A;  1EWC A;  3PO2 B;  5COY A;  3S1R H;  4K6L A;  4DV0 L;  4LF4 L;  1U9R A;  2LFN A;  4L5S A;  1S5C D;  3M3Y B;  1NAP A;  1TWF H;  4RKB A;  1H9J A;  2EYH A;  3E9H A;  3OTO Q;  4FYD A;  2D9U A;  2V1C C;  3DEO A;  3BDC A;  2JA8 B;  1Y8O B;  2QW7 A;  2DNE A;  2XSC A;  4UP9 A;  1JQY D;  2M9V A;  1PRT F;  3G6J B;  4DNI A;  4DR7 Q;  2Q8T A;  2JA7 B;  4LMQ D;  1PH3 A;  3X3N A;  2YTV A;  2NVX B;  1GHJ A;  2F0E A;  4MTK A;  3RD4 A;  1GUG A;  1KRT A;  3OMG A;  4JI3 Q;  2R7Z G;  1TU2 B;  1M90 C;  5EAY A;  1LYL A;  2TMP A;  5J1Z A;  4P75 A;  1SNM A;  2A6H D;  2HQE A;  1AH9 A;  3U9O A;  4IPD A;  4H44 C;  3QG1 A;  2QIL A;  3HGB A;  3KF8 B;  2O2L D;  2F0V A;  1VQA A;  1Y69 U;  4A93 G;  1C9O A;  4R4O A;  2VUM H;  3LX0 A;  3C46 A;  1HUM A;  4IOC A;  1X32 A;  3MAQ A;  2B63 H;  4JOI A;  3SE0 A;  1PRT B;  4FXK C;  3UDG A;  4B3R L;  3SK5 A;  2AQ3 B;  4GOP B;  3I56 A;  3PUZ A;  1YHQ A;  3LWE A;  1MI2 A;  4DF7 A;  2EYL A;  4JW0 A;  4RMF A;  1JR0 D;  1F2M A;  2IWH A;  2L5T A;  2E2I H;  2JA5 G;  2O5I C;  4C3H H;  1K8O A;  3J81 E;  2QA4 A;  2CH4 W;  1Y1W G;  2Y0S G;  2F0Q A;  1SYB A;  4A3E G;  1N9W A;  3I2Z A;  3S16 B;  2E74 C;  2HDL A;  4JVZ A;  3W5O A;  3BZD B;  1SYC A;  4KD4 A;  4ALP A;  1STA A;  2N3S A;  2NYZ D;  5I9O A;  4JI5 L;  2F0T A;  1NMF A;  3U50 C;  3GTM B;  4AYB B;  2R7D A;  5KND A;  3HS0 C;  1TWC B;  4ZQ3 A;  5IT9 E;  3PO2 G;  4UP7 A;  4FF3 A;  1QWY A;  1O80 A;  2XTI A;  3I4O A;  4AQY Q;  4A3F H;  5HGQ A;  5LHY 1;  4X64 Q;  1SRU A;  3PUX A;  4R4I A;  1RTO A;  2NZ1 D;  1CTM A;  3E0J A;  5C4J H;  1KRS A;  2F52 A;  1XMO L;  5GAD C;  4OO1 I;  3U9S A;  2K04 A;  1BCP C;  4Y52 H;  3GO5 A;  2F4V Q;  3HOW B;  1BVS A;  2JA8 G;  4POG A;  3I8Z A;  3K59 A;  4K6D A;  2JA7 G;  2CKZ B;  2LY7 A;  3PUV A;  3RNU A;  1XPO A;  4K2K A; 
#chains in the Genus database with same CATH homology
 1MIU A;  4X6A H;  4X66 Q;  1Z47 A;  1YI2 A;  3CC2 A;  1SMX A;  4DV6 L;  2Q2I A;  1X65 A;  2NZH A;  3CCJ A;  3ER0 A;  4NXM Q;  1EOV A;  2OQ0 A;  4HIO A;  1R9T H;  3K0X A;  3K81 C;  4A3I H;  3GTL H;  1PH9 A;  2JQO A;  3J81 c;  1VQE A;  3I4N G;  4A3B G;  4JI6 Q;  1T9H A;  1HNZ L;  4DR3 L;  4LFC L;  2VL6 A;  1TXY A;  4YHH Q;  5IYC H;  3HOU H;  4LNQ A;  5ELN A;  1JJG A;  1YJ9 A;  5FJ8 H;  2R7F A;  3H0G H;  3H15 A;  3HOU G;  4QIW E;  1K8G A;  4JOI C;  2K4K A;  2E8G A;  2CWA A;  5C3E H;  1PH5 A;  2HHH L;  4GLV B;  1NE3 A;  3TQY A;  3S1N H;  4K0K L;  1Q1E A;  2BA0 A;  1SLJ A;  2KCT A;  3GTK H;  1GD7 A;  3I55 A;  1Q12 A;  1KQS A;  4LFB L;  3L0O A;  3L7Z C;  2MNA A;  1UWV A;  3FKI H;  4R4Q A;  4LUO A;  3SGI A;  4GOP C;  2R6G A;  5IYD G;  5IT9 c;  1HNX Q;  2YYZ A;  2AWO A;  3KFU A;  1HJP A;  1WOC A;  5LMU Q;  2ES2 A;  2N78 A;  1O7I A;  1SFO H;  2JE6 I;  1Q81 C;  3PIP A;  1PVO A;  2K5V A;  4P74 A;  3JC6 6;  3TEH B;  1Q46 A;  5C0X J;  1EYG A;  3HOY H;  1YEZ A;  3HOV H;  1QVC A;  1WCM H;  2QEX A;  2RF4 A;  4LF5 L;  1VQH A;  3K7U C;  1L1O A;  2E5L Q;  3ICE A;  4JI2 Q;  1XNQ Q;  4LF6 Q;  4JI7 L;  4LF7 Q;  4PMW A;  3H3V I;  3UDI A;  1CSQ A;  1KHI A;  4GNX A;  1VQC A;  4AYB E;  4GN5 A;  4LUV A;  2UU9 L;  1YJW A;  1FJG Q;  3TS2 A;  2Z6K C;  5GQO A;  1QUQ A;  1U0L A;  3RN2 A;  1HH2 P;  1K9M C;  4YWM A;  2VQE L;  4B3M Q;  4NXM L;  4UPA A;  4OON A;  4IPC A;  1V1Q A;  5M3M H;  1GKH A;  2K5N A;  2Z0S A;  3T1H L;  3H3V H;  1E1T A;  1TWA H;  1Y14 B;  2VUM G;  5C0X G;  4QY7 A;  3M4P A;  1A63 A;  2EXD A;  1L0W A;  4AYB G;  4JBM A;  3KYH C;  3OTO L;  3CQZ H;  2VNU D;  4JV5 Q;  1JMC A;  4YCW A;  1PH6 A;  2B63 G;  5C4X H;  2A8V A;  5M5Y H;  1A0I A;  2Y0S E;  4KLK A;  4DR5 Q;  4A3G G;  2K50 A;  3UDX A;  3STB D;  1V43 A;  4YY3 L;  4X65 Q;  3RN5 A;  1CSP A;  2ZTE A;  1D8L A;  3EIV A;  1HR0 W;  1N32 L;  1Q82 C;  1U5K A;  5LMN W;  1HR0 Q;  1KAW A;  4DR7 L;  4NXN Q;  2UXC Q;  2I5H A;  2GN5 A;  3J80 c;  3CCR A;  2UUA Q;  2OCE A;  3IRB A;  3BZK A;  1CKN B;  3CC7 A;  1E24 A;  2MQH A;  3CMA A;  5GRO A;  5LMU L;  1K8A C;  1VQO A;  2NN6 I;  1JJ2 A;  1VQN A;  3ULJ A;  3CCM A;  1IBK Q;  1YVC A;  4A4I A;  3HOW G;  2JEB I;  4DV4 Q;  3GDE A;  4O0A A;  1E1O A;  4DR2 Q;  1QZG A;  4JI2 L;  3CCL A;  3F8T A;  1E22 A;  3ERS X;  1S40 A;  4DUY Q;  1B70 B;  3CPF A;  5H1S E;  4LF7 L;  3PF4 A;  1HZA A;  3RZO H;  2I5M X;  1EFW A;  3UDF A;  2Q2U A;  3PF5 A;  1EIY B;  1VS0 A;  1JJC B;  2NN6 G;  4JBK A;  1XPU A;  4BA1 I;  3CAM A;  1P16 A;  2JK8 A;  2CFM A;  3ULP A;  4ME3 A;  4BY7 H;  5FLM H;  1LTL A;  3DM3 A;  4LFA Q;  4DPG A;  2R93 G;  4OXP A;  1I5F A;  2WAQ G;  2YU9 H;  4K0K Q;  4A76 A;  4LF4 Q;  5BR8 Q;  1A8V A;  3NEL A;  5FLX c;  4L5T A;  2OTJ A;  4A3F G;  3S2D H;  1UEB A;  2FXQ A;  3STB C;  1VQ8 A;  1GO3 E;  1K83 H;  1N34 L;  4JI0 Q;  5IYB H;  5GAE C;  2ZTD A;  4JV5 L;  1OXU A;  3I7F A;  3NBH B;  1CKO A;  3S2H H;  3RLO A;  1G6P A;  1UE1 A;  4DR1 L;  3M4O H;  1SN8 A;  3Q8D A;  4OWW B;  1EIF A;  4DR4 Q;  4LF9 Q;  5IWA L;  3HOX H;  1Z9F A;  4BBS H;  5GAG C;  2RHS B;  2JA6 H;  1VQF A;  2B3G A;  2IT1 A;  4FDB A;  1YJN A;  1HR0 L;  2R92 H;  4NXN L;  5LMN L;  5IY0 A;  1Q7Y C;  1A62 A;  1VQI A;  1X55 A;  2JA6 G;  1TWH H;  1UE5 A;  3KF6 B;  1XMQ L;  4DV3 Q;  4OO1 G;  4DV1 Q;  1YIJ A;  3B6Y A;  4R4C A;  2UUC Q;  3GTQ H;  1EWI A;  4DV5 Q;  2LXJ A;  2IX1 A;  3M9B A;  1K0R A;  4LW1 A;  4IOA A;  2KHJ A;  4DV4 L;  4GKK Q;  1TWG H;  1YZ6 A;  1KD1 C;  1J6Q A;  2A1A A;  4GKJ Q;  1GVP A;  4A3I G;  4DUY L;  3K8A A;  3AEV A;  2UUB Q;  2DUD A;  4PG3 A;  4B3T L;  1JE5 A;  5IYC G;  2NVQ H;  1SRO A;  4JBJ A;  4BBR H;  1MKH A;  4LWC A;  4L5R C;  1HNW L;  5FJ8 G;  3H0G G;  4QQB X;  2KBN A;  2ATW A;  5GAH C;  1X3G A;  1KIX A;  3S1M H;  1EUJ A;  4A3K H;  3BZC A;  5C3E G;  2PQA A;  1DGS A;  3PGZ A;  4AQY L;  4GLA C;  3RLN A;  4LF8 L;  1IBM Q;  4OX9 Q;  4DAY B;  1HZB A;  4QL5 A;  1OXV A;  3D31 A;  4APV A;  4X64 L;  4DV7 L;  1PV4 A;  1JB7 A;  1HZC A;  2NVY H;  2WB1 E;  3CCV A;  2ASB A;  1J5E Q;  3FKI G;  1I94 L;  4IJL A;  4IPG A;  1BBU A;  2UXC L;  3M85 A;  1IL2 A;  3F2C A;  2VQF Q;  4PZ6 A;  4JBW A;  1PYB A;  4XTC S;  3GD7 A;  3KLW A;  1PHJ A;  2F4V L;  4YWK A;  2BH2 A;  1LUZ A;  1VQJ A;  3A5U A;  4B3S L;  1X54 A;  3E9I A;  4X62 L;  3HOY G;  2WB1 G;  2HIX A;  2K52 A;  3HOV G;  1QUQ B;  1WCM G;  3I4M H;  3F1Z A;  1FVI A;  3S17 H;  3CF5 A;  4C2M H;  2EIF A;  3F2D A;  4DV3 L;  4Y7N H;  4DAM A;  2IX0 A;  3AFQ A;  3W1G A;  2JEA I;  4GKK L;  4P73 A;  1IBL Q;  4X66 L;  4A3D H;  1B8A A;  2K5H A;  2PI2 E;  3KDF A;  4HJ7 A;  1PH7 A;  2HT1 A;  1IYJ B;  3J81 i;  1ASY A;  2R7Z H;  5ELO A;  1G51 A;  3WWV A;  4POF A;  1VQB A;  4C3I H;  4GLX A;  4JI6 L;  5M3M G;  1W3S A;  2ZJP A;  4YHH L;  3UE0 A;  1C7Y A;  4JI8 Q;  1D7Q A;  3AFP A;  2UUB L;  1CKM A;  1MJC A;  5E7N A;  4DV2 Q;  3HOZ H;  1XNR Q;  3RZD H;  1Q86 C;  3CME A;  4IJH A;  3M4Q A;  1QVG A;  3VDY A;  4IPH A;  4EQ5 A;  4A93 H;  5C4X G;  1VQK A;  2UXB Q;  1H95 A;  3S14 H;  5JJI A;  1V9P A;  1N36 Q;  1VQP A;  5AJ3 Q;  1YHB A;  1PFS A;  3A5Z B;  1YNX A;  4DUZ Q;  5JJK A;  2I0Q A;  4JYA Q;  3CP0 A;  3W1B A;  4H02 A;  1HNX L;  3KOJ A;  3DLL A;  4DR6 Q;  2UXD Q;  4A3L H;  4DK3 C;  3GTO H;  4BXX H;  4QJF A;  3G4S A;  1XMO Q;  4HIM A;  3RR5 A;  1IXR A;  4JI1 Q;  1Y1V H;  2D0P A;  2ZM6 Q;  2QGQ A;  3OW2 A;  3NEN A;  1Y1V G;  2MO0 A;  2E5L L;  2ZJQ A;  2JA5 H;  1XNQ L;  1X3F A;  2WAQ E;  4JG2 A;  4LF6 L;  3AQQ A;  1LM0 A;  2ID0 A;  2AMC B;  3LGJ A;  4JCV E;  4HJ8 A;  4GOP A;  3PIO A;  3FHW A;  1IBL L;  4HJ9 A;  1FJG L;  2HIV A;  5JEA J;  1Y1W H;  4P72 A;  1WJJ A;  4A3E H;  4BA2 I;  4A3J H;  2K75 A;  2IY5 B;  4B3M L;  1X3E A;  3EBE A;  1IZ6 A;  1X6O A;  1CUK A;  2Q2T A;  4OWT B;  4DV6 Q;  4BY7 G;  5FLM G;  1SR3 A;  4YCU A;  1K73 C;  4EX5 A;  2VS1 A;  5M5W H;  1VQD A;  1Q8K A;  4DV0 Q;  2XGT A;  1NJI C;  1NBW A;  4A3M H;  1GM5 A;  1HNZ Q;  4DR3 Q;  4LFC Q;  4XIG S;  3OYY A;  1OXS C;  1RL2 A;  4LUZ A;  1MJE A;  1WFQ A;  1I6H H;  1NMG A;  2B29 A;  4YCV A;  5IYB G;  3G71 A;  3UE1 A;  4DR5 L;  3PO2 H;  4X65 L;  4QGU A;  5IP7 H;  3J80 i;  5M3F H;  2D0O A;  3M3Y H;  1BKB A;  1PYS B;  1L1O C;  4YWL A;  3HOX G;  4BBS G;  2I5L X;  2PI2 A;  4DUZ L;  3CCQ A;  2UUA L;  4JYA L;  3J7Z C;  2R92 G;  4LFB Q;  1SE8 A;  3PSI A;  4P71 A;  1EQR A;  4DR6 L;  2UXD L;  3BJU A;  1L2F A;  3PUY A;  4GNX C;  2BA1 A;  4GN3 B;  1IBK L;  2E2H H;  1NY4 A;  4JI1 L;  1AE2 A;  3FP9 A;  1XJV A;  2C35 B;  4A3C H;  4PZ7 A;  2PNH A;  4AIM A;  2IHF A;  5C44 H;  2ZM6 L;  2JA8 H;  3MXN B;  3TRZ A;  4A3C G;  3CCE A;  4DR2 L;  3HFZ B;  4KHZ A;  2OWO A;  1HZ9 A;  1PA6 A;  2IHE A;  2JA7 H;  2VY3 A;  2PQA B;  1FGU A;  2NVT H;  1ASZ A;  2N49 A;  2NVX H;  3S24 A;  2MFI A;  1KL9 A;  1C0A A;  4UP8 A;  4BBR G;  3HKZ G;  4C3J H;  1S3O A;  1WYD A;  2UU9 Q;  4LFA L;  2OTL A;  2KEN A;  2OQK A;  3S1R H;  4A3K G;  2ZJR A;  3HKS A;  1KC8 C;  3I4N H;  2RCN A;  5BR8 L;  2VQE Q;  4DV0 L;  3KF6 A;  4LF4 L;  3L2P A;  2K14 A;  1QZH A;  4L5S A;  4A3B H;  4MTN A;  1VQ9 A;  4B3R L;  4JI0 L;  3T1H Q;  2JA9 A;  2Q2H A;  1VQ4 A;  1M1K C;  1L1O B;  1TWF H;  4MNO A;  1N33 Q;  4IO9 A;  1S72 A;  3E9H A;  3OTO Q;  4KI0 A;  3A0J A;  4B3R Q;  4DR4 L;  4LF9 L;  2JJQ A;  3G48 A;  4GNX B;  1VQL A;  2V1C C;  2CWP A;  3KDF B;  3J7A 5;  4YY3 Q;  3PUW A;  4UP9 A;  1N32 Q;  3I4M G;  4JI4 Q;  5IYD H;  4TVA B;  3U4V A;  1PH8 A;  4DNI A;  4DV1 L;  4DR7 Q;  4J15 A;  2F3I A;  1G29 1;  2UUC L;  2YTY A;  5JJL A;  4DV5 L;  1PH3 A;  2GVB A;  2YTV A;  4WJ3 M;  4A3D G;  4WJ4 A;  1KXL A;  1X56 A;  1K3R A;  1KRT A;  2E2J H;  4BY1 H;  3J81 j;  3PV0 A;  1YBY A;  3AYH B;  4PZ8 A;  4JI3 Q;  2R7Z G;  4GKJ L;  3CXC A;  4KHP Q;  1M90 C;  1I50 H;  5EAY A;  4BY1 G;  1LYL A;  4A75 A;  4GN4 B;  2MO1 A;  2VZA A;  4P75 A;  1AH9 A;  4RG1 A;  1PH2 A;  4IPD A;  3T1Y Q;  4JI5 Q;  5C0X I;  1NTG A;  4HJA A;  1E3P A;  3KF8 B;  4TQU S;  3HOZ G;  3U4Z A;  1N8R C;  3S16 H;  4IFD J;  1VQA A;  4NB3 A;  3TS0 A;  3D0F A;  1XTD A;  2ALY B;  1IBM L;  4OX9 L;  1JT8 A;  4A93 G;  1C9O A;  3ULL A;  1VQG A;  2KHI A;  4R4O A;  1J5E L;  2VUM H;  3GTP H;  4IFD I;  1YIT A;  3E0E A;  3GTM H;  1FL0 A;  4IOC A;  1N33 L;  2VQF L;  1WI5 A;  3CW2 C;  1Q1B A;  1VQM A;  1N34 Q;  2B63 H;  3CD6 A;  4HJ5 A;  4JOI A;  2CCZ A;  1TWC H;  2A19 A;  4R4T A;  3UDG A;  1W2B A;  4A3L G;  2PMZ E;  1UE7 A;  4BXX G;  4A3G H;  4GOP B;  3I56 A;  3PUZ A;  1YHQ A;  2ZTC A;  4DR1 Q;  3S15 H;  4AH6 A;  1VQ5 A;  4RMF A;  1PH1 A;  5IWA Q;  3KJO A;  4IFD G;  4MZ9 A;  5IE8 A;  3JAM c;  3CCS A;  2E2I H;  2JA5 G;  4JI4 L;  4C3H H;  5LMN Q;  3GTJ H;  2QA4 A;  1XPR A;  3A74 A;  2KCM A;  2CQO A;  4OWX B;  1XMQ Q;  1EQQ A;  1Y1W G;  4NPS A;  2Y0S G;  5IP9 H;  4A3E G;  1OXT A;  1N9W A;  3HOW H;  3I2Z A;  4A3J G;  2HQL A;  3K80 C;  3F2B A;  4KHP L;  3U58 A;  2H5X A;  2AWN A;  4JI3 L;  5IP9 G;  3W5O A;  2BH8 A;  1CKN A;  2N8N A;  2RHQ B;  4JI8 L;  4ALP A;  4DK6 C;  1QVF A;  2LXK A;  2YV5 A;  2N3S A;  3RLF A;  1UE6 A;  2WFW A;  1P8L A;  3CCU A;  4JI5 L;  4DV2 L;  3T1Y L;  1B7Y B;  1XNR L;  1NMF A;  2AHO B;  3U50 C;  4A3M G;  2R7D A;  5J3B A;  1PH4 A;  4B3T Q;  4UY8 C;  1BBW A;  2Z6K A;  4HIK A;  2UXB L;  3PO3 H;  2VW9 A;  1HNW Q;  5JEA G;  2DGY A;  2HHH Q;  3PO2 G;  4UP7 A;  1N36 L;  1YHA A;  5AJ3 L;  5IP7 G;  2R93 H;  1VCI A;  3K7A H;  3PO3 G;  4GS3 A;  2XTI A;  3I4O A;  3NEM A;  5M3F G;  4AQY Q;  5HY6 A;  3BU2 A;  4DKA C;  5HGQ A;  3ZJY C;  4DV7 Q;  4X64 Q;  4A3F H;  4LF8 Q;  1RIP A;  1VQ6 A;  2EQS A;  1SRU A;  3PUX A;  1AE3 A;  1OXX K;  4R4I A;  5C4J H;  2NZO A;  1KRS A;  2F52 A;  1XMO L;  2GVA A;  5GAD C;  2WP8 J;  4R1J A;  3KJP A;  1I94 Q;  4OO1 I;  5M5X H;  4O2D A;  2L15 A;  3G6E A;  3HKZ E;  5K36 G;  4Y52 H;  3GO5 A;  2LSS A;  2F4V Q;  3EN2 A;  3JAM i;  4L5Q A;  1BVS A;  5C44 G;  1OTC A;  3CC4 A;  3MEF A;  4B3S Q;  4POG A;  2JA8 G;  3M7N A;  3PCO B;  4X62 Q;  4JC0 A;  1X9N A;  4LF5 Q;  1VQ7 A;  3S1Q H;  2YTX A;  2D62 A;  4HID A;  5DLQ E;  3CPW A;  2JA7 G;  3GTG H;  1I3Q H;  2AKW B;  1E7Z A;  2CKZ B;  3PUV A;  3RNU A;  4JI7 Q;  3TRE A;  1XPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...