2OQKA

Crystal structure of putative cryptosporidium parvum translation initiation factor eif-1a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
94
structure length
94
Chain Sequence
DKRELVFKEEGQEYGQVQRMLGNGRLDAYCFDGQKRLCHIRGKMRKKVWVNPGDIVLVSLRDFQDSKGDIILKYTPDEARALKSKGEIPETTKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative translation initiation factor eIF-1A
publication title Crystal structure of putative Cryptosporidium parvum translation initiation factor eIF-1A
rcsb
source organism Cryptosporidium parvum iowa ii
molecule tags Translation
total genus 23
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2oqkA00
1N32L 1G6PA 2BH2A 2VW9A 1HZCA 1Y1VG 4YCUA 4A76A 3PIPA 4B3TQ 1HNZL 1FL0A 4A3BH 5DLQE 1OXTA 5IY0A 5IP7H 2N49A 3T1YL 2YU9H 4B3MQ 4BXXH 1V43A 1Y1WH 4LFAL 3ER0A 4APVA 5LMUL 3MXNB 4Y7NH 4IFDI 3E0EA 3HOXG 5M3FH 4JYAQ 2Q2UA 3H3VI 5GADC 3W5OA 4DR2Q 4DR5L 4JI0L 3CC7A 1PH6A 2BA0A 1EUJA 1P16A 4DV7L 4WJ4A 4HJ8A 5IP7G 2ID0A 4JC0A 1HZBA 2MFIA 1VQKA 4ALPA 4BXXG 1Y1WG 3S24A 3U50C 4JI7Q 3CXCA 1WYDA 2UUCL 4JBMA 5M3FG 1L1OB 4X62L 4JI1Q 2ATWA 4GKKL 5JJLA 2WAQE 4A3EG 1EOVA 4C2MH 5GAHC 3PO3H 1K3RA 4HJ9A 2PI2E 1SR3A 3CPFA 5C0XI 1YJNA 4HIMA 1IZ6A 4AIMA 3CCEA 1N32Q 2EQSA 4LWCA 1HNWL 1EQQA 1KRTA 4EQ5A 5IYBH 1B8AA 1X3GA 5JJIA 3T1YQ 5M3MH 2A8VA 1M1KC 3RZOH 2R7FA 3NEMA 2WB1E 3JAMc 1VCIA 2PNHA 4QGUA 4GLAC 1PYBA 3WWVA 1S40A 4JI2Q 1N36Q 3PO3G 3KOJA 5J3BA 5LMNL 1EQRA 5E7NA 4A3JG 2VQEL 3I7FA 3SGIA 1YITA 1GO3E 3RNUA 1YHAA 4JV5Q 4LF4L 4DV2L 4LNQA 2N78A 3BZKA 2KHIA 4IPCA 5M5WH 3G4SA 4DV7Q 4P71A 2UXBL 3M85A 1I6HH 4J15A 3M4OH 4DR7Q 1Z47A 1KD1C 3CCRA 3K7UC 4YCWA 1VQAA 3PCOB 1YEZA 2GVAA 1MIUA 2JA9A 4X62Q 2OTLA 1VS0A 1G291 4JCVE 2IHEA 4DV3Q 2E2JH 3S1NH 4GOPC 4R4IA 2NVXH 3GTQH 2QA4A 4JOIC 4AH6A 2EXDA 2CKZB 3G48A 1TWCH 5GROA 4A3IH 4LFBQ 2F52A 4OWTB 5C4JH 4LFCQ 3M7NA 1A0IA 3A5ZB 4B3SL 1QVFA 3CCQA 3S1RH 1I3QH 3CCLA 4KHPL 2MNAA 2OCEA 4DPGA 1XJVA 2HHHQ 4WJ3M 1PA6A 1VQIA 5C3EH 4YY3L 1DGSA 2E2IH 4DR4Q 2QEXA 3BJUA 4P74A 2H5XA 4DV0L 2F4VL 5M5XH 3PUZA 4X64Q 1AE3A 2Z6KA 1E24A 4JBKA 4GLXA 4DV4Q 4A3DH 4UP7A 2UXBQ 3MEFA 2R93G 1X3EA 1IBML 1GKHA 4IOAA 1E7ZA 4C3JH 1KRSA 5FLXc 1LUZA 2DUDA 1HZ9A 1K9MC 5C3EG 4OO1I 3W1GA 2AMCB 5K36G 1SN8A 3HOWH 4YHHQ 4JI6Q 1XNQQ 3E9IA 5JJKA 3T1HQ 4A3DG 1YJ9A 2IX0A 1UE7A 1C7YA 4DKAC 4KI0A 1XMOL 1W2BA 4DUYQ 1JJ2A 1OXVA 2CWAA 2HQLA 1W3SA 3UDIA 4B3SQ 3PO2G 1AE2A 2VY3A 4NPSA 1Q46A 3KJOA 1P8LA 5EAYA 3A0JA 3PUWA 4A4IA 4YY3Q 2R7DA 3RLNA 1Q1BA 2ZJPA 4NXNQ 3CCUA 1XPUA 3RZDH 4JI5Q 1X65A 3GTMH 4JI8L 4AYBG 2UXCL 1V1QA 2AWNA 2NN6G 3D31A 3KF6B 2RHSB 3I4MH 2UUAL 1VQMA 3FKIH 3GDEA 4IPHA 1X6OA 1CSQA 3OTOQ 4QIWE 2B29A 2MO1A 3FHWA 2UU9L 1TWFH 4JI3Q 4OX9Q 4BBSG 4B3RL 1WOCA 3HOXH 1X56A 2RCNA 4TQUS 1B7YB 2AWOA 3KYHC 4GLVB 3CPWA 4DV6Q 1K73C 1KHIA 1IBKL 1OTCA 4X6AH 1G51A 3J80c 2BA1A 3U58A 2MQHA 2IT1A 4UPAA 4DK3C 1KIXA 4LF9Q 3I4MG 2ZTEA 2HIVA 1HNXL 3FKIG 1XMQQ 1NJIC 4DR1L 2IY5B 2E5LL 3J81c 1RL2A 3KFUA 1EIFA 3PSIA 3AYHB 1FVIA 2NN6I 1N33Q 3AEVA 3RR5A 1HH2P 3IRBA 2AKWB 1B70B 4NB3A 4NXMQ 2V1CC 3K80C 3CAMA 2I5HA 2LXKA 4AQYL 2VQFL 1Q8KA 4A3EH 1ASYA 3GTPH 3ICEA 1I94L 4GOPB 4DK6C 1CKOA 1YI2A 1AH9A 3PGZA 1EFWA 1WCMH 3TS0A 4TVAB 4DR3Q 1VQOA 3UDFA 1PVOA 1A8VA 1J5EQ 1JE5A 5AJ3Q 1Q7YC 1NTGA 3KF8B 1N8RC 3ULLA 3H0GG 1PH9A 2ZM6L 4DV5L 2K14A 3RLOA 4B3RQ 2N8NA 2VL6A 1YZ6A 1EIYB 2JA8H 1ASZA 4PZ6A 1O7IA 4PG3A 1UE6A 1VQPA 1Q86C 2UUBQ 1WCMG 5GAGC 1VQDA 4A3JH 1IBKQ 2KCTA 1NBWA 5GAEC 1C0AA 1X3FA 1HNZQ 2E2HH 3TS2A 3ZJYC 4X66L 4DR1Q 2E5LQ 2JK8A 1PH8A 3HKZE 3S16H 4LFAQ 5LMUQ 5FJ8H 4O2DA 2JA8G 3GD7A 1XPOA 4UP8A 5GQOA 2ZTDA 1QUQB 3NENA 2CQOA 3TRZA 1WJJA 3RLFA 2UXDL 3KJPA 2K52A 1FGUA 1IBLL 4DR5Q 4JI0Q 3HOVG 1I94Q 4A93H 2JE6I 1KL9A 3S2HH 3F8TA 1RIPA 4POFA 4OONA 4OWWB 3CCJA 4H02A 3JC66 1YVCA 4DV1L 4R1JA 4YWKA 5FJ8G 1XNRL 4MTNA 4R4OA 2UUCQ 2IHFA 2B63G 3PUVA 1R9TH 4KLKA 1VQ4A 4GKKQ 2I5LX 4UP9A 3VDYA 4A93G 5HGQA 5ELOA 5H1SE 1SRUA 2ZJRA 3U4VA 4GOPA 2R7ZG 3TQYA 2VNUD 4JOIA 2RHQB 2L15A 3CCVA 3GTGH 4A3GG 3EIVA 1HNWQ 3CD6A 3LGJA 1PH3A 2D0PA 4IJLA 4IFDJ 2R93H 4IPDA 3HKSA 4OWXB 1U5KA 1IL2A 2HT1A 3ULPA 2ZJQA 5C44H 2CWPA 3J7ZC 2PQAB 4PMWA 3GTLH 1L1OA 4LW1A 4JI4L 2R92H 1D7QA 3RN5A 1OXXK 2EIFA 1KXLA 3D0FA 4A3LG 3PUYA 5IT9c 1I5FA 5LMNQ 4DR6L 3AFPA 1GVPA 2Z0SA 1OXSC 1H95A 1SROA 4JBJA 2VQEQ 4LF8L 3ULJA 5IE8A 1KC8C 2Q2IA 4LF4Q 4DV2Q 3EBEA 2N3SA 3E9HA 1YHBA 3CCSA 4K0KL 4MNOA 1CKNB 3TREA 4BBRH 5C44G 1KAWA 4IJHA 2R92G 1SMXA 1VQHA 5BR8L 2NZHA 5FLMH 2Y0SG 1HR0L 3PO2H 2B3GA 5C0XJ 1YIJA 1FJGL 1JB7A 1E1TA 4IPGA 3HOZH 3AFQA 2I0QA 2Q2HA 5IYDH 3S15H 4GNXC 5IYCH 4KHZA 3STBD 1C9OA 4L5QA 4EX5A 1S72A 1QVGA 4BBRG 4A3KH 2Z6KC 1BBUA 5FLMG 1LYLA 3K7AH 4KHPQ 2A1AA 2K4KA 1HJPA 2K75A 1YNXA 3I2ZA 4DUZL 4O0AA 4BBSH 4LF7L 3HOZG 4JBWA 5IYDG 1WFQA 1GM5A 4GS3A 5IYCG 1L0WA 4DV0Q 2F4VQ 4A3CH 5LMNW 4X65L 1Y14B 2RF4A 1UE5A 2I5MX 1MKHA 3HFZB 5IWAL 4A3KG 1SFOH 2ES2A 1IBMQ 2NZOA 2D62A 1PV4A 3HOUH 3J7A5 3K0XA 4RG1A 4A3MH 2PMZE 1TXYA 1HR0Q 1HZAA 1JMCA 2YTVA 4IO9A 3OW2A 3L2PA 3H3VH 2WAQG 2XTIA 3PF5A 1BKBA 3PIOA 1K8GA 3DM3A 4A3CG 3CP0A 2PI2A 4JYAL 1JT8A 1K83H 3CQZH 4DR2L 1Q1EA 3OYYA 1Q82C 1XMOQ 1PH4A 3HOUG 1X9NA 3I56A 4A3MG 3PV0A 1S3OA 4IFDG 3H0GH 1NMGA 3CC2A 3UE0A 2WB1G 2LXJA 1NE3A 2MO0A 2Y0SE 1UE1A 2E8GA 4L5SA 4JI1L 1PH2A 4BY7H 2ALYB 4ME3A 1GD7A 4XTCS 2IX1A 2GVBA 2GN5A 2F3IA 1PFSA 4JI8Q 3F2CA 4BY1H 2UXCQ 4R4TA 3CF5A 2WP8J 1SLJA 3STBC 4QY7A 2CCZA 2UUAQ 4BA1I 2JA5G 2LSSA 4A3FG 2HIXA 4YWMA 4YWLA 3ERSX 3H15A 2UU9Q 1TWGH 2JEBI 2VZAA 1VQJA 1V9PA 1HR0W 3K81C 4HJAA 2K50A 5C0XG 4BY7G 1U0LA 1XTDA 5C4XH 3S1QH 2JA6G 3UDXA 1N36L 3AQQA 1VQLA 4JI2L 2KENA 4BY1G 4DNIA 3HOVH 2JJQA 4P73A 2K5HA 3S1MH 1VQEA 3GO5A 3KF6A 3BU2A 4MZ9A 1HNXQ 1VQ5A 1N9WA 4AYBE 4JV5L 4A3BG 2JA7H 3G71A 3U4ZA 1MJCA 3KDFB 1TWAH 3S17H 1NY4A 3CMEA 4HJ5A 3F1ZA 3JAMi 4DR7L 4LF5L 4BA2I 2B63H 4Y52H 5C4XG 4AQYQ 1SE8A 1JJCB 2YTXA 2VQFQ 3M4QA 2XGTA 4L5RC 4GNXB 3K8AA 2R7ZH 4DV3L 4HIDA 3PUXA 3S14H 2VUMH 5JEAJ 4A3GH 2R6GA 2JA7G 3RN2A 1UEBA 3CC4A 3B6YA 1VQNA 4LFBL 1T9HA 4L5TA 4LFCL 2ZM6Q 2D0OA 4DV5Q 4QL5A 1VQCA 1IYJB 1CSPA 3M3YH 4P75A 2HHHL 4P72A 1N34L 4A3LH 2FXQA 4DR4L 2VUMG 2NVQH 2JQOA 1VQGA 1QVCA 4GN5A 1PYSB 4X64L 1I50H 1LM0A 5ELNA 3L0OA 4X66Q 4DV4L 4OXPA 5IYBG 1NMFA 1D8LA 4HIKA 5M3MG 2VS1A 3I55A 1BVSA 1QZHA 3M4PA 2K5NA 1PH5A 1YJWA 4LF5Q 4R4QA 3A74A 3CW2C 4LUZA 1A62A 2OWOA 3HOYH 1E3PA 2UXDQ 1LTLA 3CMAA 3BZCA 1IBLQ 1E22A 1TWHH 3GTJH 1VQ7A 1YHQA 1X55A 4YHHL 4JI6L 1XNQL 1A63A 3CCMA 1X54A 1CUKA 3T1HL 4GKJL 1Z9FA 2K5VA 4DV1Q 4POGA 4LUVA 2QGQA 4JG2A 3KDFA 4DUYL 1PH7A 1XNRQ 3W1BA 3A5UA 2KHJA 4OO1G 2Q2TA 1QUQA 3HOYG 2DGYA 5IP9H 1EWIA 1L1OC 2KCMA 2YV5A 3G6EA 4LF6L 1N34Q 3UE1A 4GNXA 3M9BA 1JJGA 1E1OA 3KLWA 4NXNL 1VQ6A 3NBHB 4XIGS 2NVYH 4QQBX 3I4NH 4JI5L 1VQ8A 3I4OA 3F2BA 4A3IG 2A19A 1CKMA 4R4CA 2C35B 4A75A 4DAYB 1Q81C 4JI4Q 4DAMA 4C3HH 5IP9G 2YTYA 3NELA 4LUOA 4FDBA 3OTOL 4OX9L 4GN4B 4HIOA 4JI3L 4DR6Q 4RMFA 4LF8Q 3J81j 3FP9A 3I4NG 2BH8A 1UWVA 3DLLA 4DV6L 1EYGA 2WFWA 4K0KQ 4LF9L 5JEAG 4UY8C 4GKJQ 4B3TL 3S2DH 1PH1A 1XMQL 1KQSA 4B3ML 2PQAA 5BR8Q 3EN2A 2KBNA 5M5YH 3L7ZC 3GTOH 1N33L 1YBYA 1XPRA 4HJ7A 1FJGQ 2AHOB 2OQ0A 4QJFA 3PF4A 1OXUA 4NXML 1BBWA 4LF6Q 3GTKH 3HOWG 4PZ8A 1IXRA 3UDGA 1L2FA 2JEAI 3J80i 1Q12A 1CKNA 4YCVA 4IOCA 5HY6A 4DR3L 2NVTH 1K0RA 3HKZG 1Y1VH 4C3IH 3J81i 1J5EL 4GN3B 5AJ3L 2JA5H 1WI5A 4DUZQ 3Q8DA 4JI7L 4A3FH 2OTJA 4LF7Q 1VQBA 1MJEA 2CFMA 1VQFA 3TEHB 1J6QA 1PHJA 4PZ7A 1M90C 1VQ9A 2JA6H 4X65Q 1K8AC 2ZTCA 2ASBA 2UUBL 1QZGA 2YYZA 3F2DA 2OQKA 5IWAQ
chains in the Genus database with same CATH superfamily
1N32L 2BH2A 1Y1VG 4C3IG 2E2HB 4DGZA 1HNZL 5DLQE 1OXTA 5KIXA 2N49A 5FLXL 4APVA 4IFDI 1WTOA 3H3VC 4DNRB 3W5OA 2EYLA 1A3VA 1RKNA 1PH6A 1H9KA 3IKJA 1JWUD 1RHPA 3ITPA 4HJ8A 1CA5A 4JC0A 1HZBA 1VQKA 2F0GA 3NSWA 2UUCL 2F0UA 4XQJA 4X62L 4JI1Q 2ATWA 4K5VA 2MJ8A 2QDBA 4RFBA 1IL8A 4HJ9A 3GV6A 1IZ6A 1N32Q 1LTRD 1STEA 4LWCA 1HNWL 4EQ5A 2R93B 1B8AA 1X3GA 1SBBB 2XRSD 1RCVD 2WB1E 4WORA 3I3CA 5J3BA 5LMNL 4DAPA 2VQEL 4DV2L 3BZKA 1B44D 2UXBL 3G4SA 4P71A 4CJ2C 1ENCA 3WDNA 1JOOA 1EYCA 1Z47A 1KD1C 1D1KA 1VF5C 1VMPA 3SK8A 4QUCA 1MSGA 4ZUIA 1RODA 4X62Q 2IHEA 4DV3Q 3S1NH 3T4AC 4R4IA 4GOPC 1JE4A 5I4DA 1GUNA 2CH4W 3G48A 2PNRC 1KTKA 5C4JH 4X3TA 3A5ZB 3CKIB 2B2WC 2LFNA 2HHHQ 2X6LA 4YY3L 2AQ1B 2QILA 2XWBB 1V1PB 3PUZA 4JBKA 4G7HC 1SFOB 5JEAH 2UXBQ 4IOAA 3S2DB 4A3MB 1BCPD 2DUDA 4CKEA 5C3EG 4RKBA 3VR6A 4XQNA 1SN8A 2EZVA 3HOWH 4J1MA 4JI6Q 5JJKA 4A3DG 4KI0A 2J0TD 1EWHA 3FPPA 3PO2G 1HTLD 3D3RA 4YY3Q 1XPUA 4NXNQ 3D6CA 3ERQA 4JI5Q 3R8BA 2R61A 4EQOA 2UUAL 1NR2A 3GDEA 4N9PA 2ICIA 4IPHA 1CSQA 4ABNA 4BBSG 2MO1A 1ESFA 3CPWA 4F87A 1SNPA 2MQHA 1XMQQ 2IY5B 2JA7B 2E5LL 3DWQA 1G2SA 1D5XC 1RL2A 4V0BA 3PSIA 1TWAB 2NN6I 1N33Q 1L0XB 4PV1C 3IRBA 5K36G 4NB3A 1LTTD 4AQYL 1ASYA 1TT2A 4GOPB 4I65A 3S14B 1EFWA 2VUMB 5E3FA 1J8IA 3TS0A 4KN7C 1ONLA 3C1EA 4HMIA 3UDFA 1II3A 4KK7A 5AJ3Q 4LK1C 3EROA 3ULLA 3H0GG 1PH9A 5FO9B 3QB3A 2EXZA 3W3AA 1STNA 4PZ6A 1C48A 3OPOA 1VQPA 1AZPA 1SNQA 2LKVA 1A6XA 1I50B 3SHLA 5ELDA 1W6KA 2E5LQ 1A15A 5TSSA 4O2DA 1HA6A 4FXGC 4UP8A 2CQOA 3HOYB 4HCSA 1ICFB 1K8OA 3RLFA 3PIP3 3KUPA 4ODGA 3GTJB 1NSNS 2JE6I 1KL9A 3S2HH 1RIPA 1DJRD 4OONA 4H02A 3GP7A 1JORA 3NPPA 4N8FA 2IHFA 4CJ0B 1I3QB 4GKKQ 1AFPA 3K58A 1F9RA 5ELOA 1SRUA 4GOPA 2F0FA 4O1NA 2RCFA 1EQVA 1PH3A 4IFDJ 3QOJA 3HKSA 4OWXB 5I9PA 1IL2A 2BE5D 4F88A 2B2WA 5C44H 2ZJQA 4FF4A 3GTLH 4BS9A 4C3HB 1L1OA 1SNOA 2HUGA 3RN5A 1KXLA 1F77A 1ET9A 5F2DA 3DMUA 4A3LG 4DR6L 3AFPA 3ULJA 1KLGD 5G3LF 1KAAA 1DOKA 1ET6A 5A2QE 3CCSA 4K8IA 2MUYA 5I6YA 2R92G 1SMXA 3PO2H 2NZHA 2Y0SG 2K7VA 1MSHA 1B3AA 1FJGL 3AFQA 3S15H 3FDTA 2KECA 1B50A 3SDZA 1DM0B 5IYCH 4KHZA 1WTRA 4K8JA 4XYOA 1YNJC 4B08A 1C9OA 2K04A 5C4HA 1EIGA 1CHPD 2F0NA 4CKBA 2H1EA 5FLMG 1D2BA 1SMYC 4DUZL 1HJPA 1YNXA 4BBSH 3HOZG 2XSCA 1GM5A 4GS3A 1L0WA 4A3CH 3DXJC 1UE5A 1MKHA 2ES2A 4QF4A 1IBMQ 1CHQD 4A3BB 1TIID 2D62A 2HQEA 3J7AV 2YU9B 3P75A 1TXYA 4IFDH 1LV9A 2YTVA 3L2PA 4Y7NB 2WAQG 2XTIA 3MZ5A 3PF5A 5M3FB 1K83H 3CQZH 2JP1A 5ISRA 1H9MA 3R3OA 4K6LA 4QMGA 3HOUG 1RD9D 1AZQA 1DOLA 1S3OA 1QCBD 3H0GH 3CC2A 1IW7C 4FYDA 4H44C 3NTHA 1MGSA 5IOCA 3TDQA 4JI8Q 1PFSA 2IWHA 1B4OA 5JAVA 4BA1I 4ZKCB 1Z6HA 4A3FG 4CDDC 3ERSX 3V96A 2JEBI 4RAUC 1E2WA 4IN3A 4M1UB 1HR0W 4QB4A 2K50A 5C0XG 1U0LA 1XTDA 3S1QH 2JA6G 1PDQA 2PZWA 4BY1G 3I8ZA 3M4YA 1LTSD 3DHQA 3BU2A 3KF6A 4MZ9A 1EY4A 1AEXA 3UI2A 3G71A 1B9MA 1MJCA 4ID6A 4OIJA 3J81E 5KNCA 1NY4A 4HJ5A 2EDGA 1JJCB 1HTPA 2JSOA 3EA6A 1ILQA 3GTGB 3B6YA 1VQNA 4LFCL 4QL5A 1I4RA 4P75A 2IPKD 1QNKA 1WTVA 4A3LH 2E2IB 4KTAA 1SYEA 1EOTA 5M5XB 1VQGA 1GUWA 4KKTA 1SNMA 1NMFA 1D8LA 3URYA 1H9JA 2EYMA 1QZHA 3N6RA 4HR7B 1Z7TA 3J7YW 1E22A 3MTSA 1IBLQ 4I7AA 1YHQA 1BNZA 4YHHL 3CCMA 4K14A 3SVMA 4GKJL 4DV1Q 4LUVA 3CRKC 1LT4D 2CVRA 2K1BA 3TSSA 4OO1G 2K01A 2Z4HA 3K7AB 1STYA 2DGYA 1C8CA 2YV5A 5J1ZA 3G6EA 4LF6L 1LTGD 1VQ6A 3DM1A 4QQBX 1CT1D 5D65A 3GTMB 4FF3A 3DEPA 1TU2B 3I4OA 3Q0AA 4KD3A 1CKMA 3CHBD 3FKIB 4CDFC 2C35B 2L5TA 3OTOL 1TWFB 3X3NA 1CZGA 2F0QA 1X32A 4LF8Q 2FMMA 3I4NG 2WFWA 4N9TA 4GKJQ 2B2YC 4UY8C 2P5ZX 3K5MA 5FLXE 3O13A 3TP7A 5D3IB 4QJFA 3PF4A 4NXML 1DD2A 4LF6Q 3GV3A 1HPCA 3UDGA 2JEAI 2DJFC 4YCVA 2NVTH 5LL6X 3ONAB 4NDXA 3ND9A 2OT2A 4A3FH 4LF7Q 1VQBA 1MJEA 2CFMA 2LS01 1KABA 4PZ7A 2JA6H 2UUBL 2YYZA 3F2DA 1G6PA 2PW7A 1FL0A 3KLSA 3VR5A 2TSSA 2LMCB 2L4NA 4BXXH 1Y1WH 4C56C 1CQVA 3ER0A 3MXNB 5CORA 3R93A 1I4XA 4JYAQ 3H3VI 3H91A 4DR2Q 4A93B 5I6WA 4JI0L 3CC7A 5EPJA 1EUJA 1P16A 4DFAA 4DV7L 5AFWA 1HFNA 1HXYD 2ID0A 5ELCA 3PIO3 3S24A 2D5DA 1I4PA 4TKOB 3CXCA 4JBMA 3M3YB 2WAQE 4A3EG 3T51B 1EOVA 4OELB 1JWMD 4C2MH 5KRUA 3PO3H 2PI2E 3CCEA 2NVQB 2EQSA 2Z4IA 2L1BA 2X69A 1IYVA 3JAMc 4EQNA 3WWVA 1S40A 4JI2Q 3P7JA 3KOJA 4DXGA 5E7NA 4DF7A 4A3JG 1YNJD 1GO3E 3RNUA 1YHAA 4JV5Q 4LF4L 3LWEA 4LNQA 4DV7Q 5M5WH 3M85A 4BBRB 3M4OH 1SMYD 4OO1H 4YCWA 1CZWA 2A69C 2OTLA 3BVGA 2KCNA 1ESRA 2CH4A 1G291 4IALA 3OWFA 1A2UA 2NVXH 3J7AF 3GTQH 2WKDA 4AH6A 2O5IC 1TR5A 2CKZB 2NVYB 3CRLC 4A3KB 4ILWA 4B3SL 3CCQA 2D2CC 3S1RH 4KHPL 4BWGB 2GA4B 1XJVA 4WJ3M 1EFID 2QEXA 2O2LD 2K5QA 3BJUA 3K6OA 4P74A 4LMQD 4DV0L 4QCLA 4X64Q 2Z6KA 4GLXA 1STBA 4UP7A 2R93G 1X3EA 1IW7D 1KRSA 1NNXA 5FLXc 1HZ9A 1VF7A 2WB1B 4L8JA 1WD1A 2AMCB 5IGGA 1XNQQ 1ENAA 3E9IA 2IJ0A 4ZRZA 1LT5D 1WTQA 2IX0A 3R2TA 1UE7A 1C7YA 2Q8RE 2B2YA 1EY8A 1W2BA 5EKIA 4DUYQ 1OXVA 2HQLA 4OEMB 2Q8IB 2JA5B 4B3SQ 4X3UA 3FVQA 5EAYA 2E74C 4UAIA 4BY7B 2R7DA 3RLNA 2ZJPA 4HTHA 4L63B 4GZYC 3OMCA 3NTIA 2AWNA 2RHSB 3I4MH 3BVMA 5BN4A 1X6OA 5FO7B 4OX9Q 3FHWA 2UU9L 4KV6A 2XRQD 5DNFA 1IKLA 2RCNA 5C4XB 1U4LA 4PMCA 2AWOA 4KD4A 3SK4A 4GLVB 1JOQA 4DV6Q 1STGA 4X6AH 4YIJA 4LF9Q 2IT1A 4DK3C 1XYIA 1KIXA 2ZTEA 2F0IA 1HNXL 1NJIC 3KFUA 1STAA 5EBCA 1EIFA 1DCZA 1GXDC 1PZKD 2L0CA 3AU7A 5CV7A 4IUPA 2B63B 1HUNA 1B70B 1ENFA 3CAMA 2I5HA 4A3EH 2KVMA 1WCMH 3MHBA 4RCNA 4TVAB 4DR3Q 3AMUA 3DWPA 1A3UA 1J5EQ 3MA2B 4JW0A 1KDBA 4DV5L 2K14A 3NK9A 3RLOA 4C1NK 1V1OA 1EIYB 2VL6A 2JA8H 5G3LD 1ASZA 2SDFA 4IUQA 1S5DD 1EZ6A 5GAGC 1VQDA 4A3JH 3K5OA 4XQQA 1HA5A 2KCTA 5GAEC 1C0AA 2EOTA 1HNZQ 2E2HH 1Y8PB 3ZJYC 2B8FA 1XPOA 2RDHA 2ZTDA 3TRZA 1EQTA 2UXDL 5CGKA 4IUVA 2TMPA 5EJWA 2BDOA 4OWWB 1B53A 3JC66 1YVCA 4X3SA 4YWKA 1XNRL 4DA2A 5C3WA 4R4OA 4ZYSA 2UUCQ 2I5LX 3BVZA 1FNVA 4FVMA 5HGQA 1SNDA 4F7XA 5H1SE 3U4VA 2R7ZG 3TQYA 2ZXPA 4K2KA 2VNUD 2L15A 4A3GG 1LABA 3EIVA 5E4XA 1HNWQ 4RA8A 2R93H 2VXWA 4JK1C 2PQAB 4PMWA 4JI4L 2NTSA 1D7QA 1HFGA 3D0FA 2MP1A 5IT9c 5LMNQ 1TS4A 2Z0SA 3NQIA 1H95A 2VQEQ 1G8ZD 3HOWB 2Q2IA 3SE0A 3BDCA 4DV2Q 3EBEA 4ME5A 4K0KL 1KNAA 3VR3A 4RGTA 1CKNB 5C44G 1VQHA 5BR8L 5M5YB 2B3GA 3I91A 3GTOB 4PQXA 1JB7A 1V8QA 4PMBA 5ELFA 2I0QA 2Q2HA 3QR8A 2KOLA 1F9PA 3STBD 1S72A 4HAEA 1QVGA 3KBXA 4F8MA 1Y1VB 4C3IB 1BBUA 1K0SA 2A1AA 2K4KA 4DNTB 4JBWA 1AN8A 2DN8A 2EYHA 5IYCG 2L11A 4X65L 1Y14B 2I5MX 1SFOH 1U4MA 2L55A 1G91A 2PO4A 1PV4A 1ZYRD 1SYBA 4A3MH 3FPUB 3OW2A 4IO9A 2IW3A 3H3VH 1EY6A 4A3CG 1V1PA 4R8IA 1Q1EA 3SK6A 4KY6A 5CYUA 3NXWA 1PH4A 4G57A 1X9NA 1DZ1A 2AQ2B 4IFDG 4ZUJA 3UE0A 1M4VA 4NMZA 1NE3A 1KNEA 2E8GA 2JXMB 4L5SA 1PH2A 2ALYB 1R4QB 4XTCS 2IX1A 1O7LA 2GVBA 3E3XA 2NBFA 2ENBA 2WP8J 1WTWA 2PQEA 2C9OA 3HG9A 1QB5D 4FP5D 2UUAQ 1K3BC 3TP5A 1TY0A 5M3MB 2EY5A 3RZOB 4YWLA 3H15A 1EZ8A 3ND8A 1V9PA 5JVG3 1N36L 1FR3A 1Y8OB 4P73A 2NB0A 2K5HA 1VQEA 3DEOA 3GO5A 4CDEC 4PNYA 4RCOA 4HCEA 5C4ZA 2MGSA 4IZ8A 4A3BG 2JA7H 1SDFA 1I6HB 1TWAH 2SOBA 5IGBA 4B9XA 4DR7L 1XWEA 4QIWB 5E4WC 4BA2I 3TMEA 4AQYQ 2YTXA 4FO2A 2ZXOA 4MHEA 2XGTA 2E2JB 2R7ZH 4HIDA 3PUXA 3S14H 3WOEA 1IYUA 1WTXA 2VUMH 1HCZA 4A3GH 3C3LA 1PYWD 1TWCB 3CC4A 4LFBL 1SYGA 2RKSA 4L5TA 2D0OA 1CSPA 1EIHA 3K59A 4P72A 1N34L 3NWTA 2RSOA 5C3EB 4DR4L 1QVCA 4GN5A 4RH6A 4A3DB 1I50H 4EGVA 3L0OA 4DV4L 4HIKA 5A35A 4CGYB 5DM73 1UUPA 1PXUA 4FNFA 3I55A 1F2ZA 4FF1A 2K5NA 4P2CB 1YJWA 1Y69U 1SYDA 3HOYH 3C46A 1BOSA 1STHA 4MIUA 3GTJH 1JICA 5LL6S 1A63A 2F0WA 1X54A 3T1HL 2SEBD 3C1FA 5EKKA 1Z9FA 2K5VA 3HKZB 4OGQC 2OEOA 3H09A 3X3MA 2ZXRA 3A5UA 2A68D 2F0TA 3A7AB 2Q2TA 3SXHA 3KK7A 2KCMA 1N34Q 3UE1A 3M9BA 3TP6A 3MVVA 3RZDB 3NBHB 4FXKC 3ZYYX 1I4QA 4A3IG 2A19A 1SYFA 5HGTA 3C2PA 4DAYB 1A3TA 1TQOA 4DAMA 4C3HH 1ZKOA 4LUOA 5FO8B 4CDCC 4GN4B 3BG3A 4JI3L 4DR6Q 3HOXB 1B2TA 1UNSA 1GHKA 3J81j 1SNCA 4B3TL 4LJZC 4B3ML 4C3JG 2KBNA 2EJMA 5D3DA 4HJ7A 1FJGQ 2AHOB 2K05A 1QG7A 2OQ0A 4ZLTF 4QUFA 2ZT9C 2A6HC 4EVOA 1QNUA 4RGNA 3HEJA 5DEHA 2I46A 1K0RA 4GN3B 1TS2A 3MXPA 4DUZQ 4OHJA 2OTJA 2VB3X 5ELBA 1PTOF 1ML0D 1VQFA 3A8JE 1M90C 1GUOA 3S1QB 2ASBA 4XT3B 1HZCA 3S9WA 4YCUA 4B3TQ 4A3BH 3T1YL 5IP7H 4B3MQ 1ICWA 2JYOA 4DAYA 2YU9H 3S16B 1T5EA 5HURA 4LFAL 5LMUL 4Y7NH 3E0EA 2N88A 1SXTA 3LX0A 5M3FH 4H0LC 1EY0A 1GUGA 3VYUA 3J80E 4DR5L 3HS0C 5JPMC 1FNWA 2K32A 3NQTA 5EPLA 4WJ4A 5E1FA 2MFIA 4BXXG 4ALPA 1Y1WG 2PMZB 3U50C 1S5ED 3R2IA 2M00A 1WYDA 3LNNA 2EYPA 3MFYA 3MAQA 1R9TB 3BS1A 2F03A 1RTOA 2PCFB 1NUCA 5GAHC 2H4OA 1SR3A 1YJNA 4HIMA 1TS3A 1HQRD 1Y8NB 3P1HA 5JJIA 2O4XA 3T1YQ 3NEMA 3BZDB 1E2ZA 2R92B 2PNHA 2Y0SB 4K5WA 4GLAC 4QGUA 4HMJA 3PO3G 4IQZA 1EQRA 3SGIA 1J9OA 1EY5A 2N78A 2KHIA 3D4RA 2KCCA 4J15A 1QWYA 1VQAA 3HP3A 3HOZB 4JCVE 1SJHD 5CC4A 2QA4A 4JOIC 2EXDA 4AYBB 4WFN3 5GROA 4A3IH 4MTKA 2F52A 4OWTB 2HCIA 4LFCQ 3M7NA 1A0IA 4ZKBB 3CCLA 1W6JA 4R9WA 2MNAA 2OCEA 2F0HA 5EBDA 4K5XA 4IUNA 1VQIA 3T13A 1PA6A 2E2IH 2WAQB 5KGUA 1DOMA 2H5XA 1XXGA 2F4VL 5M5XH 1K28A 2KEDA 1PLFA 1E24A 3H6MA 1GJXA 3MEFA 3HOUB 1GKHA 3EQLC 4KHVA 4C3JH 1H9RA 3QO2A 1K9MC 1Q8IA 4YHHQ 2Z1CA 3T53B 4KN4C 1YJ9A 4LAAA 3U9OA 5JJZA 2A6EC 1XMOL 1JJ2A 2NN6H 3UDIA 2XWJB 5EPKA 1AE2A 2VY3A 3NHHA 4NPSA 1Q46A 4DU9A 1RJTA 3PUWA 4A4IA 2A5HA 3CCUA 1X65A 4BY1B 3GTMH 1SEBD 2UXCL 1V1QA 4DXFA 3HGBA 3D31A 4KY5A 1VQMA 3FKIH 3CU7A 4UDUC 1PTOC 3VYRA 3OTOQ 1PRTF 2B29A 1TWGB 1EYAA 1TWFH 4Q5VA 1X56A 1UEAB 3D4DA 4TQUS 4RGOS 1SAPA 1K73C 2K5WA 3HOVB 1KHIA 1IBKL 3A56A 1OTCA 3S1MB 3VYSA 1G51A 4XDXA 2BA1A 2DNEA 3A54A 4UPAA 3J80c 3I4MG 2J7ZA 2I07B 2AQ3B 5LHY1 4DR1L 3J81c 3S17B 4DN4M 1FVIA 3AEVA 3RR5A 1HH2P 5FK9C 2AKWB 4NXMQ 2V1CC 3GTPH 2VQFL 3ICEA 4DAVA 1U4PA 1I94L 1CKOA 5KNDA 1MBYA 1VQOA 1PVOA 1A8VA 1JE5A 5D14A 1NTGA 2ZM6L 3TZUA 2N8NA 1CK1A 5IGFA 2EVBA 2EJFC 2AUJD 1Q86C 4U68A 2UUBQ 1WCMG 1IBKQ 5BN5A 4CKCA 1X3FA 5DAUA 1QOHA 2RSNA 3TS2A 4X66L 4DR1Q 5M5WB 5T1GA 5FJ8H 2JA8G 1HUMA 5GQOA 1QUQB 1I6VC 1KDAA 2F1MA 1WJJA 3VR2A 1PZID 1T5XD 1TWHB 4JI0Q 4A93H 1I94Q 2C5CA 2NVXB 2QDLA 1LT3D 2RVLA 1SSOA 3Q23A 3CCJA 5I9OA 1BQQT 4R1JA 2D9UA 1OO9B 2KHSA 3MXNA 5JOBA 2EY6A 5CMDA 1GUTA 2CQAA 2A74C 4KY7A 2B63G 1RF2D 3PUVA 5J22A 4KLKA 1VQ4A 1CFMA 1BXTA 1TY2A 1AW7A 4JOIA 2RHQB 3I4NB 2F3VA 3CCVA 5KYIA 4G7OC 3CD6A 1RDPD 3LGJA 1VMCA 4ZCKA 1S5BD 2SNMA 2HT1A 1U5KA 2B8GA 1PTOB 3ULPA 3VYTA 2CWPA 3J7ZC 1JB3A 4LW1A 2EIFA 1I5FA 1GVPA 2A6HD 1JOKA 1OXSC 1SYCA 3D8GA 1SROA 4JBJA 5IE8A 3KLRA 4LF4Q 1NAPA 2N3SA 3E9HA 3EFXD 1I4GA 1HRJA 4BBRH 1KAWA 4IJHA 1CM9A 1XTCD 3IAYA 1YIJA 1LO5D 4IPGA 3GTKB 5IYDH 4GNXC 2KA7A 1LLRD 1WTHA 5I2YA 1O7YA 4A3KH 5IGCA 3K0YA 1LYLA 3N52A 4KHPQ 2HD3A 3JAML 1I4HA 4NKLA 5EKLA 3VR4A 4DV0Q 4HN7A 5LMNW 3I72A 2RF4A 5IWAL 4C1NI 1EYDA 4HEDA 1NR4A 3J7A5 1PRTC 3I73A 4XYQA 3F2UA 1HHVA 1BKBA 4A3EB 4L6TB 3OYYA 2X6GA 4A3MG 2FHTA 3PV0A 1NMGA 1DXMA 2SNSA 1GOZA 1WTPA 2DJGC 3OW7A 2F0DA 5CV6A 5T1IA 4JI1L 1FGBD 2VB2X 4BY7H 1S5FD 4ME3A 1GD7A 1LT6D 2GN5A 5KYLA 2F3IA 2EYJA 2F0LA 4R4TA 4EQPA 2CCZA 3BYTB 2LSSA 1TVXA 4YWMA 2UU9Q 4I7ZC 4KKUA 1VQJA 2MHVA 4HJAA 5C4XH 3Q6SA 3UDXA 2KENA 4DNIA 3K5LA 2JJQA 3A7LA 1HNXQ 3T56B 1IHZA 3U4ZA 1YNNC 3KDFB 4KKSA 3CMEA 3F1ZA 3JAMi 2WKCA 2B63H 2CHBD 1FNUA 4GNXB 3S1NB 4DV3L 2E75C 5JEAJ 2JA7G 3IFTA 3RN2A 1UEBA 5CV4A 3MWYW 1T9HA 1JQYD 1DYQA 5C4JB 4DV5Q 4G4KA 1M8AA 3A8IE 1IYJB 2HHHL 2FXQA 5C5MA 3QOLA 2VUMG 2A6ED 1PYSB 4NW2A 1CTMA 1EY7A 4OXPA 1O80A 2F0JA 3SK5A 5IYBG 1U4RA 1PRTB 5M3MG 2VS1A 1BVSA 3RMHA 4R4QA 3A74A 1WD0A 1A62A 2OWOA 1E3PA 1LTID 2UXDQ 2KJXA 1VQ7A 3BDLA 2QEJC 4JI6L 1F2MA 2KEEA 1CUKA 4N8X1 1FD7D 1SE4A 2DY7A 2QGQA 3KDFA 2G9HD 1PTOD 3W1BA 1XNRQ 2KHJA 3TZDA 3HOYG 2NYZD 5IP9H 1L1OC 3D6WA 4GNXA 1JJGA 1E1OA 4NXNL 2DY8A 1EU4A 3MXGA 2HDMA 4JI5L 1VQ8A 3F2BA 3NWSA 4R4CA 4RWSC 4A75A 4JI4Q 2YTYA 1D1IA 2EJGC 3DUZA 4IURA 2NUCA 1X3PA 3FP9A 2BH8A 1EYGA 4K0KQ 2OXPA 4KJOA 3S2DH 3G7LA 4RKLA 1XMQL 2F0KA 1KQSA 2PQAA 3NUCA 5BR8Q 2Z8LA 4C3HG 1GHJA 1JWSD 3L7ZC 5M5YH 3GTOH 1N33L 1YBYA 1BBWA 2PZUA 4PZ8A 1IXRA 1EU3A 3IL8A 1CKNA 3V05A 4H13C 3HKZG 1Y1VH 4C3IH 1VDZA 1ZXTA 2K5DA 5AJ3L 1WI5A 4JI7L 3Q8DA 1PFBA 1UAPA 3HRZC 1QE6A 1J6QA 3QWNA 1EL0A 4X65Q 1F2LA 1K8AC 5IT9L 1QZGA 2F4IA 2OQKA 1BDOA 2VW9A 3MEHA 4A76A 3PIPA 4G7ZC 1DONA 5IY0A 1V43A 2A69D 1BUVT 3HOXG 2Q2UA 5GADC 2L12A 1R4PB 3KLSX 2R7ZB 2EY2A 3S2HB 2BA0A 4RHRA 5CBAE 4A3GB 5IP7G 5NUCA 2MPMA 4JI7Q 4OIKA 1E0BA 2B2TC 2XIWA 3I90A 1L1OB 5M3FG 4GKKL 5JJLA 2QKIC 2EYFA 2OF1A 5IIFA 1K3RA 4HSPA 3CPFA 5C0XI 2B2UC 4TSSA 4AIMA 3U9SA 1B9NA 3A8KE 1EQQA 1KRTA 5IYBH 3SR1A 2A8VA 5M3MH 1M1KC 5C44B 3RZOH 2R7FA 3GTLB 1VCIA 1PYBA 3HZXA 2AUKA 1N36Q 4X3KA 2L9HA 3PQIA 2HDLA 3I7FA 1YITA 3L9AX 4IPCA 2Z6BA 1I6HH 1SE3A 3FEWX 5I2XA 1NCVA 4DR7Q 2RDFA 3PO2B 3CCRA 3K7UC 3PCOB 1E2VA 1YEZA 2GVAA 1MIUA 2JA9A 1VS0A 4TRDA 4CHTB 2E2JH 3S15B 2NZ1D 2K33A 3QG1A 3OIQA 1TWCH 3QIAA 4LFBQ 1PRTD 2RA4A 1QVFA 1I3QH 2RQXA 1RTNA 1LTAD 4DPGA 4BBSB 3D4WA 5IODA 5C3EH 3OMGA 1DGSA 4DR4Q 3NP8A 1AE3A 1ZEQX 4O42A 4A3DH 4DV4Q 1IBML 2FINB 3L3OC 1E7ZA 2IX3A 3W2DA 5EGTA 1LUZA 4S3SA 5M9OA 2NWGA 4OO1I 3W1GA 2JN4A 2K6AA 1HQMC 1TS5A 4DK0A 1K83B 3CQZB 1SJED 3T1HQ 4FF2A 4DKAC 3I4LA 3WOFA 4OL7A 4XXEA 2CWAA 1A2TA 3MXUA 1F2YA 1W3SA 3DWAA 3H94A 3H0GB 2NTTA 1LTBD 1B3QA 1D6EC 2LY7A 3KJOA 1P8LA 2WINB 3A0JA 1Q1BA 3QJYA 1PFNA 3RZDH 5CR3A 4JI8L 1JC7A 4AYBG 1CI3M 2NN6G 1S5CD 2KQ3A 3KF6B 1YNND 1X3QA 4CJ1B 1EEID 4ZAIA 4QIWE 4B3RL 4H7BA 2B2VC 4JI3Q 1Q3LA 1WOCA 2EYOA 3HOXH 1WVLA 5K36H 1B7YB 3KYHC 3NBHA 2QW7A 3U58A 2F0MA 5C6AA 4UHVA 2HIVA 1B1ZA 2CW0C 3FKIG 4KJNA 3OHXC 3AYHB 3SEBA 4JPBW 1QILA 3K80C 1BCPF 2K28A 2LXKA 3T16A 1Q8KA 4DK6C 1YI2A 1AH9A 1JR0D 3PGZA 3KBGA 1BO0A 2DNCA 3BYYB 1Q7YC 1N8RC 3KF8B 2B2TA 1PZJD 1EY9A 5FOBB 4B3RQ 4R8NA 1YZ6A 3FRPB 1O7IA 2EPBA 3OOCA 1KDCA 4PG3A 1UE6A 3MC0B 2B2UA 2PPBC 1NBWA 1O7ZA 3M7GA 2JK8A 1JCKB 3HKZE 5IGEA 1MHWC 1PH8A 1D5MC 3S16H 4LFAQ 4ZK9B 5LMUQ 5K5PA 3GD7A 4IUUA 3NENA 2FFKB 2FMCA 1FYCA 4E6IA 1CQFA 3KJPA 1K8MA 1FGUA 2K52A 4DR5Q 1IBLL 3HOVG 3RUZA 3F8TA 3VA7A 4POFA 2ICEC 4Q0FA 2G9DA 4DV1L 4A3IB 5FJ8G 4MTNA 1R9TH 4UP9A 3VDYA 4A93G 2ZJRA 2BOSA 4ULLA 2Z9HA 3K5NA 3GTGH 2D0PA 4IJLA 2R3ZA 3KF8A 5COYA 4IPDA 3EVQA 5DM63 2M9VA 4C3JB 2FJ2A 2WIIB 2R92H 3JAME 1Q90A 1OXXK 1QJOA 2Q8TA 2IL8A 3PUYA 1MD2D 1MI2A 3Q22A 2E76C 4LF8L 1KC8C 4JVZA 2BDNA 4RGMA 4WRDA 1YHBA 2J4XA 4MNOA 3TREA 5BN3A 5FLMH 1HR0L 4CBVA 5C0XJ 2PYKA 3HOZH 1E1TA 2F0SA 2E2DC 1O78A 4L5QA 4EX5A 3OIPA 4BBRG 2NVTB 4J8QA 2XNAC 2Z6KC 1BF4A 1H9SB 2RDGA 3K7AH 4A3FB 3RD4A 3I2ZA 1U9RA 2K75A 4O0AA 4RHSA 4LF7L 4HSVA 5IYDG 1WFQA 4FXDA 2JA6B 2F4VQ 2K03A 1BR9A 4A3KG 3HFZB 3K57A 2NZOA 3HOUH 5A2QL 3K0XA 4RG1A 5CBEE 3IFDA 2PMZE 4KMUC 1JMCA 1HR0Q 1HZAA 1Y1WB 1XX8A 2B2VA 3PIOA 1K8GA 3DM3A 1G2TA 4U673 3CP0A 2PI2A 4JYAL 3GTPB 1JT8A 2PZTA 4DR2L 4Z9CB 5IGDA 1Q82C 1F9SA 3G6JB 1SE2A 1XMOQ 2G5DA 3I56A 3I70A 2WB1G 2LXJA 1BCPC 5JPNC 2MO0A 1F9QA 1CA6A 2Y0SE 1UE1A 3NTKA 5C0XH 4C2MB 3PO3B 3E0JA 1EEFD 3F2CA 4BY1H 2KUMA 2UXCQ 3CF5A 4B9WA 1SLJA 3STBC 4QY7A 3TN2A 1H9SA 3TBIB 2JA5G 1ILPA 5CV9A 3MFGA 2HIXA 2EY1A 1TWGH 2VZAA 5EQ0A 3LWUA 1IKMA 3K81C 4BY7G 4K6DA 2XN9C 3AQQA 1VQLA 4JI2L 3HOVH 1LACA 3S1MH 3EJIA 1G6ZA 1VQ5A 4JV5L 1PMRA 1N9WA 3E5SA 3OSOA 4AYBE 1PFMA 3NBIA 2F0PA 3M4OB 3S17H 1ZYRC 4LF5L 4Y52H 5C4XG 1SE8A 2VQFQ 3VA5A 1GUSA 3M4QA 4L5RC 4DK1A 3K8AA 2A73B 3GTQB 5C5LA 2R6GA 3V2TA 2ZM6Q 2XVSA 2M2LA 3S1RB 1VQCA 3M3YH 3NE5B 1TKWB 2NVQH 1KLUD 2JQOA 2QF7A 4X64L 1LM0A 4K2LA 5ELNA 5JVH3 3J80L 4X66Q 5FKAC 3Q24A 5L37A 2F0OA 3J81L 1PH5A 3M4PA 4LF5Q 3CW2C 4LUZA 2EE1A 1LTLA 3CMAA 3BZCA 1TWHH 1X55A 1XNQL 4NP5A 5ELEA 3P20A 4POGA 2RBMA 4JG2A 1PH7A 4DUYL 2V4DA 1S4ZA 2QCPX 4IUTA 3TP8A 1BCPB 1QUQA 2N55A 2WV6D 1C4QA 1EWIA 2PW5A 5C3XA 3KLWA 4XIGS 2NVYH 3I4NH 2HCCA 2CW0D 2F0EA 3I4MB 2BCOA 2B39A 5KEEA 1PTOH 1Q81C 5IP9G 3NELA 4FDBA 4OX9L 4HIOA 5IT9E 4RMFA 2WACA 1UWVA 3DLLA 4DV6L 1AP0A 3BDOA 3PMFA 4LF9L 5JEAG 5J39A 4V190 1PH1A 3EN2A 4ZQ3A 5CV5A 2BE5C 3A55A 1L0YB 1XPRA 3E6ZX 4WJWA 1OXUA 3GTKH 3HOWG 1L2FA 3J80i 1Q12A 1WCMB 4IOCA 5KNBA 3AB9A 5HY6A 1EWCA 4DR3L 3J81i 1J5EL 2JA5H 4M8AA 3GQBA 1D5ZC 3FMCA 3OWEB 2F0VA 2A68C 4MN3A 1BBXC 2F3WA 2JA8B 3TEHB 1VQ9A 5CV8A 1PHJA 2O5JC 2ZTCA 4A3JB 4XT1B 4J6HA 5IWAQ
chains in the Genus database with same CATH topology
1N32L 1G6PA 2BH2A 2VW9A 1HZCA 1Y1VG 4YCUA 4A76A 3PIPA 4B3TQ 1HNZL 1FL0A 4A3BH 5DLQE 1OXTA 5IY0A 5IP7H 2N49A 3T1YL 2YU9H 4B3MQ 4BXXH 1V43A 1Y1WH 4LFAL 3ER0A 4APVA 5LMUL 3MXNB 4Y7NH 4IFDI 3E0EA 3HOXG 5M3FH 4JYAQ 2Q2UA 3H3VI 5GADC 3W5OA 4DR2Q 4DR5L 4JI0L 3CC7A 1PH6A 2BA0A 1EUJA 1P16A 4DV7L 4WJ4A 4HJ8A 5IP7G 2ID0A 4JC0A 1HZBA 2MFIA 1VQKA 4ALPA 4BXXG 1Y1WG 3S24A 3U50C 4JI7Q 3CXCA 1WYDA 2UUCL 4JBMA 5M3FG 1L1OB 4X62L 4JI1Q 2ATWA 4GKKL 5JJLA 2WAQE 4A3EG 1EOVA 4C2MH 5GAHC 3PO3H 1K3RA 4HJ9A 2PI2E 1SR3A 3CPFA 5C0XI 1YJNA 4HIMA 1IZ6A 4AIMA 3CCEA 1N32Q 2EQSA 4LWCA 1HNWL 1EQQA 1KRTA 4EQ5A 5IYBH 1B8AA 1X3GA 5JJIA 3T1YQ 5M3MH 2A8VA 1M1KC 3RZOH 2R7FA 3NEMA 2WB1E 3JAMc 1VCIA 2PNHA 4QGUA 4GLAC 1PYBA 3WWVA 1S40A 4JI2Q 1N36Q 3PO3G 3KOJA 5J3BA 5LMNL 1EQRA 5E7NA 4A3JG 2VQEL 3I7FA 3SGIA 1YITA 1GO3E 3RNUA 1YHAA 4JV5Q 4LF4L 4DV2L 4LNQA 2N78A 3BZKA 2KHIA 4IPCA 5M5WH 3G4SA 4DV7Q 4P71A 2UXBL 3M85A 1I6HH 4J15A 3M4OH 4DR7Q 1Z47A 1KD1C 3CCRA 3K7UC 4YCWA 1VQAA 3PCOB 1YEZA 2GVAA 1MIUA 2JA9A 4X62Q 2OTLA 1VS0A 1G291 4JCVE 2IHEA 4DV3Q 2E2JH 3S1NH 4GOPC 4R4IA 2NVXH 3GTQH 2QA4A 4JOIC 4AH6A 2EXDA 2CKZB 3G48A 1TWCH 5GROA 4A3IH 4LFBQ 2F52A 4OWTB 5C4JH 4LFCQ 3M7NA 1A0IA 3A5ZB 4B3SL 1QVFA 3CCQA 3S1RH 1I3QH 3CCLA 4KHPL 2MNAA 2OCEA 4DPGA 1XJVA 2HHHQ 4WJ3M 1PA6A 1VQIA 5C3EH 4YY3L 1DGSA 2E2IH 4DR4Q 2QEXA 3BJUA 4P74A 2H5XA 4DV0L 2F4VL 5M5XH 3PUZA 4X64Q 1AE3A 2Z6KA 1E24A 4JBKA 4GLXA 4DV4Q 4A3DH 4UP7A 2UXBQ 3MEFA 2R93G 1X3EA 1IBML 1GKHA 4IOAA 1E7ZA 4C3JH 1KRSA 5FLXc 1LUZA 2DUDA 1HZ9A 1K9MC 5C3EG 4OO1I 3W1GA 2AMCB 5K36G 1SN8A 3HOWH 4YHHQ 4JI6Q 1XNQQ 3E9IA 5JJKA 3T1HQ 4A3DG 1YJ9A 2IX0A 1UE7A 1C7YA 4DKAC 4KI0A 1XMOL 1W2BA 4DUYQ 1JJ2A 1OXVA 2CWAA 2HQLA 1W3SA 3UDIA 4B3SQ 3PO2G 1AE2A 2VY3A 4NPSA 1Q46A 3KJOA 1P8LA 5EAYA 3A0JA 3PUWA 4A4IA 4YY3Q 2R7DA 3RLNA 1Q1BA 2ZJPA 4NXNQ 3CCUA 1XPUA 3RZDH 4JI5Q 1X65A 3GTMH 4JI8L 4AYBG 2UXCL 1V1QA 2AWNA 2NN6G 3D31A 3KF6B 2RHSB 3I4MH 2UUAL 1VQMA 3FKIH 3GDEA 4IPHA 1X6OA 1CSQA 3OTOQ 4QIWE 2B29A 2MO1A 3FHWA 2UU9L 1TWFH 4JI3Q 4OX9Q 4BBSG 4B3RL 1WOCA 3HOXH 1X56A 2RCNA 4TQUS 1B7YB 2AWOA 3KYHC 4GLVB 3CPWA 4DV6Q 1K73C 1KHIA 1IBKL 1OTCA 4X6AH 1G51A 3J80c 2BA1A 3U58A 2MQHA 2IT1A 4UPAA 4DK3C 1KIXA 4LF9Q 3I4MG 2ZTEA 2HIVA 1HNXL 3FKIG 1XMQQ 1NJIC 4DR1L 2IY5B 2E5LL 3J81c 1RL2A 3KFUA 1EIFA 3PSIA 3AYHB 1FVIA 2NN6I 1N33Q 3AEVA 3RR5A 1HH2P 3IRBA 2AKWB 1B70B 4NB3A 4NXMQ 2V1CC 3K80C 3CAMA 2I5HA 2LXKA 4AQYL 2VQFL 1Q8KA 4A3EH 1ASYA 3GTPH 3ICEA 1I94L 4GOPB 4DK6C 1CKOA 1YI2A 1AH9A 3PGZA 1EFWA 1WCMH 3TS0A 4TVAB 4DR3Q 1VQOA 3UDFA 1PVOA 1A8VA 1J5EQ 1JE5A 5AJ3Q 1Q7YC 1NTGA 3KF8B 1N8RC 3ULLA 3H0GG 1PH9A 2ZM6L 4DV5L 2K14A 3RLOA 4B3RQ 2N8NA 2VL6A 1YZ6A 1EIYB 2JA8H 1ASZA 4PZ6A 1O7IA 4PG3A 1UE6A 1VQPA 1Q86C 2UUBQ 1WCMG 5GAGC 1VQDA 4A3JH 1IBKQ 2KCTA 1NBWA 5GAEC 1C0AA 1X3FA 1HNZQ 2E2HH 3TS2A 3ZJYC 4X66L 4DR1Q 2E5LQ 2JK8A 1PH8A 3HKZE 3S16H 4LFAQ 5LMUQ 5FJ8H 4O2DA 2JA8G 3GD7A 1XPOA 4UP8A 5GQOA 2ZTDA 1QUQB 3NENA 2CQOA 3TRZA 1WJJA 3RLFA 2UXDL 3KJPA 2K52A 1FGUA 1IBLL 4DR5Q 4JI0Q 3HOVG 1I94Q 4A93H 2JE6I 1KL9A 3S2HH 3F8TA 1RIPA 4POFA 4OONA 4OWWB 3CCJA 4H02A 3JC66 1YVCA 4DV1L 4R1JA 4YWKA 5FJ8G 1XNRL 4MTNA 4R4OA 2UUCQ 2IHFA 2B63G 3PUVA 1R9TH 4KLKA 1VQ4A 4GKKQ 2I5LX 4UP9A 3VDYA 4A93G 5HGQA 5ELOA 5H1SE 1SRUA 2ZJRA 3U4VA 4GOPA 2R7ZG 3TQYA 2VNUD 4JOIA 2RHQB 2L15A 3CCVA 3GTGH 4A3GG 3EIVA 1HNWQ 3CD6A 3LGJA 1PH3A 2D0PA 4IJLA 4IFDJ 2R93H 4IPDA 3HKSA 4OWXB 1U5KA 1IL2A 2HT1A 3ULPA 2ZJQA 5C44H 2CWPA 3J7ZC 2PQAB 4PMWA 3GTLH 1L1OA 4LW1A 4JI4L 2R92H 1D7QA 3RN5A 1OXXK 2EIFA 1KXLA 3D0FA 4A3LG 3PUYA 5IT9c 1I5FA 5LMNQ 4DR6L 3AFPA 1GVPA 2Z0SA 1OXSC 1H95A 1SROA 4JBJA 2VQEQ 4LF8L 3ULJA 5IE8A 1KC8C 2Q2IA 4LF4Q 4DV2Q 3EBEA 2N3SA 3E9HA 1YHBA 3CCSA 4K0KL 4MNOA 1CKNB 3TREA 4BBRH 5C44G 1KAWA 4IJHA 2R92G 1SMXA 1VQHA 5BR8L 2NZHA 5FLMH 2Y0SG 1HR0L 3PO2H 2B3GA 5C0XJ 1YIJA 1FJGL 1JB7A 1E1TA 4IPGA 3HOZH 3AFQA 2I0QA 2Q2HA 5IYDH 3S15H 4GNXC 5IYCH 4KHZA 3STBD 1C9OA 4L5QA 4EX5A 1S72A 1QVGA 4BBRG 4A3KH 2Z6KC 1BBUA 5FLMG 1LYLA 3K7AH 4KHPQ 2A1AA 2K4KA 1HJPA 2K75A 1YNXA 3I2ZA 4DUZL 4O0AA 4BBSH 4LF7L 3HOZG 4JBWA 5IYDG 1WFQA 1GM5A 4GS3A 5IYCG 1L0WA 4DV0Q 2F4VQ 4A3CH 5LMNW 4X65L 1Y14B 2RF4A 1UE5A 2I5MX 1MKHA 3HFZB 5IWAL 4A3KG 1SFOH 2ES2A 1IBMQ 2NZOA 2D62A 1PV4A 3HOUH 3J7A5 3K0XA 4RG1A 4A3MH 2PMZE 1TXYA 1HR0Q 1HZAA 1JMCA 2YTVA 4IO9A 3OW2A 3L2PA 3H3VH 2WAQG 2XTIA 3PF5A 1BKBA 3PIOA 1K8GA 3DM3A 4A3CG 3CP0A 2PI2A 4JYAL 1JT8A 1K83H 3CQZH 4DR2L 1Q1EA 3OYYA 1Q82C 1XMOQ 1PH4A 3HOUG 1X9NA 3I56A 4A3MG 3PV0A 1S3OA 4IFDG 3H0GH 1NMGA 3CC2A 3UE0A 2WB1G 2LXJA 1NE3A 2MO0A 2Y0SE 1UE1A 2E8GA 4L5SA 4JI1L 1PH2A 4BY7H 2ALYB 4ME3A 1GD7A 4XTCS 2IX1A 2GVBA 2GN5A 2F3IA 1PFSA 4JI8Q 3F2CA 4BY1H 2UXCQ 4R4TA 3CF5A 2WP8J 1SLJA 3STBC 4QY7A 2CCZA 2UUAQ 4BA1I 2JA5G 2LSSA 4A3FG 2HIXA 4YWMA 4YWLA 3ERSX 3H15A 2UU9Q 1TWGH 2JEBI 2VZAA 1VQJA 1V9PA 1HR0W 3K81C 4HJAA 2K50A 5C0XG 4BY7G 1U0LA 1XTDA 5C4XH 3S1QH 2JA6G 3UDXA 1N36L 3AQQA 1VQLA 4JI2L 2KENA 4BY1G 4DNIA 3HOVH 2JJQA 4P73A 2K5HA 3S1MH 1VQEA 3GO5A 3KF6A 3BU2A 4MZ9A 1HNXQ 1VQ5A 1N9WA 4AYBE 4JV5L 4A3BG 2JA7H 3G71A 3U4ZA 1MJCA 3KDFB 1TWAH 3S17H 1NY4A 3CMEA 4HJ5A 3F1ZA 3JAMi 4DR7L 4LF5L 4BA2I 2B63H 4Y52H 5C4XG 4AQYQ 1SE8A 1JJCB 2YTXA 2VQFQ 3M4QA 2XGTA 4L5RC 4GNXB 3K8AA 2R7ZH 4DV3L 4HIDA 3PUXA 3S14H 2VUMH 5JEAJ 4A3GH 2R6GA 2JA7G 3RN2A 1UEBA 3CC4A 3B6YA 1VQNA 4LFBL 1T9HA 4L5TA 4LFCL 2ZM6Q 2D0OA 4DV5Q 4QL5A 1VQCA 1IYJB 1CSPA 3M3YH 4P75A 2HHHL 4P72A 1N34L 4A3LH 2FXQA 4DR4L 2VUMG 2NVQH 2JQOA 1VQGA 1QVCA 4GN5A 1PYSB 4X64L 1I50H 1LM0A 5ELNA 3L0OA 4X66Q 4DV4L 4OXPA 5IYBG 1NMFA 1D8LA 4HIKA 5M3MG 2VS1A 3I55A 1BVSA 1QZHA 3M4PA 2K5NA 1PH5A 1YJWA 4LF5Q 4R4QA 3A74A 3CW2C 4LUZA 1A62A 2OWOA 3HOYH 1E3PA 2UXDQ 1LTLA 3CMAA 3BZCA 1IBLQ 1E22A 1TWHH 3GTJH 1VQ7A 1YHQA 1X55A 4YHHL 4JI6L 1XNQL 1A63A 3CCMA 1X54A 1CUKA 3T1HL 4GKJL 1Z9FA 2K5VA 4DV1Q 4POGA 4LUVA 2QGQA 4JG2A 3KDFA 4DUYL 1PH7A 1XNRQ 3W1BA 3A5UA 2KHJA 4OO1G 2Q2TA 1QUQA 3HOYG 2DGYA 5IP9H 1EWIA 1L1OC 2KCMA 2YV5A 3G6EA 4LF6L 1N34Q 3UE1A 4GNXA 3M9BA 1JJGA 1E1OA 3KLWA 4NXNL 1VQ6A 3NBHB 4XIGS 2NVYH 4QQBX 3I4NH 4JI5L 1VQ8A 3I4OA 3F2BA 4A3IG 2A19A 1CKMA 4R4CA 2C35B 4A75A 4DAYB 1Q81C 4JI4Q 4DAMA 4C3HH 5IP9G 2YTYA 3NELA 4LUOA 4FDBA 3OTOL 4OX9L 4GN4B 4HIOA 4JI3L 4DR6Q 4RMFA 4LF8Q 3J81j 3FP9A 3I4NG 2BH8A 1UWVA 3DLLA 4DV6L 1EYGA 2WFWA 4K0KQ 4LF9L 5JEAG 4UY8C 4GKJQ 4B3TL 3S2DH 1PH1A 1XMQL 1KQSA 4B3ML 2PQAA 5BR8Q 3EN2A 2KBNA 5M5YH 3L7ZC 3GTOH 1N33L 1YBYA 1XPRA 4HJ7A 1FJGQ 2AHOB 2OQ0A 4QJFA 3PF4A 1OXUA 4NXML 1BBWA 4LF6Q 3GTKH 3HOWG 4PZ8A 1IXRA 3UDGA 1L2FA 2JEAI 3J80i 1Q12A 1CKNA 4YCVA 4IOCA 5HY6A 4DR3L 2NVTH 1K0RA 3HKZG 1Y1VH 4C3IH 3J81i 1J5EL 4GN3B 5AJ3L 2JA5H 1WI5A 4DUZQ 3Q8DA 4JI7L 4A3FH 2OTJA 4LF7Q 1VQBA 1MJEA 2CFMA 1VQFA 3TEHB 1J6QA 1PHJA 4PZ7A 1M90C 1VQ9A 2JA6H 4X65Q 1K8AC 2ZTCA 2ASBA 2UUBL 1QZGA 2YYZA 3F2DA 2OQKA 5IWAQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N32 L;  1G6P A;  2BH2 A;  2VW9 A;  1HZC A;  1Y1V G;  4YCU A;  4A76 A;  3PIP A;  4B3T Q;  1HNZ L;  1FL0 A;  4A3B H;  5DLQ E;  1OXT A;  5IY0 A;  5IP7 H;  2N49 A;  3T1Y L;  2YU9 H;  4B3M Q;  4BXX H;  1V43 A;  1Y1W H;  4LFA L;  3ER0 A;  4APV A;  5LMU L;  3MXN B;  4Y7N H;  4IFD I;  3E0E A;  3HOX G;  5M3F H;  4JYA Q;  2Q2U A;  3H3V I;  5GAD C;  3W5O A;  4DR2 Q;  4DR5 L;  4JI0 L;  3CC7 A;  1PH6 A;  2BA0 A;  1EUJ A;  1P16 A;  4DV7 L;  4WJ4 A;  4HJ8 A;  5IP7 G;  2ID0 A;  4JC0 A;  1HZB A;  2MFI A;  1VQK A;  4ALP A;  4BXX G;  1Y1W G;  3S24 A;  3U50 C;  4JI7 Q;  3CXC A;  1WYD A;  2UUC L;  4JBM A;  5M3F G;  1L1O B;  4X62 L;  4JI1 Q;  2ATW A;  4GKK L;  5JJL A;  2WAQ E;  4A3E G;  1EOV A;  4C2M H;  5GAH C;  3PO3 H;  1K3R A;  4HJ9 A;  2PI2 E;  1SR3 A;  3CPF A;  5C0X I;  1YJN A;  4HIM A;  1IZ6 A;  4AIM A;  3CCE A;  1N32 Q;  2EQS A;  4LWC A;  1HNW L;  1EQQ A;  1KRT A;  4EQ5 A;  5IYB H;  1B8A A;  1X3G A;  5JJI A;  3T1Y Q;  5M3M H;  2A8V A;  1M1K C;  3RZO H;  2R7F A;  3NEM A;  2WB1 E;  3JAM c;  1VCI A;  2PNH A;  4QGU A;  4GLA C;  1PYB A;  3WWV A;  1S40 A;  4JI2 Q;  1N36 Q;  3PO3 G;  3KOJ A;  5J3B A;  5LMN L;  1EQR A;  5E7N A;  4A3J G;  2VQE L;  3I7F A;  3SGI A;  1YIT A;  1GO3 E;  3RNU A;  1YHA A;  4JV5 Q;  4LF4 L;  4DV2 L;  4LNQ A;  2N78 A;  3BZK A;  2KHI A;  4IPC A;  5M5W H;  3G4S A;  4DV7 Q;  4P71 A;  2UXB L;  3M85 A;  1I6H H;  4J15 A;  3M4O H;  4DR7 Q;  1Z47 A;  1KD1 C;  3CCR A;  3K7U C;  4YCW A;  1VQA A;  3PCO B;  1YEZ A;  2GVA A;  1MIU A;  2JA9 A;  4X62 Q;  2OTL A;  1VS0 A;  1G29 1;  4JCV E;  2IHE A;  4DV3 Q;  2E2J H;  3S1N H;  4GOP C;  4R4I A;  2NVX H;  3GTQ H;  2QA4 A;  4JOI C;  4AH6 A;  2EXD A;  2CKZ B;  3G48 A;  1TWC H;  5GRO A;  4A3I H;  4LFB Q;  2F52 A;  4OWT B;  5C4J H;  4LFC Q;  3M7N A;  1A0I A;  3A5Z B;  4B3S L;  1QVF A;  3CCQ A;  3S1R H;  1I3Q H;  3CCL A;  4KHP L;  2MNA A;  2OCE A;  4DPG A;  1XJV A;  2HHH Q;  4WJ3 M;  1PA6 A;  1VQI A;  5C3E H;  4YY3 L;  1DGS A;  2E2I H;  4DR4 Q;  2QEX A;  3BJU A;  4P74 A;  2H5X A;  4DV0 L;  2F4V L;  5M5X H;  3PUZ A;  4X64 Q;  1AE3 A;  2Z6K A;  1E24 A;  4JBK A;  4GLX A;  4DV4 Q;  4A3D H;  4UP7 A;  2UXB Q;  3MEF A;  2R93 G;  1X3E A;  1IBM L;  1GKH A;  4IOA A;  1E7Z A;  4C3J H;  1KRS A;  5FLX c;  1LUZ A;  2DUD A;  1HZ9 A;  1K9M C;  5C3E G;  4OO1 I;  3W1G A;  2AMC B;  5K36 G;  1SN8 A;  3HOW H;  4YHH Q;  4JI6 Q;  1XNQ Q;  3E9I A;  5JJK A;  3T1H Q;  4A3D G;  1YJ9 A;  2IX0 A;  1UE7 A;  1C7Y A;  4DKA C;  4KI0 A;  1XMO L;  1W2B A;  4DUY Q;  1JJ2 A;  1OXV A;  2CWA A;  2HQL A;  1W3S A;  3UDI A;  4B3S Q;  3PO2 G;  1AE2 A;  2VY3 A;  4NPS A;  1Q46 A;  3KJO A;  1P8L A;  5EAY A;  3A0J A;  3PUW A;  4A4I A;  4YY3 Q;  2R7D A;  3RLN A;  1Q1B A;  2ZJP A;  4NXN Q;  3CCU A;  1XPU A;  3RZD H;  4JI5 Q;  1X65 A;  3GTM H;  4JI8 L;  4AYB G;  2UXC L;  1V1Q A;  2AWN A;  2NN6 G;  3D31 A;  3KF6 B;  2RHS B;  3I4M H;  2UUA L;  1VQM A;  3FKI H;  3GDE A;  4IPH A;  1X6O A;  1CSQ A;  3OTO Q;  4QIW E;  2B29 A;  2MO1 A;  3FHW A;  2UU9 L;  1TWF H;  4JI3 Q;  4OX9 Q;  4BBS G;  4B3R L;  1WOC A;  3HOX H;  1X56 A;  2RCN A;  4TQU S;  1B7Y B;  2AWO A;  3KYH C;  4GLV B;  3CPW A;  4DV6 Q;  1K73 C;  1KHI A;  1IBK L;  1OTC A;  4X6A H;  1G51 A;  3J80 c;  2BA1 A;  3U58 A;  2MQH A;  2IT1 A;  4UPA A;  4DK3 C;  1KIX A;  4LF9 Q;  3I4M G;  2ZTE A;  2HIV A;  1HNX L;  3FKI G;  1XMQ Q;  1NJI C;  4DR1 L;  2IY5 B;  2E5L L;  3J81 c;  1RL2 A;  3KFU A;  1EIF A;  3PSI A;  3AYH B;  1FVI A;  2NN6 I;  1N33 Q;  3AEV A;  3RR5 A;  1HH2 P;  3IRB A;  2AKW B;  1B70 B;  4NB3 A;  4NXM Q;  2V1C C;  3K80 C;  3CAM A;  2I5H A;  2LXK A;  4AQY L;  2VQF L;  1Q8K A;  4A3E H;  1ASY A;  3GTP H;  3ICE A;  1I94 L;  4GOP B;  4DK6 C;  1CKO A;  1YI2 A;  1AH9 A;  3PGZ A;  1EFW A;  1WCM H;  3TS0 A;  4TVA B;  4DR3 Q;  1VQO A;  3UDF A;  1PVO A;  1A8V A;  1J5E Q;  1JE5 A;  5AJ3 Q;  1Q7Y C;  1NTG A;  3KF8 B;  1N8R C;  3ULL A;  3H0G G;  1PH9 A;  2ZM6 L;  4DV5 L;  2K14 A;  3RLO A;  4B3R Q;  2N8N A;  2VL6 A;  1YZ6 A;  1EIY B;  2JA8 H;  1ASZ A;  4PZ6 A;  1O7I A;  4PG3 A;  1UE6 A;  1VQP A;  1Q86 C;  2UUB Q;  1WCM G;  5GAG C;  1VQD A;  4A3J H;  1IBK Q;  2KCT A;  1NBW A;  5GAE C;  1C0A A;  1X3F A;  1HNZ Q;  2E2H H;  3TS2 A;  3ZJY C;  4X66 L;  4DR1 Q;  2E5L Q;  2JK8 A;  1PH8 A;  3HKZ E;  3S16 H;  4LFA Q;  5LMU Q;  5FJ8 H;  4O2D A;  2JA8 G;  3GD7 A;  1XPO A;  4UP8 A;  5GQO A;  2ZTD A;  1QUQ B;  3NEN A;  2CQO A;  3TRZ A;  1WJJ A;  3RLF A;  2UXD L;  3KJP A;  2K52 A;  1FGU A;  1IBL L;  4DR5 Q;  4JI0 Q;  3HOV G;  1I94 Q;  4A93 H;  2JE6 I;  1KL9 A;  3S2H H;  3F8T A;  1RIP A;  4POF A;  4OON A;  4OWW B;  3CCJ A;  4H02 A;  3JC6 6;  1YVC A;  4DV1 L;  4R1J A;  4YWK A;  5FJ8 G;  1XNR L;  4MTN A;  4R4O A;  2UUC Q;  2IHF A;  2B63 G;  3PUV A;  1R9T H;  4KLK A;  1VQ4 A;  4GKK Q;  2I5L X;  4UP9 A;  3VDY A;  4A93 G;  5HGQ A;  5ELO A;  5H1S E;  1SRU A;  2ZJR A;  3U4V A;  4GOP A;  2R7Z G;  3TQY A;  2VNU D;  4JOI A;  2RHQ B;  2L15 A;  3CCV A;  3GTG H;  4A3G G;  3EIV A;  1HNW Q;  3CD6 A;  3LGJ A;  1PH3 A;  2D0P A;  4IJL A;  4IFD J;  2R93 H;  4IPD A;  3HKS A;  4OWX B;  1U5K A;  1IL2 A;  2HT1 A;  3ULP A;  2ZJQ A;  5C44 H;  2CWP A;  3J7Z C;  2PQA B;  4PMW A;  3GTL H;  1L1O A;  4LW1 A;  4JI4 L;  2R92 H;  1D7Q A;  3RN5 A;  1OXX K;  2EIF A;  1KXL A;  3D0F A;  4A3L G;  3PUY A;  5IT9 c;  1I5F A;  5LMN Q;  4DR6 L;  3AFP A;  1GVP A;  2Z0S A;  1OXS C;  1H95 A;  1SRO A;  4JBJ A;  2VQE Q;  4LF8 L;  3ULJ A;  5IE8 A;  1KC8 C;  2Q2I A;  4LF4 Q;  4DV2 Q;  3EBE A;  2N3S A;  3E9H A;  1YHB A;  3CCS A;  4K0K L;  4MNO A;  1CKN B;  3TRE A;  4BBR H;  5C44 G;  1KAW A;  4IJH A;  2R92 G;  1SMX A;  1VQH A;  5BR8 L;  2NZH A;  5FLM H;  2Y0S G;  1HR0 L;  3PO2 H;  2B3G A;  5C0X J;  1YIJ A;  1FJG L;  1JB7 A;  1E1T A;  4IPG A;  3HOZ H;  3AFQ A;  2I0Q A;  2Q2H A;  5IYD H;  3S15 H;  4GNX C;  5IYC H;  4KHZ A;  3STB D;  1C9O A;  4L5Q A;  4EX5 A;  1S72 A;  1QVG A;  4BBR G;  4A3K H;  2Z6K C;  1BBU A;  5FLM G;  1LYL A;  3K7A H;  4KHP Q;  2A1A A;  2K4K A;  1HJP A;  2K75 A;  1YNX A;  3I2Z A;  4DUZ L;  4O0A A;  4BBS H;  4LF7 L;  3HOZ G;  4JBW A;  5IYD G;  1WFQ A;  1GM5 A;  4GS3 A;  5IYC G;  1L0W A;  4DV0 Q;  2F4V Q;  4A3C H;  5LMN W;  4X65 L;  1Y14 B;  2RF4 A;  1UE5 A;  2I5M X;  1MKH A;  3HFZ B;  5IWA L;  4A3K G;  1SFO H;  2ES2 A;  1IBM Q;  2NZO A;  2D62 A;  1PV4 A;  3HOU H;  3J7A 5;  3K0X A;  4RG1 A;  4A3M H;  2PMZ E;  1TXY A;  1HR0 Q;  1HZA A;  1JMC A;  2YTV A;  4IO9 A;  3OW2 A;  3L2P A;  3H3V H;  2WAQ G;  2XTI A;  3PF5 A;  1BKB A;  3PIO A;  1K8G A;  3DM3 A;  4A3C G;  3CP0 A;  2PI2 A;  4JYA L;  1JT8 A;  1K83 H;  3CQZ H;  4DR2 L;  1Q1E A;  3OYY A;  1Q82 C;  1XMO Q;  1PH4 A;  3HOU G;  1X9N A;  3I56 A;  4A3M G;  3PV0 A;  1S3O A;  4IFD G;  3H0G H;  1NMG A;  3CC2 A;  3UE0 A;  2WB1 G;  2LXJ A;  1NE3 A;  2MO0 A;  2Y0S E;  1UE1 A;  2E8G A;  4L5S A;  4JI1 L;  1PH2 A;  4BY7 H;  2ALY B;  4ME3 A;  1GD7 A;  4XTC S;  2IX1 A;  2GVB A;  2GN5 A;  2F3I A;  1PFS A;  4JI8 Q;  3F2C A;  4BY1 H;  2UXC Q;  4R4T A;  3CF5 A;  2WP8 J;  1SLJ A;  3STB C;  4QY7 A;  2CCZ A;  2UUA Q;  4BA1 I;  2JA5 G;  2LSS A;  4A3F G;  2HIX A;  4YWM A;  4YWL A;  3ERS X;  3H15 A;  2UU9 Q;  1TWG H;  2JEB I;  2VZA A;  1VQJ A;  1V9P A;  1HR0 W;  3K81 C;  4HJA A;  2K50 A;  5C0X G;  4BY7 G;  1U0L A;  1XTD A;  5C4X H;  3S1Q H;  2JA6 G;  3UDX A;  1N36 L;  3AQQ A;  1VQL A;  4JI2 L;  2KEN A;  4BY1 G;  4DNI A;  3HOV H;  2JJQ A;  4P73 A;  2K5H A;  3S1M H;  1VQE A;  3GO5 A;  3KF6 A;  3BU2 A;  4MZ9 A;  1HNX Q;  1VQ5 A;  1N9W A;  4AYB E;  4JV5 L;  4A3B G;  2JA7 H;  3G71 A;  3U4Z A;  1MJC A;  3KDF B;  1TWA H;  3S17 H;  1NY4 A;  3CME A;  4HJ5 A;  3F1Z A;  3JAM i;  4DR7 L;  4LF5 L;  4BA2 I;  2B63 H;  4Y52 H;  5C4X G;  4AQY Q;  1SE8 A;  1JJC B;  2YTX A;  2VQF Q;  3M4Q A;  2XGT A;  4L5R C;  4GNX B;  3K8A A;  2R7Z H;  4DV3 L;  4HID A;  3PUX A;  3S14 H;  2VUM H;  5JEA J;  4A3G H;  2R6G A;  2JA7 G;  3RN2 A;  1UEB A;  3CC4 A;  3B6Y A;  1VQN A;  4LFB L;  1T9H A;  4L5T A;  4LFC L;  2ZM6 Q;  2D0O A;  4DV5 Q;  4QL5 A;  1VQC A;  1IYJ B;  1CSP A;  3M3Y H;  4P75 A;  2HHH L;  4P72 A;  1N34 L;  4A3L H;  2FXQ A;  4DR4 L;  2VUM G;  2NVQ H;  2JQO A;  1VQG A;  1QVC A;  4GN5 A;  1PYS B;  4X64 L;  1I50 H;  1LM0 A;  5ELN A;  3L0O A;  4X66 Q;  4DV4 L;  4OXP A;  5IYB G;  1NMF A;  1D8L A;  4HIK A;  5M3M G;  2VS1 A;  3I55 A;  1BVS A;  1QZH A;  3M4P A;  2K5N A;  1PH5 A;  1YJW A;  4LF5 Q;  4R4Q A;  3A74 A;  3CW2 C;  4LUZ A;  1A62 A;  2OWO A;  3HOY H;  1E3P A;  2UXD Q;  1LTL A;  3CMA A;  3BZC A;  1IBL Q;  1E22 A;  1TWH H;  3GTJ H;  1VQ7 A;  1YHQ A;  1X55 A;  4YHH L;  4JI6 L;  1XNQ L;  1A63 A;  3CCM A;  1X54 A;  1CUK A;  3T1H L;  4GKJ L;  1Z9F A;  2K5V A;  4DV1 Q;  4POG A;  4LUV A;  2QGQ A;  4JG2 A;  3KDF A;  4DUY L;  1PH7 A;  1XNR Q;  3W1B A;  3A5U A;  2KHJ A;  4OO1 G;  2Q2T A;  1QUQ A;  3HOY G;  2DGY A;  5IP9 H;  1EWI A;  1L1O C;  2KCM A;  2YV5 A;  3G6E A;  4LF6 L;  1N34 Q;  3UE1 A;  4GNX A;  3M9B A;  1JJG A;  1E1O A;  3KLW A;  4NXN L;  1VQ6 A;  3NBH B;  4XIG S;  2NVY H;  4QQB X;  3I4N H;  4JI5 L;  1VQ8 A;  3I4O A;  3F2B A;  4A3I G;  2A19 A;  1CKM A;  4R4C A;  2C35 B;  4A75 A;  4DAY B;  1Q81 C;  4JI4 Q;  4DAM A;  4C3H H;  5IP9 G;  2YTY A;  3NEL A;  4LUO A;  4FDB A;  3OTO L;  4OX9 L;  4GN4 B;  4HIO A;  4JI3 L;  4DR6 Q;  4RMF A;  4LF8 Q;  3J81 j;  3FP9 A;  3I4N G;  2BH8 A;  1UWV A;  3DLL A;  4DV6 L;  1EYG A;  2WFW A;  4K0K Q;  4LF9 L;  5JEA G;  4UY8 C;  4GKJ Q;  4B3T L;  3S2D H;  1PH1 A;  1XMQ L;  1KQS A;  4B3M L;  2PQA A;  5BR8 Q;  3EN2 A;  2KBN A;  5M5Y H;  3L7Z C;  3GTO H;  1N33 L;  1YBY A;  1XPR A;  4HJ7 A;  1FJG Q;  2AHO B;  2OQ0 A;  4QJF A;  3PF4 A;  1OXU A;  4NXM L;  1BBW A;  4LF6 Q;  3GTK H;  3HOW G;  4PZ8 A;  1IXR A;  3UDG A;  1L2F A;  2JEA I;  3J80 i;  1Q12 A;  1CKN A;  4YCV A;  4IOC A;  5HY6 A;  4DR3 L;  2NVT H;  1K0R A;  3HKZ G;  1Y1V H;  4C3I H;  3J81 i;  1J5E L;  4GN3 B;  5AJ3 L;  2JA5 H;  1WI5 A;  4DUZ Q;  3Q8D A;  4JI7 L;  4A3F H;  2OTJ A;  4LF7 Q;  1VQB A;  1MJE A;  2CFM A;  1VQF A;  3TEH B;  1J6Q A;  1PHJ A;  4PZ7 A;  1M90 C;  1VQ9 A;  2JA6 H;  4X65 Q;  1K8A C;  2ZTC A;  2ASB A;  2UUB L;  1QZG A;  2YYZ A;  3F2D A;  2OQK A;  5IWA Q; 
#chains in the Genus database with same CATH topology
 1N32 L;  2BH2 A;  1Y1V G;  4C3I G;  2E2H B;  4DGZ A;  1HNZ L;  5DLQ E;  1OXT A;  5KIX A;  2N49 A;  5FLX L;  4APV A;  4IFD I;  1WTO A;  3H3V C;  4DNR B;  3W5O A;  2EYL A;  1A3V A;  1RKN A;  1PH6 A;  1H9K A;  3IKJ A;  1JWU D;  1RHP A;  3ITP A;  4HJ8 A;  1CA5 A;  4JC0 A;  1HZB A;  1VQK A;  2F0G A;  3NSW A;  2UUC L;  2F0U A;  4XQJ A;  4X62 L;  4JI1 Q;  2ATW A;  4K5V A;  2MJ8 A;  2QDB A;  4RFB A;  1IL8 A;  4HJ9 A;  3GV6 A;  1IZ6 A;  1N32 Q;  1LTR D;  1STE A;  4LWC A;  1HNW L;  4EQ5 A;  2R93 B;  1B8A A;  1X3G A;  1SBB B;  2XRS D;  1RCV D;  2WB1 E;  4WOR A;  3I3C A;  5J3B A;  5LMN L;  4DAP A;  2VQE L;  4DV2 L;  3BZK A;  1B44 D;  2UXB L;  3G4S A;  4P71 A;  4CJ2 C;  1ENC A;  3WDN A;  1JOO A;  1EYC A;  1Z47 A;  1KD1 C;  1D1K A;  1VF5 C;  1VMP A;  3SK8 A;  4QUC A;  1MSG A;  4ZUI A;  1ROD A;  4X62 Q;  2IHE A;  4DV3 Q;  3S1N H;  3T4A C;  4R4I A;  4GOP C;  1JE4 A;  5I4D A;  1GUN A;  2CH4 W;  3G48 A;  2PNR C;  1KTK A;  5C4J H;  4X3T A;  3A5Z B;  3CKI B;  2B2W C;  2LFN A;  2HHH Q;  2X6L A;  4YY3 L;  2AQ1 B;  2QIL A;  2XWB B;  1V1P B;  3PUZ A;  4JBK A;  4G7H C;  1SFO B;  5JEA H;  2UXB Q;  4IOA A;  3S2D B;  4A3M B;  1BCP D;  2DUD A;  4CKE A;  5C3E G;  4RKB A;  3VR6 A;  4XQN A;  1SN8 A;  2EZV A;  3HOW H;  4J1M A;  4JI6 Q;  5JJK A;  4A3D G;  4KI0 A;  2J0T D;  1EWH A;  3FPP A;  3PO2 G;  1HTL D;  3D3R A;  4YY3 Q;  1XPU A;  4NXN Q;  3D6C A;  3ERQ A;  4JI5 Q;  3R8B A;  2R61 A;  4EQO A;  2UUA L;  1NR2 A;  3GDE A;  4N9P A;  2ICI A;  4IPH A;  1CSQ A;  4ABN A;  4BBS G;  2MO1 A;  1ESF A;  3CPW A;  4F87 A;  1SNP A;  2MQH A;  1XMQ Q;  2IY5 B;  2JA7 B;  2E5L L;  3DWQ A;  1G2S A;  1D5X C;  1RL2 A;  4V0B A;  3PSI A;  1TWA B;  2NN6 I;  1N33 Q;  1L0X B;  4PV1 C;  3IRB A;  5K36 G;  4NB3 A;  1LTT D;  4AQY L;  1ASY A;  1TT2 A;  4GOP B;  4I65 A;  3S14 B;  1EFW A;  2VUM B;  5E3F A;  1J8I A;  3TS0 A;  4KN7 C;  1ONL A;  3C1E A;  4HMI A;  3UDF A;  1II3 A;  4KK7 A;  5AJ3 Q;  4LK1 C;  3ERO A;  3ULL A;  3H0G G;  1PH9 A;  5FO9 B;  3QB3 A;  2EXZ A;  3W3A A;  1STN A;  4PZ6 A;  1C48 A;  3OPO A;  1VQP A;  1AZP A;  1SNQ A;  2LKV A;  1A6X A;  1I50 B;  3SHL A;  5ELD A;  1W6K A;  2E5L Q;  1A15 A;  5TSS A;  4O2D A;  1HA6 A;  4FXG C;  4UP8 A;  2CQO A;  3HOY B;  4HCS A;  1ICF B;  1K8O A;  3RLF A;  3PIP 3;  3KUP A;  4ODG A;  3GTJ B;  1NSN S;  2JE6 I;  1KL9 A;  3S2H H;  1RIP A;  1DJR D;  4OON A;  4H02 A;  3GP7 A;  1JOR A;  3NPP A;  4N8F A;  2IHF A;  4CJ0 B;  1I3Q B;  4GKK Q;  1AFP A;  3K58 A;  1F9R A;  5ELO A;  1SRU A;  4GOP A;  2F0F A;  4O1N A;  2RCF A;  1EQV A;  1PH3 A;  4IFD J;  3QOJ A;  3HKS A;  4OWX B;  5I9P A;  1IL2 A;  2BE5 D;  4F88 A;  2B2W A;  5C44 H;  2ZJQ A;  4FF4 A;  3GTL H;  4BS9 A;  4C3H B;  1L1O A;  1SNO A;  2HUG A;  3RN5 A;  1KXL A;  1F77 A;  1ET9 A;  5F2D A;  3DMU A;  4A3L G;  4DR6 L;  3AFP A;  3ULJ A;  1KLG D;  5G3L F;  1KAA A;  1DOK A;  1ET6 A;  5A2Q E;  3CCS A;  4K8I A;  2MUY A;  5I6Y A;  2R92 G;  1SMX A;  3PO2 H;  2NZH A;  2Y0S G;  2K7V A;  1MSH A;  1B3A A;  1FJG L;  3AFQ A;  3S15 H;  3FDT A;  2KEC A;  1B50 A;  3SDZ A;  1DM0 B;  5IYC H;  4KHZ A;  1WTR A;  4K8J A;  4XYO A;  1YNJ C;  4B08 A;  1C9O A;  2K04 A;  5C4H A;  1EIG A;  1CHP D;  2F0N A;  4CKB A;  2H1E A;  5FLM G;  1D2B A;  1SMY C;  4DUZ L;  1HJP A;  1YNX A;  4BBS H;  3HOZ G;  2XSC A;  1GM5 A;  4GS3 A;  1L0W A;  4A3C H;  3DXJ C;  1UE5 A;  1MKH A;  2ES2 A;  4QF4 A;  1IBM Q;  1CHQ D;  4A3B B;  1TII D;  2D62 A;  2HQE A;  3J7A V;  2YU9 B;  3P75 A;  1TXY A;  4IFD H;  1LV9 A;  2YTV A;  3L2P A;  4Y7N B;  2WAQ G;  2XTI A;  3MZ5 A;  3PF5 A;  5M3F B;  1K83 H;  3CQZ H;  2JP1 A;  5ISR A;  1H9M A;  3R3O A;  4K6L A;  4QMG A;  3HOU G;  1RD9 D;  1AZQ A;  1DOL A;  1S3O A;  1QCB D;  3H0G H;  3CC2 A;  1IW7 C;  4FYD A;  4H44 C;  3NTH A;  1MGS A;  5IOC A;  3TDQ A;  4JI8 Q;  1PFS A;  2IWH A;  1B4O A;  5JAV A;  4BA1 I;  4ZKC B;  1Z6H A;  4A3F G;  4CDD C;  3ERS X;  3V96 A;  2JEB I;  4RAU C;  1E2W A;  4IN3 A;  4M1U B;  1HR0 W;  4QB4 A;  2K50 A;  5C0X G;  1U0L A;  1XTD A;  3S1Q H;  2JA6 G;  1PDQ A;  2PZW A;  4BY1 G;  3I8Z A;  3M4Y A;  1LTS D;  3DHQ A;  3BU2 A;  3KF6 A;  4MZ9 A;  1EY4 A;  1AEX A;  3UI2 A;  3G71 A;  1B9M A;  1MJC A;  4ID6 A;  4OIJ A;  3J81 E;  5KNC A;  1NY4 A;  4HJ5 A;  2EDG A;  1JJC B;  1HTP A;  2JSO A;  3EA6 A;  1ILQ A;  3GTG B;  3B6Y A;  1VQN A;  4LFC L;  4QL5 A;  1I4R A;  4P75 A;  2IPK D;  1QNK A;  1WTV A;  4A3L H;  2E2I B;  4KTA A;  1SYE A;  1EOT A;  5M5X B;  1VQG A;  1GUW A;  4KKT A;  1SNM A;  1NMF A;  1D8L A;  3URY A;  1H9J A;  2EYM A;  1QZH A;  3N6R A;  4HR7 B;  1Z7T A;  3J7Y W;  1E22 A;  3MTS A;  1IBL Q;  4I7A A;  1YHQ A;  1BNZ A;  4YHH L;  3CCM A;  4K14 A;  3SVM A;  4GKJ L;  4DV1 Q;  4LUV A;  3CRK C;  1LT4 D;  2CVR A;  2K1B A;  3TSS A;  4OO1 G;  2K01 A;  2Z4H A;  3K7A B;  1STY A;  2DGY A;  1C8C A;  2YV5 A;  5J1Z A;  3G6E A;  4LF6 L;  1LTG D;  1VQ6 A;  3DM1 A;  4QQB X;  1CT1 D;  5D65 A;  3GTM B;  4FF3 A;  3DEP A;  1TU2 B;  3I4O A;  3Q0A A;  4KD3 A;  1CKM A;  3CHB D;  3FKI B;  4CDF C;  2C35 B;  2L5T A;  3OTO L;  1TWF B;  3X3N A;  1CZG A;  2F0Q A;  1X32 A;  4LF8 Q;  2FMM A;  3I4N G;  2WFW A;  4N9T A;  4GKJ Q;  2B2Y C;  4UY8 C;  2P5Z X;  3K5M A;  5FLX E;  3O13 A;  3TP7 A;  5D3I B;  4QJF A;  3PF4 A;  4NXM L;  1DD2 A;  4LF6 Q;  3GV3 A;  1HPC A;  3UDG A;  2JEA I;  2DJF C;  4YCV A;  2NVT H;  5LL6 X;  3ONA B;  4NDX A;  3ND9 A;  2OT2 A;  4A3F H;  4LF7 Q;  1VQB A;  1MJE A;  2CFM A;  2LS0 1;  1KAB A;  4PZ7 A;  2JA6 H;  2UUB L;  2YYZ A;  3F2D A;  1G6P A;  2PW7 A;  1FL0 A;  3KLS A;  3VR5 A;  2TSS A;  2LMC B;  2L4N A;  4BXX H;  1Y1W H;  4C56 C;  1CQV A;  3ER0 A;  3MXN B;  5COR A;  3R93 A;  1I4X A;  4JYA Q;  3H3V I;  3H91 A;  4DR2 Q;  4A93 B;  5I6W A;  4JI0 L;  3CC7 A;  5EPJ A;  1EUJ A;  1P16 A;  4DFA A;  4DV7 L;  5AFW A;  1HFN A;  1HXY D;  2ID0 A;  5ELC A;  3PIO 3;  3S24 A;  2D5D A;  1I4P A;  4TKO B;  3CXC A;  4JBM A;  3M3Y B;  2WAQ E;  4A3E G;  3T51 B;  1EOV A;  4OEL B;  1JWM D;  4C2M H;  5KRU A;  3PO3 H;  2PI2 E;  3CCE A;  2NVQ B;  2EQS A;  2Z4I A;  2L1B A;  2X69 A;  1IYV A;  3JAM c;  4EQN A;  3WWV A;  1S40 A;  4JI2 Q;  3P7J A;  3KOJ A;  4DXG A;  5E7N A;  4DF7 A;  4A3J G;  1YNJ D;  1GO3 E;  3RNU A;  1YHA A;  4JV5 Q;  4LF4 L;  3LWE A;  4LNQ A;  4DV7 Q;  5M5W H;  3M85 A;  4BBR B;  3M4O H;  1SMY D;  4OO1 H;  4YCW A;  1CZW A;  2A69 C;  2OTL A;  3BVG A;  2KCN A;  1ESR A;  2CH4 A;  1G29 1;  4IAL A;  3OWF A;  1A2U A;  2NVX H;  3J7A F;  3GTQ H;  2WKD A;  4AH6 A;  2O5I C;  1TR5 A;  2CKZ B;  2NVY B;  3CRL C;  4A3K B;  4ILW A;  4B3S L;  3CCQ A;  2D2C C;  3S1R H;  4KHP L;  4BWG B;  2GA4 B;  1XJV A;  4WJ3 M;  1EFI D;  2QEX A;  2O2L D;  2K5Q A;  3BJU A;  3K6O A;  4P74 A;  4LMQ D;  4DV0 L;  4QCL A;  4X64 Q;  2Z6K A;  4GLX A;  1STB A;  4UP7 A;  2R93 G;  1X3E A;  1IW7 D;  1KRS A;  1NNX A;  5FLX c;  1HZ9 A;  1VF7 A;  2WB1 B;  4L8J A;  1WD1 A;  2AMC B;  5IGG A;  1XNQ Q;  1ENA A;  3E9I A;  2IJ0 A;  4ZRZ A;  1LT5 D;  1WTQ A;  2IX0 A;  3R2T A;  1UE7 A;  1C7Y A;  2Q8R E;  2B2Y A;  1EY8 A;  1W2B A;  5EKI A;  4DUY Q;  1OXV A;  2HQL A;  4OEM B;  2Q8I B;  2JA5 B;  4B3S Q;  4X3U A;  3FVQ A;  5EAY A;  2E74 C;  4UAI A;  4BY7 B;  2R7D A;  3RLN A;  2ZJP A;  4HTH A;  4L63 B;  4GZY C;  3OMC A;  3NTI A;  2AWN A;  2RHS B;  3I4M H;  3BVM A;  5BN4 A;  1X6O A;  5FO7 B;  4OX9 Q;  3FHW A;  2UU9 L;  4KV6 A;  2XRQ D;  5DNF A;  1IKL A;  2RCN A;  5C4X B;  1U4L A;  4PMC A;  2AWO A;  4KD4 A;  3SK4 A;  4GLV B;  1JOQ A;  4DV6 Q;  1STG A;  4X6A H;  4YIJ A;  4LF9 Q;  2IT1 A;  4DK3 C;  1XYI A;  1KIX A;  2ZTE A;  2F0I A;  1HNX L;  1NJI C;  3KFU A;  1STA A;  5EBC A;  1EIF A;  1DCZ A;  1GXD C;  1PZK D;  2L0C A;  3AU7 A;  5CV7 A;  4IUP A;  2B63 B;  1HUN A;  1B70 B;  1ENF A;  3CAM A;  2I5H A;  4A3E H;  2KVM A;  1WCM H;  3MHB A;  4RCN A;  4TVA B;  4DR3 Q;  3AMU A;  3DWP A;  1A3U A;  1J5E Q;  3MA2 B;  4JW0 A;  1KDB A;  4DV5 L;  2K14 A;  3NK9 A;  3RLO A;  4C1N K;  1V1O A;  1EIY B;  2VL6 A;  2JA8 H;  5G3L D;  1ASZ A;  2SDF A;  4IUQ A;  1S5D D;  1EZ6 A;  5GAG C;  1VQD A;  4A3J H;  3K5O A;  4XQQ A;  1HA5 A;  2KCT A;  5GAE C;  1C0A A;  2EOT A;  1HNZ Q;  2E2H H;  1Y8P B;  3ZJY C;  2B8F A;  1XPO A;  2RDH A;  2ZTD A;  3TRZ A;  1EQT A;  2UXD L;  5CGK A;  4IUV A;  2TMP A;  5EJW A;  2BDO A;  4OWW B;  1B53 A;  3JC6 6;  1YVC A;  4X3S A;  4YWK A;  1XNR L;  4DA2 A;  5C3W A;  4R4O A;  4ZYS A;  2UUC Q;  2I5L X;  3BVZ A;  1FNV A;  4FVM A;  5HGQ A;  1SND A;  4F7X A;  5H1S E;  3U4V A;  2R7Z G;  3TQY A;  2ZXP A;  4K2K A;  2VNU D;  2L15 A;  4A3G G;  1LAB A;  3EIV A;  5E4X A;  1HNW Q;  4RA8 A;  2R93 H;  2VXW A;  4JK1 C;  2PQA B;  4PMW A;  4JI4 L;  2NTS A;  1D7Q A;  1HFG A;  3D0F A;  2MP1 A;  5IT9 c;  5LMN Q;  1TS4 A;  2Z0S A;  3NQI A;  1H95 A;  2VQE Q;  1G8Z D;  3HOW B;  2Q2I A;  3SE0 A;  3BDC A;  4DV2 Q;  3EBE A;  4ME5 A;  4K0K L;  1KNA A;  3VR3 A;  4RGT A;  1CKN B;  5C44 G;  1VQH A;  5BR8 L;  5M5Y B;  2B3G A;  3I91 A;  3GTO B;  4PQX A;  1JB7 A;  1V8Q A;  4PMB A;  5ELF A;  2I0Q A;  2Q2H A;  3QR8 A;  2KOL A;  1F9P A;  3STB D;  1S72 A;  4HAE A;  1QVG A;  3KBX A;  4F8M A;  1Y1V B;  4C3I B;  1BBU A;  1K0S A;  2A1A A;  2K4K A;  4DNT B;  4JBW A;  1AN8 A;  2DN8 A;  2EYH A;  5IYC G;  2L11 A;  4X65 L;  1Y14 B;  2I5M X;  1SFO H;  1U4M A;  2L55 A;  1G91 A;  2PO4 A;  1PV4 A;  1ZYR D;  1SYB A;  4A3M H;  3FPU B;  3OW2 A;  4IO9 A;  2IW3 A;  3H3V H;  1EY6 A;  4A3C G;  1V1P A;  4R8I A;  1Q1E A;  3SK6 A;  4KY6 A;  5CYU A;  3NXW A;  1PH4 A;  4G57 A;  1X9N A;  1DZ1 A;  2AQ2 B;  4IFD G;  4ZUJ A;  3UE0 A;  1M4V A;  4NMZ A;  1NE3 A;  1KNE A;  2E8G A;  2JXM B;  4L5S A;  1PH2 A;  2ALY B;  1R4Q B;  4XTC S;  2IX1 A;  1O7L A;  2GVB A;  3E3X A;  2NBF A;  2ENB A;  2WP8 J;  1WTW A;  2PQE A;  2C9O A;  3HG9 A;  1QB5 D;  4FP5 D;  2UUA Q;  1K3B C;  3TP5 A;  1TY0 A;  5M3M B;  2EY5 A;  3RZO B;  4YWL A;  3H15 A;  1EZ8 A;  3ND8 A;  1V9P A;  5JVG 3;  1N36 L;  1FR3 A;  1Y8O B;  4P73 A;  2NB0 A;  2K5H A;  1VQE A;  3DEO A;  3GO5 A;  4CDE C;  4PNY A;  4RCO A;  4HCE A;  5C4Z A;  2MGS A;  4IZ8 A;  4A3B G;  2JA7 H;  1SDF A;  1I6H B;  1TWA H;  2SOB A;  5IGB A;  4B9X A;  4DR7 L;  1XWE A;  4QIW B;  5E4W C;  4BA2 I;  3TME A;  4AQY Q;  2YTX A;  4FO2 A;  2ZXO A;  4MHE A;  2XGT A;  2E2J B;  2R7Z H;  4HID A;  3PUX A;  3S14 H;  3WOE A;  1IYU A;  1WTX A;  2VUM H;  1HCZ A;  4A3G H;  3C3L A;  1PYW D;  1TWC B;  3CC4 A;  4LFB L;  1SYG A;  2RKS A;  4L5T A;  2D0O A;  1CSP A;  1EIH A;  3K59 A;  4P72 A;  1N34 L;  3NWT A;  2RSO A;  5C3E B;  4DR4 L;  1QVC A;  4GN5 A;  4RH6 A;  4A3D B;  1I50 H;  4EGV A;  3L0O A;  4DV4 L;  4HIK A;  5A35 A;  4CGY B;  5DM7 3;  1UUP A;  1PXU A;  4FNF A;  3I55 A;  1F2Z A;  4FF1 A;  2K5N A;  4P2C B;  1YJW A;  1Y69 U;  1SYD A;  3HOY H;  3C46 A;  1BOS A;  1STH A;  4MIU A;  3GTJ H;  1JIC A;  5LL6 S;  1A63 A;  2F0W A;  1X54 A;  3T1H L;  2SEB D;  3C1F A;  5EKK A;  1Z9F A;  2K5V A;  3HKZ B;  4OGQ C;  2OEO A;  3H09 A;  3X3M A;  2ZXR A;  3A5U A;  2A68 D;  2F0T A;  3A7A B;  2Q2T A;  3SXH A;  3KK7 A;  2KCM A;  1N34 Q;  3UE1 A;  3M9B A;  3TP6 A;  3MVV A;  3RZD B;  3NBH B;  4FXK C;  3ZYY X;  1I4Q A;  4A3I G;  2A19 A;  1SYF A;  5HGT A;  3C2P A;  4DAY B;  1A3T A;  1TQO A;  4DAM A;  4C3H H;  1ZKO A;  4LUO A;  5FO8 B;  4CDC C;  4GN4 B;  3BG3 A;  4JI3 L;  4DR6 Q;  3HOX B;  1B2T A;  1UNS A;  1GHK A;  3J81 j;  1SNC A;  4B3T L;  4LJZ C;  4B3M L;  4C3J G;  2KBN A;  2EJM A;  5D3D A;  4HJ7 A;  1FJG Q;  2AHO B;  2K05 A;  1QG7 A;  2OQ0 A;  4ZLT F;  4QUF A;  2ZT9 C;  2A6H C;  4EVO A;  1QNU A;  4RGN A;  3HEJ A;  5DEH A;  2I46 A;  1K0R A;  4GN3 B;  1TS2 A;  3MXP A;  4DUZ Q;  4OHJ A;  2OTJ A;  2VB3 X;  5ELB A;  1PTO F;  1ML0 D;  1VQF A;  3A8J E;  1M90 C;  1GUO A;  3S1Q B;  2ASB A;  4XT3 B;  1HZC A;  3S9W A;  4YCU A;  4B3T Q;  4A3B H;  3T1Y L;  5IP7 H;  4B3M Q;  1ICW A;  2JYO A;  4DAY A;  2YU9 H;  3S16 B;  1T5E A;  5HUR A;  4LFA L;  5LMU L;  4Y7N H;  3E0E A;  2N88 A;  1SXT A;  3LX0 A;  5M3F H;  4H0L C;  1EY0 A;  1GUG A;  3VYU A;  3J80 E;  4DR5 L;  3HS0 C;  5JPM C;  1FNW A;  2K32 A;  3NQT A;  5EPL A;  4WJ4 A;  5E1F A;  2MFI A;  4BXX G;  4ALP A;  1Y1W G;  2PMZ B;  3U50 C;  1S5E D;  3R2I A;  2M00 A;  1WYD A;  3LNN A;  2EYP A;  3MFY A;  3MAQ A;  1R9T B;  3BS1 A;  2F03 A;  1RTO A;  2PCF B;  1NUC A;  5GAH C;  2H4O A;  1SR3 A;  1YJN A;  4HIM A;  1TS3 A;  1HQR D;  1Y8N B;  3P1H A;  5JJI A;  2O4X A;  3T1Y Q;  3NEM A;  3BZD B;  1E2Z A;  2R92 B;  2PNH A;  2Y0S B;  4K5W A;  4GLA C;  4QGU A;  4HMJ A;  3PO3 G;  4IQZ A;  1EQR A;  3SGI A;  1J9O A;  1EY5 A;  2N78 A;  2KHI A;  3D4R A;  2KCC A;  4J15 A;  1QWY A;  1VQA A;  3HP3 A;  3HOZ B;  4JCV E;  1SJH D;  5CC4 A;  2QA4 A;  4JOI C;  2EXD A;  4AYB B;  4WFN 3;  5GRO A;  4A3I H;  4MTK A;  2F52 A;  4OWT B;  2HCI A;  4LFC Q;  3M7N A;  1A0I A;  4ZKB B;  3CCL A;  1W6J A;  4R9W A;  2MNA A;  2OCE A;  2F0H A;  5EBD A;  4K5X A;  4IUN A;  1VQI A;  3T13 A;  1PA6 A;  2E2I H;  2WAQ B;  5KGU A;  1DOM A;  2H5X A;  1XXG A;  2F4V L;  5M5X H;  1K28 A;  2KED A;  1PLF A;  1E24 A;  3H6M A;  1GJX A;  3MEF A;  3HOU B;  1GKH A;  3EQL C;  4KHV A;  4C3J H;  1H9R A;  3QO2 A;  1K9M C;  1Q8I A;  4YHH Q;  2Z1C A;  3T53 B;  4KN4 C;  1YJ9 A;  4LAA A;  3U9O A;  5JJZ A;  2A6E C;  1XMO L;  1JJ2 A;  2NN6 H;  3UDI A;  2XWJ B;  5EPK A;  1AE2 A;  2VY3 A;  3NHH A;  4NPS A;  1Q46 A;  4DU9 A;  1RJT A;  3PUW A;  4A4I A;  2A5H A;  3CCU A;  1X65 A;  4BY1 B;  3GTM H;  1SEB D;  2UXC L;  1V1Q A;  4DXF A;  3HGB A;  3D31 A;  4KY5 A;  1VQM A;  3FKI H;  3CU7 A;  4UDU C;  1PTO C;  3VYR A;  3OTO Q;  1PRT F;  2B29 A;  1TWG B;  1EYA A;  1TWF H;  4Q5V A;  1X56 A;  1UEA B;  3D4D A;  4TQU S;  4RGO S;  1SAP A;  1K73 C;  2K5W A;  3HOV B;  1KHI A;  1IBK L;  3A56 A;  1OTC A;  3S1M B;  3VYS A;  1G51 A;  4XDX A;  2BA1 A;  2DNE A;  3A54 A;  4UPA A;  3J80 c;  3I4M G;  2J7Z A;  2I07 B;  2AQ3 B;  5LHY 1;  4DR1 L;  3J81 c;  3S17 B;  4DN4 M;  1FVI A;  3AEV A;  3RR5 A;  1HH2 P;  5FK9 C;  2AKW B;  4NXM Q;  2V1C C;  3GTP H;  2VQF L;  3ICE A;  4DAV A;  1U4P A;  1I94 L;  1CKO A;  5KND A;  1MBY A;  1VQO A;  1PVO A;  1A8V A;  1JE5 A;  5D14 A;  1NTG A;  2ZM6 L;  3TZU A;  2N8N A;  1CK1 A;  5IGF A;  2EVB A;  2EJF C;  2AUJ D;  1Q86 C;  4U68 A;  2UUB Q;  1WCM G;  1IBK Q;  5BN5 A;  4CKC A;  1X3F A;  5DAU A;  1QOH A;  2RSN A;  3TS2 A;  4X66 L;  4DR1 Q;  5M5W B;  5T1G A;  5FJ8 H;  2JA8 G;  1HUM A;  5GQO A;  1QUQ B;  1I6V C;  1KDA A;  2F1M A;  1WJJ A;  3VR2 A;  1PZI D;  1T5X D;  1TWH B;  4JI0 Q;  4A93 H;  1I94 Q;  2C5C A;  2NVX B;  2QDL A;  1LT3 D;  2RVL A;  1SSO A;  3Q23 A;  3CCJ A;  5I9O A;  1BQQ T;  4R1J A;  2D9U A;  1OO9 B;  2KHS A;  3MXN A;  5JOB A;  2EY6 A;  5CMD A;  1GUT A;  2CQA A;  2A74 C;  4KY7 A;  2B63 G;  1RF2 D;  3PUV A;  5J22 A;  4KLK A;  1VQ4 A;  1CFM A;  1BXT A;  1TY2 A;  1AW7 A;  4JOI A;  2RHQ B;  3I4N B;  2F3V A;  3CCV A;  5KYI A;  4G7O C;  3CD6 A;  1RDP D;  3LGJ A;  1VMC A;  4ZCK A;  1S5B D;  2SNM A;  2HT1 A;  1U5K A;  2B8G A;  1PTO B;  3ULP A;  3VYT A;  2CWP A;  3J7Z C;  1JB3 A;  4LW1 A;  2EIF A;  1I5F A;  1GVP A;  2A6H D;  1JOK A;  1OXS C;  1SYC A;  3D8G A;  1SRO A;  4JBJ A;  5IE8 A;  3KLR A;  4LF4 Q;  1NAP A;  2N3S A;  3E9H A;  3EFX D;  1I4G A;  1HRJ A;  4BBR H;  1KAW A;  4IJH A;  1CM9 A;  1XTC D;  3IAY A;  1YIJ A;  1LO5 D;  4IPG A;  3GTK B;  5IYD H;  4GNX C;  2KA7 A;  1LLR D;  1WTH A;  5I2Y A;  1O7Y A;  4A3K H;  5IGC A;  3K0Y A;  1LYL A;  3N52 A;  4KHP Q;  2HD3 A;  3JAM L;  1I4H A;  4NKL A;  5EKL A;  3VR4 A;  4DV0 Q;  4HN7 A;  5LMN W;  3I72 A;  2RF4 A;  5IWA L;  4C1N I;  1EYD A;  4HED A;  1NR4 A;  3J7A 5;  1PRT C;  3I73 A;  4XYQ A;  3F2U A;  1HHV A;  1BKB A;  4A3E B;  4L6T B;  3OYY A;  2X6G A;  4A3M G;  2FHT A;  3PV0 A;  1NMG A;  1DXM A;  2SNS A;  1GOZ A;  1WTP A;  2DJG C;  3OW7 A;  2F0D A;  5CV6 A;  5T1I A;  4JI1 L;  1FGB D;  2VB2 X;  4BY7 H;  1S5F D;  4ME3 A;  1GD7 A;  1LT6 D;  2GN5 A;  5KYL A;  2F3I A;  2EYJ A;  2F0L A;  4R4T A;  4EQP A;  2CCZ A;  3BYT B;  2LSS A;  1TVX A;  4YWM A;  2UU9 Q;  4I7Z C;  4KKU A;  1VQJ A;  2MHV A;  4HJA A;  5C4X H;  3Q6S A;  3UDX A;  2KEN A;  4DNI A;  3K5L A;  2JJQ A;  3A7L A;  1HNX Q;  3T56 B;  1IHZ A;  3U4Z A;  1YNN C;  3KDF B;  4KKS A;  3CME A;  3F1Z A;  3JAM i;  2WKC A;  2B63 H;  2CHB D;  1FNU A;  4GNX B;  3S1N B;  4DV3 L;  2E75 C;  5JEA J;  2JA7 G;  3IFT A;  3RN2 A;  1UEB A;  5CV4 A;  3MWY W;  1T9H A;  1JQY D;  1DYQ A;  5C4J B;  4DV5 Q;  4G4K A;  1M8A A;  3A8I E;  1IYJ B;  2HHH L;  2FXQ A;  5C5M A;  3QOL A;  2VUM G;  2A6E D;  1PYS B;  4NW2 A;  1CTM A;  1EY7 A;  4OXP A;  1O80 A;  2F0J A;  3SK5 A;  5IYB G;  1U4R A;  1PRT B;  5M3M G;  2VS1 A;  1BVS A;  3RMH A;  4R4Q A;  3A74 A;  1WD0 A;  1A62 A;  2OWO A;  1E3P A;  1LTI D;  2UXD Q;  2KJX A;  1VQ7 A;  3BDL A;  2QEJ C;  4JI6 L;  1F2M A;  2KEE A;  1CUK A;  4N8X 1;  1FD7 D;  1SE4 A;  2DY7 A;  2QGQ A;  3KDF A;  2G9H D;  1PTO D;  3W1B A;  1XNR Q;  2KHJ A;  3TZD A;  3HOY G;  2NYZ D;  5IP9 H;  1L1O C;  3D6W A;  4GNX A;  1JJG A;  1E1O A;  4NXN L;  2DY8 A;  1EU4 A;  3MXG A;  2HDM A;  4JI5 L;  1VQ8 A;  3F2B A;  3NWS A;  4R4C A;  4RWS C;  4A75 A;  4JI4 Q;  2YTY A;  1D1I A;  2EJG C;  3DUZ A;  4IUR A;  2NUC A;  1X3P A;  3FP9 A;  2BH8 A;  1EYG A;  4K0K Q;  2OXP A;  4KJO A;  3S2D H;  3G7L A;  4RKL A;  1XMQ L;  2F0K A;  1KQS A;  2PQA A;  3NUC A;  5BR8 Q;  2Z8L A;  4C3H G;  1GHJ A;  1JWS D;  3L7Z C;  5M5Y H;  3GTO H;  1N33 L;  1YBY A;  1BBW A;  2PZU A;  4PZ8 A;  1IXR A;  1EU3 A;  3IL8 A;  1CKN A;  3V05 A;  4H13 C;  3HKZ G;  1Y1V H;  4C3I H;  1VDZ A;  1ZXT A;  2K5D A;  5AJ3 L;  1WI5 A;  4JI7 L;  3Q8D A;  1PFB A;  1UAP A;  3HRZ C;  1QE6 A;  1J6Q A;  3QWN A;  1EL0 A;  4X65 Q;  1F2L A;  1K8A C;  5IT9 L;  1QZG A;  2F4I A;  2OQK A;  1BDO A;  2VW9 A;  3MEH A;  4A76 A;  3PIP A;  4G7Z C;  1DON A;  5IY0 A;  1V43 A;  2A69 D;  1BUV T;  3HOX G;  2Q2U A;  5GAD C;  2L12 A;  1R4P B;  3KLS X;  2R7Z B;  2EY2 A;  3S2H B;  2BA0 A;  4RHR A;  5CBA E;  4A3G B;  5IP7 G;  5NUC A;  2MPM A;  4JI7 Q;  4OIK A;  1E0B A;  2B2T C;  2XIW A;  3I90 A;  1L1O B;  5M3F G;  4GKK L;  5JJL A;  2QKI C;  2EYF A;  2OF1 A;  5IIF A;  1K3R A;  4HSP A;  3CPF A;  5C0X I;  2B2U C;  4TSS A;  4AIM A;  3U9S A;  1B9N A;  3A8K E;  1EQQ A;  1KRT A;  5IYB H;  3SR1 A;  2A8V A;  5M3M H;  1M1K C;  5C44 B;  3RZO H;  2R7F A;  3GTL B;  1VCI A;  1PYB A;  3HZX A;  2AUK A;  1N36 Q;  4X3K A;  2L9H A;  3PQI A;  2HDL A;  3I7F A;  1YIT A;  3L9A X;  4IPC A;  2Z6B A;  1I6H H;  1SE3 A;  3FEW X;  5I2X A;  1NCV A;  4DR7 Q;  2RDF A;  3PO2 B;  3CCR A;  3K7U C;  3PCO B;  1E2V A;  1YEZ A;  2GVA A;  1MIU A;  2JA9 A;  1VS0 A;  4TRD A;  4CHT B;  2E2J H;  3S15 B;  2NZ1 D;  2K33 A;  3QG1 A;  3OIQ A;  1TWC H;  3QIA A;  4LFB Q;  1PRT D;  2RA4 A;  1QVF A;  1I3Q H;  2RQX A;  1RTN A;  1LTA D;  4DPG A;  4BBS B;  3D4W A;  5IOD A;  5C3E H;  3OMG A;  1DGS A;  4DR4 Q;  3NP8 A;  1AE3 A;  1ZEQ X;  4O42 A;  4A3D H;  4DV4 Q;  1IBM L;  2FIN B;  3L3O C;  1E7Z A;  2IX3 A;  3W2D A;  5EGT A;  1LUZ A;  4S3S A;  5M9O A;  2NWG A;  4OO1 I;  3W1G A;  2JN4 A;  2K6A A;  1HQM C;  1TS5 A;  4DK0 A;  1K83 B;  3CQZ B;  1SJE D;  3T1H Q;  4FF2 A;  4DKA C;  3I4L A;  3WOF A;  4OL7 A;  4XXE A;  2CWA A;  1A2T A;  3MXU A;  1F2Y A;  1W3S A;  3DWA A;  3H94 A;  3H0G B;  2NTT A;  1LTB D;  1B3Q A;  1D6E C;  2LY7 A;  3KJO A;  1P8L A;  2WIN B;  3A0J A;  1Q1B A;  3QJY A;  1PFN A;  3RZD H;  5CR3 A;  4JI8 L;  1JC7 A;  4AYB G;  1CI3 M;  2NN6 G;  1S5C D;  2KQ3 A;  3KF6 B;  1YNN D;  1X3Q A;  4CJ1 B;  1EEI D;  4ZAI A;  4QIW E;  4B3R L;  4H7B A;  2B2V C;  4JI3 Q;  1Q3L A;  1WOC A;  2EYO A;  3HOX H;  1WVL A;  5K36 H;  1B7Y B;  3KYH C;  3NBH A;  2QW7 A;  3U58 A;  2F0M A;  5C6A A;  4UHV A;  2HIV A;  1B1Z A;  2CW0 C;  3FKI G;  4KJN A;  3OHX C;  3AYH B;  3SEB A;  4JPB W;  1QIL A;  3K80 C;  1BCP F;  2K28 A;  2LXK A;  3T16 A;  1Q8K A;  4DK6 C;  1YI2 A;  1AH9 A;  1JR0 D;  3PGZ A;  3KBG A;  1BO0 A;  2DNC A;  3BYY B;  1Q7Y C;  1N8R C;  3KF8 B;  2B2T A;  1PZJ D;  1EY9 A;  5FOB B;  4B3R Q;  4R8N A;  1YZ6 A;  3FRP B;  1O7I A;  2EPB A;  3OOC A;  1KDC A;  4PG3 A;  1UE6 A;  3MC0 B;  2B2U A;  2PPB C;  1NBW A;  1O7Z A;  3M7G A;  2JK8 A;  1JCK B;  3HKZ E;  5IGE A;  1MHW C;  1PH8 A;  1D5M C;  3S16 H;  4LFA Q;  4ZK9 B;  5LMU Q;  5K5P A;  3GD7 A;  4IUU A;  3NEN A;  2FFK B;  2FMC A;  1FYC A;  4E6I A;  1CQF A;  3KJP A;  1K8M A;  1FGU A;  2K52 A;  4DR5 Q;  1IBL L;  3HOV G;  3RUZ A;  3F8T A;  3VA7 A;  4POF A;  2ICE C;  4Q0F A;  2G9D A;  4DV1 L;  4A3I B;  5FJ8 G;  4MTN A;  1R9T H;  4UP9 A;  3VDY A;  4A93 G;  2ZJR A;  2BOS A;  4ULL A;  2Z9H A;  3K5N A;  3GTG H;  2D0P A;  4IJL A;  2R3Z A;  3KF8 A;  5COY A;  4IPD A;  3EVQ A;  5DM6 3;  2M9V A;  4C3J B;  2FJ2 A;  2WII B;  2R92 H;  3JAM E;  1Q90 A;  1OXX K;  1QJO A;  2Q8T A;  2IL8 A;  3PUY A;  1MD2 D;  1MI2 A;  3Q22 A;  2E76 C;  4LF8 L;  1KC8 C;  4JVZ A;  2BDN A;  4RGM A;  4WRD A;  1YHB A;  2J4X A;  4MNO A;  3TRE A;  5BN3 A;  5FLM H;  1HR0 L;  4CBV A;  5C0X J;  2PYK A;  3HOZ H;  1E1T A;  2F0S A;  2E2D C;  1O78 A;  4L5Q A;  4EX5 A;  3OIP A;  4BBR G;  2NVT B;  4J8Q A;  2XNA C;  2Z6K C;  1BF4 A;  1H9S B;  2RDG A;  3K7A H;  4A3F B;  3RD4 A;  3I2Z A;  1U9R A;  2K75 A;  4O0A A;  4RHS A;  4LF7 L;  4HSV A;  5IYD G;  1WFQ A;  4FXD A;  2JA6 B;  2F4V Q;  2K03 A;  1BR9 A;  4A3K G;  3HFZ B;  3K57 A;  2NZO A;  3HOU H;  5A2Q L;  3K0X A;  4RG1 A;  5CBE E;  3IFD A;  2PMZ E;  4KMU C;  1JMC A;  1HR0 Q;  1HZA A;  1Y1W B;  1XX8 A;  2B2V A;  3PIO A;  1K8G A;  3DM3 A;  1G2T A;  4U67 3;  3CP0 A;  2PI2 A;  4JYA L;  3GTP B;  1JT8 A;  2PZT A;  4DR2 L;  4Z9C B;  5IGD A;  1Q82 C;  1F9S A;  3G6J B;  1SE2 A;  1XMO Q;  2G5D A;  3I56 A;  3I70 A;  2WB1 G;  2LXJ A;  1BCP C;  5JPN C;  2MO0 A;  1F9Q A;  1CA6 A;  2Y0S E;  1UE1 A;  3NTK A;  5C0X H;  4C2M B;  3PO3 B;  3E0J A;  1EEF D;  3F2C A;  4BY1 H;  2KUM A;  2UXC Q;  3CF5 A;  4B9W A;  1SLJ A;  3STB C;  4QY7 A;  3TN2 A;  1H9S A;  3TBI B;  2JA5 G;  1ILP A;  5CV9 A;  3MFG A;  2HIX A;  2EY1 A;  1TWG H;  2VZA A;  5EQ0 A;  3LWU A;  1IKM A;  3K81 C;  4BY7 G;  4K6D A;  2XN9 C;  3AQQ A;  1VQL A;  4JI2 L;  3HOV H;  1LAC A;  3S1M H;  3EJI A;  1G6Z A;  1VQ5 A;  4JV5 L;  1PMR A;  1N9W A;  3E5S A;  3OSO A;  4AYB E;  1PFM A;  3NBI A;  2F0P A;  3M4O B;  3S17 H;  1ZYR C;  4LF5 L;  4Y52 H;  5C4X G;  1SE8 A;  2VQF Q;  3VA5 A;  1GUS A;  3M4Q A;  4L5R C;  4DK1 A;  3K8A A;  2A73 B;  3GTQ B;  5C5L A;  2R6G A;  3V2T A;  2ZM6 Q;  2XVS A;  2M2L A;  3S1R B;  1VQC A;  3M3Y H;  3NE5 B;  1TKW B;  2NVQ H;  1KLU D;  2JQO A;  2QF7 A;  4X64 L;  1LM0 A;  4K2L A;  5ELN A;  5JVH 3;  3J80 L;  4X66 Q;  5FKA C;  3Q24 A;  5L37 A;  2F0O A;  3J81 L;  1PH5 A;  3M4P A;  4LF5 Q;  3CW2 C;  4LUZ A;  2EE1 A;  1LTL A;  3CMA A;  3BZC A;  1TWH H;  1X55 A;  1XNQ L;  4NP5 A;  5ELE A;  3P20 A;  4POG A;  2RBM A;  4JG2 A;  1PH7 A;  4DUY L;  2V4D A;  1S4Z A;  2QCP X;  4IUT A;  3TP8 A;  1BCP B;  1QUQ A;  2N55 A;  2WV6 D;  1C4Q A;  1EWI A;  2PW5 A;  5C3X A;  3KLW A;  4XIG S;  2NVY H;  3I4N H;  2HCC A;  2CW0 D;  2F0E A;  3I4M B;  2BCO A;  2B39 A;  5KEE A;  1PTO H;  1Q81 C;  5IP9 G;  3NEL A;  4FDB A;  4OX9 L;  4HIO A;  5IT9 E;  4RMF A;  2WAC A;  1UWV A;  3DLL A;  4DV6 L;  1AP0 A;  3BDO A;  3PMF A;  4LF9 L;  5JEA G;  5J39 A;  4V19 0;  1PH1 A;  3EN2 A;  4ZQ3 A;  5CV5 A;  2BE5 C;  3A55 A;  1L0Y B;  1XPR A;  3E6Z X;  4WJW A;  1OXU A;  3GTK H;  3HOW G;  1L2F A;  3J80 i;  1Q12 A;  1WCM B;  4IOC A;  5KNB A;  3AB9 A;  5HY6 A;  1EWC A;  4DR3 L;  3J81 i;  1J5E L;  2JA5 H;  4M8A A;  3GQB A;  1D5Z C;  3FMC A;  3OWE B;  2F0V A;  2A68 C;  4MN3 A;  1BBX C;  2F3W A;  2JA8 B;  3TEH B;  1VQ9 A;  5CV8 A;  1PHJ A;  2O5J C;  2ZTC A;  4A3J B;  4XT1 B;  4J6H A;  5IWA Q; 
#chains in the Genus database with same CATH homology
 1N32 L;  1G6P A;  2BH2 A;  2VW9 A;  1HZC A;  1Y1V G;  4YCU A;  4A76 A;  3PIP A;  4B3T Q;  1HNZ L;  1FL0 A;  4A3B H;  5DLQ E;  1OXT A;  5IY0 A;  5IP7 H;  2N49 A;  3T1Y L;  2YU9 H;  4B3M Q;  4BXX H;  1V43 A;  1Y1W H;  4LFA L;  3ER0 A;  4APV A;  5LMU L;  3MXN B;  4Y7N H;  4IFD I;  3E0E A;  3HOX G;  5M3F H;  4JYA Q;  2Q2U A;  3H3V I;  5GAD C;  3W5O A;  4DR2 Q;  4DR5 L;  4JI0 L;  3CC7 A;  1PH6 A;  2BA0 A;  1EUJ A;  1P16 A;  4DV7 L;  4WJ4 A;  4HJ8 A;  5IP7 G;  2ID0 A;  4JC0 A;  1HZB A;  2MFI A;  1VQK A;  4ALP A;  4BXX G;  1Y1W G;  3S24 A;  3U50 C;  4JI7 Q;  3CXC A;  1WYD A;  2UUC L;  4JBM A;  5M3F G;  1L1O B;  4X62 L;  4JI1 Q;  2ATW A;  4GKK L;  5JJL A;  2WAQ E;  4A3E G;  1EOV A;  4C2M H;  5GAH C;  3PO3 H;  1K3R A;  4HJ9 A;  2PI2 E;  1SR3 A;  3CPF A;  5C0X I;  1YJN A;  4HIM A;  1IZ6 A;  4AIM A;  3CCE A;  1N32 Q;  2EQS A;  4LWC A;  1HNW L;  1EQQ A;  1KRT A;  4EQ5 A;  5IYB H;  1B8A A;  1X3G A;  5JJI A;  3T1Y Q;  5M3M H;  2A8V A;  1M1K C;  3RZO H;  2R7F A;  3NEM A;  2WB1 E;  3JAM c;  1VCI A;  2PNH A;  4QGU A;  4GLA C;  1PYB A;  3WWV A;  1S40 A;  4JI2 Q;  1N36 Q;  3PO3 G;  3KOJ A;  5J3B A;  5LMN L;  1EQR A;  5E7N A;  4A3J G;  2VQE L;  3I7F A;  3SGI A;  1YIT A;  1GO3 E;  3RNU A;  1YHA A;  4JV5 Q;  4LF4 L;  4DV2 L;  4LNQ A;  2N78 A;  3BZK A;  2KHI A;  4IPC A;  5M5W H;  3G4S A;  4DV7 Q;  4P71 A;  2UXB L;  3M85 A;  1I6H H;  4J15 A;  3M4O H;  4DR7 Q;  1Z47 A;  1KD1 C;  3CCR A;  3K7U C;  4YCW A;  1VQA A;  3PCO B;  1YEZ A;  2GVA A;  1MIU A;  2JA9 A;  4X62 Q;  2OTL A;  1VS0 A;  1G29 1;  4JCV E;  2IHE A;  4DV3 Q;  2E2J H;  3S1N H;  4GOP C;  4R4I A;  2NVX H;  3GTQ H;  2QA4 A;  4JOI C;  4AH6 A;  2EXD A;  2CKZ B;  3G48 A;  1TWC H;  5GRO A;  4A3I H;  4LFB Q;  2F52 A;  4OWT B;  5C4J H;  4LFC Q;  3M7N A;  1A0I A;  3A5Z B;  4B3S L;  1QVF A;  3CCQ A;  3S1R H;  1I3Q H;  3CCL A;  4KHP L;  2MNA A;  2OCE A;  4DPG A;  1XJV A;  2HHH Q;  4WJ3 M;  1PA6 A;  1VQI A;  5C3E H;  4YY3 L;  1DGS A;  2E2I H;  4DR4 Q;  2QEX A;  3BJU A;  4P74 A;  2H5X A;  4DV0 L;  2F4V L;  5M5X H;  3PUZ A;  4X64 Q;  1AE3 A;  2Z6K A;  1E24 A;  4JBK A;  4GLX A;  4DV4 Q;  4A3D H;  4UP7 A;  2UXB Q;  3MEF A;  2R93 G;  1X3E A;  1IBM L;  1GKH A;  4IOA A;  1E7Z A;  4C3J H;  1KRS A;  5FLX c;  1LUZ A;  2DUD A;  1HZ9 A;  1K9M C;  5C3E G;  4OO1 I;  3W1G A;  2AMC B;  5K36 G;  1SN8 A;  3HOW H;  4YHH Q;  4JI6 Q;  1XNQ Q;  3E9I A;  5JJK A;  3T1H Q;  4A3D G;  1YJ9 A;  2IX0 A;  1UE7 A;  1C7Y A;  4DKA C;  4KI0 A;  1XMO L;  1W2B A;  4DUY Q;  1JJ2 A;  1OXV A;  2CWA A;  2HQL A;  1W3S A;  3UDI A;  4B3S Q;  3PO2 G;  1AE2 A;  2VY3 A;  4NPS A;  1Q46 A;  3KJO A;  1P8L A;  5EAY A;  3A0J A;  3PUW A;  4A4I A;  4YY3 Q;  2R7D A;  3RLN A;  1Q1B A;  2ZJP A;  4NXN Q;  3CCU A;  1XPU A;  3RZD H;  4JI5 Q;  1X65 A;  3GTM H;  4JI8 L;  4AYB G;  2UXC L;  1V1Q A;  2AWN A;  2NN6 G;  3D31 A;  3KF6 B;  2RHS B;  3I4M H;  2UUA L;  1VQM A;  3FKI H;  3GDE A;  4IPH A;  1X6O A;  1CSQ A;  3OTO Q;  4QIW E;  2B29 A;  2MO1 A;  3FHW A;  2UU9 L;  1TWF H;  4JI3 Q;  4OX9 Q;  4BBS G;  4B3R L;  1WOC A;  3HOX H;  1X56 A;  2RCN A;  4TQU S;  1B7Y B;  2AWO A;  3KYH C;  4GLV B;  3CPW A;  4DV6 Q;  1K73 C;  1KHI A;  1IBK L;  1OTC A;  4X6A H;  1G51 A;  3J80 c;  2BA1 A;  3U58 A;  2MQH A;  2IT1 A;  4UPA A;  4DK3 C;  1KIX A;  4LF9 Q;  3I4M G;  2ZTE A;  2HIV A;  1HNX L;  3FKI G;  1XMQ Q;  1NJI C;  4DR1 L;  2IY5 B;  2E5L L;  3J81 c;  1RL2 A;  3KFU A;  1EIF A;  3PSI A;  3AYH B;  1FVI A;  2NN6 I;  1N33 Q;  3AEV A;  3RR5 A;  1HH2 P;  3IRB A;  2AKW B;  1B70 B;  4NB3 A;  4NXM Q;  2V1C C;  3K80 C;  3CAM A;  2I5H A;  2LXK A;  4AQY L;  2VQF L;  1Q8K A;  4A3E H;  1ASY A;  3GTP H;  3ICE A;  1I94 L;  4GOP B;  4DK6 C;  1CKO A;  1YI2 A;  1AH9 A;  3PGZ A;  1EFW A;  1WCM H;  3TS0 A;  4TVA B;  4DR3 Q;  1VQO A;  3UDF A;  1PVO A;  1A8V A;  1J5E Q;  1JE5 A;  5AJ3 Q;  1Q7Y C;  1NTG A;  3KF8 B;  1N8R C;  3ULL A;  3H0G G;  1PH9 A;  2ZM6 L;  4DV5 L;  2K14 A;  3RLO A;  4B3R Q;  2N8N A;  2VL6 A;  1YZ6 A;  1EIY B;  2JA8 H;  1ASZ A;  4PZ6 A;  1O7I A;  4PG3 A;  1UE6 A;  1VQP A;  1Q86 C;  2UUB Q;  1WCM G;  5GAG C;  1VQD A;  4A3J H;  1IBK Q;  2KCT A;  1NBW A;  5GAE C;  1C0A A;  1X3F A;  1HNZ Q;  2E2H H;  3TS2 A;  3ZJY C;  4X66 L;  4DR1 Q;  2E5L Q;  2JK8 A;  1PH8 A;  3HKZ E;  3S16 H;  4LFA Q;  5LMU Q;  5FJ8 H;  4O2D A;  2JA8 G;  3GD7 A;  1XPO A;  4UP8 A;  5GQO A;  2ZTD A;  1QUQ B;  3NEN A;  2CQO A;  3TRZ A;  1WJJ A;  3RLF A;  2UXD L;  3KJP A;  2K52 A;  1FGU A;  1IBL L;  4DR5 Q;  4JI0 Q;  3HOV G;  1I94 Q;  4A93 H;  2JE6 I;  1KL9 A;  3S2H H;  3F8T A;  1RIP A;  4POF A;  4OON A;  4OWW B;  3CCJ A;  4H02 A;  3JC6 6;  1YVC A;  4DV1 L;  4R1J A;  4YWK A;  5FJ8 G;  1XNR L;  4MTN A;  4R4O A;  2UUC Q;  2IHF A;  2B63 G;  3PUV A;  1R9T H;  4KLK A;  1VQ4 A;  4GKK Q;  2I5L X;  4UP9 A;  3VDY A;  4A93 G;  5HGQ A;  5ELO A;  5H1S E;  1SRU A;  2ZJR A;  3U4V A;  4GOP A;  2R7Z G;  3TQY A;  2VNU D;  4JOI A;  2RHQ B;  2L15 A;  3CCV A;  3GTG H;  4A3G G;  3EIV A;  1HNW Q;  3CD6 A;  3LGJ A;  1PH3 A;  2D0P A;  4IJL A;  4IFD J;  2R93 H;  4IPD A;  3HKS A;  4OWX B;  1U5K A;  1IL2 A;  2HT1 A;  3ULP A;  2ZJQ A;  5C44 H;  2CWP A;  3J7Z C;  2PQA B;  4PMW A;  3GTL H;  1L1O A;  4LW1 A;  4JI4 L;  2R92 H;  1D7Q A;  3RN5 A;  1OXX K;  2EIF A;  1KXL A;  3D0F A;  4A3L G;  3PUY A;  5IT9 c;  1I5F A;  5LMN Q;  4DR6 L;  3AFP A;  1GVP A;  2Z0S A;  1OXS C;  1H95 A;  1SRO A;  4JBJ A;  2VQE Q;  4LF8 L;  3ULJ A;  5IE8 A;  1KC8 C;  2Q2I A;  4LF4 Q;  4DV2 Q;  3EBE A;  2N3S A;  3E9H A;  1YHB A;  3CCS A;  4K0K L;  4MNO A;  1CKN B;  3TRE A;  4BBR H;  5C44 G;  1KAW A;  4IJH A;  2R92 G;  1SMX A;  1VQH A;  5BR8 L;  2NZH A;  5FLM H;  2Y0S G;  1HR0 L;  3PO2 H;  2B3G A;  5C0X J;  1YIJ A;  1FJG L;  1JB7 A;  1E1T A;  4IPG A;  3HOZ H;  3AFQ A;  2I0Q A;  2Q2H A;  5IYD H;  3S15 H;  4GNX C;  5IYC H;  4KHZ A;  3STB D;  1C9O A;  4L5Q A;  4EX5 A;  1S72 A;  1QVG A;  4BBR G;  4A3K H;  2Z6K C;  1BBU A;  5FLM G;  1LYL A;  3K7A H;  4KHP Q;  2A1A A;  2K4K A;  1HJP A;  2K75 A;  1YNX A;  3I2Z A;  4DUZ L;  4O0A A;  4BBS H;  4LF7 L;  3HOZ G;  4JBW A;  5IYD G;  1WFQ A;  1GM5 A;  4GS3 A;  5IYC G;  1L0W A;  4DV0 Q;  2F4V Q;  4A3C H;  5LMN W;  4X65 L;  1Y14 B;  2RF4 A;  1UE5 A;  2I5M X;  1MKH A;  3HFZ B;  5IWA L;  4A3K G;  1SFO H;  2ES2 A;  1IBM Q;  2NZO A;  2D62 A;  1PV4 A;  3HOU H;  3J7A 5;  3K0X A;  4RG1 A;  4A3M H;  2PMZ E;  1TXY A;  1HR0 Q;  1HZA A;  1JMC A;  2YTV A;  4IO9 A;  3OW2 A;  3L2P A;  3H3V H;  2WAQ G;  2XTI A;  3PF5 A;  1BKB A;  3PIO A;  1K8G A;  3DM3 A;  4A3C G;  3CP0 A;  2PI2 A;  4JYA L;  1JT8 A;  1K83 H;  3CQZ H;  4DR2 L;  1Q1E A;  3OYY A;  1Q82 C;  1XMO Q;  1PH4 A;  3HOU G;  1X9N A;  3I56 A;  4A3M G;  3PV0 A;  1S3O A;  4IFD G;  3H0G H;  1NMG A;  3CC2 A;  3UE0 A;  2WB1 G;  2LXJ A;  1NE3 A;  2MO0 A;  2Y0S E;  1UE1 A;  2E8G A;  4L5S A;  4JI1 L;  1PH2 A;  4BY7 H;  2ALY B;  4ME3 A;  1GD7 A;  4XTC S;  2IX1 A;  2GVB A;  2GN5 A;  2F3I A;  1PFS A;  4JI8 Q;  3F2C A;  4BY1 H;  2UXC Q;  4R4T A;  3CF5 A;  2WP8 J;  1SLJ A;  3STB C;  4QY7 A;  2CCZ A;  2UUA Q;  4BA1 I;  2JA5 G;  2LSS A;  4A3F G;  2HIX A;  4YWM A;  4YWL A;  3ERS X;  3H15 A;  2UU9 Q;  1TWG H;  2JEB I;  2VZA A;  1VQJ A;  1V9P A;  1HR0 W;  3K81 C;  4HJA A;  2K50 A;  5C0X G;  4BY7 G;  1U0L A;  1XTD A;  5C4X H;  3S1Q H;  2JA6 G;  3UDX A;  1N36 L;  3AQQ A;  1VQL A;  4JI2 L;  2KEN A;  4BY1 G;  4DNI A;  3HOV H;  2JJQ A;  4P73 A;  2K5H A;  3S1M H;  1VQE A;  3GO5 A;  3KF6 A;  3BU2 A;  4MZ9 A;  1HNX Q;  1VQ5 A;  1N9W A;  4AYB E;  4JV5 L;  4A3B G;  2JA7 H;  3G71 A;  3U4Z A;  1MJC A;  3KDF B;  1TWA H;  3S17 H;  1NY4 A;  3CME A;  4HJ5 A;  3F1Z A;  3JAM i;  4DR7 L;  4LF5 L;  4BA2 I;  2B63 H;  4Y52 H;  5C4X G;  4AQY Q;  1SE8 A;  1JJC B;  2YTX A;  2VQF Q;  3M4Q A;  2XGT A;  4L5R C;  4GNX B;  3K8A A;  2R7Z H;  4DV3 L;  4HID A;  3PUX A;  3S14 H;  2VUM H;  5JEA J;  4A3G H;  2R6G A;  2JA7 G;  3RN2 A;  1UEB A;  3CC4 A;  3B6Y A;  1VQN A;  4LFB L;  1T9H A;  4L5T A;  4LFC L;  2ZM6 Q;  2D0O A;  4DV5 Q;  4QL5 A;  1VQC A;  1IYJ B;  1CSP A;  3M3Y H;  4P75 A;  2HHH L;  4P72 A;  1N34 L;  4A3L H;  2FXQ A;  4DR4 L;  2VUM G;  2NVQ H;  2JQO A;  1VQG A;  1QVC A;  4GN5 A;  1PYS B;  4X64 L;  1I50 H;  1LM0 A;  5ELN A;  3L0O A;  4X66 Q;  4DV4 L;  4OXP A;  5IYB G;  1NMF A;  1D8L A;  4HIK A;  5M3M G;  2VS1 A;  3I55 A;  1BVS A;  1QZH A;  3M4P A;  2K5N A;  1PH5 A;  1YJW A;  4LF5 Q;  4R4Q A;  3A74 A;  3CW2 C;  4LUZ A;  1A62 A;  2OWO A;  3HOY H;  1E3P A;  2UXD Q;  1LTL A;  3CMA A;  3BZC A;  1IBL Q;  1E22 A;  1TWH H;  3GTJ H;  1VQ7 A;  1YHQ A;  1X55 A;  4YHH L;  4JI6 L;  1XNQ L;  1A63 A;  3CCM A;  1X54 A;  1CUK A;  3T1H L;  4GKJ L;  1Z9F A;  2K5V A;  4DV1 Q;  4POG A;  4LUV A;  2QGQ A;  4JG2 A;  3KDF A;  4DUY L;  1PH7 A;  1XNR Q;  3W1B A;  3A5U A;  2KHJ A;  4OO1 G;  2Q2T A;  1QUQ A;  3HOY G;  2DGY A;  5IP9 H;  1EWI A;  1L1O C;  2KCM A;  2YV5 A;  3G6E A;  4LF6 L;  1N34 Q;  3UE1 A;  4GNX A;  3M9B A;  1JJG A;  1E1O A;  3KLW A;  4NXN L;  1VQ6 A;  3NBH B;  4XIG S;  2NVY H;  4QQB X;  3I4N H;  4JI5 L;  1VQ8 A;  3I4O A;  3F2B A;  4A3I G;  2A19 A;  1CKM A;  4R4C A;  2C35 B;  4A75 A;  4DAY B;  1Q81 C;  4JI4 Q;  4DAM A;  4C3H H;  5IP9 G;  2YTY A;  3NEL A;  4LUO A;  4FDB A;  3OTO L;  4OX9 L;  4GN4 B;  4HIO A;  4JI3 L;  4DR6 Q;  4RMF A;  4LF8 Q;  3J81 j;  3FP9 A;  3I4N G;  2BH8 A;  1UWV A;  3DLL A;  4DV6 L;  1EYG A;  2WFW A;  4K0K Q;  4LF9 L;  5JEA G;  4UY8 C;  4GKJ Q;  4B3T L;  3S2D H;  1PH1 A;  1XMQ L;  1KQS A;  4B3M L;  2PQA A;  5BR8 Q;  3EN2 A;  2KBN A;  5M5Y H;  3L7Z C;  3GTO H;  1N33 L;  1YBY A;  1XPR A;  4HJ7 A;  1FJG Q;  2AHO B;  2OQ0 A;  4QJF A;  3PF4 A;  1OXU A;  4NXM L;  1BBW A;  4LF6 Q;  3GTK H;  3HOW G;  4PZ8 A;  1IXR A;  3UDG A;  1L2F A;  2JEA I;  3J80 i;  1Q12 A;  1CKN A;  4YCV A;  4IOC A;  5HY6 A;  4DR3 L;  2NVT H;  1K0R A;  3HKZ G;  1Y1V H;  4C3I H;  3J81 i;  1J5E L;  4GN3 B;  5AJ3 L;  2JA5 H;  1WI5 A;  4DUZ Q;  3Q8D A;  4JI7 L;  4A3F H;  2OTJ A;  4LF7 Q;  1VQB A;  1MJE A;  2CFM A;  1VQF A;  3TEH B;  1J6Q A;  1PHJ A;  4PZ7 A;  1M90 C;  1VQ9 A;  2JA6 H;  4X65 Q;  1K8A C;  2ZTC A;  2ASB A;  2UUB L;  1QZG A;  2YYZ A;  3F2D A;  2OQK A;  5IWA Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...